BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10892

Length=794
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP05623.1|  unnamed protein product                                389   2e-128   Coffea canephora [robusta coffee]
gb|EYU19131.1|  hypothetical protein MIMGU_mgv1a003219mg                383   5e-126   Erythranthe guttata [common monkey flower]
ref|XP_006468282.1|  PREDICTED: cationic amino acid transporter 1...    378   5e-124   Citrus sinensis [apfelsine]
ref|XP_009612550.1|  PREDICTED: cationic amino acid transporter 1...    377   7e-124   Nicotiana tomentosiformis
gb|KDO75318.1|  hypothetical protein CISIN_1g007398mg                   377   7e-124   Citrus sinensis [apfelsine]
ref|XP_010092666.1|  Cationic amino acid transporter 1                  371   1e-123   Morus notabilis
ref|XP_010051967.1|  PREDICTED: cationic amino acid transporter 1...    376   3e-123   Eucalyptus grandis [rose gum]
ref|XP_009612551.1|  PREDICTED: cationic amino acid transporter 1...    375   3e-123   Nicotiana tomentosiformis
ref|XP_009591377.1|  PREDICTED: cationic amino acid transporter 1...    375   5e-123   Nicotiana tomentosiformis
ref|XP_006448936.1|  hypothetical protein CICLE_v10014647mg             375   7e-123   
ref|XP_004233142.1|  PREDICTED: cationic amino acid transporter 1...    373   5e-122   Solanum lycopersicum
ref|XP_009766110.1|  PREDICTED: cationic amino acid transporter 1...    372   7e-122   Nicotiana sylvestris
ref|XP_009600414.1|  PREDICTED: cationic amino acid transporter 1...    372   9e-122   Nicotiana tomentosiformis
ref|XP_009795093.1|  PREDICTED: cationic amino acid transporter 1...    371   1e-121   Nicotiana sylvestris
ref|XP_009795094.1|  PREDICTED: cationic amino acid transporter 1...    370   5e-121   Nicotiana sylvestris
ref|XP_011096669.1|  PREDICTED: cationic amino acid transporter 1...    370   7e-121   Sesamum indicum [beniseed]
ref|XP_004293998.1|  PREDICTED: cationic amino acid transporter 1...    370   8e-121   Fragaria vesca subsp. vesca
ref|XP_006352988.1|  PREDICTED: cationic amino acid transporter 1...    369   1e-120   Solanum tuberosum [potatoes]
ref|XP_010051968.1|  PREDICTED: cationic amino acid transporter 1...    369   1e-120   Eucalyptus grandis [rose gum]
ref|XP_011096668.1|  PREDICTED: cationic amino acid transporter 1...    370   2e-120   Sesamum indicum [beniseed]
ref|XP_002318265.2|  cationic amino acid transporter 1 family pro...    368   3e-120   Populus trichocarpa [western balsam poplar]
ref|XP_004253188.1|  PREDICTED: cationic amino acid transporter 1...    367   9e-120   Solanum lycopersicum
ref|NP_193844.2|  amino acid transporter 1                              366   2e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011096667.1|  PREDICTED: cationic amino acid transporter 1...    369   2e-119   Sesamum indicum [beniseed]
ref|XP_010537818.1|  PREDICTED: cationic amino acid transporter 1       366   2e-119   Tarenaya hassleriana [spider flower]
ref|XP_002869906.1|  hypothetical protein ARALYDRAFT_329490             366   2e-119   Arabidopsis lyrata subsp. lyrata
ref|XP_010092669.1|  Cationic amino acid transporter 1                  365   8e-119   Morus notabilis
ref|XP_010923669.1|  PREDICTED: cationic amino acid transporter 1...    362   5e-118   Elaeis guineensis
ref|XP_010923711.1|  PREDICTED: cationic amino acid transporter 1...    363   5e-118   Elaeis guineensis
emb|CBI30990.3|  unnamed protein product                                363   6e-118   Vitis vinifera
ref|XP_006413819.1|  hypothetical protein EUTSA_v10024732mg             361   2e-117   Eutrema salsugineum [saltwater cress]
ref|XP_011023494.1|  PREDICTED: cationic amino acid transporter 1...    361   2e-117   Populus euphratica
ref|XP_002281463.1|  PREDICTED: cationic amino acid transporter 1       360   3e-117   Vitis vinifera
ref|XP_011085217.1|  PREDICTED: cationic amino acid transporter 1...    360   3e-117   Sesamum indicum [beniseed]
ref|XP_002319043.2|  cationic amino acid transporter 1 family pro...    360   6e-117   
ref|XP_007211385.1|  hypothetical protein PRUPE_ppa003107mg             359   7e-117   
ref|XP_008225561.1|  PREDICTED: cationic amino acid transporter 1...    360   1e-116   Prunus mume [ume]
ref|XP_012075759.1|  PREDICTED: cationic amino acid transporter 1...    357   2e-116   Jatropha curcas
ref|XP_010434234.1|  PREDICTED: cationic amino acid transporter 1       358   3e-116   Camelina sativa [gold-of-pleasure]
ref|XP_010439517.1|  PREDICTED: cationic amino acid transporter 1       358   3e-116   Camelina sativa [gold-of-pleasure]
gb|KFK28695.1|  hypothetical protein AALP_AA7G034300                    357   7e-116   Arabis alpina [alpine rockcress]
ref|XP_010905430.1|  PREDICTED: cationic amino acid transporter 1...    356   1e-115   Elaeis guineensis
ref|XP_009407711.1|  PREDICTED: cationic amino acid transporter 1...    356   2e-115   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007041134.1|  Amino acid transporter 1                           356   2e-115   
ref|XP_008794464.1|  PREDICTED: cationic amino acid transporter 1...    355   2e-115   
ref|XP_012075761.1|  PREDICTED: cationic amino acid transporter 1...    353   3e-115   
ref|XP_009362249.1|  PREDICTED: cationic amino acid transporter 1...    355   3e-115   Pyrus x bretschneideri [bai li]
ref|XP_008784883.1|  PREDICTED: cationic amino acid transporter 1...    355   3e-115   
ref|XP_006342695.1|  PREDICTED: cationic amino acid transporter 1...    354   1e-114   Solanum tuberosum [potatoes]
ref|XP_010449114.1|  PREDICTED: cationic amino acid transporter 1...    353   2e-114   Camelina sativa [gold-of-pleasure]
ref|XP_002321859.2|  cationic amino acid transporter 1 family pro...    353   2e-114   
ref|XP_011041665.1|  PREDICTED: cationic amino acid transporter 1...    353   3e-114   Populus euphratica
ref|XP_009795092.1|  PREDICTED: cationic amino acid transporter 1...    352   5e-114   Nicotiana sylvestris
emb|CDX94024.1|  BnaC07g36580D                                          351   1e-113   
emb|CDY58484.1|  BnaA03g58530D                                          351   1e-113   Brassica napus [oilseed rape]
gb|EPS73602.1|  hypothetical protein M569_01155                         350   3e-113   Genlisea aurea
ref|XP_012075649.1|  PREDICTED: cationic amino acid transporter 1...    350   4e-113   Jatropha curcas
gb|KDP34957.1|  hypothetical protein JCGZ_09245                         348   7e-113   Jatropha curcas
ref|XP_009627441.1|  PREDICTED: cationic amino acid transporter 1...    348   2e-112   Nicotiana tomentosiformis
ref|XP_009137166.1|  PREDICTED: cationic amino acid transporter 1       347   3e-112   Brassica rapa
gb|KJB32880.1|  hypothetical protein B456_005G266500                    346   9e-112   Gossypium raimondii
gb|KCW73889.1|  hypothetical protein EUGRSUZ_E02481                     344   2e-111   Eucalyptus grandis [rose gum]
gb|KJB77975.1|  hypothetical protein B456_012G170500                    345   2e-111   Gossypium raimondii
ref|XP_010056965.1|  PREDICTED: LOW QUALITY PROTEIN: cationic ami...    344   4e-111   
emb|CDX76419.1|  BnaA08g09810D                                          343   1e-110   
emb|CDY65339.1|  BnaC03g64380D                                          343   1e-110   Brassica napus [oilseed rape]
ref|XP_009108509.1|  PREDICTED: cationic amino acid transporter 1...    343   2e-110   Brassica rapa
ref|XP_010241173.1|  PREDICTED: cationic amino acid transporter 1...    342   3e-110   
ref|XP_003531311.1|  PREDICTED: cationic amino acid transporter 1...    342   4e-110   Glycine max [soybeans]
ref|XP_006836312.1|  PREDICTED: cationic amino acid transporter 1       342   5e-110   Amborella trichopoda
ref|XP_002526614.1|  cationic amino acid transporter, putative          341   6e-110   Ricinus communis
ref|XP_008445160.1|  PREDICTED: cationic amino acid transporter 1...    340   9e-110   Cucumis melo [Oriental melon]
ref|XP_004141615.1|  PREDICTED: cationic amino acid transporter 1...    338   5e-109   Cucumis sativus [cucumbers]
ref|XP_002274916.1|  PREDICTED: cationic amino acid transporter 1...    338   7e-109   Vitis vinifera
ref|XP_009344397.1|  PREDICTED: cationic amino acid transporter 1...    338   1e-108   Pyrus x bretschneideri [bai li]
ref|XP_009419637.1|  PREDICTED: cationic amino acid transporter 1...    337   3e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004135553.1|  PREDICTED: cationic amino acid transporter 1...    336   7e-108   Cucumis sativus [cucumbers]
ref|XP_008372220.1|  PREDICTED: cationic amino acid transporter 1...    336   1e-107   
ref|XP_006448934.1|  hypothetical protein CICLE_v10018362mg             332   9e-107   
ref|XP_006468283.1|  PREDICTED: cationic amino acid transporter 1...    333   9e-107   Citrus sinensis [apfelsine]
ref|XP_009405465.1|  PREDICTED: cationic amino acid transporter 1...    332   1e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408749.1|  PREDICTED: cationic amino acid transporter 1...    332   2e-106   
ref|XP_004504162.1|  PREDICTED: cationic amino acid transporter 1...    331   7e-106   Cicer arietinum [garbanzo]
ref|XP_009778011.1|  PREDICTED: cationic amino acid transporter 1...    329   3e-105   Nicotiana sylvestris
ref|XP_009362250.1|  PREDICTED: cationic amino acid transporter 1...    329   7e-105   Pyrus x bretschneideri [bai li]
ref|XP_007214130.1|  hypothetical protein PRUPE_ppa018024mg             327   2e-104   Prunus persica
ref|XP_008459518.1|  PREDICTED: cationic amino acid transporter 1...    327   2e-104   Cucumis melo [Oriental melon]
ref|XP_008383406.1|  PREDICTED: cationic amino acid transporter 1...    328   2e-104   Malus domestica [apple tree]
ref|XP_010241177.1|  PREDICTED: cationic amino acid transporter 1...    325   3e-104   
ref|XP_006664195.1|  PREDICTED: cationic amino acid transporter 1...    327   3e-104   Oryza brachyantha
ref|XP_008372219.1|  PREDICTED: cationic amino acid transporter 1...    327   6e-104   Malus domestica [apple tree]
ref|XP_010241176.1|  PREDICTED: cationic amino acid transporter 1...    326   6e-104   Nelumbo nucifera [Indian lotus]
ref|XP_010941816.1|  PREDICTED: cationic amino acid transporter 1...    325   2e-103   
ref|XP_009362248.1|  PREDICTED: cationic amino acid transporter 1...    324   3e-103   Pyrus x bretschneideri [bai li]
ref|XP_008372218.1|  PREDICTED: cationic amino acid transporter 1...    323   7e-103   
ref|XP_010245195.1|  PREDICTED: cationic amino acid transporter 1...    323   8e-103   Nelumbo nucifera [Indian lotus]
gb|EPS73601.1|  cationic amino acid transporter                         322   1e-102   Genlisea aurea
ref|XP_003630015.1|  High affinity cationic amino acid transporter      323   1e-102   Medicago truncatula
ref|XP_002443551.1|  hypothetical protein SORBIDRAFT_08g021380          322   1e-102   Sorghum bicolor [broomcorn]
ref|XP_007159614.1|  hypothetical protein PHAVU_002G252100g             321   4e-102   Phaseolus vulgaris [French bean]
ref|XP_007041135.1|  Amino acid transporter 1                           321   5e-102   
ref|XP_004964213.1|  PREDICTED: cationic amino acid transporter 1...    321   6e-102   Setaria italica
ref|XP_010276879.1|  PREDICTED: cationic amino acid transporter 1...    318   2e-101   
ref|XP_006580236.1|  PREDICTED: cationic amino acid transporter 1...    319   4e-101   
ref|XP_003630016.1|  Cationic amino acid transporter                    318   9e-101   
gb|KJB15136.1|  hypothetical protein B456_002G162700                    317   2e-100   Gossypium raimondii
dbj|BAJ85357.1|  predicted protein                                      316   4e-100   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008225625.1|  PREDICTED: cationic amino acid transporter 1...    315   9e-100   Prunus mume [ume]
ref|XP_010687039.1|  PREDICTED: cationic amino acid transporter 1...    316   9e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006836311.1|  PREDICTED: cationic amino acid transporter 1       315   1e-99    Amborella trichopoda
ref|XP_004295609.2|  PREDICTED: cationic amino acid transporter 1...    315   2e-99    Fragaria vesca subsp. vesca
ref|NP_001050746.1|  Os03g0641200                                       313   5e-99    
ref|XP_003535010.1|  PREDICTED: cationic amino acid transporter 1...    313   5e-99    Glycine max [soybeans]
gb|KDP34945.1|  hypothetical protein JCGZ_09233                         311   2e-98    Jatropha curcas
gb|EMT33624.1|  High affinity cationic amino acid transporter 1         311   2e-98    
ref|XP_002464178.1|  hypothetical protein SORBIDRAFT_01g013690          311   5e-98    Sorghum bicolor [broomcorn]
gb|EPS61395.1|  hypothetical protein M569_13402                         305   9e-98    Genlisea aurea
ref|NP_001148009.1|  cationic amino acid transporter 4                  309   2e-97    
ref|XP_003532802.2|  PREDICTED: cationic amino acid transporter 1...    309   3e-97    
ref|XP_010519076.1|  PREDICTED: cationic amino acid transporter 1...    307   9e-97    Tarenaya hassleriana [spider flower]
ref|XP_006587247.1|  PREDICTED: cationic amino acid transporter 1...    306   1e-96    Glycine max [soybeans]
ref|XP_007138860.1|  hypothetical protein PHAVU_009G243600g             306   1e-96    Phaseolus vulgaris [French bean]
ref|XP_003579146.1|  PREDICTED: cationic amino acid transporter 1...    306   1e-96    
ref|XP_003533107.2|  PREDICTED: cationic amino acid transporter 1...    307   1e-96    Glycine max [soybeans]
ref|XP_004233878.1|  PREDICTED: cationic amino acid transporter 1...    307   2e-96    Solanum lycopersicum
ref|XP_007138855.1|  hypothetical protein PHAVU_009G243100g             306   2e-96    Phaseolus vulgaris [French bean]
ref|XP_006353075.1|  PREDICTED: cationic amino acid transporter 1...    306   2e-96    Solanum tuberosum [potatoes]
ref|XP_003594855.1|  High affinity cationic amino acid transporter      305   5e-96    
gb|AES65106.2|  cationic amino acid transporter                         305   8e-96    Medicago truncatula
emb|CAN73404.1|  hypothetical protein VITISV_010051                     305   1e-95    Vitis vinifera
ref|XP_008661460.1|  PREDICTED: uncharacterized protein LOC100194...    303   4e-95    
ref|XP_003533631.1|  PREDICTED: cationic amino acid transporter 5...    303   4e-95    Glycine max [soybeans]
gb|KHN26606.1|  Cationic amino acid transporter 5                       303   4e-95    Glycine soja [wild soybean]
ref|XP_006850457.1|  PREDICTED: cationic amino acid transporter 5       303   5e-95    Amborella trichopoda
ref|XP_003559648.1|  PREDICTED: cationic amino acid transporter 1...    302   8e-95    Brachypodium distachyon [annual false brome]
ref|XP_012065092.1|  PREDICTED: cationic amino acid transporter 5       300   3e-94    Jatropha curcas
ref|XP_008440316.1|  PREDICTED: cationic amino acid transporter 5       301   3e-94    Cucumis melo [Oriental melon]
ref|XP_010260734.1|  PREDICTED: cationic amino acid transporter 5...    300   5e-94    Nelumbo nucifera [Indian lotus]
ref|XP_004968601.1|  PREDICTED: cationic amino acid transporter 5...    301   5e-94    Setaria italica
ref|XP_002976452.1|  hypothetical protein SELMODRAFT_104889             300   1e-93    Selaginella moellendorffii
ref|XP_003534865.1|  PREDICTED: cationic amino acid transporter 5...    299   1e-93    Glycine max [soybeans]
ref|XP_002987271.1|  hypothetical protein SELMODRAFT_269243             299   1e-93    Selaginella moellendorffii
ref|NP_001042365.1|  Os01g0209800                                       298   4e-93    
ref|XP_004487906.1|  PREDICTED: LOW QUALITY PROTEIN: cationic ami...    297   6e-93    
gb|KEH40544.1|  cationic amino acid transporter                         296   2e-92    Medicago truncatula
ref|XP_006468574.1|  PREDICTED: cationic amino acid transporter 5...    295   8e-92    Citrus sinensis [apfelsine]
tpg|DAA52890.1|  TPA: hypothetical protein ZEAMMB73_769223              295   1e-91    
ref|XP_006448600.1|  hypothetical protein CICLE_v10014698mg             293   2e-91    Citrus clementina [clementine]
ref|XP_007040997.1|  Cationic amino acid transporter 5                  293   2e-91    
emb|CDM82248.1|  unnamed protein product                                294   2e-91    Triticum aestivum [Canadian hard winter wheat]
ref|XP_008673559.1|  PREDICTED: cationic amino acid transporter 5       295   6e-91    
gb|KCW44978.1|  hypothetical protein EUGRSUZ_L01436                     291   7e-91    Eucalyptus grandis [rose gum]
ref|NP_181041.1|  cationic amino acid transporter 5                     291   9e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009409403.1|  PREDICTED: cationic amino acid transporter 5...    291   1e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010040721.1|  PREDICTED: cationic amino acid transporter 5...    291   1e-90    Eucalyptus grandis [rose gum]
gb|KGN64456.1|  hypothetical protein Csa_1G056920                       291   1e-90    Cucumis sativus [cucumbers]
ref|XP_010051809.1|  PREDICTED: cationic amino acid transporter 5...    292   1e-90    Eucalyptus grandis [rose gum]
ref|XP_004145133.2|  PREDICTED: cationic amino acid transporter 5       291   1e-90    Cucumis sativus [cucumbers]
ref|XP_010504987.1|  PREDICTED: cationic amino acid transporter 5       290   2e-90    Camelina sativa [gold-of-pleasure]
ref|XP_002303714.2|  cationic amino acid transporter 5 family pro...    291   2e-90    Populus trichocarpa [western balsam poplar]
ref|XP_010028233.1|  PREDICTED: cationic amino acid transporter 5...    291   2e-90    Eucalyptus grandis [rose gum]
gb|KEH20726.1|  cationic amino acid transporter-like protein            290   3e-90    Medicago truncatula
emb|CDY64649.1|  BnaAnng19530D                                          290   3e-90    Brassica napus [oilseed rape]
emb|CDY43646.1|  BnaA04g20450D                                          289   5e-90    Brassica napus [oilseed rape]
ref|XP_009141413.1|  PREDICTED: cationic amino acid transporter 5       289   6e-90    Brassica rapa
ref|XP_003630017.1|  High affinity cationic amino acid transporter      290   6e-90    Medicago truncatula
ref|XP_010915551.1|  PREDICTED: cationic amino acid transporter 5...    289   8e-90    Elaeis guineensis
dbj|BAJ88234.1|  predicted protein                                      290   9e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008372126.1|  PREDICTED: cationic amino acid transporter 5...    280   1e-89    
ref|XP_002454959.1|  hypothetical protein SORBIDRAFT_03g002130          290   1e-89    Sorghum bicolor [broomcorn]
ref|XP_010915550.1|  PREDICTED: cationic amino acid transporter 5...    290   1e-89    Elaeis guineensis
ref|XP_010516664.1|  PREDICTED: cationic amino acid transporter 5...    288   1e-89    Camelina sativa [gold-of-pleasure]
ref|XP_008225925.1|  PREDICTED: cationic amino acid transporter 5...    289   1e-89    Prunus mume [ume]
emb|CAA17531.1|  amino acid transport protein AAT1                      287   1e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011022320.1|  PREDICTED: cationic amino acid transporter 5       288   2e-89    Populus euphratica
ref|XP_006363175.1|  PREDICTED: cationic amino acid transporter 5...    288   3e-89    Solanum tuberosum [potatoes]
ref|XP_010540618.1|  PREDICTED: cationic amino acid transporter 5       288   3e-89    Tarenaya hassleriana [spider flower]
ref|XP_010509683.1|  PREDICTED: cationic amino acid transporter 5...    287   3e-89    Camelina sativa [gold-of-pleasure]
ref|XP_001761522.1|  predicted protein                                  288   3e-89    
ref|XP_004498422.1|  PREDICTED: cationic amino acid transporter 1...    288   4e-89    
ref|XP_007214132.1|  hypothetical protein PRUPE_ppa018037mg             288   4e-89    
ref|XP_007138538.1|  hypothetical protein PHAVU_009G217500g             287   5e-89    Phaseolus vulgaris [French bean]
ref|XP_009617281.1|  PREDICTED: LOW QUALITY PROTEIN: cationic ami...    287   5e-89    
gb|ADB92669.1|  cationic amino acid transporter 5                       287   6e-89    Populus tremula x Populus alba [gray poplar]
ref|XP_006410652.1|  hypothetical protein EUTSA_v10016446mg             286   7e-89    Eutrema salsugineum [saltwater cress]
ref|XP_002881367.1|  hypothetical protein ARALYDRAFT_482460             286   1e-88    
ref|XP_006295596.1|  hypothetical protein CARUB_v10024707mg             286   1e-88    Capsella rubella
emb|CDP18179.1|  unnamed protein product                                286   1e-88    Coffea canephora [robusta coffee]
ref|XP_009765076.1|  PREDICTED: cationic amino acid transporter 5       286   2e-88    Nicotiana sylvestris
ref|XP_010678963.1|  PREDICTED: cationic amino acid transporter 5       285   2e-88    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004982336.1|  PREDICTED: uncharacterized protein LOC101754459    295   3e-88    
ref|XP_004232627.2|  PREDICTED: cationic amino acid transporter 5       285   3e-88    Solanum lycopersicum
ref|XP_009340268.1|  PREDICTED: cationic amino acid transporter 5...    283   1e-87    Pyrus x bretschneideri [bai li]
ref|XP_011085215.1|  PREDICTED: cationic amino acid transporter 1...    283   2e-87    Sesamum indicum [beniseed]
ref|XP_010687038.1|  PREDICTED: cationic amino acid transporter 1...    282   3e-87    Beta vulgaris subsp. vulgaris [field beet]
emb|CDP18177.1|  unnamed protein product                                282   4e-87    Coffea canephora [robusta coffee]
gb|ABA99390.1|  Amino acid permease family protein                      282   7e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008383266.1|  PREDICTED: cationic amino acid transporter 5...    281   9e-87    Malus domestica [apple tree]
ref|XP_004293806.1|  PREDICTED: cationic amino acid transporter 5       281   1e-86    Fragaria vesca subsp. vesca
gb|KFK36400.1|  hypothetical protein AALP_AA4G119400                    279   4e-86    Arabis alpina [alpine rockcress]
gb|KJB48037.1|  hypothetical protein B456_008G051200                    278   9e-86    Gossypium raimondii
ref|XP_003565484.1|  PREDICTED: cationic amino acid transporter 5       279   2e-85    Brachypodium distachyon [annual false brome]
ref|XP_002273828.1|  PREDICTED: cationic amino acid transporter 5       278   2e-85    Vitis vinifera
gb|EAY83876.1|  hypothetical protein OsI_39096                          277   3e-85    Oryza sativa Indica Group [Indian rice]
ref|XP_003576816.1|  PREDICTED: cationic amino acid transporter 5...    278   4e-85    Brachypodium distachyon [annual false brome]
gb|KJB32882.1|  hypothetical protein B456_005G266500                    276   5e-85    Gossypium raimondii
ref|XP_004504191.1|  PREDICTED: cationic amino acid transporter 1...    275   1e-84    
emb|CBI27231.3|  unnamed protein product                                278   2e-84    Vitis vinifera
ref|XP_010092716.1|  Cationic amino acid transporter 8                  272   3e-83    Morus notabilis
ref|XP_010915549.1|  PREDICTED: cationic amino acid transporter 5...    271   8e-83    Elaeis guineensis
ref|XP_008781696.1|  PREDICTED: cationic amino acid transporter 5...    270   2e-82    Phoenix dactylifera
ref|XP_010279630.1|  PREDICTED: cationic amino acid transporter 8...    269   3e-82    
ref|XP_010028234.1|  PREDICTED: cationic amino acid transporter 5...    270   3e-82    Eucalyptus grandis [rose gum]
ref|XP_011082871.1|  PREDICTED: cationic amino acid transporter 8...    270   4e-82    Sesamum indicum [beniseed]
ref|XP_004983495.1|  PREDICTED: cationic amino acid transporter 5...    269   5e-82    Setaria italica
ref|XP_010062740.1|  PREDICTED: cationic amino acid transporter 8...    268   1e-81    
ref|XP_010911512.1|  PREDICTED: LOW QUALITY PROTEIN: cationic ami...    267   3e-81    Elaeis guineensis
gb|KDO45646.1|  hypothetical protein CISIN_1g007913mg                   261   4e-81    Citrus sinensis [apfelsine]
ref|XP_004251831.1|  PREDICTED: cationic amino acid transporter 8...    267   5e-81    Solanum lycopersicum
ref|XP_006650336.1|  PREDICTED: cationic amino acid transporter 1...    264   6e-81    Oryza brachyantha
ref|XP_008382964.1|  PREDICTED: LOW QUALITY PROTEIN: cationic ami...    265   1e-80    
ref|XP_009783431.1|  PREDICTED: cationic amino acid transporter 8...    264   7e-80    Nicotiana sylvestris
ref|XP_006477927.1|  PREDICTED: cationic amino acid transporter 8...    263   1e-79    Citrus sinensis [apfelsine]
gb|KDO45645.1|  hypothetical protein CISIN_1g007913mg                   259   2e-79    Citrus sinensis [apfelsine]
gb|KDO45644.1|  hypothetical protein CISIN_1g007913mg                   261   7e-79    Citrus sinensis [apfelsine]
ref|XP_010062739.1|  PREDICTED: cationic amino acid transporter 8...    261   7e-79    Eucalyptus grandis [rose gum]
ref|XP_011045597.1|  PREDICTED: cationic amino acid transporter 8...    261   1e-78    Populus euphratica
ref|XP_009354858.1|  PREDICTED: cationic amino acid transporter 8...    259   3e-78    Pyrus x bretschneideri [bai li]
ref|XP_006307083.1|  hypothetical protein CARUB_v10008669mg             258   5e-78    
ref|XP_008356194.1|  PREDICTED: cationic amino acid transporter 8...    258   6e-78    
ref|XP_006442252.1|  hypothetical protein CICLE_v10019753mg             256   6e-78    
ref|XP_002300432.2|  cationic amino acid transporter 8 family pro...    258   7e-78    Populus trichocarpa [western balsam poplar]
ref|XP_009367760.1|  PREDICTED: cationic amino acid transporter 8...    258   7e-78    Pyrus x bretschneideri [bai li]
ref|XP_008356146.1|  PREDICTED: LOW QUALITY PROTEIN: cationic ami...    257   1e-77    
ref|XP_009409402.1|  PREDICTED: cationic amino acid transporter 5...    257   1e-77    
ref|XP_009604320.1|  PREDICTED: cationic amino acid transporter 8...    257   3e-77    Nicotiana tomentosiformis
ref|XP_008801990.1|  PREDICTED: cationic amino acid transporter 5...    254   2e-76    
gb|KJB82108.1|  hypothetical protein B456_013G176800                    254   2e-76    Gossypium raimondii
ref|XP_006349994.1|  PREDICTED: cationic amino acid transporter 8...    255   2e-76    Solanum tuberosum [potatoes]
ref|XP_010694567.1|  PREDICTED: cationic amino acid transporter 8...    254   4e-76    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007022159.1|  Cationic amino acid transporter 8                  255   6e-76    
ref|XP_001753423.1|  predicted protein                                  253   8e-76    
ref|XP_008801991.1|  PREDICTED: cationic amino acid transporter 5...    252   1e-75    
ref|XP_007214017.1|  hypothetical protein PRUPE_ppa016270mg             249   3e-75    
ref|XP_004301950.1|  PREDICTED: cationic amino acid transporter 8...    251   3e-75    Fragaria vesca subsp. vesca
ref|XP_002518795.1|  cationic amino acid transporter, putative          249   1e-74    
gb|EYU45055.1|  hypothetical protein MIMGU_mgv1a003403mg                249   2e-74    Erythranthe guttata [common monkey flower]
emb|CDP06088.1|  unnamed protein product                                250   2e-74    Coffea canephora [robusta coffee]
gb|ACJ85737.1|  unknown                                                 247   2e-74    Medicago truncatula
ref|XP_002278606.1|  PREDICTED: cationic amino acid transporter 8...    248   3e-74    Vitis vinifera
ref|XP_008226236.1|  PREDICTED: cationic amino acid transporter 8...    248   4e-74    Prunus mume [ume]
ref|XP_006416741.1|  hypothetical protein EUTSA_v10007175mg             247   7e-74    Eutrema salsugineum [saltwater cress]
ref|XP_010540127.1|  PREDICTED: cationic amino acid transporter 8...    247   1e-73    Tarenaya hassleriana [spider flower]
ref|XP_004497371.1|  PREDICTED: cationic amino acid transporter 8...    246   2e-73    Cicer arietinum [garbanzo]
ref|XP_002890204.1|  hypothetical protein ARALYDRAFT_471910             245   7e-73    
gb|EPS74420.1|  hypothetical protein M569_00333                         245   8e-73    Genlisea aurea
ref|NP_173155.1|  cationic amino acid transporter 8                     244   1e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008451786.1|  PREDICTED: cationic amino acid transporter 8...    244   2e-72    Cucumis melo [Oriental melon]
ref|XP_007211395.1|  hypothetical protein PRUPE_ppa003337mg             243   3e-72    Prunus persica
ref|XP_010476848.1|  PREDICTED: cationic amino acid transporter 8...    243   4e-72    
emb|CBI27075.3|  unnamed protein product                                248   4e-72    Vitis vinifera
ref|XP_010498053.1|  PREDICTED: cationic amino acid transporter 8...    243   4e-72    Camelina sativa [gold-of-pleasure]
ref|XP_012075640.1|  PREDICTED: cationic amino acid transporter 1...    241   6e-72    
ref|XP_010644794.1|  PREDICTED: LOW QUALITY PROTEIN: cationic ami...    243   8e-72    Vitis vinifera
ref|XP_004137314.1|  PREDICTED: cationic amino acid transporter 8...    242   1e-71    Cucumis sativus [cucumbers]
emb|CDX81804.1|  BnaC08g37970D                                          240   4e-71    
ref|XP_009117725.1|  PREDICTED: cationic amino acid transporter 8...    240   4e-71    Brassica rapa
ref|XP_010459277.1|  PREDICTED: cationic amino acid transporter 8...    240   4e-71    
emb|CDY21764.1|  BnaA09g45150D                                          240   5e-71    Brassica napus [oilseed rape]
ref|XP_003534729.1|  PREDICTED: cationic amino acid transporter 8...    238   2e-70    Glycine max [soybeans]
ref|XP_002523204.1|  cationic amino acid transporter, putative          237   3e-70    
ref|XP_012086296.1|  PREDICTED: cationic amino acid transporter 8...    234   8e-69    Jatropha curcas
gb|KDP25932.1|  hypothetical protein JCGZ_22837                         234   1e-68    Jatropha curcas
ref|XP_012086295.1|  PREDICTED: cationic amino acid transporter 8...    234   1e-68    Jatropha curcas
gb|EMT30719.1|  Putative amino acid permease yfnA                       231   1e-68    
ref|XP_004965550.1|  PREDICTED: cationic amino acid transporter 8...    233   2e-68    Setaria italica
dbj|BAJ88072.1|  predicted protein                                      232   1e-67    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007133375.1|  hypothetical protein PHAVU_011G174000g             230   3e-67    Phaseolus vulgaris [French bean]
ref|XP_002437109.1|  hypothetical protein SORBIDRAFT_10g021160          229   6e-67    Sorghum bicolor [broomcorn]
ref|XP_003560703.1|  PREDICTED: cationic amino acid transporter 8...    229   9e-67    
gb|ABF46817.1|  putative cationic amino acid transporter 5              221   1e-66    
ref|XP_008649162.1|  PREDICTED: cationic amino acid transporter 8...    228   2e-66    
gb|EAZ01252.1|  hypothetical protein OsI_23277                          227   4e-66    
ref|NP_001057802.1|  Os06g0539400                                       227   4e-66    
gb|ABF46815.1|  putative cationic amino acid transporter 5              219   4e-66    
gb|ABF46816.1|  putative cationic amino acid transporter 5              218   1e-65    
gb|KFK43902.1|  hypothetical protein AALP_AA1G188800                    223   2e-64    
gb|KEH19497.1|  cationic amino acid transporter                         221   1e-63    
gb|KDP26578.1|  hypothetical protein JCGZ_17736                         207   1e-63    
ref|XP_006645624.1|  PREDICTED: cationic amino acid transporter 5...    219   2e-63    
gb|KHN41447.1|  Cationic amino acid transporter 1                       213   2e-61    
ref|XP_006282918.1|  hypothetical protein CARUB_v10007351mg             202   3e-61    
emb|CAN78727.1|  hypothetical protein VITISV_020011                     210   7e-60    
ref|XP_006368834.1|  hypothetical protein POPTR_0001s12180g             207   3e-59    
gb|EYU43634.1|  hypothetical protein MIMGU_mgv1a025028mg                187   1e-55    
ref|XP_002310990.1|  hypothetical protein POPTR_0008s01800g             191   7e-55    
ref|XP_012065466.1|  PREDICTED: cationic amino acid transporter 7...    193   1e-54    
ref|XP_009130837.1|  PREDICTED: cationic amino acid transporter 6...    196   1e-54    
gb|KHN36421.1|  Cationic amino acid transporter 1                       196   2e-54    
ref|XP_002269556.1|  PREDICTED: cationic amino acid transporter 6...    196   2e-54    
gb|KJB78667.1|  hypothetical protein B456_013G011200                    193   2e-53    
ref|XP_006379455.1|  hypothetical protein POPTR_0008s01700g             191   2e-53    
gb|KFK24917.1|  hypothetical protein AALP_AA8G041700                    193   3e-53    
gb|KHG16483.1|  Cationic amino acid transporter 7, chloroplastic ...    192   3e-53    
ref|XP_012065465.1|  PREDICTED: cationic amino acid transporter 7...    192   4e-53    
ref|XP_011031981.1|  PREDICTED: cationic amino acid transporter 6...    192   6e-53    
ref|XP_006445757.1|  hypothetical protein CICLE_v10014713mg             186   7e-53    
gb|KEH20723.1|  cationic amino acid transporter                         179   1e-52    
gb|KHN48118.1|  Cationic amino acid transporter 1                       191   1e-52    
gb|KDO40957.1|  hypothetical protein CISIN_1g0398001mg                  186   2e-52    
emb|CBI30991.3|  unnamed protein product                                186   4e-52    
ref|XP_011032916.1|  PREDICTED: cationic amino acid transporter 6...    189   4e-52    
gb|KFK38452.1|  hypothetical protein AALP_AA3G115100                    189   4e-52    
ref|XP_006407531.1|  hypothetical protein EUTSA_v10020371mg             189   5e-52    
ref|XP_004497134.1|  PREDICTED: cationic amino acid transporter 7...    189   6e-52    
ref|XP_006398930.1|  hypothetical protein EUTSA_v10013075mg             188   9e-52    
ref|XP_006385572.1|  hypothetical protein POPTR_0003s08200g             187   2e-51    
gb|KJB25451.1|  hypothetical protein B456_004G192000                    187   3e-51    
ref|XP_006445759.1|  hypothetical protein CICLE_v10014713mg             184   4e-51    
ref|XP_001765563.1|  predicted protein                                  186   5e-51    
gb|KHG24252.1|  Cationic amino acid transporter 6, chloroplastic ...    186   5e-51    
ref|XP_011024173.1|  PREDICTED: cationic amino acid transporter 6...    186   9e-51    
ref|XP_011047557.1|  PREDICTED: cationic amino acid transporter 6...    186   1e-50    
ref|XP_006378822.1|  hypothetical protein POPTR_0010s24730g             185   2e-50    
gb|EMS53631.1|  putative amino acid permease YfnA                       179   3e-50    
ref|XP_006445758.1|  hypothetical protein CICLE_v10014713mg             184   3e-50    
ref|XP_011656572.1|  PREDICTED: cationic amino acid transporter 7...    184   5e-50    
ref|XP_008456609.1|  PREDICTED: cationic amino acid transporter 6...    184   7e-50    
ref|XP_009383017.1|  PREDICTED: cationic amino acid transporter 6...    183   8e-50    
ref|XP_010695076.1|  PREDICTED: cationic amino acid transporter 6...    183   9e-50    
gb|EYU37209.1|  hypothetical protein MIMGU_mgv1a024374mg                183   1e-49    
ref|XP_012070111.1|  PREDICTED: cationic amino acid transporter 6...    182   2e-49    
gb|KEH44284.1|  cationic amino acid transporter                         182   2e-49    
gb|AAT85281.1|  cationic amino acid transporter, putative               172   2e-49    
ref|XP_006368941.1|  hypothetical protein POPTR_0001s150801g            172   4e-49    
ref|XP_002975704.1|  hypothetical protein SELMODRAFT_103397             181   5e-49    
ref|XP_001756602.1|  predicted protein                                  181   8e-49    
ref|XP_002973649.1|  hypothetical protein SELMODRAFT_173423             181   9e-49    
ref|XP_007039671.1|  Cationic amino acid transporter, putative          180   1e-48    
ref|XP_009416875.1|  PREDICTED: cationic amino acid transporter 7...    180   1e-48    
ref|XP_010423539.1|  PREDICTED: cationic amino acid transporter 6...    180   2e-48    
ref|XP_010452377.1|  PREDICTED: cationic amino acid transporter 6...    179   3e-48    
ref|XP_007010450.1|  Cationic amino acid transporter 7                  179   4e-48    
ref|XP_004308176.1|  PREDICTED: cationic amino acid transporter 7...    179   4e-48    
ref|XP_003635611.1|  PREDICTED: cationic amino acid transporter 6...    171   5e-48    
ref|XP_010490998.1|  PREDICTED: cationic amino acid transporter 6...    178   6e-48    
gb|KJB73378.1|  hypothetical protein B456_011G229700                    176   6e-48    
ref|XP_002531231.1|  cationic amino acid transporter, putative          178   7e-48    
ref|XP_007142869.1|  hypothetical protein PHAVU_007G023700g             177   1e-47    
ref|XP_009122720.1|  PREDICTED: cationic amino acid transporter 7...    177   1e-47    
ref|XP_002871112.1|  ATCAT6/CAT6                                        176   3e-47    
ref|XP_008794928.1|  PREDICTED: cationic amino acid transporter 6...    176   3e-47    
ref|XP_006287349.1|  hypothetical protein CARUB_v10000547mg             176   3e-47    
ref|XP_002316491.1|  cationic amino acid transporter 6 family pro...    176   3e-47    
ref|NP_196097.1|  cationic amino acid transporter 6                     176   3e-47    
gb|EPS66398.1|  cationic amino acid transporter                         176   4e-47    
ref|XP_003555221.1|  PREDICTED: cationic amino acid transporter 7...    175   6e-47    
gb|KJB73377.1|  hypothetical protein B456_011G229700                    176   6e-47    
emb|CBI33021.3|  unnamed protein product                                175   7e-47    
ref|XP_010088818.1|  Cationic amino acid transporter 6                  176   1e-46    
ref|XP_010919915.1|  PREDICTED: cationic amino acid transporter 6...    174   1e-46    
ref|XP_009346156.1|  PREDICTED: cationic amino acid transporter 6...    175   1e-46    
ref|XP_006838495.1|  PREDICTED: cationic amino acid transporter 7...    174   1e-46    
ref|XP_004300325.1|  PREDICTED: cationic amino acid transporter 6...    174   2e-46    
ref|XP_011465218.1|  PREDICTED: cationic amino acid transporter 6...    174   3e-46    
ref|XP_002515785.1|  cationic amino acid transporter, putative          172   5e-46    
emb|CDY11308.1|  BnaA03g01440D                                          172   6e-46    
ref|XP_010486672.1|  PREDICTED: cationic amino acid transporter 7...    172   9e-46    
gb|KHG26942.1|  Cationic amino acid transporter 7, chloroplastic ...    172   1e-45    
ref|XP_010931101.1|  PREDICTED: cationic amino acid transporter 6...    167   1e-45    
ref|XP_010464736.1|  PREDICTED: cationic amino acid transporter 7...    171   1e-45    
ref|XP_004250472.1|  PREDICTED: cationic amino acid transporter 7...    171   2e-45    
ref|XP_003637200.1|  High affinity cationic amino acid transporter      172   2e-45    
ref|XP_006367241.1|  PREDICTED: cationic amino acid transporter 7...    171   2e-45    
emb|CDX80920.1|  BnaC03g01740D                                          170   2e-45    
emb|CBI25025.3|  unnamed protein product                                170   3e-45    
ref|XP_002882687.1|  hypothetical protein ARALYDRAFT_317861             171   3e-45    
gb|KJB39772.1|  hypothetical protein B456_007G030200                    171   3e-45    
ref|XP_010558926.1|  PREDICTED: cationic amino acid transporter 6...    170   4e-45    
gb|EYU19824.1|  hypothetical protein MIMGU_mgv1a003376mg                170   6e-45    
ref|NP_187671.1|  cationic amino acid transporter 7                     169   1e-44    
ref|XP_010269827.1|  PREDICTED: cationic amino acid transporter 6...    169   2e-44    
ref|XP_007155719.1|  hypothetical protein PHAVU_003G225700g             169   2e-44    
gb|KHG11086.1|  Cationic amino acid transporter 7, chloroplastic ...    168   2e-44    
gb|KJB51756.1|  hypothetical protein B456_008G230700                    168   2e-44    
ref|XP_004978161.1|  PREDICTED: cationic amino acid transporter 6...    167   3e-44    
ref|XP_007153297.1|  hypothetical protein PHAVU_003G023100g             157   4e-44    
ref|XP_010274503.1|  PREDICTED: cationic amino acid transporter 7...    167   4e-44    
ref|XP_010494590.1|  PREDICTED: cationic amino acid transporter 7...    167   5e-44    
ref|XP_007210584.1|  hypothetical protein PRUPE_ppa015187mg             167   5e-44    
ref|XP_006299116.1|  hypothetical protein CARUB_v10015257mg             167   7e-44    
ref|XP_009341581.1|  PREDICTED: cationic amino acid transporter 7...    166   9e-44    
ref|XP_007214662.1|  hypothetical protein PRUPE_ppa003270mg             166   1e-43    
gb|KEH31612.1|  cationic amino acid transporter                         161   1e-43    
ref|XP_006359260.1|  PREDICTED: cationic amino acid transporter 6...    166   2e-43    
ref|XP_008345866.1|  PREDICTED: cationic amino acid transporter 7...    166   2e-43    
ref|XP_010931100.1|  PREDICTED: cationic amino acid transporter 6...    166   2e-43    
ref|XP_008799668.1|  PREDICTED: cationic amino acid transporter 6...    164   6e-43    
ref|XP_008373647.1|  PREDICTED: cationic amino acid transporter 6...    164   7e-43    
ref|XP_007156591.1|  hypothetical protein PHAVU_002G001800g             164   9e-43    
ref|XP_008377513.1|  PREDICTED: cationic amino acid transporter 6...    163   1e-42    
gb|KEH31610.1|  cationic amino acid transporter                         160   1e-42    
ref|XP_008465895.1|  PREDICTED: cationic amino acid transporter 6...    159   1e-42    
ref|XP_004977353.1|  PREDICTED: cationic amino acid transporter 6...    163   1e-42    
ref|XP_008784057.1|  PREDICTED: cationic amino acid transporter 7...    162   2e-42    
ref|XP_006285137.1|  hypothetical protein CARUB_v10006478mg             160   4e-42    
ref|XP_011030189.1|  PREDICTED: cationic amino acid transporter 1...    160   4e-42    
gb|KHG28946.1|  Cationic amino acid transporter 7, chloroplastic ...    161   9e-42    
ref|XP_003525587.1|  PREDICTED: cationic amino acid transporter 6...    161   9e-42    
ref|XP_009797086.1|  PREDICTED: cationic amino acid transporter 6...    160   1e-41    
ref|XP_009629399.1|  PREDICTED: cationic amino acid transporter 6...    160   1e-41    
gb|KHN33269.1|  Cationic amino acid transporter 6, chloroplastic        160   1e-41    
ref|XP_006590230.1|  PREDICTED: cationic amino acid transporter 7...    159   2e-41    
ref|XP_004508965.1|  PREDICTED: cationic amino acid transporter 6...    160   2e-41    
emb|CBI14847.3|  unnamed protein product                                152   3e-41    
ref|XP_002449017.1|  hypothetical protein SORBIDRAFT_05g003440          159   4e-41    
ref|XP_002442832.1|  hypothetical protein SORBIDRAFT_08g003570          159   4e-41    
ref|XP_010449682.1|  PREDICTED: cationic amino acid transporter 6...    159   4e-41    
ref|XP_010436466.1|  PREDICTED: cationic amino acid transporter 1...    158   4e-41    
ref|XP_010053544.1|  PREDICTED: cationic amino acid transporter 6...    159   4e-41    
gb|KJB51755.1|  hypothetical protein B456_008G230700                    159   5e-41    
ref|XP_008679437.1|  PREDICTED: cationic amino acid transporter 6...    159   6e-41    
ref|XP_003581477.1|  PREDICTED: cationic amino acid transporter 6...    158   6e-41    
ref|XP_010912336.1|  PREDICTED: cationic amino acid transporter 6...    158   8e-41    
ref|XP_002441854.1|  hypothetical protein SORBIDRAFT_08g003530          157   2e-40    
gb|KFK26763.1|  hypothetical protein AALP_AA8G290600                    155   2e-40    
ref|XP_010233241.1|  PREDICTED: cationic amino acid transporter 8...    153   2e-40    
ref|XP_011652690.1|  PREDICTED: cationic amino acid transporter 6...    157   3e-40    
ref|XP_006836089.1|  PREDICTED: cationic amino acid transporter 7...    157   3e-40    
ref|XP_006440163.1|  hypothetical protein CICLE_v10019477mg             156   3e-40    
ref|XP_006477566.1|  PREDICTED: cationic amino acid transporter 6...    156   4e-40    
gb|EAY95030.1|  hypothetical protein OsI_16839                          156   4e-40    
gb|AAL91292.1|  At2g34960/F19I3.19                                      155   4e-40    
gb|KDO57032.1|  hypothetical protein CISIN_1g007861mg                   156   4e-40    
emb|CAE04272.2|  OSJNBb0103I08.20                                       156   4e-40    
ref|XP_011076844.1|  PREDICTED: cationic amino acid transporter 7...    156   4e-40    
ref|XP_010434728.1|  PREDICTED: cationic amino acid transporter 6...    156   4e-40    
ref|XP_008231821.1|  PREDICTED: cationic amino acid transporter 6...    156   4e-40    
gb|EMS46615.1|  putative amino acid permease YfnA                       150   4e-40    
ref|XP_003549952.1|  PREDICTED: cationic amino acid transporter 6...    155   6e-40    
ref|XP_010440066.1|  PREDICTED: cationic amino acid transporter 6...    155   6e-40    
ref|XP_006653631.1|  PREDICTED: LOW QUALITY PROTEIN: cationic ami...    155   8e-40    
ref|XP_006283404.1|  hypothetical protein CARUB_v10004452mg             155   9e-40    
ref|XP_010677143.1|  PREDICTED: cationic amino acid transporter 7...    155   1e-39    
ref|XP_003577030.2|  PREDICTED: cationic amino acid transporter 6...    154   2e-39    
gb|EEC67700.1|  hypothetical protein OsI_35169                          154   2e-39    
ref|NP_001065789.2|  Os11g0155500                                       154   3e-39    
ref|XP_009591737.1|  PREDICTED: cationic amino acid transporter 7...    153   4e-39    
gb|EEC68890.1|  hypothetical protein OsI_37534                          153   5e-39    
ref|XP_004978714.1|  PREDICTED: cationic amino acid transporter 6...    152   7e-39    
ref|XP_009799957.1|  PREDICTED: cationic amino acid transporter 7...    152   7e-39    
emb|CAN83060.1|  hypothetical protein VITISV_010305                     151   2e-38    
ref|XP_008663437.1|  PREDICTED: cationic amino acid transporter 6...    150   2e-38    
ref|XP_008345869.1|  PREDICTED: cationic amino acid transporter 7...    151   2e-38    
gb|EMT24842.1|  Putative amino acid permease yfnA                       149   3e-38    
ref|XP_008663436.1|  PREDICTED: cationic amino acid transporter 6...    150   6e-38    
ref|XP_010540809.1|  PREDICTED: cationic amino acid transporter 7...    150   8e-38    
ref|XP_008663434.1|  PREDICTED: cationic amino acid transporter 6...    150   8e-38    
ref|XP_009136823.1|  PREDICTED: cationic amino acid transporter 6...    150   8e-38    
ref|XP_002448255.1|  hypothetical protein SORBIDRAFT_06g024120          149   9e-38    
emb|CDY09649.1|  BnaC07g34120D                                          149   1e-37    
ref|XP_009407333.1|  PREDICTED: cationic amino acid transporter 7...    147   6e-37    
gb|KIY94554.1|  cationic amino acid transporter                         142   3e-36    
gb|ABA96501.1|  Amino acid permease family protein, expressed           144   4e-36    
emb|CDO99923.1|  unnamed protein product                                144   7e-36    
ref|XP_007153299.1|  hypothetical protein PHAVU_003G023300g             143   7e-36    
ref|XP_008663435.1|  PREDICTED: cationic amino acid transporter 6...    144   8e-36    
emb|CDP08331.1|  unnamed protein product                                143   1e-35    
gb|EMT15465.1|  High affinity cationic amino acid transporter 1         143   1e-35    
gb|AAX92723.1|  amino acid transporter-like protein                     143   1e-35    
ref|XP_010031295.1|  PREDICTED: cationic amino acid transporter 6...    143   2e-35    
gb|KEH31609.1|  cationic amino acid transporter                         143   2e-35    
emb|CAA63346.1|  cationic amino acid transporter                        132   2e-35    
ref|XP_005647970.1|  amino acid permease family protein                 141   6e-35    
gb|EMT10508.1|  Putative amino acid permease yfnA                       140   1e-34    
ref|XP_009136822.1|  PREDICTED: cationic amino acid transporter 6...    140   2e-34    
emb|CAN73583.1|  hypothetical protein VITISV_038273                     143   4e-34    
ref|XP_002953996.1|  hypothetical protein VOLCADRAFT_64294              138   7e-34    
ref|XP_005648323.1|  amino acid transporter                             135   7e-33    
emb|CDX90490.1|  BnaA03g42910D                                          131   1e-32    
ref|XP_010110562.1|  Cationic amino acid transporter 6                  135   1e-32    
ref|WP_032390127.1|  amino acid permease                                133   5e-32    
ref|XP_001689684.1|  cationic amino acid transporter 2                  133   7e-32    
gb|KJV01181.1|  cationic amino acid transport protein                   131   1e-31    
ref|WP_032407071.1|  amino acid permease                                131   2e-31    
ref|XP_011085216.1|  PREDICTED: cationic amino acid transporter 1...    131   2e-31    
ref|WP_032372590.1|  amino acid permease                                131   2e-31    
ref|WP_027496772.1|  MULTISPECIES: amino acid permease                  131   2e-31    
ref|WP_032400590.1|  amino acid permease                                131   2e-31    
gb|KCW77857.1|  hypothetical protein EUGRSUZ_D02134                     131   2e-31    
ref|XP_010430722.1|  PREDICTED: cationic amino acid transporter 8...    127   7e-31    
ref|XP_001690454.1|  cationic amino acid transporter                    130   9e-31    
ref|XP_006385370.1|  hypothetical protein POPTR_0003s031602g            121   2e-30    
gb|EMT25036.1|  Putative cationic amino acid transporter                128   3e-30    
ref|WP_034629510.1|  amino acid permease                                127   3e-30    
ref|XP_006664352.1|  PREDICTED: cationic amino acid transporter 6...    126   6e-30    
ref|XP_002526615.1|  cationic amino acid transporter, putative          126   7e-30    
emb|CDQ56335.1|  unnamed protein product                                128   8e-30    
emb|CDQ65636.1|  unnamed protein product                                128   8e-30    
ref|XP_004506462.1|  PREDICTED: cationic amino acid transporter 1...    120   1e-29    



>emb|CDP05623.1| unnamed protein product [Coffea canephora]
Length=598

 Score =   389 bits (999),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/242 (78%), Positives = 209/242 (86%), Gaps = 0/242 (0%)
 Frame = +2

Query  68   KNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA  247
             N G+ +GMR RGCS  K+DFLPEESFR++GNY+NAL+QTP RL DRV +RS DQ E+A 
Sbjct  7    DNSGTGTGMRRRGCSYQKNDFLPEESFRTFGNYINALKQTPNRLVDRVLTRSKDQAEMAV  66

Query  248  KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLS  427
            K+RSQ+EMK+ L WWDLIWFGMGAVIGAGIFVLTG EA + AGPAVVLS+ VSG+SAMLS
Sbjct  67   KNRSQNEMKKTLTWWDLIWFGMGAVIGAGIFVLTGLEAKEEAGPAVVLSFVVSGISAMLS  126

Query  428  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLF  607
            VFCYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNILLEYVIGGAAVARSWT Y ATL 
Sbjct  127  VFCYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNILLEYVIGGAAVARSWTSYFATLL  186

Query  608  NKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVF  787
            N HP  F I A+AL   YN L PIAVGVC  ICI+A+LSTKGSSRLNYIASIVH+VVI+F
Sbjct  187  NHHPSDFRIHAHALANNYNELDPIAVGVCICICILAVLSTKGSSRLNYIASIVHIVVILF  246

Query  788  II  793
            II
Sbjct  247  II  248



>gb|EYU19131.1| hypothetical protein MIMGU_mgv1a003219mg [Erythranthe guttata]
Length=599

 Score =   383 bits (983),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 186/245 (76%), Positives = 205/245 (84%), Gaps = 0/245 (0%)
 Frame = +2

Query  59   VETKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVE  238
            VE   GGS    R RGCSC KDDFLPEESF+SWGNYV+ALRQTPARL DRV +RS  + E
Sbjct  5    VEANGGGSTGLTRRRGCSCTKDDFLPEESFKSWGNYVSALRQTPARLADRVLTRSTVEAE  64

Query  239  LAAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSA  418
            +  K+RS +EMKR L+WWDLIW G+GAVIGAGIFVLTG EA+  AGPAVVLSY VSGLSA
Sbjct  65   MEMKTRSGNEMKRTLSWWDLIWLGLGAVIGAGIFVLTGLEAHDDAGPAVVLSYVVSGLSA  124

Query  419  MLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLA  598
            +LSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEY+IGGAAVARSWT Y A
Sbjct  125  LLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYIIGGAAVARSWTSYFA  184

Query  599  TLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVV  778
            TL N  PE F I A +L EGYN L PIAV VC  IC+IA+LSTKGSSR NY+AS+VH+ V
Sbjct  185  TLCNHKPEQFRIHATSLAEGYNQLDPIAVAVCIVICLIAVLSTKGSSRFNYVASVVHIAV  244

Query  779  IVFII  793
            I+FII
Sbjct  245  ILFII  249



>ref|XP_006468282.1| PREDICTED: cationic amino acid transporter 1-like [Citrus sinensis]
Length=605

 Score =   378 bits (970),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 185/242 (76%), Positives = 206/242 (85%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   NGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AA  247
            N G E G+R RGCSC K+DFLPEESFRSWGNYV AL+ TP RL+DRV +RSLD  E+   
Sbjct  4    NDGDE-GLRRRGCSCTKNDFLPEESFRSWGNYVQALKATPLRLKDRVLTRSLDTTEIHEI  62

Query  248  KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLS  427
            K+RS+HEMK+ L WWDLIWFG+GAVIGAGIFVLTGQEA Q AGPAVVLS+ VSGLSAMLS
Sbjct  63   KARSEHEMKKTLTWWDLIWFGIGAVIGAGIFVLTGQEARQEAGPAVVLSFVVSGLSAMLS  122

Query  428  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLF  607
            VFCYTEFAVEIPVAGGSFAYLRVELGDFVAF+AAGNILLEYVIGGAAVARSWT Y ATL 
Sbjct  123  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFVAAGNILLEYVIGGAAVARSWTSYFATLC  182

Query  608  NKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVF  787
            NK PE F I  +++ E Y  L PIAVGV   ICI+A++STKGSSR NYIASI+H+VVI+F
Sbjct  183  NKQPEDFRIIVHSMPEDYGQLDPIAVGVSAVICILAVVSTKGSSRFNYIASIIHVVVILF  242

Query  788  II  793
            II
Sbjct  243  II  244



>ref|XP_009612550.1| PREDICTED: cationic amino acid transporter 1-like isoform X1 
[Nicotiana tomentosiformis]
Length=598

 Score =   377 bits (969),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 198/231 (86%), Gaps = 0/231 (0%)
 Frame = +2

Query  68   KNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA  247
            K  G ES +R R CSC K+DFLPEESF+SWGNYV AL+QTP RL DRV +RS D+ E+ A
Sbjct  3    KKMGRESELRRRICSCTKEDFLPEESFKSWGNYVKALKQTPNRLMDRVLTRSKDEAEVEA  62

Query  248  KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLS  427
            KSRSQHEMK+ L+WWDLIWFGMGAV+GAGIFVLTG EA+Q AGPAVVLSY VSG+SA+LS
Sbjct  63   KSRSQHEMKKTLSWWDLIWFGMGAVVGAGIFVLTGLEASQDAGPAVVLSYVVSGVSALLS  122

Query  428  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLF  607
            VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT Y ATL 
Sbjct  123  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTSYFATLL  182

Query  608  NKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
            N  P+  LIK N L EGYN L P+AVGVC  IC IAILSTKGSSR+NY+AS
Sbjct  183  NYQPDKLLIKVNTLAEGYNQLDPLAVGVCIIICFIAILSTKGSSRINYVAS  233



>gb|KDO75318.1| hypothetical protein CISIN_1g007398mg [Citrus sinensis]
Length=605

 Score =   377 bits (969),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 184/242 (76%), Positives = 206/242 (85%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   NGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AA  247
            N G E G+R RGCSC K+DFLPEESFRSWGNYV AL+ TP RL+DRV +RSLD  E+   
Sbjct  4    NDGDE-GLRRRGCSCTKNDFLPEESFRSWGNYVQALKATPLRLKDRVLTRSLDTTEIHEI  62

Query  248  KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLS  427
            K+RS+HEMK+ L WWDLIWFG+GAVIGAGIFVLTGQEA Q AGPAVVLS+ VSGLSAMLS
Sbjct  63   KARSEHEMKKTLTWWDLIWFGIGAVIGAGIFVLTGQEARQEAGPAVVLSFVVSGLSAMLS  122

Query  428  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLF  607
            VFCYTEFAVEIPVAGGSFAYLRVELGDFVAF+AAGNILLEYVIGGAAVARSWT Y ATL 
Sbjct  123  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFVAAGNILLEYVIGGAAVARSWTSYFATLC  182

Query  608  NKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVF  787
            NK PE F I  +++ E Y  L PIAVGV   ICI+A++STKGSSR NYIASI+H++VI+F
Sbjct  183  NKQPEDFRIIVHSMPEDYGQLDPIAVGVSAVICILAVVSTKGSSRFNYIASIIHVIVILF  242

Query  788  II  793
            II
Sbjct  243  II  244



>ref|XP_010092666.1| Cationic amino acid transporter 1 [Morus notabilis]
 gb|EXB51963.1| Cationic amino acid transporter 1 [Morus notabilis]
Length=424

 Score =   371 bits (952),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/241 (74%), Positives = 202/241 (84%), Gaps = 1/241 (0%)
 Frame = +2

Query  74   GGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-AK  250
            G S+ G+R RGCSC KDDFLPEESFRSWGNYV AL++TP RL+DRV +RS D  EL   K
Sbjct  2    GESDEGIRRRGCSCSKDDFLPEESFRSWGNYVKALKETPFRLKDRVLTRSSDTSELVDMK  61

Query  251  SRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSV  430
            +RSQHEMK+ LNWWDLIWFGMGAVIGAGIFVLTG EA + AGPAVVLSY VSG+SAMLSV
Sbjct  62   ARSQHEMKKTLNWWDLIWFGMGAVIGAGIFVLTGLEAKEDAGPAVVLSYVVSGISAMLSV  121

Query  431  FCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFN  610
            FCYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNI+LEY+IG AAVARSWT YLATL N
Sbjct  122  FCYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNIILEYIIGNAAVARSWTSYLATLLN  181

Query  611  KHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFI  790
              P  F I A++L+  Y+ L  +AV V   +C  A+LSTKGSSRLNY+ASIVH++VI FI
Sbjct  182  HKPNDFRITASSLNPDYSHLDLLAVAVITGVCAFAVLSTKGSSRLNYVASIVHLIVIAFI  241

Query  791  I  793
            I
Sbjct  242  I  242



>ref|XP_010051967.1| PREDICTED: cationic amino acid transporter 1-like [Eucalyptus 
grandis]
 gb|KCW75803.1| hypothetical protein EUGRSUZ_D00192 [Eucalyptus grandis]
Length=610

 Score =   376 bits (966),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 180/243 (74%), Positives = 206/243 (85%), Gaps = 1/243 (0%)
 Frame = +2

Query  68   KNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-A  244
            K+   E   R R CSC KDDFLPEESFRSWGNY  AL++TPARLRDR+ +RSL+  EL  
Sbjct  5    KDARGERTARRRVCSCSKDDFLPEESFRSWGNYWGALKETPARLRDRLLTRSLETTELHE  64

Query  245  AKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAML  424
             ++RSQHEMKR L WWDLIWFG+GAVIGAGIFVLTG +  +HAGPA+VLS+ VSG+SAML
Sbjct  65   VRARSQHEMKRTLMWWDLIWFGIGAVIGAGIFVLTGLQTKEHAGPAIVLSFVVSGVSAML  124

Query  425  SVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATL  604
            SVFCYTEFAVEIPVAGGSFAYLRVELGDF+AF+AAGNI+LEY+IGGAAVARSWT Y ATL
Sbjct  125  SVFCYTEFAVEIPVAGGSFAYLRVELGDFMAFVAAGNIILEYLIGGAAVARSWTSYFATL  184

Query  605  FNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIV  784
             N  PE FLIKA+ L +GYN L PIAV +C  +C+ A+LSTKGSSRLNYIASIVH++VIV
Sbjct  185  LNHKPEDFLIKAHGLADGYNELDPIAVCICGIVCVFAVLSTKGSSRLNYIASIVHILVIV  244

Query  785  FII  793
            FII
Sbjct  245  FII  247



>ref|XP_009612551.1| PREDICTED: cationic amino acid transporter 1-like isoform X2 
[Nicotiana tomentosiformis]
 ref|XP_009612552.1| PREDICTED: cationic amino acid transporter 1-like isoform X2 
[Nicotiana tomentosiformis]
 ref|XP_009612553.1| PREDICTED: cationic amino acid transporter 1-like isoform X2 
[Nicotiana tomentosiformis]
 ref|XP_009612554.1| PREDICTED: cationic amino acid transporter 1-like isoform X2 
[Nicotiana tomentosiformis]
Length=594

 Score =   375 bits (964),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 197/228 (86%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   GSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAAKSR  256
            G ES +R R CSC K+DFLPEESF+SWGNYV AL+QTP RL DRV +RS D+ E+ AKSR
Sbjct  2    GRESELRRRICSCTKEDFLPEESFKSWGNYVKALKQTPNRLMDRVLTRSKDEAEVEAKSR  61

Query  257  SQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFC  436
            SQHEMK+ L+WWDLIWFGMGAV+GAGIFVLTG EA+Q AGPAVVLSY VSG+SA+LSVFC
Sbjct  62   SQHEMKKTLSWWDLIWFGMGAVVGAGIFVLTGLEASQDAGPAVVLSYVVSGVSALLSVFC  121

Query  437  YTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKH  616
            YTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT Y ATL N  
Sbjct  122  YTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTSYFATLLNYQ  181

Query  617  PESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
            P+  LIK N L EGYN L P+AVGVC  IC IAILSTKGSSR+NY+AS
Sbjct  182  PDKLLIKVNTLAEGYNQLDPLAVGVCIIICFIAILSTKGSSRINYVAS  229



>ref|XP_009591377.1| PREDICTED: cationic amino acid transporter 1-like [Nicotiana 
tomentosiformis]
Length=610

 Score =   375 bits (964),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 186/235 (79%), Positives = 201/235 (86%), Gaps = 3/235 (1%)
 Frame = +2

Query  56   EVETKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQV  235
            EV T++GG   G+R R C C KDDFLPEESF+SW NY NALRQTP RL +RV +RS D+ 
Sbjct  7    EVITESGG---GIRRRNCLCTKDDFLPEESFKSWSNYANALRQTPRRLIERVLTRSGDEA  63

Query  236  ELAAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLS  415
            EL +KSRSQHEMK+ LNWWDLIWFGMGAVIGAGIFVLTG EA+Q AGPAVVLSY VSG+S
Sbjct  64   ELESKSRSQHEMKKTLNWWDLIWFGMGAVIGAGIFVLTGLEASQDAGPAVVLSYAVSGVS  123

Query  416  AMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYL  595
            A+LSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT Y 
Sbjct  124  ALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTSYF  183

Query  596  ATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
            ATL N   + FLI AN L +GYN L PIAVGVCF ICIIAI STKGSSRLNY+AS
Sbjct  184  ATLLNFRADKFLITANGLAKGYNQLDPIAVGVCFIICIIAIRSTKGSSRLNYVAS  238



>ref|XP_006448936.1| hypothetical protein CICLE_v10014647mg [Citrus clementina]
 ref|XP_006448937.1| hypothetical protein CICLE_v10014647mg [Citrus clementina]
 ref|XP_006448938.1| hypothetical protein CICLE_v10014647mg [Citrus clementina]
 gb|ESR62176.1| hypothetical protein CICLE_v10014647mg [Citrus clementina]
 gb|ESR62177.1| hypothetical protein CICLE_v10014647mg [Citrus clementina]
 gb|ESR62178.1| hypothetical protein CICLE_v10014647mg [Citrus clementina]
Length=605

 Score =   375 bits (963),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 205/242 (85%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   NGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AA  247
            N G E G+R RGCSC K+DFLPEESF+SWGNYV AL+ TP R +DRV +RSLD  E+   
Sbjct  4    NDGDE-GLRRRGCSCTKNDFLPEESFQSWGNYVQALKATPLRFKDRVLTRSLDTTEIHEI  62

Query  248  KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLS  427
            K+RS+HEMK+ L WWDLIWFG+GAVIGAGIFVLTGQEA Q AGPAVVLS+ VSGLSAMLS
Sbjct  63   KARSEHEMKKTLTWWDLIWFGIGAVIGAGIFVLTGQEARQEAGPAVVLSFVVSGLSAMLS  122

Query  428  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLF  607
            VFCYTEFAVEIPVAGGSFAYLRVELGDFVAF+AAGNILLEYVIGGAAVARSWT Y ATL 
Sbjct  123  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFVAAGNILLEYVIGGAAVARSWTSYFATLC  182

Query  608  NKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVF  787
            NK PE F I  +++ E Y  L PIAVGV   ICI+A++STKGSSR NYIASI+H+VVI+F
Sbjct  183  NKQPEDFRIIVHSMPEDYGQLDPIAVGVSAVICILAVVSTKGSSRFNYIASIIHVVVILF  242

Query  788  II  793
            II
Sbjct  243  II  244



>ref|XP_004233142.1| PREDICTED: cationic amino acid transporter 1-like [Solanum lycopersicum]
Length=604

 Score =   373 bits (957),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 183/236 (78%), Positives = 197/236 (83%), Gaps = 0/236 (0%)
 Frame = +2

Query  53   MEVETKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQ  232
            M +E +   S  G+R R C C KDDFLPEESF+SWGNY NALRQTP RL +R  +RS D+
Sbjct  1    MGIEGEVPESGGGIRRRNCVCTKDDFLPEESFKSWGNYTNALRQTPTRLIERALTRSNDE  60

Query  233  VELAAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGL  412
             EL AKSRS HEMK+ L WWDLIWFGMGAVIGAGIFVLTG EA+Q AGPAVVLSY VSG+
Sbjct  61   AELEAKSRSHHEMKKTLTWWDLIWFGMGAVIGAGIFVLTGLEASQDAGPAVVLSYAVSGV  120

Query  413  SAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYY  592
            SA+LSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT Y
Sbjct  121  SALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTSY  180

Query  593  LATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
             ATL N  PE FLI A+ L +GYN L PIAV VCF ICIIAI STKGSSRLNY+AS
Sbjct  181  FATLLNFKPEKFLITAHGLAKGYNQLDPIAVAVCFIICIIAIRSTKGSSRLNYVAS  236



>ref|XP_009766110.1| PREDICTED: cationic amino acid transporter 1-like [Nicotiana 
sylvestris]
Length=606

 Score =   372 bits (956),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 183/232 (79%), Positives = 199/232 (86%), Gaps = 3/232 (1%)
 Frame = +2

Query  65   TKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA  244
            T++GG   G+R R C C KDDFLPEESF+SW NY NALR+TP RL +RV +RS D+ EL 
Sbjct  10   TESGG---GIRRRNCFCTKDDFLPEESFKSWSNYANALRETPTRLIERVLTRSGDEAELE  66

Query  245  AKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAML  424
            +KSRSQHEMK+ LNWWDLIWFGMGAVIGAGIFVLTG EA+Q AGPAVVLSY VSG+SA+L
Sbjct  67   SKSRSQHEMKKTLNWWDLIWFGMGAVIGAGIFVLTGLEASQDAGPAVVLSYAVSGVSALL  126

Query  425  SVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATL  604
            SVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT Y ATL
Sbjct  127  SVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTSYFATL  186

Query  605  FNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
             N   + FLI AN L +GYN L PIAVGVCF ICIIAI STKGSSRLNY+AS
Sbjct  187  LNFRADKFLITANGLAKGYNQLDPIAVGVCFIICIIAIRSTKGSSRLNYVAS  238



>ref|XP_009600414.1| PREDICTED: cationic amino acid transporter 1-like [Nicotiana 
tomentosiformis]
Length=609

 Score =   372 bits (956),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 182/235 (77%), Positives = 199/235 (85%), Gaps = 0/235 (0%)
 Frame = +2

Query  56   EVETKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQV  235
            +  TK+ G E G+R R CSC KDDFLPEESF+SWGNY NAL QTP RL DR+ +RS D  
Sbjct  6    DQHTKSEGGEVGIRRRVCSCTKDDFLPEESFKSWGNYANALIQTPTRLIDRILTRSEDGE  65

Query  236  ELAAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLS  415
            EL AKSRSQ+EMK+ L WWDLIWFGMGAVIGAGIFVLTG EANQ AGPAVVLSY VSG+S
Sbjct  66   ELQAKSRSQNEMKKTLTWWDLIWFGMGAVIGAGIFVLTGLEANQEAGPAVVLSYAVSGIS  125

Query  416  AMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYL  595
            AMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVI GAAVAR+WT Y 
Sbjct  126  AMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIAGAAVARTWTSYF  185

Query  596  ATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
            ATL N + + FLIK N+L +GYN L PIAVGVC  +C+IAI STKGSSRLNYIA+
Sbjct  186  ATLLNFNSDRFLIKVNSLADGYNELDPIAVGVCLIVCLIAIYSTKGSSRLNYIAT  240



>ref|XP_009795093.1| PREDICTED: cationic amino acid transporter 1-like isoform X1 
[Nicotiana sylvestris]
Length=599

 Score =   371 bits (953),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 197/231 (85%), Gaps = 0/231 (0%)
 Frame = +2

Query  68   KNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA  247
            K  G ES +R R CS  K+DFLPEESF+SW NYV AL+QTP+RL DRV +RS D+ E+  
Sbjct  3    KKMGRESELRRRICSRTKEDFLPEESFKSWENYVKALKQTPSRLMDRVLTRSKDEAEVEV  62

Query  248  KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLS  427
            KSRSQHEMK+ L+WWDLIWFGMGAVIGAGIFVLTG EA+Q AGPAVVLSY VSG+SA+LS
Sbjct  63   KSRSQHEMKKTLSWWDLIWFGMGAVIGAGIFVLTGLEASQDAGPAVVLSYVVSGVSALLS  122

Query  428  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLF  607
            VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT Y ATL 
Sbjct  123  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTSYFATLL  182

Query  608  NKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
            N  P+ FLIK N L +GYN L P+AVGVC  IC IAILSTKGSSRLNY+AS
Sbjct  183  NYQPDKFLIKVNTLADGYNQLDPLAVGVCIIICFIAILSTKGSSRLNYVAS  233



>ref|XP_009795094.1| PREDICTED: cationic amino acid transporter 1-like isoform X2 
[Nicotiana sylvestris]
Length=595

 Score =   370 bits (950),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 196/228 (86%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   GSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAAKSR  256
            G ES +R R CS  K+DFLPEESF+SW NYV AL+QTP+RL DRV +RS D+ E+  KSR
Sbjct  2    GRESELRRRICSRTKEDFLPEESFKSWENYVKALKQTPSRLMDRVLTRSKDEAEVEVKSR  61

Query  257  SQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFC  436
            SQHEMK+ L+WWDLIWFGMGAVIGAGIFVLTG EA+Q AGPAVVLSY VSG+SA+LSVFC
Sbjct  62   SQHEMKKTLSWWDLIWFGMGAVIGAGIFVLTGLEASQDAGPAVVLSYVVSGVSALLSVFC  121

Query  437  YTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKH  616
            YTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT Y ATL N  
Sbjct  122  YTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTSYFATLLNYQ  181

Query  617  PESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
            P+ FLIK N L +GYN L P+AVGVC  IC IAILSTKGSSRLNY+AS
Sbjct  182  PDKFLIKVNTLADGYNQLDPLAVGVCIIICFIAILSTKGSSRLNYVAS  229



>ref|XP_011096669.1| PREDICTED: cationic amino acid transporter 1-like isoform X3 
[Sesamum indicum]
Length=615

 Score =   370 bits (950),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 205/242 (85%), Gaps = 1/242 (0%)
 Frame = +2

Query  71   NGGSESGM-RIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA  247
            NGG  SG+ R R C+  KDDFLPEESF+SW NY +AL+QTP RL DR+F+RS  + EL  
Sbjct  8    NGGGSSGLTRRRVCTFRKDDFLPEESFKSWSNYASALKQTPYRLVDRIFTRSSVEAELEV  67

Query  248  KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLS  427
            K+RS +EMK+ L+WWDL+WFGMGAVIGAGIFVLTG EA +HAGPAVVLSY VSGLSA+LS
Sbjct  68   KARSGNEMKKTLSWWDLMWFGMGAVIGAGIFVLTGLEAREHAGPAVVLSYAVSGLSALLS  127

Query  428  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLF  607
            VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT Y ATL 
Sbjct  128  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTSYFATLC  187

Query  608  NKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVF  787
            N  P+ F I  + L +GYN L PIAVG+   ICIIA++STKGSSRLNYIAS+VHMVVI+F
Sbjct  188  NHDPDDFRILVHGLTDGYNQLDPIAVGIMIVICIIAVVSTKGSSRLNYIASVVHMVVILF  247

Query  788  II  793
            II
Sbjct  248  II  249



>ref|XP_004293998.1| PREDICTED: cationic amino acid transporter 1-like [Fragaria vesca 
subsp. vesca]
Length=612

 Score =   370 bits (950),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 179/245 (73%), Positives = 200/245 (82%), Gaps = 1/245 (0%)
 Frame = +2

Query  62   ETKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL  241
            E   GG E   + RGCSC K+DFLPEESF SWGNYVNALR TPAR +DR  +RS D  EL
Sbjct  7    EPSAGGGEGLTKRRGCSCSKEDFLPEESFESWGNYVNALRSTPARFKDRFLTRSADSTEL  66

Query  242  AA-KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSA  418
               K+RSQHEMK+ LNWWDLIWFG+GAVIGAGIFVLTG EA  HAGPAVV+SY VSG+SA
Sbjct  67   VEMKARSQHEMKKTLNWWDLIWFGIGAVIGAGIFVLTGIEAKNHAGPAVVMSYVVSGVSA  126

Query  419  MLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLA  598
            +LSVFCYTEFAVEIPVAGGSFAYLRVELGDFVA+IAAGNILLEYVIGGAAVARSWT Y  
Sbjct  127  LLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAYIAAGNILLEYVIGGAAVARSWTSYFT  186

Query  599  TLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVV  778
            TL N++   F I  +   E Y  L PIA+GV   ICI+A++STKGSSRLNYIASIVH++V
Sbjct  187  TLCNRNSNDFRITVDGWSENYKYLDPIAIGVIICICILAVMSTKGSSRLNYIASIVHVIV  246

Query  779  IVFII  793
            I+FII
Sbjct  247  ILFII  251



>ref|XP_006352988.1| PREDICTED: cationic amino acid transporter 1-like [Solanum tuberosum]
Length=607

 Score =   369 bits (948),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 181/236 (77%), Positives = 197/236 (83%), Gaps = 0/236 (0%)
 Frame = +2

Query  53   MEVETKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQ  232
            M +E++   S  G+R R C C KDDFLPEESF+SWGNY NALRQTP RL +R  +RS D+
Sbjct  1    MGIESEVPESGGGIRRRNCVCTKDDFLPEESFKSWGNYANALRQTPTRLIERALTRSSDE  60

Query  233  VELAAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGL  412
             EL AKSRS HEMK+ L WWDLIWFGMGAVIGAGIFVLTG EA+Q AGPAVVLSY VSG+
Sbjct  61   AELEAKSRSHHEMKKTLTWWDLIWFGMGAVIGAGIFVLTGLEASQDAGPAVVLSYAVSGV  120

Query  413  SAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYY  592
            SA+LSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT Y
Sbjct  121  SALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTSY  180

Query  593  LATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
             ATL N   + FLI A+ L +GYN L PIAV VCF ICIIAI STKGSSRLNY+AS
Sbjct  181  FATLLNFKSDKFLITAHGLAKGYNQLDPIAVAVCFIICIIAIRSTKGSSRLNYVAS  236



>ref|XP_010051968.1| PREDICTED: cationic amino acid transporter 1-like [Eucalyptus 
grandis]
 ref|XP_010051969.1| PREDICTED: cationic amino acid transporter 1-like [Eucalyptus 
grandis]
 gb|KCW75804.1| hypothetical protein EUGRSUZ_D00193 [Eucalyptus grandis]
Length=607

 Score =   369 bits (947),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 201/242 (83%), Gaps = 1/242 (0%)
 Frame = +2

Query  71   NGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AA  247
            + G  +  R R CSC K DFLPEESFRSWGNY  AL++TPARLRDRV SRSL+  EL   
Sbjct  3    DAGGGTMRRRRACSCSKGDFLPEESFRSWGNYWGALKETPARLRDRVLSRSLETTELHEV  62

Query  248  KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLS  427
            K++S HEMKR L WWDL+WFG+GAVIGAGIFVLTGQE  + AGPAVVLSY VSG+SAMLS
Sbjct  63   KAQSGHEMKRTLTWWDLMWFGIGAVIGAGIFVLTGQETREGAGPAVVLSYVVSGVSAMLS  122

Query  428  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLF  607
            VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT Y ATL 
Sbjct  123  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTSYFATLL  182

Query  608  NKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVF  787
            N  P  F+I  ++L + YN L PIAVGVC  IC  A+LSTKGSSRLNYIASIVH++VI+F
Sbjct  183  NHDPSDFVITVHSLAKNYNELDPIAVGVCCIICAFAVLSTKGSSRLNYIASIVHILVIIF  242

Query  788  II  793
            II
Sbjct  243  II  244



>ref|XP_011096668.1| PREDICTED: cationic amino acid transporter 1-like isoform X2 
[Sesamum indicum]
Length=638

 Score =   370 bits (949),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 205/242 (85%), Gaps = 1/242 (0%)
 Frame = +2

Query  71   NGGSESGM-RIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA  247
            NGG  SG+ R R C+  KDDFLPEESF+SW NY +AL+QTP RL DR+F+RS  + EL  
Sbjct  31   NGGGSSGLTRRRVCTFRKDDFLPEESFKSWSNYASALKQTPYRLVDRIFTRSSVEAELEV  90

Query  248  KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLS  427
            K+RS +EMK+ L+WWDL+WFGMGAVIGAGIFVLTG EA +HAGPAVVLSY VSGLSA+LS
Sbjct  91   KARSGNEMKKTLSWWDLMWFGMGAVIGAGIFVLTGLEAREHAGPAVVLSYAVSGLSALLS  150

Query  428  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLF  607
            VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT Y ATL 
Sbjct  151  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTSYFATLC  210

Query  608  NKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVF  787
            N  P+ F I  + L +GYN L PIAVG+   ICIIA++STKGSSRLNYIAS+VHMVVI+F
Sbjct  211  NHDPDDFRILVHGLTDGYNQLDPIAVGIMIVICIIAVVSTKGSSRLNYIASVVHMVVILF  270

Query  788  II  793
            II
Sbjct  271  II  272



>ref|XP_002318265.2| cationic amino acid transporter 1 family protein [Populus trichocarpa]
 gb|EEE96485.2| cationic amino acid transporter 1 family protein [Populus trichocarpa]
Length=606

 Score =   368 bits (945),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 180/246 (73%), Positives = 207/246 (84%), Gaps = 4/246 (2%)
 Frame = +2

Query  68   KNGGSESGMRIR---GCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVE  238
            + GG + GMR R   GCSC K+DFLPEESF+S GNY+ AL++TP R +DR+ +RSLD  E
Sbjct  11   QEGGDQEGMRRRRGCGCSCTKNDFLPEESFQSIGNYLQALKETPMRFKDRLLTRSLDSTE  70

Query  239  L-AAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLS  415
            L   KSRS HEMK+NL WWDLIWFG+GAVIGAGIFVLTG EA +HAGPAVVLSY VSG+S
Sbjct  71   LHEIKSRSDHEMKKNLTWWDLIWFGIGAVIGAGIFVLTGLEAKEHAGPAVVLSYVVSGVS  130

Query  416  AMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYL  595
            AMLSVFCYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNI+LEYVIGGAAVARSWT Y 
Sbjct  131  AMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNIILEYVIGGAAVARSWTSYF  190

Query  596  ATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMV  775
            ATL N  P+ F I A++L E Y  L PI+V VC AIC++A+LSTKGSSR NY+ASI+H+V
Sbjct  191  ATLCNHKPDDFRIIAHSLPEDYGHLDPISVFVCAAICVLAVLSTKGSSRFNYVASIIHVV  250

Query  776  VIVFII  793
            VI+FII
Sbjct  251  VILFII  256



>ref|XP_004253188.1| PREDICTED: cationic amino acid transporter 1-like [Solanum lycopersicum]
Length=599

 Score =   367 bits (942),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 190/247 (77%), Positives = 208/247 (84%), Gaps = 0/247 (0%)
 Frame = +2

Query  53   MEVETKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQ  232
            M VE  +  + SG+R R CSC KDDFLPEESF+SW NY NAL QTP RL DR+ +RS D+
Sbjct  1    MGVEGVDQQTNSGVRRRVCSCTKDDFLPEESFKSWRNYANALIQTPTRLIDRILTRSEDE  60

Query  233  VELAAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGL  412
             EL AKSRSQ+EMK+ L WWDLIWFG+GAVIGAGIFVLTG EANQ AGPAVVLSY VSG+
Sbjct  61   EELEAKSRSQNEMKKTLTWWDLIWFGLGAVIGAGIFVLTGLEANQEAGPAVVLSYVVSGV  120

Query  413  SAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYY  592
            SA+LSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVI GAAVAR+WT Y
Sbjct  121  SALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIAGAAVARTWTSY  180

Query  593  LATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHM  772
             ATL N   + FLIK ++L EGYN L PIAVGVC  ICIIAILSTKGSSRLNYIA+IVH+
Sbjct  181  FATLLNFSSDKFLIKVDSLAEGYNELDPIAVGVCIIICIIAILSTKGSSRLNYIATIVHI  240

Query  773  VVIVFII  793
             VI FII
Sbjct  241  FVIFFII  247



>ref|NP_193844.2| amino acid transporter 1 [Arabidopsis thaliana]
 sp|Q84MA5.1|CAAT1_ARATH RecName: Full=Cationic amino acid transporter 1; AltName: Full=Amino 
acid transporter 1 [Arabidopsis thaliana]
 gb|AAP21253.1| At4g21120 [Arabidopsis thaliana]
 dbj|BAE99519.1| amino acid transport protein AAT1 [Arabidopsis thaliana]
 gb|AEE84405.1| amino acid transporter 1 [Arabidopsis thaliana]
Length=594

 Score =   366 bits (940),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/242 (71%), Positives = 203/242 (84%), Gaps = 1/242 (0%)
 Frame = +2

Query  71   NGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AA  247
            +GG + G+R RGCSC KDDFLPEESF+S GNY+ AL++TP+R  DR+ +RSLD  E+   
Sbjct  3    SGGGDDGLRRRGCSCTKDDFLPEESFQSMGNYLKALKETPSRFMDRIMTRSLDSDEINEM  62

Query  248  KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLS  427
            K+RS HEMK+ L WWDL+WFG+GAVIG+GIFVLTG EA  H+GPAVVLSY VSG+SAMLS
Sbjct  63   KARSGHEMKKTLTWWDLMWFGIGAVIGSGIFVLTGLEARNHSGPAVVLSYVVSGVSAMLS  122

Query  428  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLF  607
            VFCYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNI+LEYV+GGAAVARSWT Y ATL 
Sbjct  123  VFCYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNIILEYVVGGAAVARSWTSYFATLL  182

Query  608  NKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVF  787
            N  PE F I  + L E Y+ L PIAVGVC  IC++A++ TKGSSR NYIASI+HMVVI+F
Sbjct  183  NHKPEDFRIIVHKLGEDYSHLDPIAVGVCAIICVLAVVGTKGSSRFNYIASIIHMVVILF  242

Query  788  II  793
            +I
Sbjct  243  VI  244



>ref|XP_011096667.1| PREDICTED: cationic amino acid transporter 1-like isoform X1 
[Sesamum indicum]
Length=710

 Score =   369 bits (948),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 205/242 (85%), Gaps = 1/242 (0%)
 Frame = +2

Query  71   NGGSESGM-RIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA  247
            NGG  SG+ R R C+  KDDFLPEESF+SW NY +AL+QTP RL DR+F+RS  + EL  
Sbjct  103  NGGGSSGLTRRRVCTFRKDDFLPEESFKSWSNYASALKQTPYRLVDRIFTRSSVEAELEV  162

Query  248  KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLS  427
            K+RS +EMK+ L+WWDL+WFGMGAVIGAGIFVLTG EA +HAGPAVVLSY VSGLSA+LS
Sbjct  163  KARSGNEMKKTLSWWDLMWFGMGAVIGAGIFVLTGLEAREHAGPAVVLSYAVSGLSALLS  222

Query  428  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLF  607
            VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT Y ATL 
Sbjct  223  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTSYFATLC  282

Query  608  NKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVF  787
            N  P+ F I  + L +GYN L PIAVG+   ICIIA++STKGSSRLNYIAS+VHMVVI+F
Sbjct  283  NHDPDDFRILVHGLTDGYNQLDPIAVGIMIVICIIAVVSTKGSSRLNYIASVVHMVVILF  342

Query  788  II  793
            II
Sbjct  343  II  344



>ref|XP_010537818.1| PREDICTED: cationic amino acid transporter 1 [Tarenaya hassleriana]
Length=596

 Score =   366 bits (939),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 177/242 (73%), Positives = 201/242 (83%), Gaps = 1/242 (0%)
 Frame = +2

Query  71   NGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AA  247
            +GG +  +R RGCSC KDDFLPEESF+S GNYV AL++ PARL+DRV +RS+D  E+   
Sbjct  4    SGGEDGVVRRRGCSCTKDDFLPEESFQSMGNYVKALKEIPARLKDRVMTRSVDAAEIHEI  63

Query  248  KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLS  427
            ++RS HEMKRNL WWDL+WFG+GAVIGAGIFVLTG EA  HAGPAVVLSY VSG+SAMLS
Sbjct  64   RARSGHEMKRNLTWWDLMWFGIGAVIGAGIFVLTGLEARDHAGPAVVLSYVVSGVSAMLS  123

Query  428  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLF  607
            VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNI+LEYV+GGAAVARSWT Y ATL 
Sbjct  124  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNIILEYVVGGAAVARSWTSYFATLC  183

Query  608  NKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVF  787
            N  P+ F + A  L E Y  L PIAV VC  ICI A+ STKGSSRLNY+ASI+H+ VIVF
Sbjct  184  NHKPDDFRLIARCLGEDYGHLDPIAVAVCAVICIFAVFSTKGSSRLNYVASIIHIAVIVF  243

Query  788  II  793
            I+
Sbjct  244  IV  245



>ref|XP_002869906.1| hypothetical protein ARALYDRAFT_329490 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46165.1| hypothetical protein ARALYDRAFT_329490 [Arabidopsis lyrata subsp. 
lyrata]
Length=599

 Score =   366 bits (939),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/243 (72%), Positives = 205/243 (84%), Gaps = 1/243 (0%)
 Frame = +2

Query  68   KNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-A  244
            ++GG + G+R RGCSC KDDFLPEESF+S GNY+ AL++TP+R  DR+ +RSLD  E+  
Sbjct  4    EHGGGDDGLRRRGCSCTKDDFLPEESFQSMGNYLKALKETPSRFMDRIMTRSLDSDEINE  63

Query  245  AKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAML  424
             K+RS HEMK+ L WWDL+WFG+GAVIG+GIFVLTG EA   +GPAVVLSY VSG+SAML
Sbjct  64   MKARSGHEMKKTLTWWDLMWFGIGAVIGSGIFVLTGLEARNASGPAVVLSYVVSGVSAML  123

Query  425  SVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATL  604
            SVFCYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNI+LEYV+GGAAVARSWT Y ATL
Sbjct  124  SVFCYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNIILEYVVGGAAVARSWTSYFATL  183

Query  605  FNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIV  784
             N  PE F I A++L E Y+ L PIAVGVC  IC++A+L TKGSSR NYIASI+HMVVI+
Sbjct  184  LNHKPEDFRIIAHSLGEDYSHLDPIAVGVCAIICVLAVLGTKGSSRFNYIASIIHMVVIL  243

Query  785  FII  793
            F+I
Sbjct  244  FVI  246



>ref|XP_010092669.1| Cationic amino acid transporter 1 [Morus notabilis]
 gb|EXB51966.1| Cationic amino acid transporter 1 [Morus notabilis]
Length=610

 Score =   365 bits (936),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 180/242 (74%), Positives = 199/242 (82%), Gaps = 1/242 (0%)
 Frame = +2

Query  71   NGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-A  247
             G    G+R RGCSC KDDFLPEESF+SWGNYV AL++T +R  DRV +RS+D  EL   
Sbjct  2    EGDQAVGVRKRGCSCTKDDFLPEESFKSWGNYVKALKETSSRFVDRVTTRSMDSTELVDM  61

Query  248  KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLS  427
            K+RSQHEMK+ LNWWDLIWFGMGAV+GAGIFVLTG EA Q AGPAVVLSY VSG+SAMLS
Sbjct  62   KARSQHEMKKTLNWWDLIWFGMGAVVGAGIFVLTGLEAKQDAGPAVVLSYVVSGISAMLS  121

Query  428  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLF  607
            VFCYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNILLEYVIGGAAVAR+WT Y ATL 
Sbjct  122  VFCYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNILLEYVIGGAAVARAWTSYFATLC  181

Query  608  NKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVF  787
            N+    F I A+ L   Y+ L  IAV V   IC+IAILSTKGSSRLNYIASIVH +VI+F
Sbjct  182  NRDANDFRIHAHGLSPDYSHLDLIAVAVLIVICLIAILSTKGSSRLNYIASIVHFIVILF  241

Query  788  II  793
            II
Sbjct  242  II  243



>ref|XP_010923669.1| PREDICTED: cationic amino acid transporter 1-like [Elaeis guineensis]
Length=601

 Score =   362 bits (930),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 175/232 (75%), Positives = 195/232 (84%), Gaps = 1/232 (0%)
 Frame = +2

Query  101  RGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKR  277
            RGCSC K+DF PEESF+SW NY  A R+T  RLRDRV +RSLDQ EL   ++RS HEMKR
Sbjct  16   RGCSCAKEDFFPEESFKSWANYRQAFRETGMRLRDRVTARSLDQTELHEVRARSGHEMKR  75

Query  278  NLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVE  457
            NL WWDLIWFG+GAVIGAGIFVLTGQE ++  GPAVVLSY VSG+SAMLSVFCYTEFAVE
Sbjct  76   NLTWWDLIWFGIGAVIGAGIFVLTGQETHEDVGPAVVLSYVVSGISAMLSVFCYTEFAVE  135

Query  458  IPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIK  637
            IPVAGGSFAYLRVELGDF+AFIAAGNILLEYVIGGAAVARSWT Y ATL N +P+ F I 
Sbjct  136  IPVAGGSFAYLRVELGDFMAFIAAGNILLEYVIGGAAVARSWTSYFATLLNHNPDDFRIH  195

Query  638  ANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             +AL   YNLL PIAV V   +CIIA+LSTKG+SR NYIASI+H+ VI+FII
Sbjct  196  VSALANDYNLLDPIAVAVITIVCIIAVLSTKGTSRFNYIASIIHVAVILFII  247



>ref|XP_010923711.1| PREDICTED: cationic amino acid transporter 1-like [Elaeis guineensis]
Length=613

 Score =   363 bits (931),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 175/236 (74%), Positives = 197/236 (83%), Gaps = 1/236 (0%)
 Frame = +2

Query  89   GMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQH  265
             ++ RGCSC K+DF PEESF+SW NY  A R+T  RLRDRV +RSLDQ EL   ++RS H
Sbjct  14   AVKRRGCSCTKEDFFPEESFKSWANYRQAFRETGMRLRDRVTARSLDQTELHEVRARSGH  73

Query  266  EMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTE  445
            EMKRNL+WWDLIWFG+GAVIGAGIFVLTGQE N+  GPAVVLSY VSG+SAMLSVFCYTE
Sbjct  74   EMKRNLSWWDLIWFGIGAVIGAGIFVLTGQETNEDVGPAVVLSYVVSGISAMLSVFCYTE  133

Query  446  FAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPES  625
            FAVEIPVAGGSFAYLRVELGDF+AFIAAGNILLEYVIGGAAVARSWT Y ATL N  P  
Sbjct  134  FAVEIPVAGGSFAYLRVELGDFMAFIAAGNILLEYVIGGAAVARSWTSYFATLLNHDPND  193

Query  626  FLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            F I  ++L + YNLL PIAV V   +CI+AILSTKG+SR NYIASI+H+ VI+FII
Sbjct  194  FRIHVSSLAKDYNLLDPIAVAVITIVCIVAILSTKGTSRFNYIASIIHVAVILFII  249



>emb|CBI30990.3| unnamed protein product [Vitis vinifera]
Length=617

 Score =   363 bits (931),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 183/258 (71%), Positives = 207/258 (80%), Gaps = 7/258 (3%)
 Frame = +2

Query  26   SPSRSI-EIKMEVETKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLR  202
            SPS  I + KM VE        G+R RGCSC KDDFLPEESF++WGNY  AL + PARL+
Sbjct  15   SPSSEIYQNKMGVE-----PSEGVRRRGCSCSKDDFLPEESFKTWGNYGRALAEIPARLK  69

Query  203  DRVFSRSLDQVEL-AAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGP  379
            DR+ +RSLD  E+   K+RS HEMK+ L WWDL+WFG+GAVIGAGIFVLTG +A   AGP
Sbjct  70   DRLLTRSLDTTEMNEIKARSAHEMKKTLTWWDLMWFGIGAVIGAGIFVLTGIQARDVAGP  129

Query  380  AVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIG  559
            AVVLSY VSG+SAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNILLEYVIG
Sbjct  130  AVVLSYVVSGISAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNILLEYVIG  189

Query  560  GAAVARSWTYYLATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSS  739
            GAAVARSWT Y ATL N  PE F I A++L E YN L PIAVGV   IC++A+ STKGSS
Sbjct  190  GAAVARSWTSYFATLCNHKPEDFRIIAHSLKEDYNQLDPIAVGVITIICLLAVFSTKGSS  249

Query  740  RLNYIASIVHMVVIVFII  793
            R NYIASI H++VI+FII
Sbjct  250  RFNYIASIFHVIVILFII  267



>ref|XP_006413819.1| hypothetical protein EUTSA_v10024732mg [Eutrema salsugineum]
 gb|ESQ55272.1| hypothetical protein EUTSA_v10024732mg [Eutrema salsugineum]
Length=597

 Score =   361 bits (926),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/238 (71%), Positives = 203/238 (85%), Gaps = 1/238 (0%)
 Frame = +2

Query  83   ESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRS  259
            + G+R RGCSC KDDFLPEESF+S G+Y+ AL++TP+R  DRV +RSLD VE+   K+RS
Sbjct  7    DDGLRRRGCSCTKDDFLPEESFKSMGSYLKALKETPSRFMDRVTTRSLDSVEIHEMKARS  66

Query  260  QHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCY  439
             +EMK+ L WWDL+WFG+GAVIG+GIFVLTG EA +H+GPAVVLSY +SG+SAMLSVFCY
Sbjct  67   GNEMKKTLTWWDLMWFGVGAVIGSGIFVLTGLEAREHSGPAVVLSYVISGVSAMLSVFCY  126

Query  440  TEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHP  619
            TEFAVEIPVAGGSFAY+RVELGDF+AFIAAGNI+LEY++GGAAVARSWT Y ATL N  P
Sbjct  127  TEFAVEIPVAGGSFAYMRVELGDFMAFIAAGNIILEYIVGGAAVARSWTSYFATLLNHKP  186

Query  620  ESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            + F I A++L E Y+ L PIAVGVC AICII +L TKGSS  NYIASIVHMVVI+F++
Sbjct  187  DDFRIIAHSLSEDYSHLDPIAVGVCVAICIITVLGTKGSSIFNYIASIVHMVVILFVV  244



>ref|XP_011023494.1| PREDICTED: cationic amino acid transporter 1-like [Populus euphratica]
Length=604

 Score =   361 bits (926),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 200/242 (83%), Gaps = 1/242 (0%)
 Frame = +2

Query  71   NGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AA  247
             G    G++ RGCSC KDDFLPE+SFRSW NYV+A+RQTP R RDR+ +RSLD  EL   
Sbjct  5    QGDRGEGIKKRGCSCTKDDFLPEQSFRSWTNYVHAIRQTPVRFRDRLLTRSLDSTELNEI  64

Query  248  KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLS  427
            KSRS+H+MK+NL WWDL+WFG+GAV+GAGIFVLTG EA  + GPAVVLSY VSG+SAMLS
Sbjct  65   KSRSEHDMKKNLTWWDLMWFGVGAVVGAGIFVLTGLEARDNTGPAVVLSYVVSGVSAMLS  124

Query  428  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLF  607
            VFCYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNILLEYVIGGAAVARSWT Y ATL 
Sbjct  125  VFCYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNILLEYVIGGAAVARSWTSYFATLC  184

Query  608  NKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVF  787
            N  P+ F I A++L + Y  L PIAV V   IC++A+LSTKGSSR NYI SI+H+ VIVF
Sbjct  185  NYQPDDFRIIAHSLPDDYGHLDPIAVVVSSLICVLAVLSTKGSSRFNYITSIMHVAVIVF  244

Query  788  II  793
            II
Sbjct  245  II  246



>ref|XP_002281463.1| PREDICTED: cationic amino acid transporter 1 [Vitis vinifera]
 ref|XP_003633038.1| PREDICTED: cationic amino acid transporter 1 [Vitis vinifera]
Length=606

 Score =   360 bits (925),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 175/236 (74%), Positives = 198/236 (84%), Gaps = 1/236 (0%)
 Frame = +2

Query  89   GMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQH  265
            G+R RGCSC KDDFLPEESF++WGNY  AL + PARL+DR+ +RSLD  E+   K+RS H
Sbjct  8    GVRRRGCSCSKDDFLPEESFKTWGNYGRALAEIPARLKDRLLTRSLDTTEMNEIKARSAH  67

Query  266  EMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTE  445
            EMK+ L WWDL+WFG+GAVIGAGIFVLTG +A   AGPAVVLSY VSG+SAMLSVFCYTE
Sbjct  68   EMKKTLTWWDLMWFGIGAVIGAGIFVLTGIQARDVAGPAVVLSYVVSGISAMLSVFCYTE  127

Query  446  FAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPES  625
            FAVEIPVAGGSFAYLRVELGDF+AFIAAGNILLEYVIGGAAVARSWT Y ATL N  PE 
Sbjct  128  FAVEIPVAGGSFAYLRVELGDFMAFIAAGNILLEYVIGGAAVARSWTSYFATLCNHKPED  187

Query  626  FLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            F I A++L E YN L PIAVGV   IC++A+ STKGSSR NYIASI H++VI+FII
Sbjct  188  FRIIAHSLKEDYNQLDPIAVGVITIICLLAVFSTKGSSRFNYIASIFHVIVILFII  243



>ref|XP_011085217.1| PREDICTED: cationic amino acid transporter 1-like isoform X3 
[Sesamum indicum]
Length=612

 Score =   360 bits (925),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 170/223 (76%), Positives = 193/223 (87%), Gaps = 0/223 (0%)
 Frame = +2

Query  95   RIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAAKSRSQHEMK  274
            R RGC+C KDDFLPEESFRSW NYVNAL++TPARL DRV +RS +Q EL  K+RS+H+MK
Sbjct  16   RRRGCTCTKDDFLPEESFRSWSNYVNALKETPARLVDRVLTRSNEQGELEVKARSEHDMK  75

Query  275  RNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAV  454
            + LNWWDL+WFGMGAVIGAGIFVLTG EA   AGPAVVLSY VSG SA+LSVFCYTEFAV
Sbjct  76   KTLNWWDLMWFGMGAVIGAGIFVLTGLEARDEAGPAVVLSYVVSGTSALLSVFCYTEFAV  135

Query  455  EIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLI  634
            EIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT Y ATL N  P+ F I
Sbjct  136  EIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTSYFATLCNHKPDDFRI  195

Query  635  KANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASI  763
            +A+ L +GYN L PI++G+   +CI+A++STKGSSRLNYIAS+
Sbjct  196  QAHNLPDGYNQLDPISIGIIICVCILAVMSTKGSSRLNYIASV  238



>ref|XP_002319043.2| cationic amino acid transporter 1 family protein [Populus trichocarpa]
 gb|EEE94966.2| cationic amino acid transporter 1 family protein [Populus trichocarpa]
Length=604

 Score =   360 bits (923),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 174/236 (74%), Positives = 199/236 (84%), Gaps = 1/236 (0%)
 Frame = +2

Query  89   GMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQH  265
            G++ RGCSC KDDFLPEESFRSW NYV+A+RQTP R  DR+ +RSLD  EL   KSRS+H
Sbjct  11   GIKKRGCSCTKDDFLPEESFRSWTNYVHAIRQTPVRFSDRLLTRSLDSTELNEIKSRSEH  70

Query  266  EMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTE  445
            +MK+NL WWDL+WFG+GAV+GAGIFVLTG EA ++ GPAVVLSY VSG+SAMLSVFCYTE
Sbjct  71   DMKKNLTWWDLMWFGVGAVVGAGIFVLTGLEARENTGPAVVLSYVVSGVSAMLSVFCYTE  130

Query  446  FAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPES  625
            FAVEIPVAGGSFAYLRVELGDF+AFIAAGNILLEYVIGGAAVARSWT Y ATL N  P+ 
Sbjct  131  FAVEIPVAGGSFAYLRVELGDFMAFIAAGNILLEYVIGGAAVARSWTSYFATLCNHQPDD  190

Query  626  FLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            F I A++L + Y  L PIAV V   IC++A+LSTKGSSR NYI SI+H+ VIVFII
Sbjct  191  FRIIAHSLPDDYGHLDPIAVVVSSLICVLAVLSTKGSSRFNYITSIMHVAVIVFII  246



>ref|XP_007211385.1| hypothetical protein PRUPE_ppa003107mg [Prunus persica]
 gb|EMJ12584.1| hypothetical protein PRUPE_ppa003107mg [Prunus persica]
Length=603

 Score =   359 bits (922),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 177/242 (73%), Positives = 199/242 (82%), Gaps = 1/242 (0%)
 Frame = +2

Query  71   NGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-  247
            +GG + G+R RGC+  K DFLPEESF++WGNYV AL QTP R +DRV +RSLD  EL   
Sbjct  9    SGGGDEGLRRRGCTYRKYDFLPEESFQTWGNYVKALSQTPGRFKDRVLTRSLDSTELVEM  68

Query  248  KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLS  427
            K++S +EMK+ LNWWDLIWFG+GAVIGAGIFVLTG EA +HAGPAVVLSY VSG+SA+LS
Sbjct  69   KAQSHNEMKKTLNWWDLIWFGIGAVIGAGIFVLTGLEAKKHAGPAVVLSYVVSGVSALLS  128

Query  428  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLF  607
            VFCYTEFAVEIPVAGGSFAYLRVELGDF AFIAAGNILLEYVIGGAAVARSWT Y ATL 
Sbjct  129  VFCYTEFAVEIPVAGGSFAYLRVELGDFTAFIAAGNILLEYVIGGAAVARSWTSYFATLC  188

Query  608  NKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVF  787
            N +   F I A  L E Y  L PIAV V   IC +A+LSTKGSSRLNYIASIVH++VI+F
Sbjct  189  NHNSNDFRIVAPGLGENYKYLDPIAVVVIIGICFLAVLSTKGSSRLNYIASIVHVIVILF  248

Query  788  II  793
            II
Sbjct  249  II  250



>ref|XP_008225561.1| PREDICTED: cationic amino acid transporter 1-like [Prunus mume]
Length=621

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/242 (74%), Positives = 198/242 (82%), Gaps = 1/242 (0%)
 Frame = +2

Query  71   NGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-  247
            +GG + G+R RGC+  K DFLPEESF+SWGNYV AL QTP R +DRV +RSLD  EL   
Sbjct  9    SGGGDVGLRRRGCTYRKYDFLPEESFQSWGNYVKALSQTPGRFKDRVLTRSLDSTELVEM  68

Query  248  KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLS  427
            K++S +EMK+ LNWWDLIWFG+GAVIGAGIFVLTG EA  HAGPAVVLSY VSG+SA+LS
Sbjct  69   KAQSHNEMKKTLNWWDLIWFGIGAVIGAGIFVLTGLEARNHAGPAVVLSYVVSGVSALLS  128

Query  428  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLF  607
            VFCYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNILLEYVIGGAAVARSWT Y ATL 
Sbjct  129  VFCYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNILLEYVIGGAAVARSWTSYFATLC  188

Query  608  NKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVF  787
            N     F I A  L E Y  L PIAV V   IC +A+LSTKGSSRLNYIASIVH++VI+F
Sbjct  189  NHDSNDFRIVAPGLRENYKYLDPIAVVVIIGICFLAVLSTKGSSRLNYIASIVHVIVILF  248

Query  788  II  793
            II
Sbjct  249  II  250



>ref|XP_012075759.1| PREDICTED: cationic amino acid transporter 1-like [Jatropha curcas]
 gb|KDP34956.1| hypothetical protein JCGZ_09244 [Jatropha curcas]
Length=582

 Score =   357 bits (917),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/239 (71%), Positives = 202/239 (85%), Gaps = 1/239 (0%)
 Frame = +2

Query  80   SESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSR  256
            +++G+R RGCSC K+DFLPEESF+SWGNY+ AL +TP R +DR+ +RS+D  EL   K+R
Sbjct  9    ADTGIRRRGCSCTKNDFLPEESFQSWGNYMKALSETPMRFKDRLLTRSMDSTELHEIKAR  68

Query  257  SQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFC  436
            S+H+MK++L WWDLIWFG+G VIG+GIFVLTG EA  HAGPA++LSY +SG+SAML+VFC
Sbjct  69   SEHDMKKDLTWWDLIWFGIGVVIGSGIFVLTGLEARDHAGPAILLSYVISGVSAMLAVFC  128

Query  437  YTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKH  616
            YTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT Y ATL N +
Sbjct  129  YTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTSYFATLCNHN  188

Query  617  PESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            P+ F I  ++L + Y  L PIAV V   ICI+A+LSTKGSSR NYIASIVH++ IVFII
Sbjct  189  PDDFRIIVHSLPDDYGHLDPIAVVVSSVICILAVLSTKGSSRFNYIASIVHVITIVFII  247



>ref|XP_010434234.1| PREDICTED: cationic amino acid transporter 1 [Camelina sativa]
Length=598

 Score =   358 bits (918),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/240 (70%), Positives = 201/240 (84%), Gaps = 1/240 (0%)
 Frame = +2

Query  77   GSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKS  253
            G ++G+R RGCSC KDDFLPEESF+S GNY  AL++TP+R  DR+ +RSLD  E+   K+
Sbjct  6    GGDAGLRRRGCSCTKDDFLPEESFQSMGNYFKALKETPSRFLDRITTRSLDTDEINEIKA  65

Query  254  RSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVF  433
            RS HEMK+ L WWDL+WFG+GAVIG+GIFVLTG EA +++GPAVVLSY VSG+SAMLSVF
Sbjct  66   RSGHEMKKTLTWWDLMWFGIGAVIGSGIFVLTGLEAREYSGPAVVLSYAVSGVSAMLSVF  125

Query  434  CYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNK  613
            CYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNI+LEYV+GGAAVARSWT Y ATL N 
Sbjct  126  CYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNIILEYVVGGAAVARSWTSYFATLLNH  185

Query  614  HPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             P+ F +    L E Y+ L PIAVGVC  IC++A+L TKGSSR NYIASI+HMVVI+F++
Sbjct  186  KPDDFRVIVPRLGEDYSHLDPIAVGVCVIICVLAVLGTKGSSRFNYIASIIHMVVILFVV  245



>ref|XP_010439517.1| PREDICTED: cationic amino acid transporter 1 [Camelina sativa]
Length=598

 Score =   358 bits (918),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/240 (70%), Positives = 201/240 (84%), Gaps = 1/240 (0%)
 Frame = +2

Query  77   GSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKS  253
            G ++G+R RGCSC KDDFLPEESF+S GNY  AL++TP+R  DR+ +RSLD  E+   K+
Sbjct  6    GGDAGLRRRGCSCTKDDFLPEESFQSIGNYFKALKETPSRFLDRITTRSLDTDEINEIKA  65

Query  254  RSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVF  433
            RS HEMK+ L WWDL+WFG+GAVIG+GIFVLTG EA +++GPAVVLSY VSG+SAMLSVF
Sbjct  66   RSGHEMKKTLTWWDLMWFGIGAVIGSGIFVLTGLEAREYSGPAVVLSYAVSGVSAMLSVF  125

Query  434  CYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNK  613
            CYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNI+LEYV+GGAAVARSWT Y ATL N 
Sbjct  126  CYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNIILEYVVGGAAVARSWTSYFATLLNH  185

Query  614  HPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             P+ F +    L E Y+ L PIAVGVC  IC++A+L TKGSSR NYIASI+HMVVI+F++
Sbjct  186  KPDDFRVIVPRLGEDYSHLDPIAVGVCVIICVLAVLGTKGSSRFNYIASIIHMVVILFVV  245



>gb|KFK28695.1| hypothetical protein AALP_AA7G034300 [Arabis alpina]
Length=599

 Score =   357 bits (916),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 169/244 (69%), Positives = 206/244 (84%), Gaps = 1/244 (0%)
 Frame = +2

Query  65   TKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-  241
            ++NGG + G+R RGCSC KDDFLPEESF++ GNY  AL++TP+R  DRV +RSLD  E+ 
Sbjct  3    SENGGDDGGLRRRGCSCTKDDFLPEESFKNMGNYFKALKETPSRFMDRVTTRSLDSAEIH  62

Query  242  AAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAM  421
              K+RS +EMK+ LNWWDL+WFG+GAVIG+GIFVLTG EA + +GPAVVLS+ VSG+SAM
Sbjct  63   EMKARSGNEMKKTLNWWDLMWFGIGAVIGSGIFVLTGLEAREVSGPAVVLSFVVSGVSAM  122

Query  422  LSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLAT  601
            LSVFCYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNI+LEY++GGAAVARSWT Y AT
Sbjct  123  LSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNIILEYIVGGAAVARSWTSYFAT  182

Query  602  LFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVI  781
            L N +P+ F I A++L E Y  L PIAVGVC  IC++A++ TKGSS  NYIASI+HMVVI
Sbjct  183  LCNHNPDDFRIIAHSLGEDYGHLDPIAVGVCAIICVLAVVGTKGSSVFNYIASIIHMVVI  242

Query  782  VFII  793
            +F++
Sbjct  243  LFVV  246



>ref|XP_010905430.1| PREDICTED: cationic amino acid transporter 1-like [Elaeis guineensis]
Length=590

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 200/242 (83%), Gaps = 1/242 (0%)
 Frame = +2

Query  71   NGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AA  247
            +G  E+  + RGCSC K+DFLPE+SF SW +Y  ALR+T  RLRDRV +RSL++ EL   
Sbjct  6    DGSGETVAKRRGCSCSKEDFLPEKSFESWASYGKALRETGMRLRDRVTARSLEETELHEV  65

Query  248  KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLS  427
            ++RS HEMK+NL+WWDLIWFG+GAVIGAGIFVLTGQEAN+ AGPAVVLSY VSG+ AMLS
Sbjct  66   RARSGHEMKKNLSWWDLIWFGIGAVIGAGIFVLTGQEANEVAGPAVVLSYVVSGICAMLS  125

Query  428  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLF  607
            VFCYTEFAVEIPVAGGSFAYLRVELGDF+AF+AAGNILLEYVIGGAAVARSWT Y ATL 
Sbjct  126  VFCYTEFAVEIPVAGGSFAYLRVELGDFMAFVAAGNILLEYVIGGAAVARSWTSYFATLL  185

Query  608  NKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVF  787
            N  P  F I A AL + YN L PIAV V   ICI A+LSTKG+SR NYIASI+H+ VI+F
Sbjct  186  NHAPNDFRIHATALADDYNRLDPIAVVVISVICIAAVLSTKGTSRFNYIASIIHLAVILF  245

Query  788  II  793
            II
Sbjct  246  II  247



>ref|XP_009407711.1| PREDICTED: cationic amino acid transporter 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009407712.1| PREDICTED: cationic amino acid transporter 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009407713.1| PREDICTED: cationic amino acid transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=592

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/243 (72%), Positives = 198/243 (81%), Gaps = 1/243 (0%)
 Frame = +2

Query  68   KNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-A  244
              GG+ + ++ RGCSC KDDF PEESF+SW NY  ALR+T  RLRDRV +RSL+Q EL  
Sbjct  5    SEGGATTAVKRRGCSCTKDDFFPEESFKSWANYGRALRETGKRLRDRVTARSLEQSELHE  64

Query  245  AKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAML  424
             + RS H+MK+NL WWDLIWFG+GAVIG+GIFVLTGQEA +  GPAVVLSY VSG+SAML
Sbjct  65   VRLRSGHDMKKNLTWWDLIWFGIGAVIGSGIFVLTGQEAREDVGPAVVLSYVVSGISAML  124

Query  425  SVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATL  604
            SVFCYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNILLEYVIGGAAVARSWT Y +TL
Sbjct  125  SVFCYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNILLEYVIGGAAVARSWTSYFSTL  184

Query  605  FNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIV  784
             N     F I A AL +GYN L PIAV V   IC++A LSTKG+SR NY+ASIVH+ VI+
Sbjct  185  LNHEANDFRIHATALADGYNRLDPIAVAVICIICLVAALSTKGTSRFNYLASIVHVAVIL  244

Query  785  FII  793
            FII
Sbjct  245  FII  247



>ref|XP_007041134.1| Amino acid transporter 1 [Theobroma cacao]
 gb|EOX96965.1| Amino acid transporter 1 [Theobroma cacao]
Length=604

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 202/238 (85%), Gaps = 1/238 (0%)
 Frame = +2

Query  83   ESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRS  259
            E G+R RGCSC KDDFLPEESF+SWGNYV AL++TP+R  DRV +RSLD  EL   K+RS
Sbjct  9    EEGIRRRGCSCTKDDFLPEESFKSWGNYVQALKETPSRFMDRVLTRSLDSTELHEIKARS  68

Query  260  QHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCY  439
            QHEMK+NL+WWDLIWFG+GAVIGAGIFVLTG +A + AGPAVVLSY +SG+SAMLSVFCY
Sbjct  69   QHEMKKNLSWWDLIWFGIGAVIGAGIFVLTGLQAKEVAGPAVVLSYVISGVSAMLSVFCY  128

Query  440  TEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHP  619
            TEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNILLEYVIGGAAVARSWT Y ATL N  P
Sbjct  129  TEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNILLEYVIGGAAVARSWTSYFATLCNHQP  188

Query  620  ESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            E F I  +++   Y  L PIAV V   IC++A+LSTKGSSR NYIAS++H++VI+FII
Sbjct  189  EDFRIIVHSMPADYGHLDPIAVVVVSVICVLAVLSTKGSSRFNYIASVIHVIVILFII  246



>ref|XP_008794464.1| PREDICTED: cationic amino acid transporter 1-like [Phoenix dactylifera]
 ref|XP_008794465.1| PREDICTED: cationic amino acid transporter 1-like [Phoenix dactylifera]
Length=601

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/232 (75%), Positives = 193/232 (83%), Gaps = 1/232 (0%)
 Frame = +2

Query  101  RGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKR  277
            RGCSC K+DF PEESF+SW NY  ALR+T  RLRDRV +RS D  EL   ++RS HEMKR
Sbjct  18   RGCSCTKEDFFPEESFKSWVNYRQALRETGMRLRDRVTARSHDLTELHEVRARSGHEMKR  77

Query  278  NLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVE  457
            NL+WWDLIWFG+GAVIGAGIFVLTGQEAN+  GPAVVLSY VSG+SAMLSVFCYTEFAVE
Sbjct  78   NLSWWDLIWFGIGAVIGAGIFVLTGQEANRDVGPAVVLSYVVSGISAMLSVFCYTEFAVE  137

Query  458  IPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIK  637
            IPVAGGSFAYLRVELGDF+AFIAAGNILLEYVIGGAAVARSWT Y ATL N  PE F I 
Sbjct  138  IPVAGGSFAYLRVELGDFMAFIAAGNILLEYVIGGAAVARSWTSYFATLLNHDPEDFRIH  197

Query  638  ANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             + L   YN L PIAV +   +CI+A+LSTKG+SR NYIASI+H+ VI+FII
Sbjct  198  VSGLAADYNRLDPIAVAIITIVCIVAVLSTKGTSRFNYIASIIHVAVIIFII  249



>ref|XP_012075761.1| PREDICTED: cationic amino acid transporter 1-like [Jatropha curcas]
Length=539

 Score =   353 bits (907),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 169/239 (71%), Positives = 201/239 (84%), Gaps = 1/239 (0%)
 Frame = +2

Query  80   SESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSR  256
            +++G+R RG SC K+DFLPEESF+SWGNY+ AL +TP R +DR+ +RS+D  EL   K+R
Sbjct  9    ADTGIRRRGWSCTKNDFLPEESFQSWGNYMKALSETPMRFKDRLLTRSMDSTELHEIKAR  68

Query  257  SQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFC  436
            S+H+MK++L WWDLIWFG+G VIG+GIFVLTG EA  HAGPA++LSY +SG+SAMLSVFC
Sbjct  69   SEHDMKKDLTWWDLIWFGIGVVIGSGIFVLTGLEARDHAGPAILLSYVISGVSAMLSVFC  128

Query  437  YTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKH  616
            YTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT Y ATL N +
Sbjct  129  YTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTSYFATLCNHN  188

Query  617  PESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            P+ F I  ++L + Y  L PIAV V   ICI+A+LSTKGSSR NYIASIVH++ IVFII
Sbjct  189  PDDFRIIVHSLPDDYGHLDPIAVVVSSVICILAVLSTKGSSRFNYIASIVHVITIVFII  247



>ref|XP_009362249.1| PREDICTED: cationic amino acid transporter 1-like [Pyrus x bretschneideri]
Length=613

 Score =   355 bits (912),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 177/242 (73%), Positives = 198/242 (82%), Gaps = 2/242 (1%)
 Frame = +2

Query  74   GGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-AK  250
            GG + G+R RGC+  +DDFLPEESF+SWGNYVNAL+QTP R  DRV +RS D  EL   K
Sbjct  5    GGDDEGIRRRGCTYRRDDFLPEESFQSWGNYVNALKQTPGRFVDRVLTRSADNTELVEVK  64

Query  251  SRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSV  430
            +RS HEMKR L+WW LIWFG+GAVIGAGIFVLTG EA +HAGPAVVLSY VSG+SA+LSV
Sbjct  65   ARSHHEMKRPLSWWALIWFGLGAVIGAGIFVLTGLEAREHAGPAVVLSYVVSGVSALLSV  124

Query  431  FCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFN  610
            FCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT Y  TL N
Sbjct  125  FCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTSYFTTLCN  184

Query  611  K-HPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVF  787
            +     F I A+   E Y  L PIAV V   IC +A+LSTKGSSRLNYIASIVH++VI+F
Sbjct  185  RSDTNDFRIIAHGFPEDYKYLDPIAVVVIIGICCLAVLSTKGSSRLNYIASIVHIIVILF  244

Query  788  II  793
            I+
Sbjct  245  IV  246



>ref|XP_008784883.1| PREDICTED: cationic amino acid transporter 1-like, partial [Phoenix 
dactylifera]
Length=587

 Score =   355 bits (910),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 197/232 (85%), Gaps = 1/232 (0%)
 Frame = +2

Query  101  RGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKR  277
            RGCSC K+DFLPE+SF SW +Y  ALR+T +RLRDRV +RSLD+ EL   ++RS HEMK+
Sbjct  13   RGCSCTKEDFLPEKSFESWASYGQALRETGSRLRDRVTARSLDETELHEVRARSGHEMKK  72

Query  278  NLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVE  457
            NL+WWDLIWFG+GAVIGAGIFVLTGQEAN+ AGPAVVLSY +SG+SAMLSVFCYTEFAVE
Sbjct  73   NLSWWDLIWFGIGAVIGAGIFVLTGQEANKEAGPAVVLSYVISGISAMLSVFCYTEFAVE  132

Query  458  IPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIK  637
            IPVAGGSFAYLRVELGDF+AFIAAGNILLEYVIGGAAVARSWT Y ATL N  P  F I 
Sbjct  133  IPVAGGSFAYLRVELGDFMAFIAAGNILLEYVIGGAAVARSWTSYFATLLNHKPNDFRIH  192

Query  638  ANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            A+AL   YN L PIAV V  A+C+ A+LSTK +SR NYIASI+H+ +I+FI+
Sbjct  193  ASALAADYNRLDPIAVVVITAVCLAAVLSTKATSRFNYIASIIHVAIILFIV  244



>ref|XP_006342695.1| PREDICTED: cationic amino acid transporter 1-like [Solanum tuberosum]
Length=601

 Score =   354 bits (908),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 197/231 (85%), Gaps = 0/231 (0%)
 Frame = +2

Query  68   KNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA  247
            +   SE G+R R CSC KDDFLPEESF+SWGNY NAL QTP RL DR+ +RS D+ EL +
Sbjct  8    QQTNSEGGIRRRVCSCTKDDFLPEESFKSWGNYANALIQTPTRLIDRILTRSEDEEELES  67

Query  248  KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLS  427
            KSRSQ+EMK+ L WWDLIWFGMGAVIGAGIFVLTG EANQ AGPAVVLSY VSG+SA+LS
Sbjct  68   KSRSQNEMKKTLTWWDLIWFGMGAVIGAGIFVLTGLEANQEAGPAVVLSYVVSGVSALLS  127

Query  428  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLF  607
            VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVI GAAVAR+WT Y ATL 
Sbjct  128  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIAGAAVARTWTSYFATLL  187

Query  608  NKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
            N   + FLIK ++L EGYN L PIAVGVC  ICIIAILSTKGSSRLNYIA+
Sbjct  188  NFSSDKFLIKVDSLAEGYNELDPIAVGVCIIICIIAILSTKGSSRLNYIAT  238



>ref|XP_010449114.1| PREDICTED: cationic amino acid transporter 1-like [Camelina sativa]
Length=598

 Score =   353 bits (906),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/240 (70%), Positives = 199/240 (83%), Gaps = 1/240 (0%)
 Frame = +2

Query  77   GSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKS  253
            G ++ +R RGCSC KDDFLPEESF+S GNY  AL++TP+R  DR+ +RSLD  E+   K+
Sbjct  6    GGDASLRRRGCSCTKDDFLPEESFQSMGNYFKALKETPSRFLDRITTRSLDTDEINEIKA  65

Query  254  RSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVF  433
            RS HEMK+ L WWDL+WFG+GAVIG+GIFVLTG EA + +GPAVV+SY VSG+SAMLSVF
Sbjct  66   RSGHEMKKTLTWWDLMWFGIGAVIGSGIFVLTGLEAREFSGPAVVVSYAVSGVSAMLSVF  125

Query  434  CYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNK  613
            CYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNI+LEYV+GGAAVARSWT Y ATL N 
Sbjct  126  CYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNIILEYVVGGAAVARSWTSYFATLLNH  185

Query  614  HPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             P+ F +    L E Y+ L PIAVGVC  IC++A+L TKGSSR NYIASI+HMVVI+F++
Sbjct  186  KPDDFRVIVPRLGEDYSHLDPIAVGVCVIICVLAVLGTKGSSRFNYIASIIHMVVILFVV  245



>ref|XP_002321859.2| cationic amino acid transporter 1 family protein [Populus trichocarpa]
 gb|EEF05986.2| cationic amino acid transporter 1 family protein [Populus trichocarpa]
Length=602

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/240 (72%), Positives = 202/240 (84%), Gaps = 3/240 (1%)
 Frame = +2

Query  83   ESGMRIRGC--SCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKS  253
            E G+R RGC  SC K+DFLPEESF+S+GNY+ AL++TP R +DR+ +RS D  E+   K+
Sbjct  12   EEGLRRRGCGCSCSKNDFLPEESFQSFGNYLQALKETPMRFKDRLLTRSKDTTEIHEIKA  71

Query  254  RSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVF  433
            RS+HEMK+ L WWDLIWFG+GAVIGAGIFVLTG EA +HAGPAVVLSY VSG+SAMLSVF
Sbjct  72   RSEHEMKKTLTWWDLIWFGIGAVIGAGIFVLTGLEAREHAGPAVVLSYVVSGVSAMLSVF  131

Query  434  CYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNK  613
            CYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNILLEYVIGGAAV+R+WT Y ATL N 
Sbjct  132  CYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNILLEYVIGGAAVSRAWTSYFATLCNH  191

Query  614  HPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             P+ F I A++L + Y  L PIAV V   ICI+A+LSTKGSSR NY+ASI+H+VVI+FII
Sbjct  192  KPDDFRIIAHSLPDDYGHLDPIAVLVGVVICILAVLSTKGSSRFNYVASIIHVVVILFII  251



>ref|XP_011041665.1| PREDICTED: cationic amino acid transporter 1-like [Populus euphratica]
 ref|XP_011041666.1| PREDICTED: cationic amino acid transporter 1-like [Populus euphratica]
Length=602

 Score =   353 bits (905),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 172/241 (71%), Positives = 201/241 (83%), Gaps = 3/241 (1%)
 Frame = +2

Query  80   SESGMRIRGC--SCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAK  250
             E G+R RGC  SC K+DFLPEESF+S+GNY+ AL++TP R +DR+ +RS D  E+   K
Sbjct  11   QEEGLRRRGCGCSCSKNDFLPEESFQSFGNYLQALKETPMRFKDRLLTRSKDTTEIHEIK  70

Query  251  SRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSV  430
             RS+HEMK+ L WWDLIWFG+GAVIGAGIFVLTG EA +HAGPAVVLSY VSG+SAMLSV
Sbjct  71   GRSEHEMKKTLTWWDLIWFGIGAVIGAGIFVLTGLEAREHAGPAVVLSYVVSGVSAMLSV  130

Query  431  FCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFN  610
            FCYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNILLEYVIGGAAV+R+WT Y ATL N
Sbjct  131  FCYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNILLEYVIGGAAVSRAWTSYFATLCN  190

Query  611  KHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFI  790
              P+ F I A++L + Y  L PIAV V   ICI+A+LSTKGSSR NY+ASI+H+VVI+FI
Sbjct  191  HKPDDFRIIAHSLPDDYGHLDPIAVLVGVVICILAVLSTKGSSRFNYVASIIHVVVILFI  250

Query  791  I  793
            I
Sbjct  251  I  251



>ref|XP_009795092.1| PREDICTED: cationic amino acid transporter 1-like [Nicotiana 
sylvestris]
Length=606

 Score =   352 bits (904),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 175/247 (71%), Positives = 206/247 (83%), Gaps = 1/247 (0%)
 Frame = +2

Query  56   EVETKNGGSESG-MRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQ  232
            E E  +G S SG +R RGC+  KDDFLPEESF+SWGNYVNAL  TPARL DRV +RS +Q
Sbjct  3    EGEEGHGLSTSGGIRRRGCTLSKDDFLPEESFKSWGNYVNALSNTPARLYDRVVTRSDEQ  62

Query  233  VELAAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGL  412
             E+ AK+RS ++MKR+LNWWDL+WFG+GA++GAGIFVLTG EA   AGPAVVL+Y +SG+
Sbjct  63   EEMDAKARSVNQMKRSLNWWDLMWFGLGALVGAGIFVLTGLEARTDAGPAVVLAYVISGV  122

Query  413  SAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYY  592
            SAML+VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIG AA+ARSWT Y
Sbjct  123  SAMLAVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGSAAMARSWTSY  182

Query  593  LATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHM  772
             ATL  + P+ F I  N+L EGYN L PIA+GVC  I IIA  STK SSR+NYIAS+VH+
Sbjct  183  FATLCGRQPDDFRIVVNSLAEGYNRLDPIAIGVCIIISIIACNSTKASSRINYIASVVHV  242

Query  773  VVIVFII  793
            ++++FII
Sbjct  243  LILLFII  249



>emb|CDX94024.1| BnaC07g36580D [Brassica napus]
Length=594

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 199/238 (84%), Gaps = 1/238 (0%)
 Frame = +2

Query  83   ESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRS  259
            + G+R RGCSC KDDFLPEESF+S GNY  AL++TP+R  DRV +RS D  E+   K+RS
Sbjct  7    DDGLRRRGCSCTKDDFLPEESFKSMGNYFKALKETPSRFIDRVMTRSDDSAEIHDMKARS  66

Query  260  QHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCY  439
             +EMK+ L WWDL+WFG+GAVIG+GIFVLTGQEA + +GPAVVLS+ VSG+SAMLSVFCY
Sbjct  67   GNEMKKTLTWWDLMWFGVGAVIGSGIFVLTGQEARERSGPAVVLSFVVSGVSAMLSVFCY  126

Query  440  TEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHP  619
            TEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNI+LEYV+GGAAVARSWT Y ATL N  P
Sbjct  127  TEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNIILEYVVGGAAVARSWTSYFATLLNHKP  186

Query  620  ESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            E F I A++L+E Y+ L PIAVGVC  IC++A++  KGSS  NYIAS++HMVVI F+I
Sbjct  187  EDFRIIAHSLNEDYSHLDPIAVGVCAIICVLAVVGIKGSSVFNYIASMIHMVVIAFVI  244



>emb|CDY58484.1| BnaA03g58530D [Brassica napus]
Length=595

 Score =   351 bits (900),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 199/238 (84%), Gaps = 1/238 (0%)
 Frame = +2

Query  83   ESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRS  259
            + G+R RGCSC KDDFLPEESF+S GNY  AL++TP+R  DRV +RS D  E+   K+RS
Sbjct  7    DDGLRRRGCSCTKDDFLPEESFKSMGNYFKALKETPSRFIDRVMTRSDDSAEIHDMKARS  66

Query  260  QHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCY  439
             +EMK+ L WWDL+WFG+GAVIG+GIFVLTGQ+A   +GPAVVLS+ VSG+SAMLSVFCY
Sbjct  67   GNEMKKTLTWWDLMWFGVGAVIGSGIFVLTGQQAKGESGPAVVLSFVVSGVSAMLSVFCY  126

Query  440  TEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHP  619
            TEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNI+LEYV+GGAAVARSWT Y ATL N  P
Sbjct  127  TEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNIILEYVVGGAAVARSWTSYFATLLNHKP  186

Query  620  ESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            E F I A++L+E Y+ L PIAVGVC  IC++A++ TKGSS  NYIAS++HMVVI F+I
Sbjct  187  EDFRIIAHSLNEDYSHLDPIAVGVCAIICVLAVVGTKGSSVFNYIASMIHMVVIAFVI  244



>gb|EPS73602.1| hypothetical protein M569_01155 [Genlisea aurea]
Length=612

 Score =   350 bits (899),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 177/236 (75%), Positives = 200/236 (85%), Gaps = 0/236 (0%)
 Frame = +2

Query  86   SGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAAKSRSQH  265
            S  R R C+C KDDFLPEESF+SWGNYV ALR+TP+RL DRVF+RS  + EL  K RSQH
Sbjct  16   SSTRRRLCTCTKDDFLPEESFKSWGNYVTALRETPSRLVDRVFTRSSVEEELEVKKRSQH  75

Query  266  EMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTE  445
            EMK+ L+WWDLIWFGMGAVIGAGIFVLTGQEA+  AGPAVVLSY VSG+SAMLSVFCYTE
Sbjct  76   EMKKTLSWWDLIWFGMGAVIGAGIFVLTGQEAHNTAGPAVVLSYVVSGISAMLSVFCYTE  135

Query  446  FAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPES  625
            FA+EIP+AGGSFAYLRVELGDFVAFIAAGNI+LEYV+ GAAVARSWT Y ATL N +P  
Sbjct  136  FAIEIPIAGGSFAYLRVELGDFVAFIAAGNIILEYVVSGAAVARSWTSYFATLCNHNPND  195

Query  626  FLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            F I A+ L +GYN L PIAV V   +CII ++STKG+SRLNYIASIVHM++I FII
Sbjct  196  FRIHAHGLADGYNELDPIAVIVLIVVCIIIVVSTKGTSRLNYIASIVHMLIIAFII  251



>ref|XP_012075649.1| PREDICTED: cationic amino acid transporter 1-like [Jatropha curcas]
 gb|KDP34958.1| hypothetical protein JCGZ_09246 [Jatropha curcas]
Length=598

 Score =   350 bits (897),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 197/230 (86%), Gaps = 1/230 (0%)
 Frame = +2

Query  107  CSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-AKSRSQHEMKRNL  283
            CSC KDDFLPEESF+S+ NY  AL +TP R +DR+F+RS+D VE+   K++S+HEMK+NL
Sbjct  23   CSCTKDDFLPEESFQSFSNYGKALLETPMRFKDRLFTRSVDSVEITEVKAQSEHEMKKNL  82

Query  284  NWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIP  463
             WWDLIWFG+GAVIGAGIFVLTG EA + +GPAVVLSY VSG+SAMLSVFCYTEFAVEIP
Sbjct  83   TWWDLIWFGIGAVIGAGIFVLTGLEAKEVSGPAVVLSYVVSGVSAMLSVFCYTEFAVEIP  142

Query  464  VAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKAN  643
            VAGGSFAYLRVELGDF+AFIAAGNILLEYVIGGAAVARSWT YLATL N  P+ F I A+
Sbjct  143  VAGGSFAYLRVELGDFMAFIAAGNILLEYVIGGAAVARSWTSYLATLCNHKPDDFRIIAH  202

Query  644  ALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            +L + Y  L P+AVG+   IC++A+LSTKGSSR NY+ASIVH+ VI+FII
Sbjct  203  SLPDDYGHLDPVAVGITAVICVLAVLSTKGSSRFNYVASIVHIAVILFII  252



>gb|KDP34957.1| hypothetical protein JCGZ_09245 [Jatropha curcas]
Length=573

 Score =   348 bits (893),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 169/230 (73%), Positives = 196/230 (85%), Gaps = 1/230 (0%)
 Frame = +2

Query  107  CSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-AKSRSQHEMKRNL  283
            CSC KDDFLPEESF+S+ NY  AL +TP R +DR+F+RS+D VE+   K++S+HEMK+NL
Sbjct  23   CSCTKDDFLPEESFQSFSNYGKALLETPMRFKDRLFTRSVDSVEITEVKAQSEHEMKKNL  82

Query  284  NWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIP  463
             WWDLIWFGMGAVIGAGIFVLTG EA + AGPAVVLSY VSG+SAMLSVFCYTE AVEIP
Sbjct  83   TWWDLIWFGMGAVIGAGIFVLTGLEAKKVAGPAVVLSYVVSGVSAMLSVFCYTECAVEIP  142

Query  464  VAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKAN  643
            VAGGSFAYLRVELGDF+AFIAAGNILLEYVIGGAAVARSWT YLATL N  P+ F I A+
Sbjct  143  VAGGSFAYLRVELGDFMAFIAAGNILLEYVIGGAAVARSWTSYLATLCNHKPDDFRIIAH  202

Query  644  ALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            +L + Y  L P+AVG+   IC++A+LSTKGSSR NY+ASIVH+ VI+FII
Sbjct  203  SLPDDYGHLDPVAVGITAVICVLAVLSTKGSSRFNYVASIVHIAVILFII  252



>ref|XP_009627441.1| PREDICTED: cationic amino acid transporter 1-like [Nicotiana 
tomentosiformis]
Length=606

 Score =   348 bits (892),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 201/244 (82%), Gaps = 0/244 (0%)
 Frame = +2

Query  62   ETKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL  241
            E     +  G+R RGC+  KDDFLPEESF+SWGNYVNAL  TPARL DRV +RS +Q E+
Sbjct  6    EGHGSSTAGGIRKRGCTLSKDDFLPEESFKSWGNYVNALSNTPARLYDRVVTRSDEQEEM  65

Query  242  AAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAM  421
             AK+RS ++MKR+LNWWDL+WFG+GA++GAGIFVLTG EA   AGPAVVL+Y +SG+SAM
Sbjct  66   DAKARSVNQMKRSLNWWDLMWFGLGALVGAGIFVLTGLEARTDAGPAVVLAYVISGVSAM  125

Query  422  LSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLAT  601
            L+VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIG AA+ARSWT Y AT
Sbjct  126  LAVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGSAAMARSWTSYFAT  185

Query  602  LFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVI  781
            L  + P+ F I  N+L EGYN L  IA+GVC  I IIA  STK SSR+NYIAS+VH++++
Sbjct  186  LCGRQPDDFRIVVNSLAEGYNRLDLIAIGVCIIISIIACNSTKASSRINYIASVVHVLIL  245

Query  782  VFII  793
            +FII
Sbjct  246  LFII  249



>ref|XP_009137166.1| PREDICTED: cationic amino acid transporter 1 [Brassica rapa]
Length=595

 Score =   347 bits (891),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 165/238 (69%), Positives = 198/238 (83%), Gaps = 1/238 (0%)
 Frame = +2

Query  83   ESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRS  259
            + G+R RGCSC KDDFLPEESF+S GNY  AL++TP+R  DRV +RS D  E+   K+RS
Sbjct  7    DDGLRRRGCSCTKDDFLPEESFKSMGNYFKALKETPSRFIDRVMTRSDDSAEIHDMKARS  66

Query  260  QHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCY  439
             +EMK+ L WWDL+WFG+GAVIG+GIFVLTGQ+A   +GPAVVLS+ VSG+SAMLSVFCY
Sbjct  67   GNEMKKTLTWWDLMWFGVGAVIGSGIFVLTGQQARGESGPAVVLSFVVSGVSAMLSVFCY  126

Query  440  TEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHP  619
            TEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNI+LEYV+GGAAVAR+W  Y ATL N  P
Sbjct  127  TEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNIILEYVVGGAAVARAWASYFATLLNHKP  186

Query  620  ESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            E F I A++L+E Y+ L PIAVGVC  IC++A++ TKGSS  NYIAS++HMVVI F+I
Sbjct  187  EDFRIIAHSLNEDYSHLDPIAVGVCAIICVLAVVGTKGSSVFNYIASMIHMVVIAFVI  244



>gb|KJB32880.1| hypothetical protein B456_005G266500 [Gossypium raimondii]
 gb|KJB32881.1| hypothetical protein B456_005G266500 [Gossypium raimondii]
 gb|KJB32883.1| hypothetical protein B456_005G266500 [Gossypium raimondii]
Length=596

 Score =   346 bits (888),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 176/236 (75%), Positives = 200/236 (85%), Gaps = 1/236 (0%)
 Frame = +2

Query  89   GMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQH  265
            G+R RGCSC KDDFLPEESF+SWGNYV AL+QTP R  DRVF+RSLD  EL   K+RSQH
Sbjct  11   GVRRRGCSCTKDDFLPEESFKSWGNYVQALQQTPERFMDRVFTRSLDSTELHEIKARSQH  70

Query  266  EMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTE  445
            EMK+ L+WWDLIWFG+GAVIGAGIFVLTG +A + +GPAVV+SY VSG+SAMLSVFCYTE
Sbjct  71   EMKKTLSWWDLIWFGIGAVIGAGIFVLTGLQAREVSGPAVVISYVVSGISAMLSVFCYTE  130

Query  446  FAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPES  625
            FAVEIPVAGGSFAYLRVELGDF+AFIAAGNILLEYVI GAAVARSWT Y ATL N  PE 
Sbjct  131  FAVEIPVAGGSFAYLRVELGDFMAFIAAGNILLEYVISGAAVARSWTSYFATLCNHKPED  190

Query  626  FLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            F I  +++ E Y  L PIAV V   IC++A+LSTKGSSR NYIASI+H++VI+FII
Sbjct  191  FRIIVHSMSEDYGHLDPIAVVVVCVICVLAVLSTKGSSRFNYIASIIHVIVILFII  246



>gb|KCW73889.1| hypothetical protein EUGRSUZ_E02481 [Eucalyptus grandis]
Length=562

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/220 (78%), Positives = 186/220 (85%), Gaps = 2/220 (1%)
 Frame = +2

Query  92   MRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHE  268
            +R RGC C K DFLPEESF S G+Y  ALR+TPARLRDR+ SRSLD  EL   K+RSQHE
Sbjct  10   VRRRGC-CSKQDFLPEESFASLGSYGRALRETPARLRDRLLSRSLDSTELHEVKARSQHE  68

Query  269  MKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEF  448
            MKR LNWWDLIWFG+GAVIGAGIFVLTG EA   AGPAVVLSY VSG+SA+LSVFCYTEF
Sbjct  69   MKRTLNWWDLIWFGIGAVIGAGIFVLTGLEARDDAGPAVVLSYVVSGVSALLSVFCYTEF  128

Query  449  AVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESF  628
            AVEIP AGGSFAYLRVELGDFVAFIAAGNI+LEYVIGGAAVARSWT Y ATLFN  P  F
Sbjct  129  AVEIPSAGGSFAYLRVELGDFVAFIAAGNIILEYVIGGAAVARSWTSYCATLFNHKPTDF  188

Query  629  LIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLN  748
            LIKA+ L EGYN L P+AVGVC AIC++A+LSTKGSS  N
Sbjct  189  LIKAHGLAEGYNELDPLAVGVCAAICVLAVLSTKGSSIFN  228



>gb|KJB77975.1| hypothetical protein B456_012G170500 [Gossypium raimondii]
Length=606

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/240 (72%), Positives = 205/240 (85%), Gaps = 1/240 (0%)
 Frame = +2

Query  77   GSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKS  253
            G + G+R RGCSCGKDDFLPEESF+SWGNYV AL++TP R  +RV +RSLD  EL   K+
Sbjct  8    GEDEGLRRRGCSCGKDDFLPEESFKSWGNYVQALKETPNRFMNRVLTRSLDSTELHEIKA  67

Query  254  RSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVF  433
            RSQHEMK+NL+WWDLIWFG+GAVIG+GIFVLTG +A Q +GPAVVLS+ VSG+SAMLSVF
Sbjct  68   RSQHEMKKNLSWWDLIWFGIGAVIGSGIFVLTGLQAQQVSGPAVVLSFVVSGVSAMLSVF  127

Query  434  CYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNK  613
            CYTEFAVEIPVAGGSFAYLRVELGDF+A+IAAGNILLEYVIGGAAVARSWT Y ATL N 
Sbjct  128  CYTEFAVEIPVAGGSFAYLRVELGDFIAYIAAGNILLEYVIGGAAVARSWTSYFATLCNH  187

Query  614  HPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
              + F+I  +++ + Y+ L PIAV V   IC++A+LSTKGSSR NYIASI+H++VI+FII
Sbjct  188  DSDDFVIIVHSMPDDYSKLDPIAVVVVCVICVLAVLSTKGSSRFNYIASIIHVIVILFII  247



>ref|XP_010056965.1| PREDICTED: LOW QUALITY PROTEIN: cationic amino acid transporter 
1-like [Eucalyptus grandis]
Length=579

 Score =   344 bits (882),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 172/220 (78%), Positives = 186/220 (85%), Gaps = 2/220 (1%)
 Frame = +2

Query  92   MRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHE  268
            +R RGC C K DFLPEESF S G+Y  ALR+TPARLRDR+ SRSLD  EL   K+RSQHE
Sbjct  5    VRRRGC-CSKQDFLPEESFASLGSYGRALRETPARLRDRLLSRSLDSTELHEVKARSQHE  63

Query  269  MKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEF  448
            MKR LNWWDLIWFG+GAVIGAGIFVLTG EA   AGPAVVLSY VSG+SA+LSVFCYTEF
Sbjct  64   MKRTLNWWDLIWFGIGAVIGAGIFVLTGLEARDDAGPAVVLSYVVSGVSALLSVFCYTEF  123

Query  449  AVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESF  628
            AVEIP AGGSFAYLRVELGDFVAFIAAGNI+LEYVIGGAAVARSWT Y ATLFN  P  F
Sbjct  124  AVEIPSAGGSFAYLRVELGDFVAFIAAGNIILEYVIGGAAVARSWTSYCATLFNHKPTDF  183

Query  629  LIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLN  748
            LIKA+ L EGYN L P+AVGVC AIC++A+LSTKGSS  N
Sbjct  184  LIKAHGLAEGYNELDPLAVGVCAAICVLAVLSTKGSSIFN  223



>emb|CDX76419.1| BnaA08g09810D [Brassica napus]
Length=597

 Score =   343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 204/244 (84%), Gaps = 3/244 (1%)
 Frame = +2

Query  65   TKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-  241
            ++NG  + G+R RGCSC KDDFLPEESF+S GNY  AL++TP+R  DR+ +RS D VE+ 
Sbjct  3    SENG--DDGLRRRGCSCTKDDFLPEESFKSMGNYFKALKETPSRFVDRLLTRSQDSVEIH  60

Query  242  AAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAM  421
              K+RS HEMK+ L WWDL+WFG+GAVIG+GIFVLTGQEA   AGPAVV+S+ VSG+SAM
Sbjct  61   DMKARSGHEMKKTLTWWDLMWFGVGAVIGSGIFVLTGQEARDSAGPAVVVSFVVSGVSAM  120

Query  422  LSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLAT  601
            LSVFCYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNI+L+Y++GGAAVARSWT Y AT
Sbjct  121  LSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNIILQYIVGGAAVARSWTSYFAT  180

Query  602  LFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVI  781
            L N  P+ F I AN+LHE YN L PI+VGVC  IC++A + TKGSS  NYIASI+HM+VI
Sbjct  181  LLNHKPDDFRIVANSLHEDYNHLDPISVGVCVIICVLAAIGTKGSSVFNYIASIIHMLVI  240

Query  782  VFII  793
            +FI+
Sbjct  241  LFIV  244



>emb|CDY65339.1| BnaC03g64380D [Brassica napus]
Length=597

 Score =   343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 204/244 (84%), Gaps = 3/244 (1%)
 Frame = +2

Query  65   TKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-  241
            ++NG  + G+R RGCSC KDDFLPEESF+S GNY  AL++TP+R  DR+ +RS D VE+ 
Sbjct  3    SENG--DDGLRRRGCSCTKDDFLPEESFKSMGNYFKALKETPSRFVDRLLTRSQDSVEIH  60

Query  242  AAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAM  421
              K+RS HEMK+ L WWDL+WFG+GAVIG+GIFVLTGQEA   AGPAVV+S+ VSG+SAM
Sbjct  61   DMKARSGHEMKKTLTWWDLMWFGVGAVIGSGIFVLTGQEARDSAGPAVVVSFVVSGVSAM  120

Query  422  LSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLAT  601
            LSVFCYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNI+L+Y++GGAAVARSWT Y AT
Sbjct  121  LSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNIILQYIVGGAAVARSWTSYFAT  180

Query  602  LFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVI  781
            L N  P+ F I AN+LHE YN L PI+VGVC  IC++A + TKGSS  NYIASI+HM+VI
Sbjct  181  LLNHKPDDFRIVANSLHEDYNHLDPISVGVCVIICVLAAIGTKGSSVFNYIASIIHMLVI  240

Query  782  VFII  793
            +FI+
Sbjct  241  LFIV  244



>ref|XP_009108509.1| PREDICTED: cationic amino acid transporter 1-like [Brassica rapa]
Length=597

 Score =   343 bits (879),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 204/244 (84%), Gaps = 3/244 (1%)
 Frame = +2

Query  65   TKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-  241
            ++NG  + G+R RGCSC KDDFLPEESF+S GNY  AL++TP+R  DR+ +RS D VE+ 
Sbjct  3    SENG--DDGLRRRGCSCTKDDFLPEESFKSMGNYFKALKETPSRFVDRLLTRSQDSVEIH  60

Query  242  AAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAM  421
              K+RS HEMK+ L WWDL+WFG+GAVIG+GIFVLTGQEA   AGPAVV+S+ VSG+SAM
Sbjct  61   DMKARSGHEMKKTLTWWDLMWFGVGAVIGSGIFVLTGQEARDSAGPAVVVSFVVSGVSAM  120

Query  422  LSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLAT  601
            LSVFCYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNI+L+Y++GGAAVARSWT Y AT
Sbjct  121  LSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNIILQYIVGGAAVARSWTSYFAT  180

Query  602  LFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVI  781
            L N  P+ F I AN+LHE YN L PI+VGVC  IC++A + TKGSS  NYIASI+HM+VI
Sbjct  181  LLNHKPDDFRIVANSLHEDYNHLDPISVGVCAIICVLAAIGTKGSSVFNYIASIIHMLVI  240

Query  782  VFII  793
            +FI+
Sbjct  241  LFIV  244



>ref|XP_010241173.1| PREDICTED: cationic amino acid transporter 1-like [Nelumbo nucifera]
 ref|XP_010241174.1| PREDICTED: cationic amino acid transporter 1-like [Nelumbo nucifera]
 ref|XP_010241175.1| PREDICTED: cationic amino acid transporter 1-like [Nelumbo nucifera]
Length=585

 Score =   342 bits (877),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 165/227 (73%), Positives = 186/227 (82%), Gaps = 1/227 (0%)
 Frame = +2

Query  74   GGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAK  250
            G S  G+R RGCSC K+DFLPEESF+SWGNY  AL QT  RL+DR+ +RSLD+ E+   +
Sbjct  2    GVSSEGVRRRGCSCSKEDFLPEESFKSWGNYAKALSQTGLRLKDRILTRSLDETEIHEIR  61

Query  251  SRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSV  430
            +RSQH+MK+NL+WWDLIWFG+GAVIGAGIFVLTG E    AGPAVVLSY VSG+SAMLSV
Sbjct  62   ARSQHDMKKNLSWWDLIWFGIGAVIGAGIFVLTGLEVKSVAGPAVVLSYVVSGISAMLSV  121

Query  431  FCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFN  610
            FCYTEFAVEIPVAGGSFAYLRVELGDF+AFIA GNILLEY+IGGAAVARSWT Y ATL N
Sbjct  122  FCYTEFAVEIPVAGGSFAYLRVELGDFMAFIAGGNILLEYIIGGAAVARSWTSYFATLCN  181

Query  611  KHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNY  751
              P  F I  + L E Y  L PI+VGV   ICI+A+LSTKGSSRLNY
Sbjct  182  HDPNDFRIHVHQLGEDYGYLDPISVGVIIGICILAVLSTKGSSRLNY  228



>ref|XP_003531311.1| PREDICTED: cationic amino acid transporter 1-like isoform X1 
[Glycine max]
 ref|XP_006585236.1| PREDICTED: cationic amino acid transporter 1-like isoform X2 
[Glycine max]
Length=602

 Score =   342 bits (877),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 197/243 (81%), Gaps = 1/243 (0%)
 Frame = +2

Query  68   KNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA  247
            ++G  + G+R RGC+  ++DF PEESF+SWGNY  A+ +TP RL+DRV +RS DQ EL  
Sbjct  3    RDGEIDGGVRRRGCTFRRNDFFPEESFKSWGNYARAVLETPWRLKDRVVTRSEDQTELVE  62

Query  248  -KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAML  424
             K+RS HEMK+ LNWWDL+WFG+GAVIG+GIFVLTG EA    GPAVVLSY VSG+SA+ 
Sbjct  63   MKARSNHEMKKTLNWWDLMWFGIGAVIGSGIFVLTGLEARTAVGPAVVLSYVVSGVSALF  122

Query  425  SVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATL  604
            SVFCYTEFAVEIPVAGGSFAYLRVELGDFVA+IAAGNILLEYVIGGAAVARSWT Y ATL
Sbjct  123  SVFCYTEFAVEIPVAGGSFAYLRVELGDFVAYIAAGNILLEYVIGGAAVARSWTSYFATL  182

Query  605  FNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIV  784
              KHP+ F I A+ ++  Y  L PIA+GV  AI I+A+ STKGSS  N+IA+I H++VIV
Sbjct  183  CGKHPDDFRIIAHNMNPNYGHLDPIAIGVLIAITILAVYSTKGSSIFNFIATIFHLIVIV  242

Query  785  FII  793
            FII
Sbjct  243  FII  245



>ref|XP_006836312.1| PREDICTED: cationic amino acid transporter 1 [Amborella trichopoda]
 gb|ERM99165.1| hypothetical protein AMTR_s00092p00050170 [Amborella trichopoda]
Length=592

 Score =   342 bits (876),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 161/238 (68%), Positives = 198/238 (83%), Gaps = 2/238 (1%)
 Frame = +2

Query  83   ESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-AKSRS  259
             SG++ R C+C KDDF PEESF+SWGNY+ AL +TP+RL+DR+ +RSLD  E+   +++S
Sbjct  4    HSGLKRRACTCSKDDFFPEESFKSWGNYMRALGKTPSRLKDRLLARSLDATEITEVRAQS  63

Query  260  QHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCY  439
            Q++MK++LNWWDLIWFG+GAVIGAGIFVLTG EA Q AGPAVV+SY VSGLSA+LSVFCY
Sbjct  64   QNDMKKSLNWWDLIWFGLGAVIGAGIFVLTGLEARQDAGPAVVISYVVSGLSALLSVFCY  123

Query  440  TEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHP  619
            TEFAVEIPVAGGSFAYLRVELGDFVAFI AGNIL EY++  AAVAR+WT YLA+L N+ P
Sbjct  124  TEFAVEIPVAGGSFAYLRVELGDFVAFITAGNILFEYIVSNAAVARAWTSYLASLCNRSP  183

Query  620  ESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            +SF I   +L   YN+L PIAV V  A+ + A+ STK SSR NYIASIVH+++I+F+I
Sbjct  184  DSFRIT-TSLAPDYNVLDPIAVAVILAVSLAALFSTKHSSRFNYIASIVHVIIILFVI  240



>ref|XP_002526614.1| cationic amino acid transporter, putative [Ricinus communis]
 gb|EEF35773.1| cationic amino acid transporter, putative [Ricinus communis]
Length=587

 Score =   341 bits (875),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 172/241 (71%), Positives = 201/241 (83%), Gaps = 1/241 (0%)
 Frame = +2

Query  74   GGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAK  250
            G  + G+R RGCSC K DF+PEESF+S G+Y+ AL +TP R +DR+ +RS+D  E+   K
Sbjct  5    GDGDEGVRRRGCSCTKSDFIPEESFQSMGSYLKALSETPMRFKDRLLARSMDSTEINEIK  64

Query  251  SRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSV  430
            +RS+H+MK+NL WWDLIWFG+GAVIGAGIFVLTG EA   AGPAVVLSY VSG+SAMLSV
Sbjct  65   ARSEHQMKKNLTWWDLIWFGIGAVIGAGIFVLTGLEAQSVAGPAVVLSYVVSGISAMLSV  124

Query  431  FCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFN  610
            FCYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNILLEYVIGGAAVAR+WT Y ATL N
Sbjct  125  FCYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNILLEYVIGGAAVARAWTSYFATLLN  184

Query  611  KHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFI  790
              PE+F I A++L E Y  L PIAV V   IC++A+LSTKGSSR NYIASI+H+VVI+FI
Sbjct  185  HKPENFRIIAHSLPEDYGHLDPIAVVVIAVICVLAVLSTKGSSRFNYIASIIHIVVILFI  244

Query  791  I  793
            I
Sbjct  245  I  245



>ref|XP_008445160.1| PREDICTED: cationic amino acid transporter 1-like [Cucumis melo]
 ref|XP_008445169.1| PREDICTED: cationic amino acid transporter 1-like [Cucumis melo]
Length=581

 Score =   340 bits (873),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 171/236 (72%), Positives = 196/236 (83%), Gaps = 1/236 (0%)
 Frame = +2

Query  89   GMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQH  265
            G+R R C CGK+DFLPEESF+SWGNY NAL+ TP+RL DR+ +RS ++ EL   K+RS+H
Sbjct  10   GIRRRSCGCGKEDFLPEESFQSWGNYANALKATPSRLMDRLMTRSAEKTELVEMKARSEH  69

Query  266  EMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTE  445
            EMK+NL WWDLIWFG+GAVIGAGIFVLTG E  +HAGPAVVLSY VSG+SA+LSVFCYTE
Sbjct  70   EMKKNLTWWDLIWFGVGAVIGAGIFVLTGLETKEHAGPAVVLSYVVSGVSALLSVFCYTE  129

Query  446  FAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPES  625
            FAVEIP AGGSFAYLRVELGDFVAFIAAGNILLEYVIG AAVARSWT Y ATL N HP  
Sbjct  130  FAVEIPAAGGSFAYLRVELGDFVAFIAAGNILLEYVIGSAAVARSWTSYFATLCNHHPND  189

Query  626  FLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            F I   A  + YN L PIA+ V   +CI A++STKGSSR NYIASI+H+VVI+FI+
Sbjct  190  FRIHIPAFADNYNRLDPIAIVVIIVVCIFAVMSTKGSSRFNYIASILHVVVILFIV  245



>ref|XP_004141615.1| PREDICTED: cationic amino acid transporter 1-like [Cucumis sativus]
 gb|KGN52612.1| hypothetical protein Csa_5G647350 [Cucumis sativus]
Length=584

 Score =   338 bits (868),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 163/240 (68%), Positives = 189/240 (79%), Gaps = 1/240 (0%)
 Frame = +2

Query  53   MEVETKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQ  232
            M   + +G +  G+R R C CGKDDFLPEESF+SW NY  AL+ TP RL +R+ +RS D 
Sbjct  1    MGQPSSDGSNGEGIRRRSCGCGKDDFLPEESFQSWENYTKALKATPFRLFNRLTARSADH  60

Query  233  VELAA-KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSG  409
             EL   K+RSQH+MK+ L WWDL+WFG+GAVIGAGIFVLTG E  +HAGPAVVLSY VSG
Sbjct  61   TELVEMKARSQHQMKKTLTWWDLMWFGVGAVIGAGIFVLTGLETKKHAGPAVVLSYIVSG  120

Query  410  LSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTY  589
            +SAMLSVFCYTEFAVEIP AGGSFAYLRVELGDFVAFIAAGNILLEY+IG AAVAR+WT 
Sbjct  121  ISAMLSVFCYTEFAVEIPAAGGSFAYLRVELGDFVAFIAAGNILLEYIIGSAAVARAWTS  180

Query  590  YLATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVH  769
            Y ATL N HP  F +  +A  + YN L PIA+ V   I I A++STKGSSRLNY+ASI+H
Sbjct  181  YFATLCNHHPNDFRVHISAFPDDYNQLDPIAIVVILIIGIFALVSTKGSSRLNYVASILH  240



>ref|XP_002274916.1| PREDICTED: cationic amino acid transporter 1-like [Vitis vinifera]
 ref|XP_010655725.1| PREDICTED: cationic amino acid transporter 1-like [Vitis vinifera]
Length=589

 Score =   338 bits (868),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 164/245 (67%), Positives = 196/245 (80%), Gaps = 3/245 (1%)
 Frame = +2

Query  62   ETKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL  241
             T  GG  +  R RGC   K+DFLPEESF+SWG YV AL  T ARL+DRV +RSLD+VEL
Sbjct  3    NTSEGGGVA--RKRGCGWTKEDFLPEESFQSWGTYVKALGNTTARLKDRVLTRSLDEVEL  60

Query  242  -AAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSA  418
             A + RS++EMK+ LNWWDL+WFG+GAV+G+GIFVLTG+ AN++AGPAVVLSY +SG+SA
Sbjct  61   HAVRDRSKNEMKKTLNWWDLLWFGIGAVMGSGIFVLTGEAANEYAGPAVVLSYFISGVSA  120

Query  419  MLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLA  598
            +LSV CYTEFAVE+PVAGGSFAYLRVELGDFVA++AAGNIL EYV+ GA VARSWT Y A
Sbjct  121  ILSVLCYTEFAVELPVAGGSFAYLRVELGDFVAYVAAGNILFEYVVAGAGVARSWTSYFA  180

Query  599  TLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVV  778
            TL N  P  F   A++L EGYN L PIAV V   +C++A LS KGSSR N IASIVHMV+
Sbjct  181  TLCNHDPNDFRFYASSLAEGYNRLDPIAVAVSIVVCVLASLSMKGSSRFNSIASIVHMVI  240

Query  779  IVFII  793
            I F++
Sbjct  241  IAFML  245



>ref|XP_009344397.1| PREDICTED: cationic amino acid transporter 1-like [Pyrus x bretschneideri]
Length=614

 Score =   338 bits (868),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 184/228 (81%), Gaps = 2/228 (1%)
 Frame = +2

Query  74   GGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-K  250
            GG + G+R RGC+  +DDFLPEESF+SWGNYVNALRQTP R  DRV +RS D  EL   K
Sbjct  6    GGVDEGLRRRGCTYRRDDFLPEESFQSWGNYVNALRQTPGRFMDRVLTRSADSTELVEMK  65

Query  251  SRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSV  430
            +RS  EMK+ LNWWDLIWFG+GAVIGAGIFVLTG EA  HAGPAVVLSY VSG+SA+LSV
Sbjct  66   ARSHSEMKKTLNWWDLIWFGLGAVIGAGIFVLTGLEAKNHAGPAVVLSYVVSGVSALLSV  125

Query  431  FCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFN  610
            FCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT Y  TL N
Sbjct  126  FCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTSYFTTLCN  185

Query  611  K-HPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNY  751
            +     F I A+ L E Y  L PIAV V   IC +A+LSTKGSSRLNY
Sbjct  186  RSDTNDFRIVAHDLPEDYRFLDPIAVVVIIGICCLAVLSTKGSSRLNY  233



>ref|XP_009419637.1| PREDICTED: cationic amino acid transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=577

 Score =   337 bits (863),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 187/232 (81%), Gaps = 1/232 (0%)
 Frame = +2

Query  101  RGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKR  277
            R  SC K DFLPEESF+SW NY  AL++T  RL+DR+ SRSLD +EL   K RS  EMK+
Sbjct  15   RAWSCTKQDFLPEESFQSWANYTKALKETGTRLKDRITSRSLDNLELTEIKGRSGFEMKK  74

Query  278  NLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVE  457
             L+WWDLIWFG+GAVIGAGIFVLTGQEA   AGPAV+LSY VSG+SAMLSVFCYTEFAVE
Sbjct  75   TLSWWDLIWFGIGAVIGAGIFVLTGQEARDSAGPAVILSYVVSGISAMLSVFCYTEFAVE  134

Query  458  IPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIK  637
            IPVAGGSFAYLRVELGDF+AFIAAGNILLEYVIGGAAVARSWT Y ATL N H   F I 
Sbjct  135  IPVAGGSFAYLRVELGDFIAFIAAGNILLEYVIGGAAVARSWTSYFATLLNHHSNDFRIH  194

Query  638  ANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            A +L+  Y+ L PIAV V   +C+ A+ STK +SR NY+ASI+H+ +IVFII
Sbjct  195  ATSLNPDYSRLDPIAVVVIALVCLAAVSSTKATSRFNYVASIIHLAIIVFII  246



>ref|XP_004135553.1| PREDICTED: cationic amino acid transporter 1-like [Cucumis sativus]
 gb|KGN65930.1| hypothetical protein Csa_1G538280 [Cucumis sativus]
Length=582

 Score =   336 bits (861),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 172/236 (73%), Positives = 194/236 (82%), Gaps = 1/236 (0%)
 Frame = +2

Query  89   GMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQH  265
            G+R R C CGK+DFLPEESF+SWGNY NAL+ TP RL +R+ +RS +Q EL   K+RS+H
Sbjct  10   GIRRRSCGCGKEDFLPEESFQSWGNYANALKATPFRLMNRLTARSAEQTELVEMKARSEH  69

Query  266  EMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTE  445
            EMK+NL WWDLIWFG+GAVIGAGIFVLTG E  +HAGPAVVLSY VSG+SAMLSVFCYTE
Sbjct  70   EMKKNLTWWDLIWFGVGAVIGAGIFVLTGLETRKHAGPAVVLSYVVSGVSAMLSVFCYTE  129

Query  446  FAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPES  625
            FAVEIP AGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT Y ATL N  P  
Sbjct  130  FAVEIPAAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTSYFATLCNHRPND  189

Query  626  FLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            F I   +    YN L PIAV V   ICI A++STKGSSR NYIASI+H++VI+FI+
Sbjct  190  FRIHIPSFAHDYNRLDPIAVVVIIVICIFAVMSTKGSSRFNYIASILHVIVILFIV  245



>ref|XP_008372220.1| PREDICTED: cationic amino acid transporter 1-like [Malus domestica]
Length=614

 Score =   336 bits (861),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/225 (74%), Positives = 184/225 (82%), Gaps = 2/225 (1%)
 Frame = +2

Query  92   MRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-AKSRSQHE  268
            +R RGC+  KDDFLPEESF+SWGNYV+AL+QTP R  DRV +RS D  EL   K+RS HE
Sbjct  12   IRRRGCTYRKDDFLPEESFQSWGNYVDALKQTPGRFVDRVLTRSADNTELVEVKARSHHE  71

Query  269  MKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEF  448
            MK+ L+WWDLIWFG+GAVIGAGIFVLTG EA +HAGPAVVLSY VSG+SA+LSVFCYTEF
Sbjct  72   MKKTLSWWDLIWFGLGAVIGAGIFVLTGLEAREHAGPAVVLSYVVSGVSALLSVFCYTEF  131

Query  449  AVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNK-HPES  625
            AVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT Y  TL N+     
Sbjct  132  AVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTSYFTTLCNRSDTND  191

Query  626  FLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
            F I A+   E Y  L PIAV V   IC +A+LSTKGSSRLNYIAS
Sbjct  192  FRIIAHGFPEDYKYLDPIAVAVIIGICCLAVLSTKGSSRLNYIAS  236



>ref|XP_006448934.1| hypothetical protein CICLE_v10018362mg [Citrus clementina]
 gb|ESR62174.1| hypothetical protein CICLE_v10018362mg [Citrus clementina]
Length=570

 Score =   332 bits (852),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 195/240 (81%), Gaps = 1/240 (0%)
 Frame = +2

Query  77   GSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKS  253
            G+ SG++ RGC+C K DFLPEESF+SWGNYV AL  T AR++DR+ +RS D +EL   ++
Sbjct  4    GNGSGIKKRGCACTKQDFLPEESFQSWGNYVKALASTRARMKDRLLTRSNDNLELHQMRA  63

Query  254  RSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVF  433
            RS HEMK+NLNWWDLIWFG+GAV+GAGIFVLTG+ A   AGPAV++SY +SG+SA+LSV 
Sbjct  64   RSDHEMKKNLNWWDLIWFGIGAVMGAGIFVLTGEAARNFAGPAVIISYLISGISALLSVL  123

Query  434  CYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNK  613
            CYTEF+VE+PVAGGSFAYLRVELGDFVA+IAAGNIL EYV+ GA+VARSWT Y ATL N 
Sbjct  124  CYTEFSVELPVAGGSFAYLRVELGDFVAYIAAGNILFEYVVSGASVARSWTSYFATLCNH  183

Query  614  HPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             P SF I  ++  E Y+ L PIAV V F +C+ A LS KGSSR N +A+IVH+V+++FI+
Sbjct  184  DPSSFRIHVSSFAEDYSHLDPIAVIVSFFVCVGACLSMKGSSRFNSVATIVHIVILIFIL  243



>ref|XP_006468283.1| PREDICTED: cationic amino acid transporter 1-like isoform X1 
[Citrus sinensis]
 ref|XP_006468284.1| PREDICTED: cationic amino acid transporter 1-like isoform X2 
[Citrus sinensis]
 gb|KDO75317.1| hypothetical protein CISIN_1g007943mg [Citrus sinensis]
Length=584

 Score =   333 bits (853),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 158/240 (66%), Positives = 197/240 (82%), Gaps = 1/240 (0%)
 Frame = +2

Query  77   GSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKS  253
            G+ SG++ RGC+C K DFLPEESF+SWGNYV AL  T ARL+DR+ +RS D +EL   ++
Sbjct  4    GNGSGIKKRGCACTKQDFLPEESFQSWGNYVKALASTRARLKDRLLTRSNDNLELHQMRA  63

Query  254  RSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVF  433
            RS+HEMK+NLNWWDLIWFG+GAV+GAGIFVLTG+ A   AGPAV++SY +SG+SA+LSV 
Sbjct  64   RSEHEMKKNLNWWDLIWFGIGAVMGAGIFVLTGEAARNFAGPAVIISYLISGISALLSVL  123

Query  434  CYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNK  613
            CYTEF+VE+PVAGGSFAYLRVELGDFVA+IAAGNIL EYV+ GA+VARSWT Y ATL N 
Sbjct  124  CYTEFSVELPVAGGSFAYLRVELGDFVAYIAAGNILFEYVVSGASVARSWTSYFATLCNH  183

Query  614  HPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             P SF I  +++ E Y+ L PIAV V F +C+ A LS KGSSR N +A+IVH+V+++FI+
Sbjct  184  DPGSFRIHVSSVAEDYSHLDPIAVIVSFFVCVGACLSMKGSSRFNSVATIVHIVILIFIL  243



>ref|XP_009405465.1| PREDICTED: cationic amino acid transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=580

 Score =   332 bits (852),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 181/221 (82%), Gaps = 1/221 (0%)
 Frame = +2

Query  101  RGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKR  277
            R CSC K DFLPEESF+SW NY  AL++T  RL+DRV SRSLD+ EL   ++RS HEMK+
Sbjct  16   RTCSCTKQDFLPEESFQSWANYGKALKETGMRLKDRVMSRSLDKSELTEIRARSGHEMKK  75

Query  278  NLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVE  457
            NL WWDLIWFG+GAVIGAGIFVLTGQEA   AGPAV+LSY VSG+SAMLSVFCYTEFAVE
Sbjct  76   NLTWWDLIWFGIGAVIGAGIFVLTGQEARDDAGPAVILSYVVSGVSAMLSVFCYTEFAVE  135

Query  458  IPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIK  637
            IPVAGGSFAYLRVELGDF+AFIAAGNILLEYVIGGAAV+RSWT Y ATL N HP  F I 
Sbjct  136  IPVAGGSFAYLRVELGDFMAFIAAGNILLEYVIGGAAVSRSWTSYFATLLNHHPNDFRIH  195

Query  638  ANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
            A +L   Y+ L PIAV V   +C+ A+LSTK +SR NY+AS
Sbjct  196  ATSLDPDYSHLDPIAVVVITLVCVAAVLSTKATSRFNYVAS  236



>ref|XP_009408749.1| PREDICTED: cationic amino acid transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=602

 Score =   332 bits (852),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/234 (68%), Positives = 190/234 (81%), Gaps = 1/234 (0%)
 Frame = +2

Query  95   RIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEM  271
            R  GC C KD+FLP+ESF+SW NY+ ALR+T  RL++R+ +RS+D  E+   ++RS HEM
Sbjct  23   RRAGCCCTKDEFLPDESFQSWANYMKALRETGMRLKNRIAARSMDDTEINEVRARSGHEM  82

Query  272  KRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFA  451
            KRNL+WWDLIWFG+GAVIGAGIFVLTGQEA   AGPAV+LS+ VSG+S+MLSVFCYTEFA
Sbjct  83   KRNLSWWDLIWFGIGAVIGAGIFVLTGQEARNAAGPAVILSFVVSGVSSMLSVFCYTEFA  142

Query  452  VEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFL  631
            VEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYV+  AAVARSWT Y ATL N  P+ F 
Sbjct  143  VEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVVSCAAVARSWTSYFATLLNHQPDDFR  202

Query  632  IKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            I   +L   Y+ L PIAV V  AIC+ A+ STK +SR NY++SI+H+ +IVFII
Sbjct  203  IHIASLSPDYSRLDPIAVVVIVAICLAAVFSTKATSRFNYVSSIIHLAIIVFII  256



>ref|XP_004504162.1| PREDICTED: cationic amino acid transporter 1-like isoform X1 
[Cicer arietinum]
 ref|XP_004504163.1| PREDICTED: cationic amino acid transporter 1-like isoform X2 
[Cicer arietinum]
Length=593

 Score =   331 bits (848),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 167/248 (67%), Positives = 194/248 (78%), Gaps = 4/248 (2%)
 Frame = +2

Query  53   MEVETKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQ  232
            M V  +NGG   G+R RGC+  K+DF PEESF+SWGNY  ++ +TP RL+DRV  RS D 
Sbjct  1    MAVGEENGG---GVRRRGCTFQKNDFFPEESFKSWGNYGRSVMETPFRLKDRVLKRSSDH  57

Query  233  VEL-AAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSG  409
             EL   K+RS +EMK+ LNWWDLIWFG+GAV+G+GIFVLTG EA Q AGPAVVLS+ VSG
Sbjct  58   SELFEVKARSGNEMKKTLNWWDLIWFGIGAVVGSGIFVLTGLEARQEAGPAVVLSFVVSG  117

Query  410  LSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTY  589
            +SA+LSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIG AAVARSWT 
Sbjct  118  ISALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGNAAVARSWTS  177

Query  590  YLATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVH  769
            Y ATL N+ PE F I  ++++  Y  L PIAV     I  +A+ STKGSS  NY+A+I H
Sbjct  178  YFATLCNRAPEDFRIIVHSMNPDYGHLDPIAVVALIVITALAVYSTKGSSIFNYVATIFH  237

Query  770  MVVIVFII  793
            M VIVFII
Sbjct  238  MFVIVFII  245



>ref|XP_009778011.1| PREDICTED: cationic amino acid transporter 1-like [Nicotiana 
sylvestris]
Length=600

 Score =   329 bits (844),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 189/235 (80%), Gaps = 1/235 (0%)
 Frame = +2

Query  92   MRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHE  268
            ++ RGC C KDDFLPEESF SWG+Y  ALR+T  RL+DR+ SRS DQ+EL   + RSQH+
Sbjct  16   LKKRGCGCSKDDFLPEESFTSWGSYAQALRETKTRLKDRILSRSSDQLELHEVRDRSQHQ  75

Query  269  MKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEF  448
            MK++LNW+DLIWFG+GAV+GAG+FVLTG+     AGPAV+LSY +SG+SA+LSV CYTEF
Sbjct  76   MKKSLNWFDLIWFGIGAVMGAGVFVLTGEATKNIAGPAVLLSYVISGISALLSVLCYTEF  135

Query  449  AVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESF  628
            +VE+PVAGGSFAYLRVELGDF+AFIAAGNIL EY++ GA+VARSWT Y ATL N  P+ F
Sbjct  136  SVELPVAGGSFAYLRVELGDFIAFIAAGNILFEYIVSGASVARSWTSYFATLCNHKPDDF  195

Query  629  LIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             I  ++L EGYN L PIA+ V   IC+ A LS KGSSR N   +IVH++V+VFI+
Sbjct  196  RINVSSLAEGYNHLDPIAIVVSMVICVGASLSMKGSSRFNSFVTIVHIIVMVFIL  250



>ref|XP_009362250.1| PREDICTED: cationic amino acid transporter 1-like [Pyrus x bretschneideri]
 ref|XP_009362251.1| PREDICTED: cationic amino acid transporter 1-like [Pyrus x bretschneideri]
 ref|XP_009362252.1| PREDICTED: cationic amino acid transporter 1-like [Pyrus x bretschneideri]
Length=614

 Score =   329 bits (843),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 166/225 (74%), Positives = 180/225 (80%), Gaps = 2/225 (1%)
 Frame = +2

Query  92   MRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-AKSRSQHE  268
            +R RGC+  KDDFLPEESF+SWGNYVNAL++TP R  DRV SRS D  EL   K+RS HE
Sbjct  12   IRRRGCTYRKDDFLPEESFQSWGNYVNALKKTPRRFVDRVLSRSADNTELVEVKARSHHE  71

Query  269  MKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEF  448
            MK+ LNWWDLIWFG+G VIGAGIFVLTG EA +HAG AVVLSY VSG+SAMLSVFCYTEF
Sbjct  72   MKKKLNWWDLIWFGIGVVIGAGIFVLTGLEAKRHAGAAVVLSYLVSGVSAMLSVFCYTEF  131

Query  449  AVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNK-HPES  625
            AVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVI GAAVARSWT Y  TL N+     
Sbjct  132  AVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVISGAAVARSWTSYFTTLCNRSDTND  191

Query  626  FLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
            F I A+   E Y  L PIAV V   IC +A+LS KGSSRLNYIAS
Sbjct  192  FRIIAHGFPEDYKYLDPIAVAVLIGICCLAVLSIKGSSRLNYIAS  236



>ref|XP_007214130.1| hypothetical protein PRUPE_ppa018024mg [Prunus persica]
 gb|EMJ15329.1| hypothetical protein PRUPE_ppa018024mg [Prunus persica]
Length=597

 Score =   327 bits (839),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 190/245 (78%), Gaps = 1/245 (0%)
 Frame = +2

Query  59   VETKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVE  238
            +E   GG  +G+R R C C K+DFLPEESF+SWGNYV+AL  T  RL DR+ +RS+D  E
Sbjct  5    IEAAGGGQGNGIRKRSCFCSKEDFLPEESFKSWGNYVHALANTKTRLTDRILARSMDHQE  64

Query  239  L-AAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLS  415
            L   ++RS ++MK+ LNWWDLIWFG+GAV+GAGIFVLTGQ A   AGPAVV+SY +SG+S
Sbjct  65   LEQMRARSNNQMKKTLNWWDLIWFGIGAVMGAGIFVLTGQAARNDAGPAVVISYFISGVS  124

Query  416  AMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYL  595
            A+LSV CYTEF+VE+PVAGGSF+YLRVELGDFVA+IAAGNIL EYV+ GA+VARSWT Y 
Sbjct  125  ALLSVLCYTEFSVELPVAGGSFSYLRVELGDFVAYIAAGNILFEYVVAGASVARSWTSYF  184

Query  596  ATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMV  775
            ATL N +P  F I   AL + +N L PIAV +   +CI A LS K SSR N + +IVH+V
Sbjct  185  ATLCNHNPNDFRINVPALADNFNHLDPIAVVISIVVCIGAALSMKASSRFNSVTTIVHLV  244

Query  776  VIVFI  790
            V+VFI
Sbjct  245  VLVFI  249



>ref|XP_008459518.1| PREDICTED: cationic amino acid transporter 1-like [Cucumis melo]
Length=585

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/234 (70%), Positives = 187/234 (80%), Gaps = 2/234 (1%)
 Frame = +2

Query  71   NGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-  247
            + GSE G+R R C CGKDDFLPEESF+SW NY  AL+ TP RL DR+ +RS D  EL   
Sbjct  9    SNGSE-GIRRRFCGCGKDDFLPEESFQSWENYTKALKATPLRLFDRLTARSADHTELVEM  67

Query  248  KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLS  427
            K+RSQH+MK+ L WWDL+WFG+GAVIGAGIFVLTG E  +HAGPAVVLSY VSG+SAMLS
Sbjct  68   KARSQHQMKKTLTWWDLMWFGVGAVIGAGIFVLTGLETKKHAGPAVVLSYIVSGISAMLS  127

Query  428  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLF  607
            VFCYTEFAVEIP AGGSFAYLRVELGDFVAFIAAGNILLEY+IG AAVAR+WT Y ATL 
Sbjct  128  VFCYTEFAVEIPAAGGSFAYLRVELGDFVAFIAAGNILLEYIIGSAAVARAWTSYFATLC  187

Query  608  NKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVH  769
            N HP  F +  +A  + YN L PIA+ +   I   A++STKGSSRLNY+ASI+H
Sbjct  188  NHHPNDFRVHISAFPDDYNQLDPIAIVIILIIGTFALVSTKGSSRLNYVASILH  241



>ref|XP_008383406.1| PREDICTED: cationic amino acid transporter 1-like [Malus domestica]
Length=614

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 183/228 (80%), Gaps = 2/228 (1%)
 Frame = +2

Query  74   GGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-K  250
            GG + G+R RGC+  ++DFLPEESF+SW NYV+AL QTP R  DRV +RS D  EL   K
Sbjct  6    GGDDEGIRRRGCTYRRNDFLPEESFQSWWNYVHALCQTPGRFVDRVLTRSADSTELVEMK  65

Query  251  SRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSV  430
            +RS +EMK+ LNWWDLIWFG+GAVIGAGIFVLTG EA  HAGPAVVLSY VSG+SA+LSV
Sbjct  66   ARSHNEMKKTLNWWDLIWFGLGAVIGAGIFVLTGLEAKNHAGPAVVLSYVVSGVSALLSV  125

Query  431  FCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFN  610
            FCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT Y  TL N
Sbjct  126  FCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTSYFTTLCN  185

Query  611  K-HPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNY  751
            +     F I A+ L E Y  L PIAV V   IC +A+LSTKGSSRLNY
Sbjct  186  RSDTNDFRIVAHDLPEDYRFLDPIAVVVIIGICCLAVLSTKGSSRLNY  233



>ref|XP_010241177.1| PREDICTED: cationic amino acid transporter 1-like isoform X2 
[Nelumbo nucifera]
Length=553

 Score =   325 bits (834),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/240 (68%), Positives = 191/240 (80%), Gaps = 1/240 (0%)
 Frame = +2

Query  77   GSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKS  253
            G   G+R RGC CGK DFLPEESF+SWGNYV A  +T  RL+DR+ +RSLD+ EL   K+
Sbjct  3    GERKGVRRRGCVCGKGDFLPEESFKSWGNYVKAWSETGMRLKDRILTRSLDETELNEMKA  62

Query  254  RSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVF  433
            RSQ++MK+NL+WWDLIW G+GAVIG GIFVLTGQEA   AGPAVV SY VSG+SAMLSVF
Sbjct  63   RSQNDMKKNLSWWDLIWLGIGAVIGTGIFVLTGQEARYDAGPAVVFSYVVSGISAMLSVF  122

Query  434  CYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNK  613
            CYTEFAVEIP AGGSFAYLRVELGDF+AFIAAGNIL EYVI GAAV+RSWT Y ATL N 
Sbjct  123  CYTEFAVEIPAAGGSFAYLRVELGDFMAFIAAGNILFEYVISGAAVSRSWTSYFATLCNH  182

Query  614  HPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             P+ F I AN L E Y+ L PIAV +   + + A  STK SSR+NY+ASI+H+ +I+F+I
Sbjct  183  KPDEFRIIANGLAEDYSRLDPIAVVIIAIVAVFASRSTKASSRVNYVASIIHVCIILFVI  242



>ref|XP_006664195.1| PREDICTED: cationic amino acid transporter 1-like [Oryza brachyantha]
Length=590

 Score =   327 bits (837),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 164/239 (69%), Positives = 188/239 (79%), Gaps = 2/239 (1%)
 Frame = +2

Query  80   SESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSR  256
            ++  +R RGC CG   F PEESF SWG Y  AL +T  RLRDRV +RS D VEL   +  
Sbjct  3    ADGEVRRRGC-CGGGAFFPEESFASWGAYGRALMETGPRLRDRVTARSADAVELHEVRGW  61

Query  257  SQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFC  436
            S  +M+R L WWDLIWFG+GAVIGAGIFVLTGQEA + AGPAVVLSY VSG+SAMLSVFC
Sbjct  62   SGAKMRRTLTWWDLIWFGVGAVIGAGIFVLTGQEAKEAAGPAVVLSYAVSGVSAMLSVFC  121

Query  437  YTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKH  616
            YTEFA+EIPVAGGSFAYLRVELGDF+AFIAAGNILLEY IGGAAVARSWT Y ATL N H
Sbjct  122  YTEFAIEIPVAGGSFAYLRVELGDFMAFIAAGNILLEYCIGGAAVARSWTSYFATLLNHH  181

Query  617  PESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            P  F I A +L + Y+ L P+AV V   IC++A+LSTKGSSR NY+ SI+H+ VI+FII
Sbjct  182  PNDFRIHAASLSDDYSRLDPVAVAVIVLICLLAVLSTKGSSRFNYVLSILHLAVILFII  240



>ref|XP_008372219.1| PREDICTED: cationic amino acid transporter 1-like [Malus domestica]
Length=614

 Score =   327 bits (837),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 179/225 (80%), Gaps = 2/225 (1%)
 Frame = +2

Query  92   MRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-AKSRSQHE  268
            +R RGC+  KDDFLPEESF+SWGNYVNAL++TP R  DRV SRS D  EL   K+RS HE
Sbjct  12   IRRRGCTYRKDDFLPEESFQSWGNYVNALKKTPFRFVDRVLSRSADSTELVEVKARSHHE  71

Query  269  MKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEF  448
            MK+ LNWWDLIWFG+G VIGAGIF LTG EA +HAG A+VLSY VSG+SAMLSVFCYTEF
Sbjct  72   MKKKLNWWDLIWFGIGVVIGAGIFALTGLEARRHAGAAIVLSYVVSGVSAMLSVFCYTEF  131

Query  449  AVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNK-HPES  625
            AVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVI GAAVARSWT Y  TL N+     
Sbjct  132  AVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVISGAAVARSWTSYFTTLCNRSDTND  191

Query  626  FLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
            F I A+   E Y  L PIAV V   IC +A+LS KGSSRLNYIAS
Sbjct  192  FRIIAHGFPEDYKYLDPIAVAVLICICCLAVLSIKGSSRLNYIAS  236



>ref|XP_010241176.1| PREDICTED: cationic amino acid transporter 1-like isoform X1 
[Nelumbo nucifera]
Length=605

 Score =   326 bits (836),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 163/240 (68%), Positives = 191/240 (80%), Gaps = 1/240 (0%)
 Frame = +2

Query  77   GSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKS  253
            G   G+R RGC CGK DFLPEESF+SWGNYV A  +T  RL+DR+ +RSLD+ EL   K+
Sbjct  3    GERKGVRRRGCVCGKGDFLPEESFKSWGNYVKAWSETGMRLKDRILTRSLDETELNEMKA  62

Query  254  RSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVF  433
            RSQ++MK+NL+WWDLIW G+GAVIG GIFVLTGQEA   AGPAVV SY VSG+SAMLSVF
Sbjct  63   RSQNDMKKNLSWWDLIWLGIGAVIGTGIFVLTGQEARYDAGPAVVFSYVVSGISAMLSVF  122

Query  434  CYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNK  613
            CYTEFAVEIP AGGSFAYLRVELGDF+AFIAAGNIL EYVI GAAV+RSWT Y ATL N 
Sbjct  123  CYTEFAVEIPAAGGSFAYLRVELGDFMAFIAAGNILFEYVISGAAVSRSWTSYFATLCNH  182

Query  614  HPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             P+ F I AN L E Y+ L PIAV +   + + A  STK SSR+NY+ASI+H+ +I+F+I
Sbjct  183  KPDEFRIIANGLAEDYSRLDPIAVVIIAIVAVFASRSTKASSRVNYVASIIHVCIILFVI  242



>ref|XP_010941816.1| PREDICTED: cationic amino acid transporter 1-like [Elaeis guineensis]
Length=589

 Score =   325 bits (832),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/235 (66%), Positives = 187/235 (80%), Gaps = 2/235 (1%)
 Frame = +2

Query  95   RIRGC-SCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHE  268
            + RGC SC K DFLPEESF+SW NY  ALR+T  RL DR+ +RSLD+ EL   ++RS HE
Sbjct  15   KPRGCYSCSKKDFLPEESFQSWANYGRALRETGKRLGDRITARSLDRTELNEVRARSGHE  74

Query  269  MKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEF  448
            M+RNL+WWDL+WFG+  V+GAGIFVLTGQEA+  AGPAVVLSY VSG++AMLSV CYTEF
Sbjct  75   MRRNLSWWDLMWFGVSCVVGAGIFVLTGQEAHDAAGPAVVLSYVVSGVAAMLSVLCYTEF  134

Query  449  AVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESF  628
            AVEIPVAGGSFAYLRVELGDF+AFIAAGNILLEY++  AAVAR+WT Y ATL N HP+ F
Sbjct  135  AVEIPVAGGSFAYLRVELGDFIAFIAAGNILLEYIVSCAAVARAWTSYFATLLNHHPDDF  194

Query  629  LIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             I   +L   YN L PIAV V   + + AILSTK +SR NY+A I+H+ ++VFI+
Sbjct  195  RIHIPSLSPDYNRLDPIAVAVTATVGLAAILSTKAASRFNYVACIIHLTIVVFIV  249



>ref|XP_009362248.1| PREDICTED: cationic amino acid transporter 1-like [Pyrus x bretschneideri]
Length=600

 Score =   324 bits (831),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/234 (65%), Positives = 187/234 (80%), Gaps = 1/234 (0%)
 Frame = +2

Query  92   MRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHE  268
            ++ R C C KDDFLPEESF+SWGNYV+AL  T  RL+DR+ +RSLD  E+   ++RSQ++
Sbjct  19   IKRRSCICSKDDFLPEESFKSWGNYVHALSSTKTRLKDRLLARSLDHQEVEEIRARSQNQ  78

Query  269  MKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEF  448
            MK+ LNWWDLIWFG+GAV+G+GIFVLTGQEA  HAGPA+V+SY +SG+SAMLSV CYTEF
Sbjct  79   MKKTLNWWDLIWFGIGAVMGSGIFVLTGQEARNHAGPAIVISYFISGVSAMLSVLCYTEF  138

Query  449  AVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESF  628
            AVE+PVAGGSF+YLRVELGDFVA+IAAGN+L EY+I GA+VARSWT Y ATL N  P  F
Sbjct  139  AVELPVAGGSFSYLRVELGDFVAYIAAGNLLFEYIISGASVARSWTSYFATLCNHSPNDF  198

Query  629  LIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFI  790
             I A++L + +N L PIAV +   +C  A LS K SSR N + SI H+VV++FI
Sbjct  199  RITASSLSDNFNHLDPIAVFISILVCFGAALSMKASSRFNSVMSITHLVVLIFI  252



>ref|XP_008372218.1| PREDICTED: cationic amino acid transporter 1-like [Malus domestica]
Length=599

 Score =   323 bits (829),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 188/233 (81%), Gaps = 2/233 (1%)
 Frame = +2

Query  101  RG-CSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMK  274
            RG C C KDDFLPEESF+SWGNYV+AL  T  RL+DR+ +RSLD  E+   ++RSQ++MK
Sbjct  21   RGSCICSKDDFLPEESFKSWGNYVHALXSTKTRLKDRLLARSLDHQEVEEIRARSQNQMK  80

Query  275  RNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAV  454
            + LNWWDLIWFG+GAV+G+GIFVLTGQEA  HAGPA+V+SY +SG+SAMLSV CYTEFAV
Sbjct  81   KTLNWWDLIWFGIGAVMGSGIFVLTGQEARNHAGPAIVISYFISGVSAMLSVLCYTEFAV  140

Query  455  EIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLI  634
            E+PVAGGSF+YLRVELGDFVA+IAAGN+L EY+I GA+VARSWT Y ATL N  P  F I
Sbjct  141  ELPVAGGSFSYLRVELGDFVAYIAAGNLLFEYIISGASVARSWTSYFATLCNHSPNDFRI  200

Query  635  KANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             A++L + +N L PIAV +   +C  A LS K SSR N++ SI H+VV++FI+
Sbjct  201  TASSLADNFNHLDPIAVFISILVCFGAALSMKASSRFNWVMSITHLVVLIFIL  253



>ref|XP_010245195.1| PREDICTED: cationic amino acid transporter 1-like [Nelumbo nucifera]
Length=604

 Score =   323 bits (828),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 153/245 (62%), Positives = 192/245 (78%), Gaps = 3/245 (1%)
 Frame = +2

Query  62   ETKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL  241
            +  N G    ++ RGC C KDDF PEESFRSWG+YV ALR+T  RL+ R F+RSLD++EL
Sbjct  9    DQSNDGD--AIKRRGCRCSKDDFFPEESFRSWGSYVKALRETVPRLKSRAFARSLDEIEL  66

Query  242  -AAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSA  418
               ++RSQ+E+K++L+WWDLIWFG+ AV+GAG+FVLTG EA   AGPAV+LS+ VSG+SA
Sbjct  67   NQVRARSQNELKKSLSWWDLIWFGVSAVMGAGVFVLTGLEARNDAGPAVILSFVVSGISA  126

Query  419  MLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLA  598
            MLSVFCYTEFAVEIPVAGGSFAYLRVELGDF AFIAAGNILLEY++ GA VARSWT Y A
Sbjct  127  MLSVFCYTEFAVEIPVAGGSFAYLRVELGDFAAFIAAGNILLEYIVAGAGVARSWTSYFA  186

Query  599  TLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVV  778
            TL N  P+ F I  + L++ YN L PI+V +  A+ ++A +S KGSS  N +AS++H+ V
Sbjct  187  TLCNHEPDDFRIVVSGLNKNYNHLDPISVAISAAVGVMAAISIKGSSHFNVVASVIHIAV  246

Query  779  IVFII  793
            +  II
Sbjct  247  LFLII  251



>gb|EPS73601.1| cationic amino acid transporter, partial [Genlisea aurea]
Length=563

 Score =   322 bits (824),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 189/228 (83%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   GSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAAKSR  256
            G  S  R RGC C KD+F PEESF+SWGNY  A+R+TPARL +RV +RS  + E+  +SR
Sbjct  1    GGGSLTRRRGCFCTKDEFFPEESFQSWGNYARAMRETPARLMNRVLTRSSVEAEVEVRSR  60

Query  257  SQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFC  436
            S++E+KR L+WWDL+WFGMGAVIGAGIFVLTGQEA+Q AGPAVVLSY VSG+SA+LSVFC
Sbjct  61   SENELKRKLSWWDLMWFGMGAVIGAGIFVLTGQEASQAAGPAVVLSYVVSGISALLSVFC  120

Query  437  YTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKH  616
            YTEFAVEIPVAGGSFAYLRVELG+FVAFIAAGNILLEYVIGGAAVARSWT Y ATL N  
Sbjct  121  YTEFAVEIPVAGGSFAYLRVELGEFVAFIAAGNILLEYVIGGAAVARSWTSYFATLCNHQ  180

Query  617  PESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
            P  F I A+ L  GY+ L P+AVGV   IC+I +LSTK SSRLNY+AS
Sbjct  181  PNDFRIHAHGLASGYDELDPVAVGVIIIICVITVLSTKASSRLNYVAS  228



>ref|XP_003630015.1| High affinity cationic amino acid transporter [Medicago truncatula]
 gb|AET04491.1| cationic amino acid transporter-like protein [Medicago truncatula]
Length=604

 Score =   323 bits (827),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 186/234 (79%), Gaps = 1/234 (0%)
 Frame = +2

Query  95   RIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEM  271
            R RGC+  K+DF PEESF+SW NY  ++ +TP RL+DR+  RS D  EL   K+RS +EM
Sbjct  13   RRRGCTFQKNDFFPEESFKSWENYGKSVMETPYRLKDRLLKRSSDHAELVEIKARSGNEM  72

Query  272  KRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFA  451
            K+ LNWWDL+WFGMGAVIG+GIFVLTG EA Q AGPAVVLS+ +SG+SA+LSVFCYTEFA
Sbjct  73   KKTLNWWDLMWFGMGAVIGSGIFVLTGLEARQEAGPAVVLSFVISGISALLSVFCYTEFA  132

Query  452  VEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFL  631
            VEIPVAGGSFAYLRVELGDFVAFIAAGNIL EY+IG AAVARSWT Y ATL NK+P+ F 
Sbjct  133  VEIPVAGGSFAYLRVELGDFVAFIAAGNILFEYIIGNAAVARSWTSYFATLCNKNPDDFR  192

Query  632  IKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            I  + ++  Y  L PIA+    AI  +A+ STKGSS  NYIA+++HM VI+FI+
Sbjct  193  IIVHNMNPDYGHLDPIAIAALVAITALAVYSTKGSSIFNYIATLLHMAVIIFIV  246



>ref|XP_002443551.1| hypothetical protein SORBIDRAFT_08g021380 [Sorghum bicolor]
 gb|EES17389.1| hypothetical protein SORBIDRAFT_08g021380 [Sorghum bicolor]
Length=598

 Score =   322 bits (826),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 182/223 (82%), Gaps = 1/223 (0%)
 Frame = +2

Query  128  FLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKRNLNWWDLIW  304
              PEESFRSW  Y  AL +T  RLRDR+ +RSLD  E+   + RS  +M+RNL WWDLIW
Sbjct  22   LFPEESFRSWSAYGRALLETGPRLRDRLTARSLDATEVNEVRGRSGADMRRNLTWWDLIW  81

Query  305  FGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGGSFA  484
            FG+GAVIGAGIFVLTGQEA + AGPAVV+SY +SG+SAML+VFCYTEFA+EIPVAGGSFA
Sbjct  82   FGIGAVIGAGIFVLTGQEAKEAAGPAVVVSYAISGVSAMLAVFCYTEFAIEIPVAGGSFA  141

Query  485  YLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHEGYN  664
            YLRVELGDF+AFIAAGNI+LEY IGGAAVARSWT Y ATL N HP+ F + A AL EGY+
Sbjct  142  YLRVELGDFMAFIAAGNIILEYCIGGAAVARSWTSYFATLLNHHPDDFRVHAAALAEGYS  201

Query  665  LLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             L PIAV V  AIC +A+LSTKGSSR NY+ SI+H+VVI FI+
Sbjct  202  ELDPIAVAVTAAICALAVLSTKGSSRFNYVLSILHLVVIAFIV  244



>ref|XP_007159614.1| hypothetical protein PHAVU_002G252100g [Phaseolus vulgaris]
 gb|ESW31608.1| hypothetical protein PHAVU_002G252100g [Phaseolus vulgaris]
Length=602

 Score =   321 bits (823),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 158/244 (65%), Positives = 189/244 (77%), Gaps = 4/244 (2%)
 Frame = +2

Query  74   GGSES---GMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA  244
            GG ++   G+R RG +  ++DF PEESF+SW NY  A+  TP RL+DRV SRS D  E+ 
Sbjct  2    GGEDAIHGGVRRRGLTFRRNDFFPEESFKSWENYARAIMDTPWRLKDRVLSRSEDHTEIV  61

Query  245  A-KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAM  421
              K+RS HEMK+ LNWWDL+WFG+GAVIG+GIFVLTG EA    GPAVVLSY VSG+SA+
Sbjct  62   EMKARSSHEMKKTLNWWDLMWFGIGAVIGSGIFVLTGLEARTEVGPAVVLSYVVSGVSAL  121

Query  422  LSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLAT  601
             SVFCYTEFAVEIPVAGGSFAYLRVELG+FVAFIAAGNILLEYV+ GAAVARSWT Y AT
Sbjct  122  FSVFCYTEFAVEIPVAGGSFAYLRVELGEFVAFIAAGNILLEYVVSGAAVARSWTSYFAT  181

Query  602  LFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVI  781
            L   HP+ F I  + ++  Y  L PI++GV  AI I+A+ STKGSS  N+IA+I H++VI
Sbjct  182  LCGHHPDDFRIVVHKMNPDYGHLDPISIGVLIAITILAVYSTKGSSIFNFIATIFHLIVI  241

Query  782  VFII  793
             FII
Sbjct  242  AFII  245



>ref|XP_007041135.1| Amino acid transporter 1 [Theobroma cacao]
 gb|EOX96966.1| Amino acid transporter 1 [Theobroma cacao]
Length=590

 Score =   321 bits (822),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/249 (61%), Positives = 195/249 (78%), Gaps = 2/249 (1%)
 Frame = +2

Query  53   MEVETKNG-GSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLD  229
            M +ET  G G+ + ++ R C C K DFLPE+SF+SW +YVNAL  T +RL+DR+ +RS+D
Sbjct  1    MAIETNVGDGNGNDLKKRRCGCSKQDFLPEDSFQSWTSYVNALSNTKSRLKDRLLARSMD  60

Query  230  QVEL-AAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVS  406
             VEL   ++RSQHEMK+ L WWDLIWFGMGAV+G+GIFVLTG+ A  H+GPAVV+SY +S
Sbjct  61   HVELHEMRARSQHEMKKTLTWWDLIWFGMGAVMGSGIFVLTGEAARNHSGPAVVVSYFIS  120

Query  407  GLSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT  586
            G++A+LSV CYTEFA+E+PVAGGSF YLRVELGDF+A+++AGNIL EYV+ GA+VARSWT
Sbjct  121  GITALLSVLCYTEFAIELPVAGGSFTYLRVELGDFIAYVSAGNILFEYVVAGASVARSWT  180

Query  587  YYLATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIV  766
             YLATLFN  P+SF    ++  E Y+ L PIAV +   I I A +S KGS+R N  A+IV
Sbjct  181  SYLATLFNHAPDSFRFHVSSFSEHYSHLDPIAVAISVVIGIAAGISMKGSARFNSAATIV  240

Query  767  HMVVIVFII  793
             +VVI+FI+
Sbjct  241  QLVVILFIL  249



>ref|XP_004964213.1| PREDICTED: cationic amino acid transporter 1-like [Setaria italica]
Length=596

 Score =   321 bits (822),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 177/224 (79%), Gaps = 1/224 (0%)
 Frame = +2

Query  125  DFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKRNLNWWDLI  301
               PEESFRSW  Y  AL +T  RLRDRV +RSLD  E+   + RS  +MKR L WWDLI
Sbjct  24   SLFPEESFRSWSAYGRALLETGPRLRDRVTARSLDSAEVNEVRGRSGADMKRTLTWWDLI  83

Query  302  WFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGGSF  481
            WFG+GAVIG+GIFVLTGQEA + AGPAVV+SY VSG+SAMLSVFCYTEFAVEIPVAGGSF
Sbjct  84   WFGIGAVIGSGIFVLTGQEAKEAAGPAVVVSYAVSGVSAMLSVFCYTEFAVEIPVAGGSF  143

Query  482  AYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHEGY  661
            AYLRVELGDF+AFIAAGNILLEY IGGAAVARSWT Y ATL N HP  F I A +L + Y
Sbjct  144  AYLRVELGDFMAFIAAGNILLEYCIGGAAVARSWTSYFATLLNHHPNDFRIHATSLADDY  203

Query  662  NLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            + L PIAV V   IC+ A+LSTKGSSR NYI SIVH+ VI FI+
Sbjct  204  SRLDPIAVAVVLLICLFAVLSTKGSSRFNYILSIVHLAVIAFIV  247



>ref|XP_010276879.1| PREDICTED: cationic amino acid transporter 1-like [Nelumbo nucifera]
Length=563

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 188/232 (81%), Gaps = 1/232 (0%)
 Frame = +2

Query  101  RGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKR  277
            RGC C KDDF PEESFR+WG+YV AL +T ARL+DR+F+RSLD +EL   ++RSQHEMK+
Sbjct  23   RGCWCSKDDFFPEESFRNWGSYVKALGETKARLKDRLFARSLDDIELNQVRARSQHEMKK  82

Query  278  NLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVE  457
            +L+WWDLIWFG+ +V+GAGIFVLTG EA   AGPAVV+S+ VSG+SA+LSVFCYTEFAV+
Sbjct  83   SLSWWDLIWFGVSSVMGAGIFVLTGLEARNDAGPAVVISFVVSGISALLSVFCYTEFAVD  142

Query  458  IPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIK  637
            IPVAGGSFAYLRVELGDF A+IAAGNIL EY++ GA VARSWT Y ATL N  P+ F I 
Sbjct  143  IPVAGGSFAYLRVELGDFAAYIAAGNILFEYIVAGAGVARSWTSYFATLCNHEPDDFRIV  202

Query  638  ANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             + L++ YN L PI+V +   + ++A +STKGSS  N +AS++H+ V++ I+
Sbjct  203  VSGLNKNYNHLDPISVVISAIVAVLASVSTKGSSVFNVVASVIHIAVLLLIV  254



>ref|XP_006580236.1| PREDICTED: cationic amino acid transporter 1-like [Glycine max]
Length=600

 Score =   319 bits (817),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/246 (65%), Positives = 190/246 (77%), Gaps = 2/246 (1%)
 Frame = +2

Query  59   VETKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVE  238
            +ET+ GGS    R RGC+  K+DF PEESF+SWGNY  ALR+TP R +DRV +RS D+ E
Sbjct  1    METEEGGSRGAKR-RGCTFQKNDFFPEESFKSWGNYGKALRETPWRFKDRVMTRSKDETE  59

Query  239  LAA-KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLS  415
            +   K RS +EMK+ LN WDLIWFG+GAVIG+GIFV+TG EA + AGPAVVLSY  SG+S
Sbjct  60   VVEMKGRSGNEMKKTLNSWDLIWFGIGAVIGSGIFVITGLEAREVAGPAVVLSYVASGIS  119

Query  416  AMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYL  595
            A+LSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAF+AAGNILLEYVIGGA ++RSWT Y 
Sbjct  120  ALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFMAAGNILLEYVIGGATISRSWTSYF  179

Query  596  ATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMV  775
            ATL N HP+ F I    ++  Y  L PIAV    AI  +A+ STK SS  N IA+I+H +
Sbjct  180  ATLCNHHPDEFRIIVPNMNPDYGHLDPIAVVALIAIATLAMCSTKASSLFNNIATILHCL  239

Query  776  VIVFII  793
            VIVF+I
Sbjct  240  VIVFVI  245



>ref|XP_003630016.1| Cationic amino acid transporter [Medicago truncatula]
Length=610

 Score =   318 bits (815),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 152/230 (66%), Positives = 184/230 (80%), Gaps = 1/230 (0%)
 Frame = +2

Query  107  CSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNL  283
            C+   +DF PEESF+SW NY  ++ +TP RL+DR+  RS D  EL   K+RS +EMK+ L
Sbjct  18   CTFQTNDFFPEESFKSWENYGKSVMETPYRLKDRLLKRSSDHAELVEIKARSGNEMKKTL  77

Query  284  NWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIP  463
            NWWDL+WFG+GAV+G+GIFVLTG EA QHAGPAVVLS+ +SG+SA+LSVFCYTEFAVEIP
Sbjct  78   NWWDLMWFGIGAVVGSGIFVLTGLEAKQHAGPAVVLSFVISGISALLSVFCYTEFAVEIP  137

Query  464  VAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKAN  643
            VAGGSFAYLRVE+GDFVAFIAAGNILLEYVIG AAVARSWT Y ATL NK+P+ F I  +
Sbjct  138  VAGGSFAYLRVEMGDFVAFIAAGNILLEYVIGNAAVARSWTSYFATLCNKNPDDFRIIVH  197

Query  644  ALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             ++  Y  L PIA+G   AI  +A+ STKGSS  NYIA++ HM VI+FI+
Sbjct  198  NMNPDYGHLDPIAIGALVAITALAVYSTKGSSIFNYIATMFHMAVIIFIV  247



>gb|KJB15136.1| hypothetical protein B456_002G162700 [Gossypium raimondii]
 gb|KJB15137.1| hypothetical protein B456_002G162700 [Gossypium raimondii]
 gb|KJB15138.1| hypothetical protein B456_002G162700 [Gossypium raimondii]
 gb|KJB15139.1| hypothetical protein B456_002G162700 [Gossypium raimondii]
Length=592

 Score =   317 bits (811),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 185/235 (79%), Gaps = 1/235 (0%)
 Frame = +2

Query  68   KNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA  247
            + G +E+G + RGC C K DFLPEESF+S  +Y+NAL  T +RLRDR+ +RS D +EL  
Sbjct  2    EGGENENGGKKRGCGCSKQDFLPEESFQSCRSYLNALCNTKSRLRDRLLARSADHMELHE  61

Query  248  -KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAML  424
             + RSQHEMK+ LNWWD+IWFG+GAV+G+GIFVLTG+ A  H+GPAVV+SY +SG++A+L
Sbjct  62   IRGRSQHEMKKRLNWWDIIWFGIGAVMGSGIFVLTGEAARNHSGPAVVVSYLISGMTALL  121

Query  425  SVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATL  604
            SV CYTEF VE+PVAGGSF YLRVELGDFVA+IAAGNIL EYV+ GA+VARSWT YLATL
Sbjct  122  SVLCYTEFCVELPVAGGSFTYLRVELGDFVAYIAAGNILFEYVVAGASVARSWTSYLATL  181

Query  605  FNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVH  769
            FN  P SF   A++  E Y+ L PIA  V   ICI A +STKGSSR N IA+IVH
Sbjct  182  FNHDPNSFRFHASSFPEDYSHLDPIAAVVSLLICIAACMSTKGSSRFNSIATIVH  236



>dbj|BAJ85357.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92098.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score =   316 bits (810),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 170/248 (69%), Positives = 192/248 (77%), Gaps = 4/248 (2%)
 Frame = +2

Query  53   MEVETKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQ  232
            M V  + GG   G+R RGC+CGK DF PEESF SW  Y  ALR T  RL DR+ SRSL+ 
Sbjct  1    MAVGAEAGG---GVRRRGCTCGKADFFPEESFSSWAAYGRALRSTGPRLADRLTSRSLEA  57

Query  233  VEL-AAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSG  409
             EL   ++RS  +MKR+L WWDL WFG+GAVIGAGIFVLTGQEA + AGPAVV+SY VSG
Sbjct  58   TELHEVRARSGADMKRDLTWWDLAWFGVGAVIGAGIFVLTGQEAKEVAGPAVVVSYVVSG  117

Query  410  LSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTY  589
            +SAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDF+AF+AAGNILLEY IGGAAVAR+WT 
Sbjct  118  VSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAFVAAGNILLEYCIGGAAVARAWTS  177

Query  590  YLATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVH  769
            Y ATL N  P  F I A+AL+  Y+ L PIAV V   IC  A+LSTKGSSR NY+ SIVH
Sbjct  178  YFATLLNHQPSDFRIHASALYADYSELDPIAVVVITLICAFAVLSTKGSSRFNYLLSIVH  237

Query  770  MVVIVFII  793
            + VI FII
Sbjct  238  IAVIAFII  245



>ref|XP_008225625.1| PREDICTED: cationic amino acid transporter 1-like [Prunus mume]
Length=597

 Score =   315 bits (807),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 181/231 (78%), Gaps = 1/231 (0%)
 Frame = +2

Query  101  RGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKR  277
            R C C K+DFLPEESF+SWGNYV+AL  T  RL DR+ +RS+D  EL   ++RS ++MK+
Sbjct  19   RSCFCSKEDFLPEESFKSWGNYVHALANTKTRLTDRILARSMDHQELEQMRARSHNQMKK  78

Query  278  NLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVE  457
             LNWWDLIWFG+GAV+GAGIFVLTGQ A   AGPAVV+SY +SG+S +LSV CYTEF+VE
Sbjct  79   TLNWWDLIWFGIGAVMGAGIFVLTGQAARNDAGPAVVISYFISGVSELLSVLCYTEFSVE  138

Query  458  IPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIK  637
            +PVAGGSF+YLRVELGDFVA+IAAGNIL EYV+ GA+VARSWT Y ATL N +P  F I 
Sbjct  139  LPVAGGSFSYLRVELGDFVAYIAAGNILFEYVVAGASVARSWTSYFATLCNHNPNDFRIN  198

Query  638  ANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFI  790
              AL + +N L PIAV +   +CI A LS K SSR N + +IVH+VV+VFI
Sbjct  199  VPALADNFNHLDPIAVVISILVCIGAALSMKASSRFNSVTTIVHLVVLVFI  249



>ref|XP_010687039.1| PREDICTED: cationic amino acid transporter 1-like [Beta vulgaris 
subsp. vulgaris]
Length=621

 Score =   316 bits (809),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 187/224 (83%), Gaps = 1/224 (0%)
 Frame = +2

Query  92   MRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHE  268
            MR R   C KDDFLPE+SF+SW NY+ AL+ TPAR ++R+ +RSLD  EL   K++S HE
Sbjct  21   MRRRSRGCTKDDFLPEKSFQSWSNYMTALKDTPARFKNRLLTRSLDDTELHQVKAQSHHE  80

Query  269  MKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEF  448
            MKR+L+WWDLIWFG+GAVIGAGIFVLTGQEANQHAG AVVLSY +SG+SAMLSVFCYTEF
Sbjct  81   MKRSLSWWDLIWFGVGAVIGAGIFVLTGQEANQHAGSAVVLSYAISGVSAMLSVFCYTEF  140

Query  449  AVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESF  628
            AVEIPVAGGSFAYLRVELGDF+AFIAAGNI+LEYVI GAAVARSWT Y ATL N+ P++F
Sbjct  141  AVEIPVAGGSFAYLRVELGDFMAFIAAGNIILEYVISGAAVARSWTSYFATLCNQEPQTF  200

Query  629  LIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
             I A+ L   Y+ L PIAV V   ICI+++ S KGSSRLNY++S
Sbjct  201  RITAHNLSPDYSHLDPIAVVVIIVICIVSVYSVKGSSRLNYVSS  244



>ref|XP_006836311.1| PREDICTED: cationic amino acid transporter 1 [Amborella trichopoda]
 ref|XP_011620764.1| PREDICTED: cationic amino acid transporter 1 [Amborella trichopoda]
 gb|ERM99164.1| hypothetical protein AMTR_s00092p00049320 [Amborella trichopoda]
Length=592

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 188/230 (82%), Gaps = 2/230 (1%)
 Frame = +2

Query  74   GGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAK  250
            G     +R RGC+C K+DFLPEESF+SWGNY  +L +   RL+DR+ +RSLD+ EL   +
Sbjct  5    GDRPQVLRRRGCTCTKEDFLPEESFKSWGNYTRSLSEMWPRLKDRILTRSLDETELNEIR  64

Query  251  SRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSV  430
            +RS +EMK+NL WWDL+WFG+GAVIGAGIFVLTG+EA Q AGPAVVLSY VSG+SAML+V
Sbjct  65   ARSHNEMKKNLKWWDLMWFGIGAVIGAGIFVLTGREAKQGAGPAVVLSYVVSGISAMLAV  124

Query  431  FCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFN  610
            FCYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNILLEYVIGGAAVAR+WT Y ATL N
Sbjct  125  FCYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNILLEYVIGGAAVARAWTSYFATLLN  184

Query  611  KHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
             HP+ F I  N L   YN L PIAV V   +CI+A+LSTKG+SR NYIAS
Sbjct  185  HHPDDFRIITN-LAPDYNKLDPIAVVVLIIVCIVAVLSTKGTSRFNYIAS  233



>ref|XP_004295609.2| PREDICTED: cationic amino acid transporter 1-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011460654.1| PREDICTED: cationic amino acid transporter 1-like [Fragaria vesca 
subsp. vesca]
Length=604

 Score =   315 bits (806),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/230 (66%), Positives = 184/230 (80%), Gaps = 1/230 (0%)
 Frame = +2

Query  107  CSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNL  283
            C C K+DFLPEESF++WGNYV+AL     RL+DR+ +RSLD+ EL   ++RS++EMK+ L
Sbjct  27   CICSKEDFLPEESFKNWGNYVHALASIKTRLKDRLLARSLDRHELEEMRARSENEMKKTL  86

Query  284  NWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIP  463
            NWWDLIWFG+GAV+GAGIFVLTG+ A   AGPAVV+SY +SG+SA+LSV CYTEFAVE+P
Sbjct  87   NWWDLIWFGIGAVMGAGIFVLTGEAARDLAGPAVVISYLISGVSALLSVLCYTEFAVELP  146

Query  464  VAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKAN  643
            VAGGSFAYLRVELGDF+A+IAAGNIL EY++ GA+VARSWT Y ATL N  P  F I A+
Sbjct  147  VAGGSFAYLRVELGDFMAYIAAGNILFEYIVAGASVARSWTSYFATLCNHSPNDFRIYAH  206

Query  644  ALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            +L E YN L PIAV V F  C+ A  S K SSR N I SI+H+VV+VFI+
Sbjct  207  SLAENYNQLDPIAVFVSFVACVGAAWSIKASSRFNSITSIIHLVVLVFIL  256



>ref|NP_001050746.1| Os03g0641200 [Oryza sativa Japonica Group]
 dbj|BAF12660.1| Os03g0641200 [Oryza sativa Japonica Group]
 gb|EAY91164.1| hypothetical protein OsI_12773 [Oryza sativa Indica Group]
 gb|EAZ27904.1| hypothetical protein OsJ_11862 [Oryza sativa Japonica Group]
Length=593

 Score =   313 bits (802),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/226 (69%), Positives = 178/226 (79%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKRNLNWWD  295
            K+DF PEESF SW  Y  ALR T ARL DR+ +RSLD  EL   ++RS  +MKR+L WWD
Sbjct  20   KEDFFPEESFSSWEAYGRALRSTGARLADRLTARSLDATELHEVRARSGADMKRDLTWWD  79

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG+GAVIGAGIFVLTGQEA    GPAVV+SY VSG+SAMLSVFCYTEFAVEIPVAGG
Sbjct  80   LAWFGVGAVIGAGIFVLTGQEARNAVGPAVVISYVVSGVSAMLSVFCYTEFAVEIPVAGG  139

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLRVELGDF+AF+AAGNILLEY IGGAAVAR+WT Y ATL N HP  F I A +L  
Sbjct  140  SFAYLRVELGDFMAFVAAGNILLEYCIGGAAVARAWTSYFATLLNHHPNDFRIHAASLAA  199

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             Y+ L PIAV V   IC++++LSTK SSR NY+ S++H+ VI FII
Sbjct  200  DYSRLDPIAVAVIAIICLLSVLSTKASSRFNYVLSVLHVAVIAFII  245



>ref|XP_003535010.1| PREDICTED: cationic amino acid transporter 1-like [Glycine max]
Length=594

 Score =   313 bits (802),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 159/237 (67%), Positives = 185/237 (78%), Gaps = 3/237 (1%)
 Frame = +2

Query  59   VETKNGGSESGM--RIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQ  232
            + T   G E G+  R +GC+  K+DFLPEESF SWG+Y  AL +TP RL+DR+ +RS + 
Sbjct  1    MRTSEEGREGGVMRRRKGCTFQKNDFLPEESFGSWGSYGRALMETPRRLKDRILTRSNES  60

Query  233  VELAA-KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSG  409
             E+   ++RS H+MK+ LNWWDL+W G+GAVIGAGIFVLTG EA + AGPAVVLSY VSG
Sbjct  61   AEVGEMRARSSHQMKKTLNWWDLMWLGIGAVIGAGIFVLTGIEAREVAGPAVVLSYVVSG  120

Query  410  LSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTY  589
             SAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVI  AAV+RSWT 
Sbjct  121  FSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVISCAAVSRSWTS  180

Query  590  YLATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
            Y ATL NK+P+ F I  + ++  YN   PIAV V  AICI+AI STKGSS  NYIAS
Sbjct  181  YFATLCNKNPDDFRIVVHNMNPNYNHFDPIAVIVLAAICILAIYSTKGSSIFNYIAS  237



>gb|KDP34945.1| hypothetical protein JCGZ_09233 [Jatropha curcas]
Length=595

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/239 (64%), Positives = 186/239 (78%), Gaps = 1/239 (0%)
 Frame = +2

Query  80   SESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSR  256
            +  G++ RGC C KDDFLPEESF++W NYV AL  T  RL+DR+ SRS D +EL   + R
Sbjct  16   NSDGLKKRGCGCRKDDFLPEESFKNWRNYVKALSSTKERLKDRILSRSKDSLELDVMRGR  75

Query  257  SQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFC  436
            S HEMK+ LNWWD+IWFG+GAV+GAG+FVLTG+ A   AGPAV+LSY +SG+SA+LSV C
Sbjct  76   SDHEMKKTLNWWDIIWFGIGAVMGAGVFVLTGEAARNDAGPAVILSYLISGISALLSVLC  135

Query  437  YTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKH  616
            Y+EFA E+PVAGGSFAYLRVELGDF+A+IAAGNIL EY++ GA VARSWT Y ATL N  
Sbjct  136  YSEFAAELPVAGGSFAYLRVELGDFIAYIAAGNILFEYIVSGAGVARSWTSYFATLCNHD  195

Query  617  PESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            P SF I   +L E YN L PI+V +   ICI A LSTKGSSR N IA++VH++V+ FI+
Sbjct  196  PNSFRIHVTSLAENYNYLDPISVVISIIICIGACLSTKGSSRFNSIATMVHLLVLSFIL  254



>gb|EMT33624.1| High affinity cationic amino acid transporter 1 [Aegilops tauschii]
Length=595

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 167/248 (67%), Positives = 190/248 (77%), Gaps = 4/248 (2%)
 Frame = +2

Query  53   MEVETKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQ  232
            M V  + GG   G+R RGC+C K DF PEESF SW  Y  ALR T  RL DR+ SRSL+ 
Sbjct  1    MAVGAEAGG---GVRRRGCACAKADFFPEESFSSWAAYGRALRSTAPRLADRLTSRSLEA  57

Query  233  VEL-AAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSG  409
             EL   ++RS  +MKR+L WWDL WFG+GAVIGAGIFVLTGQEA + AGPAVV+SY VSG
Sbjct  58   TELHEVRARSGADMKRDLTWWDLAWFGVGAVIGAGIFVLTGQEAKEVAGPAVVVSYVVSG  117

Query  410  LSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTY  589
            +SAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDF+AF+AAGNILLEY IGGAAVAR+WT 
Sbjct  118  VSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAFVAAGNILLEYCIGGAAVARAWTS  177

Query  590  YLATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVH  769
            Y ATL N  P  F I A AL   Y+ L PIAV V   IC +A+LSTKGSSR NY+ SI+H
Sbjct  178  YFATLLNHQPSDFRIHAPALSPHYSELDPIAVVVITLICALAVLSTKGSSRFNYLLSILH  237

Query  770  MVVIVFII  793
            + V+ FII
Sbjct  238  LAVVAFII  245



>ref|XP_002464178.1| hypothetical protein SORBIDRAFT_01g013690 [Sorghum bicolor]
 gb|EER91176.1| hypothetical protein SORBIDRAFT_01g013690 [Sorghum bicolor]
Length=595

 Score =   311 bits (796),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 174/230 (76%), Gaps = 1/230 (0%)
 Frame = +2

Query  74   GGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAK  250
            GG     R RGCSC K DF PEESF SW  Y  ALR T +RL DRV SRSL+  EL   +
Sbjct  4    GGEGVRQRQRGCSCTKADFFPEESFSSWSAYGRALRSTVSRLADRVTSRSLETTELHEVR  63

Query  251  SRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSV  430
            +RS  +MKR+L WWDL WFG+GAVIGAGIFVLTGQEA +  GPAVV+SY VSG+SAMLSV
Sbjct  64   ARSGADMKRDLTWWDLAWFGVGAVIGAGIFVLTGQEAREDVGPAVVISYVVSGVSAMLSV  123

Query  431  FCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFN  610
            FCYTEFAVEIPVAGGSFAYLRVELGDF+AF+AAGNILLEY IGGAAVAR+WT Y ATL N
Sbjct  124  FCYTEFAVEIPVAGGSFAYLRVELGDFMAFVAAGNILLEYCIGGAAVARAWTSYFATLLN  183

Query  611  KHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
              P  F I A+ L   Y+ L PIAV V   +CI A  STKG+SR NY+ S
Sbjct  184  HQPSDFRIHASGLDANYSELDPIAVVVIALVCIFASASTKGTSRFNYVLS  233



>gb|EPS61395.1| hypothetical protein M569_13402, partial [Genlisea aurea]
Length=433

 Score =   305 bits (781),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 151/227 (67%), Positives = 182/227 (80%), Gaps = 0/227 (0%)
 Frame = +2

Query  113  CGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAAKSRSQHEMKRNLNWW  292
            C KDDF PEESF+SWGNYV AL+QTPARL DR+ +RS  + EL  K+RS++ MKR L WW
Sbjct  6    CSKDDFFPEESFKSWGNYVGALKQTPARLLDRLTARSDPEAELEMKARSRNAMKRTLRWW  65

Query  293  DLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAG  472
            DL+ FGMG VIGAGIFVLTGQE  + AGPAVV+SY +SG+SAM SVFCYTEFAVEIPVAG
Sbjct  66   DLMGFGMGGVIGAGIFVLTGQETREKAGPAVVISYVISGISAMFSVFCYTEFAVEIPVAG  125

Query  473  GSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALH  652
            GSFAYLRVELG+  AF+ AGNI+++ +IG AA+AR+WT Y ATL N+ P +F I A +L 
Sbjct  126  GSFAYLRVELGELTAFLVAGNIVVDGLIGTAAIARAWTSYFATLCNRSPNAFRIHAPSLA  185

Query  653  EGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             G+N L PIAVGV  A+C++ +LSTK SSR NY A+IVH+ VI FII
Sbjct  186  AGFNELDPIAVGVLAAVCVLVVLSTKASSRFNYFATIVHVAVIAFII  232



>ref|NP_001148009.1| cationic amino acid transporter 4 [Zea mays]
 gb|ACG29378.1| cationic amino acid transporter 4 [Zea mays]
 tpg|DAA55134.1| TPA: cationic amino acid transporter 4 [Zea mays]
Length=600

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/230 (67%), Positives = 178/230 (77%), Gaps = 3/230 (1%)
 Frame = +2

Query  83   ESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRS  259
            +  + I GC CG   F PE+SFRSW  Y  AL +T  RLRDRV +RS+D  E+   + RS
Sbjct  6    DGDVDIDGC-CGGTLF-PEKSFRSWSAYGQALLETGPRLRDRVTTRSMDDTEVNEVRGRS  63

Query  260  QHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCY  439
              +M+R L WWDLIWFG+GAVIG+GIFVLTGQEA   AGPAVV+SY +SG+ AML+VFCY
Sbjct  64   GADMRRTLTWWDLIWFGIGAVIGSGIFVLTGQEAKNAAGPAVVVSYAISGVCAMLAVFCY  123

Query  440  TEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHP  619
            TEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNILLEY IGGAAVARSWT Y ATL N HP
Sbjct  124  TEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNILLEYCIGGAAVARSWTSYFATLLNHHP  183

Query  620  ESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVH  769
            + F + A AL EGY+ L PIAV V   IC +A+ STKGSSR NY+ SI+H
Sbjct  184  DDFRVHAAALAEGYSQLDPIAVAVTAVICALAVFSTKGSSRFNYVLSILH  233



>ref|XP_003532802.2| PREDICTED: cationic amino acid transporter 1-like [Glycine max]
Length=604

 Score =   309 bits (791),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 183/230 (80%), Gaps = 1/230 (0%)
 Frame = +2

Query  107  CSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-AKSRSQHEMKRNL  283
            C+  K+DF PEESF+SWG+Y  ALR+TP + ++RV +RS D+ E+   K RS +EMK+ L
Sbjct  19   CTFQKNDFFPEESFKSWGSYGIALRETPWKFKNRVMTRSKDETEVVEMKGRSSNEMKKTL  78

Query  284  NWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIP  463
            N WDLIWFG+GAVIG+GIFV+TG EA   AGPAVVLSY VSG+SA+LSVFCYTEFAVEIP
Sbjct  79   NSWDLIWFGIGAVIGSGIFVITGLEARDAAGPAVVLSYVVSGISALLSVFCYTEFAVEIP  138

Query  464  VAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKAN  643
            VAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAA++RSWT Y ATL N HP+ F I   
Sbjct  139  VAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAISRSWTSYFATLCNHHPDEFRIIIP  198

Query  644  ALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             ++  Y  L PIAV V  AI  +A++STK SS  N IA+IVH +VIVFII
Sbjct  199  NVNPDYGHLDPIAVVVLIAIATLAMVSTKASSLFNNIATIVHCLVIVFII  248



>ref|XP_010519076.1| PREDICTED: cationic amino acid transporter 1-like [Tarenaya hassleriana]
Length=586

 Score =   307 bits (787),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/232 (63%), Positives = 180/232 (78%), Gaps = 3/232 (1%)
 Frame = +2

Query  107  CS--CGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKR  277
            CS  C K+DFLPEESFR WG Y  AL +T  R +DRV +RS D  EL   + RSQHEMK+
Sbjct  11   CSRFCRKEDFLPEESFRDWGTYKKALSETKTRFKDRVLTRSQDSFELHEMRGRSQHEMKK  70

Query  278  NLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVE  457
             LNWWDL WFG+GAV+GAGIFVLTG+ A  ++GPAVVLSY +SG+SA+LSV CYTEF+VE
Sbjct  71   ALNWWDLTWFGIGAVMGAGIFVLTGETARNNSGPAVVLSYLISGISALLSVLCYTEFSVE  130

Query  458  IPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIK  637
            +PVAGGSF+YLRVELGDFVA+IAAGNIL EY++ GA+VARSWT Y ATL N  P  F I 
Sbjct  131  LPVAGGSFSYLRVELGDFVAYIAAGNILFEYIVAGASVARSWTSYFATLCNHSPNDFRIT  190

Query  638  ANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             ++  E Y+ L PIA+ +   +C+ A LS KGSSR NY+A+I+H+ V++FI+
Sbjct  191  VSSFAEDYSHLDPIAIIISVIVCVGACLSIKGSSRFNYVATILHIAVVLFIL  242



>ref|XP_006587247.1| PREDICTED: cationic amino acid transporter 1-like isoform X2 
[Glycine max]
Length=589

 Score =   306 bits (785),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 175/219 (80%), Gaps = 1/219 (0%)
 Frame = +2

Query  140  ESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-AKSRSQHEMKRNLNWWDLIWFGMG  316
            ESF+S  NY  AL +TP RL DRV  RS+D+VEL   K RS+HEMK+ L WWDLIWFGMG
Sbjct  13   ESFQSAWNYGKALLETPCRLVDRVTGRSMDEVELKEVKKRSEHEMKKTLTWWDLIWFGMG  72

Query  317  AVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGGSFAYLRV  496
            +VIG+GIFVLTG E   H GP VVLSY +SG+SAMLSVFCYTEFAVEIPVAGGSFAYLRV
Sbjct  73   SVIGSGIFVLTGFEVKNHVGPGVVLSYVISGISAMLSVFCYTEFAVEIPVAGGSFAYLRV  132

Query  497  ELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHEGYNLLXP  676
            ELGDFVAFIA+GNILLEYVIGGAAVARSWT Y ATL N+  + FLI+ + L   Y+ L P
Sbjct  133  ELGDFVAFIASGNILLEYVIGGAAVARSWTSYFATLCNQPSDKFLIQVHGLAADYSQLDP  192

Query  677  IAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            IAV V   I   A+ STKGSSR NYIASIVH++V++FII
Sbjct  193  IAVVVLVVIGFFAVFSTKGSSRFNYIASIVHVIVLIFII  231



>ref|XP_007138860.1| hypothetical protein PHAVU_009G243600g [Phaseolus vulgaris]
 gb|ESW10854.1| hypothetical protein PHAVU_009G243600g [Phaseolus vulgaris]
Length=590

 Score =   306 bits (785),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 175/226 (77%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DFLPEESF+SW NYV+AL QT  R +DR+FSRS D  E    K +S+H+MKR LNWWD
Sbjct  22   KQDFLPEESFQSWNNYVSALSQTWLRFKDRLFSRSDDATETEELKKQSEHDMKRCLNWWD  81

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            +IWFG GAVIGAGIFVLTGQEA+ HAG A+VLSY  SG SAMLSVFCYTEFAVE+P AGG
Sbjct  82   MIWFGFGAVIGAGIFVLTGQEAHDHAGSAIVLSYVASGFSAMLSVFCYTEFAVEVPSAGG  141

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLRVELGDFVAFI AGNILLE VIG AAVARSWT Y   L N+   S  IK N L E
Sbjct  142  SFAYLRVELGDFVAFITAGNILLESVIGSAAVARSWTSYFTNLLNRPKNSLRIKTN-LKE  200

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIA GV     +I ++STK +S LN+IAS ++  VI+F+I
Sbjct  201  GYNLLDPIASGVLVIASVITMISTKKTSFLNWIASAINTAVIIFVI  246



>ref|XP_003579146.1| PREDICTED: cationic amino acid transporter 1-like [Brachypodium 
distachyon]
Length=587

 Score =   306 bits (785),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/222 (70%), Positives = 175/222 (79%), Gaps = 1/222 (0%)
 Frame = +2

Query  131  LPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKRNLNWWDLIWF  307
             PE SF SW  Y  AL +T  RLRDR+ +RS  + E  A + RS  EM+R LNWWDL WF
Sbjct  15   FPEPSFASWAAYGRALTETGPRLRDRLTARSAAETETDAVRGRSGAEMRRELNWWDLAWF  74

Query  308  GMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGGSFAY  487
            G+GAVIGAGIFVLTGQEA + AGPAVVLSY VSG+SAMLSVFCYTEFA+EIPVAGGSFAY
Sbjct  75   GVGAVIGAGIFVLTGQEAKEAAGPAVVLSYAVSGVSAMLSVFCYTEFAIEIPVAGGSFAY  134

Query  488  LRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHEGYNL  667
            LRVELGDF+AFIAAGNILLEY IGGAAVARSWT Y ATL N  P+ F I A+ L E Y+ 
Sbjct  135  LRVELGDFMAFIAAGNILLEYCIGGAAVARSWTSYFATLLNHRPDDFRIHASGLAEDYSR  194

Query  668  LXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            L PIAV V   IC++A++STKGSSR NYI SIVH  VI+FII
Sbjct  195  LDPIAVVVIAIICVLAVVSTKGSSRFNYILSIVHFGVILFII  236



>ref|XP_003533107.2| PREDICTED: cationic amino acid transporter 1-like isoform X1 
[Glycine max]
Length=593

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 175/219 (80%), Gaps = 1/219 (0%)
 Frame = +2

Query  140  ESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-AKSRSQHEMKRNLNWWDLIWFGMG  316
            ESF+S  NY  AL +TP RL DRV  RS+D+VEL   K RS+HEMK+ L WWDLIWFGMG
Sbjct  17   ESFQSAWNYGKALLETPCRLVDRVTGRSMDEVELKEVKKRSEHEMKKTLTWWDLIWFGMG  76

Query  317  AVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGGSFAYLRV  496
            +VIG+GIFVLTG E   H GP VVLSY +SG+SAMLSVFCYTEFAVEIPVAGGSFAYLRV
Sbjct  77   SVIGSGIFVLTGFEVKNHVGPGVVLSYVISGISAMLSVFCYTEFAVEIPVAGGSFAYLRV  136

Query  497  ELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHEGYNLLXP  676
            ELGDFVAFIA+GNILLEYVIGGAAVARSWT Y ATL N+  + FLI+ + L   Y+ L P
Sbjct  137  ELGDFVAFIASGNILLEYVIGGAAVARSWTSYFATLCNQPSDKFLIQVHGLAADYSQLDP  196

Query  677  IAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            IAV V   I   A+ STKGSSR NYIASIVH++V++FII
Sbjct  197  IAVVVLVVIGFFAVFSTKGSSRFNYIASIVHVIVLIFII  235



>ref|XP_004233878.1| PREDICTED: cationic amino acid transporter 1-like [Solanum lycopersicum]
Length=596

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/230 (65%), Positives = 177/230 (77%), Gaps = 1/230 (0%)
 Frame = +2

Query  83   ESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRS  259
             S +  RGC C K DFLPEESF SWG+Y  AL +T ARL++RV SRS DQ EL   +  S
Sbjct  13   HSTLTKRGCGCSKKDFLPEESFTSWGSYGQALLETKARLKNRVLSRSSDQSELHKVRDSS  72

Query  260  QHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCY  439
            QH+MK++LNW+DLIW G+GAV+GAG+FVLTG+     AGPAV+LSY +SGLSA+LSV CY
Sbjct  73   QHQMKKSLNWFDLIWLGIGAVMGAGVFVLTGEATKSLAGPAVLLSYAISGLSALLSVLCY  132

Query  440  TEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHP  619
            TEF+VE+PVAGGSFAYLRVELGDFVAFIAAGNIL EYV+ GA+VARSWT Y ATL N  P
Sbjct  133  TEFSVELPVAGGSFAYLRVELGDFVAFIAAGNILFEYVVVGASVARSWTSYFATLCNHQP  192

Query  620  ESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVH  769
            + F I  ++L EGYN L P+AV V   IC  A +S KGSSR N I +I+H
Sbjct  193  DDFRINVSSLSEGYNHLDPVAVVVTLLICACACVSMKGSSRFNSILTILH  242



>ref|XP_007138855.1| hypothetical protein PHAVU_009G243100g [Phaseolus vulgaris]
 gb|ESW10849.1| hypothetical protein PHAVU_009G243100g [Phaseolus vulgaris]
Length=591

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 176/226 (78%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DFLPEESF+SW NYV+AL Q+  R +DR+ SRS D  E    K +S+H+MKR LNWWD
Sbjct  22   KQDFLPEESFQSWNNYVSALSQSWPRFKDRLLSRSDDATETEELKKQSEHDMKRCLNWWD  81

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIWFG GAVIGAGIFVLTGQEA+ HAG A+VLSY  SG SAMLSVFCYTEFAVE+P AGG
Sbjct  82   LIWFGFGAVIGAGIFVLTGQEAHDHAGSAIVLSYVASGFSAMLSVFCYTEFAVEVPSAGG  141

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLRVELGDFVAFI AGNILLE VIG AAVARSWT Y  +L N+  +S  IK N L E
Sbjct  142  SFAYLRVELGDFVAFITAGNILLESVIGSAAVARSWTSYFTSLLNRPKDSLRIKTN-LQE  200

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIA GV     +I ++STK +S LN+IAS ++  VI+F+I
Sbjct  201  GYNLLDPIASGVLLIAAVITMISTKKTSYLNWIASAINTAVIIFVI  246



>ref|XP_006353075.1| PREDICTED: cationic amino acid transporter 1-like [Solanum tuberosum]
Length=596

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/230 (64%), Positives = 178/230 (77%), Gaps = 1/230 (0%)
 Frame = +2

Query  83   ESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRS  259
             S +  RGC C K+DFLPEESF SWG+Y  ALR+T  RL++RV SRS DQ EL   +  S
Sbjct  13   HSTLTKRGCGCSKNDFLPEESFTSWGSYAQALRETKTRLKNRVLSRSSDQSELHEIRDCS  72

Query  260  QHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCY  439
            QH+MK++LNW+DLIW G+GAV+GAG+FVLTG+     AGPAV+LSY +SG+SA+LSV CY
Sbjct  73   QHQMKKSLNWFDLIWLGIGAVMGAGVFVLTGEATKSLAGPAVLLSYAISGISALLSVLCY  132

Query  440  TEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHP  619
            TEF+VE+PVAGGSFAYLRVELGDFVAFIAAGNIL EY++ GA+VARSWT Y ATL N  P
Sbjct  133  TEFSVELPVAGGSFAYLRVELGDFVAFIAAGNILFEYIVVGASVARSWTSYFATLCNHKP  192

Query  620  ESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVH  769
            + F I  ++L EGYN L P+AV V   IC  A +S KGSSR N I +I+H
Sbjct  193  DDFRINVSSLAEGYNHLDPVAVVVSLLICACACISMKGSSRFNSILTILH  242



>ref|XP_003594855.1| High affinity cationic amino acid transporter [Medicago truncatula]
Length=578

 Score =   305 bits (781),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 182/226 (81%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKRNLNWWD  295
            K DFLPEESF+SW NYV+AL QT  R +DRV +RS D  E    K +S++EMK+ LNWWD
Sbjct  21   KQDFLPEESFQSWNNYVSALSQTWLRFKDRVQTRSDDATETHELKKQSENEMKKCLNWWD  80

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIWFG GAVIGAGIFVLTGQEA+ HAG A+VLSY  SG+SAMLSVFCYTEFAVE+P AGG
Sbjct  81   LIWFGFGAVIGAGIFVLTGQEAHNHAGAAIVLSYVASGISAMLSVFCYTEFAVEVPAAGG  140

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDFVAFIAAGNILLE V+G AAV+RSWT Y  +L N+  +S  IKA+ L +
Sbjct  141  SFAYLRIELGDFVAFIAAGNILLECVLGSAAVSRSWTSYFTSLLNRPKDSLRIKAHHLKD  200

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIAVGV     +IA++ST+ +S LN+IAS V++ VI+F+I
Sbjct  201  GYNLLDPIAVGVLVISAMIAMISTRKTSLLNWIASAVNIGVIIFVI  246



>gb|AES65106.2| cationic amino acid transporter [Medicago truncatula]
Length=591

 Score =   305 bits (781),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 182/226 (81%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKRNLNWWD  295
            K DFLPEESF+SW NYV+AL QT  R +DRV +RS D  E    K +S++EMK+ LNWWD
Sbjct  21   KQDFLPEESFQSWNNYVSALSQTWLRFKDRVQTRSDDATETHELKKQSENEMKKCLNWWD  80

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIWFG GAVIGAGIFVLTGQEA+ HAG A+VLSY  SG+SAMLSVFCYTEFAVE+P AGG
Sbjct  81   LIWFGFGAVIGAGIFVLTGQEAHNHAGAAIVLSYVASGISAMLSVFCYTEFAVEVPAAGG  140

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDFVAFIAAGNILLE V+G AAV+RSWT Y  +L N+  +S  IKA+ L +
Sbjct  141  SFAYLRIELGDFVAFIAAGNILLECVLGSAAVSRSWTSYFTSLLNRPKDSLRIKAHHLKD  200

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIAVGV     +IA++ST+ +S LN+IAS V++ VI+F+I
Sbjct  201  GYNLLDPIAVGVLVISAMIAMISTRKTSLLNWIASAVNIGVIIFVI  246



>emb|CAN73404.1| hypothetical protein VITISV_010051 [Vitis vinifera]
Length=603

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 176/215 (82%), Gaps = 1/215 (0%)
 Frame = +2

Query  152  SWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKRNLNWWDLIWFGMGAVIG  328
            SWG YV AL  T ARL+DR+ +RSLD+VEL A + RS +EMK+ LNWWDL+WFG+GAV+G
Sbjct  45   SWGTYVKALGNTTARLKDRLLTRSLDEVELHAVRDRSXNEMKKTLNWWDLLWFGIGAVMG  104

Query  329  AGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGD  508
            +GIFVLTG+ AN++AGPAVVLSY +SG+SA+LSV CYTEFAVE+PVAGGSFAYLRVELGD
Sbjct  105  SGIFVLTGEAANEYAGPAVVLSYFISGVSAILSVLCYTEFAVELPVAGGSFAYLRVELGD  164

Query  509  FVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHEGYNLLXPIAVG  688
            FVA++AAGNIL EYV+ GA VARSWT Y ATL N  P  F   A++L EGYN L PIAV 
Sbjct  165  FVAYVAAGNILFEYVVAGAGVARSWTSYFATLCNHDPNDFRFYASSLAEGYNHLDPIAVA  224

Query  689  VCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            V   +C++A LS KGSSR N IASIVHMV+I F++
Sbjct  225  VSIVVCVLASLSMKGSSRFNSIASIVHMVIIAFML  259



>ref|XP_008661460.1| PREDICTED: uncharacterized protein LOC100194142 isoform X1 [Zea 
mays]
 tpg|DAA50331.1| TPA: hypothetical protein ZEAMMB73_935981 [Zea mays]
Length=602

 Score =   303 bits (777),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 181/230 (79%), Gaps = 1/230 (0%)
 Frame = +2

Query  107  CSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKRNL  283
            CSC K DF PEESF SW  Y  ALR T  RL DR+ SRSL+  EL   ++RS  +MKR+L
Sbjct  21   CSCTKADFFPEESFSSWSAYGRALRSTGPRLADRLTSRSLESTELHEVRARSGADMKRDL  80

Query  284  NWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIP  463
             WWDL+WFG+GAVIGAGIFVLTGQEA +  GPAVV+SY VSG+SAMLSVFCYTEFAVEIP
Sbjct  81   TWWDLVWFGVGAVIGAGIFVLTGQEAREDVGPAVVVSYVVSGVSAMLSVFCYTEFAVEIP  140

Query  464  VAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKAN  643
            VAGGSFAYLRVELGDF+AF+AAGNILLEY IGGAAVAR+WT Y ATL N  P  F I A+
Sbjct  141  VAGGSFAYLRVELGDFMAFVAAGNILLEYCIGGAAVARAWTSYFATLLNHQPSDFRIHAS  200

Query  644  ALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            +L   Y+ L PIAV V   +CI A+ STKG+SR NY+ SIVH+ VIVFII
Sbjct  201  SLSADYSELDPIAVVVIALVCIFAVASTKGTSRFNYVLSIVHIAVIVFII  250



>ref|XP_003533631.1| PREDICTED: cationic amino acid transporter 5-like [Glycine max]
Length=589

 Score =   303 bits (776),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 176/226 (78%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DFLPEESF+SW NYV+AL QT  R +DR+ +RS D  E    K +S+H+MKR LNWWD
Sbjct  21   KQDFLPEESFQSWSNYVSALSQTRLRFKDRLLARSDDATETEELKKQSEHDMKRCLNWWD  80

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIWFG GAVIGAGIFVLTGQEA+ HAGPA+VLSY  SG SAMLSVFCYTEFAVE+P AGG
Sbjct  81   LIWFGFGAVIGAGIFVLTGQEAHDHAGPAIVLSYVASGFSAMLSVFCYTEFAVEVPSAGG  140

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAY+RVELGDFVAFI AGNILLE VIG AAVARSWT Y  +L N+  +S  IK  +L E
Sbjct  141  SFAYMRVELGDFVAFITAGNILLESVIGSAAVARSWTSYFTSLLNRPKDSLRIK-TSLKE  199

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIA  V     +I I+ST+ +S LN++AS ++  VI+F+I
Sbjct  200  GYNLLDPIASVVLVIASVITIISTRKTSVLNWLASAINTAVIIFVI  245



>gb|KHN26606.1| Cationic amino acid transporter 5 [Glycine soja]
Length=589

 Score =   303 bits (776),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 176/226 (78%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DFLPEESF+SW NYV+AL QT  R +DR+ +RS D  E    K +S+H+MKR LNWWD
Sbjct  21   KQDFLPEESFQSWNNYVSALSQTRLRFKDRLLARSDDATETEELKKQSEHDMKRCLNWWD  80

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIWFG GAVIGAGIFVLTGQEA+ HAGPA+VLSY  SG SAMLSVFCYTEFAVE+P AGG
Sbjct  81   LIWFGFGAVIGAGIFVLTGQEAHDHAGPAIVLSYVASGFSAMLSVFCYTEFAVEVPSAGG  140

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAY+RVELGDFVAFI AGNILLE VIG AAVARSWT Y  +L N+  +S  IK  +L E
Sbjct  141  SFAYMRVELGDFVAFITAGNILLESVIGSAAVARSWTSYFTSLLNRPKDSLRIK-TSLKE  199

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIA  V     +I I+ST+ +S LN++AS ++  VI+F+I
Sbjct  200  GYNLLDPIASVVLVIASVITIISTRKTSVLNWLASAINTAVIIFVI  245



>ref|XP_006850457.1| PREDICTED: cationic amino acid transporter 5 [Amborella trichopoda]
 gb|ERN12038.1| hypothetical protein AMTR_s00035p00052900 [Amborella trichopoda]
Length=594

 Score =   303 bits (775),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 181/226 (80%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            KDDF PE+SF+SW +Y +AL   P R +DR+ SRS +  EL   + +S+++MK+ LNWWD
Sbjct  24   KDDFFPEQSFKSWSSYKDALLSAPHRFKDRLLSRSDESDELTKLRKQSENDMKKCLNWWD  83

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG G+VIGAGIFVLTGQEA+ HAGPA++LSY  SGLSAMLSVFCYTEFA+EIPVAGG
Sbjct  84   LTWFGFGSVIGAGIFVLTGQEAHDHAGPAIILSYLASGLSAMLSVFCYTEFAIEIPVAGG  143

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLRVELGDFVAFI A NILLE +IGGAAVAR+WT Y  TL ++HP SF I  ++L +
Sbjct  144  SFAYLRVELGDFVAFITAANILLECIIGGAAVARAWTSYFTTLLDRHPNSFRIHVHSLSK  203

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G++LL PIAV       I+A++ST+ +S LN++AS V+M+VI+F+I
Sbjct  204  GFDLLDPIAVTELILASILAMISTRKTSYLNWVASAVNMIVILFVI  249



>ref|XP_003559648.1| PREDICTED: cationic amino acid transporter 1-like [Brachypodium 
distachyon]
Length=600

 Score =   302 bits (774),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 174/224 (78%), Gaps = 1/224 (0%)
 Frame = +2

Query  125  DFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKRNLNWWDLI  301
            +F PE SF SW  Y  ALR T  RL DR+ SRSL+  EL   ++RS  +MKR+L WWDL 
Sbjct  24   EFFPEASFSSWAAYGRALRSTGPRLADRLTSRSLEATELHEVRARSGADMKRDLTWWDLA  83

Query  302  WFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGGSF  481
            WFG+GAVIGAGIFVLTGQEA +  GPAVV+SY VSG+SAMLSVFCYTEFAVEIPVAGGSF
Sbjct  84   WFGVGAVIGAGIFVLTGQEAKEVVGPAVVISYVVSGVSAMLSVFCYTEFAVEIPVAGGSF  143

Query  482  AYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHEGY  661
            AYLRVELGDF+AF+AAGNILLEY IG AAVAR+WT Y ATL N  P  F I A++L   Y
Sbjct  144  AYLRVELGDFMAFVAAGNILLEYCIGSAAVARAWTSYFATLLNHQPAQFRIHASSLAADY  203

Query  662  NLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            + L PIAV V   IC  A++STKGSSR NY+ SIVH+ VI+FII
Sbjct  204  SELDPIAVVVITLICAFAVVSTKGSSRFNYVLSIVHIAVILFII  247



>ref|XP_012065092.1| PREDICTED: cationic amino acid transporter 5 [Jatropha curcas]
 gb|KDP46791.1| hypothetical protein JCGZ_11162 [Jatropha curcas]
Length=568

 Score =   300 bits (769),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 177/226 (78%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DFLPEESF+SW NY +AL QT  R +DR+ SRS D  E+   + +S+++MKR L WWD
Sbjct  18   KQDFLPEESFQSWANYRSALAQTGFRFKDRLISRSDDAKEIGELRKQSENDMKRCLTWWD  77

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG GAVIGAGIFVLTGQEA+ HAGPA+VLSY  SG SAMLSVFCYTEFAVEIPVAGG
Sbjct  78   LTWFGFGAVIGAGIFVLTGQEAHNHAGPAIVLSYVASGFSAMLSVFCYTEFAVEIPVAGG  137

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDFVAFI AGNILLE ++  AAVAR+WT Y  TL N+HP S  I  N L E
Sbjct  138  SFAYLRIELGDFVAFITAGNILLESIVSSAAVARAWTSYFTTLLNRHPNSLRIHTN-LSE  196

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAVGV      IA++ST+ +S LN+IA++++  +I+F+I
Sbjct  197  GFNLLDPIAVGVLVIAATIAMISTRKTSLLNWIATLINTSIILFVI  242



>ref|XP_008440316.1| PREDICTED: cationic amino acid transporter 5 [Cucumis melo]
Length=598

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 177/226 (78%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DFLPEESF+SW NY  AL QT  R  DR+ SRS D+ E+   + RS++EMKR L WWD
Sbjct  29   KQDFLPEESFQSWSNYRTALSQTWFRFIDRLQSRSFDENEIGELRKRSENEMKRCLTWWD  88

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG GAVIGAGIFVLTGQEAN+HAGPA+VLSY  SG+SAMLSVFCYTEFA+EIPVAGG
Sbjct  89   LTWFGFGAVIGAGIFVLTGQEANEHAGPAIVLSYVASGISAMLSVFCYTEFAIEIPVAGG  148

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDF AFI AGNILLE ++G AAVARSWT Y  +L ++  +S LI  N L +
Sbjct  149  SFAYLRIELGDFAAFITAGNILLESIVGTAAVARSWTSYFTSLLDRPDKSLLIHTN-LKD  207

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIAVGV      IA+ ST+ +S LN+IAS ++ VVI+F+I
Sbjct  208  GYNLLDPIAVGVLAIAATIAMTSTRKTSYLNWIASAINTVVILFVI  253



>ref|XP_010260734.1| PREDICTED: cationic amino acid transporter 5-like [Nelumbo nucifera]
Length=592

 Score =   300 bits (769),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 178/226 (79%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF PE+SF SW +Y +AL QT  R +DR+ SRS D  EL   + +S++EMKR LNWWD
Sbjct  21   KQDFFPEQSFESWNSYRSALSQTCFRFKDRLLSRSDDANELGELRKQSENEMKRCLNWWD  80

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIWFG G+VIGAGIFVLTGQEA  HAGPA+VLSY  SG+SA+LSVFCYTEFAVEIPVAGG
Sbjct  81   LIWFGFGSVIGAGIFVLTGQEARYHAGPAIVLSYVASGISALLSVFCYTEFAVEIPVAGG  140

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAY+RVELGDF AFIAAGN+LLE ++GGAAVAR+WT Y ATL N+HP S  I  N L E
Sbjct  141  SFAYMRVELGDFAAFIAAGNLLLESIVGGAAVARAWTSYFATLLNRHPNSLRIHTN-LAE  199

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             YNLL PIAV V  A   +A++ST+ +S  N+IAS ++ VVI+F+I
Sbjct  200  NYNLLDPIAVVVLIAAATLAMISTRKTSYFNWIASAINTVVILFVI  245



>ref|XP_004968601.1| PREDICTED: cationic amino acid transporter 5-like [Setaria italica]
Length=613

 Score =   301 bits (770),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 174/226 (77%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            KDDF PE SF SWG Y  AL  TP+RLRDR   RS D  EL A + RS++EM+R L WWD
Sbjct  30   KDDFFPEPSFASWGAYCRALGATPSRLRDRFAGRSTDAAELGAMRRRSENEMRRCLTWWD  89

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG G+VIGAGIFVLTGQEA  HAGPA+VLSY  SGLSAMLSVFCYTEFAVEIPVAGG
Sbjct  90   LTWFGFGSVIGAGIFVLTGQEARDHAGPAIVLSYVASGLSAMLSVFCYTEFAVEIPVAGG  149

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLRVELGD  AFIAA N++LE +IG AAVARSWT YLA+L NK   +  I  ++L E
Sbjct  150  SFAYLRVELGDVAAFIAAANLILESIIGTAAVARSWTSYLASLINKPASALRIHTSSLAE  209

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYN L PIA  V      +A+LS+KG+SR+N++AS VH++VI F+I
Sbjct  210  GYNELDPIAAVVIAVTATLAMLSSKGTSRVNWVASAVHVLVIGFVI  255



>ref|XP_002976452.1| hypothetical protein SELMODRAFT_104889 [Selaginella moellendorffii]
 gb|EFJ22712.1| hypothetical protein SELMODRAFT_104889 [Selaginella moellendorffii]
Length=595

 Score =   300 bits (767),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 178/225 (79%), Gaps = 1/225 (0%)
 Frame = +2

Query  122  DDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKRNLNWWDL  298
             +FLPEESF+SW +YV+AL +T  R  DR+ +RS DQ EL   KSRS++EM + LNWWDL
Sbjct  3    SNFLPEESFQSWSSYVHALSETRPRFMDRLRARSSDQEELLEVKSRSKNEMIKTLNWWDL  62

Query  299  IWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGGS  478
            +WFG+GAVIGAG+FVLTGQEA +HAGPA++LSY V+GLSAMLSVFCYTEFAVEIPVAGGS
Sbjct  63   MWFGIGAVIGAGVFVLTGQEAKEHAGPAIILSYAVAGLSAMLSVFCYTEFAVEIPVAGGS  122

Query  479  FAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHEG  658
            FAYLRVELGDF AFIAAGNI+LEY+IG AAVARSWT Y A L N     F I A +L + 
Sbjct  123  FAYLRVELGDFAAFIAAGNIILEYIIGNAAVARSWTGYFAALLNHDSSDFRIYAPSLAKD  182

Query  659  YNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            YN L PIAV V      IA  ST+ +S LN+IAS+V+M+VI FII
Sbjct  183  YNYLDPIAVVVLCIAGAIACYSTRHASTLNWIASVVNMLVIAFII  227



>ref|XP_003534865.1| PREDICTED: cationic amino acid transporter 5-like [Glycine max]
 gb|KHN26610.1| Cationic amino acid transporter 5 [Glycine soja]
Length=585

 Score =   299 bits (765),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 173/226 (77%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DFLPEESF+SW NYV+AL QT  R +DR+ +RS D  E    K +S+H+MKR LNWWD
Sbjct  21   KQDFLPEESFQSWNNYVSALSQTRLRFKDRLLARSDDATETEELKKQSEHDMKRCLNWWD  80

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIWFG GAVIGAGIFVLTGQ+A+  AGPA+VLSY  SG SAMLSVFCYTEFAVE+P AGG
Sbjct  81   LIWFGFGAVIGAGIFVLTGQQAHDSAGPAIVLSYVASGFSAMLSVFCYTEFAVEVPSAGG  140

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLRVELGDFVAFI AGNILLE VIG AAVARSWT Y  +L N+   S  IK N L E
Sbjct  141  SFAYLRVELGDFVAFITAGNILLESVIGSAAVARSWTSYFTSLLNRPKNSLCIKTN-LKE  199

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIA  V      I I+ST+ +S LN+IAS ++  VI+F+I
Sbjct  200  GYNLLDPIASVVLVIASAITIISTRKTSVLNWIASAINTAVIIFVI  245



>ref|XP_002987271.1| hypothetical protein SELMODRAFT_269243 [Selaginella moellendorffii]
 gb|EFJ11586.1| hypothetical protein SELMODRAFT_269243 [Selaginella moellendorffii]
Length=595

 Score =   299 bits (766),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 178/225 (79%), Gaps = 1/225 (0%)
 Frame = +2

Query  122  DDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKRNLNWWDL  298
             +FLPEESF+SW +YV+AL +T  R  DR+ +RS DQ EL   KSRS++EM + LNWWDL
Sbjct  3    SNFLPEESFQSWSSYVHALSETRPRFMDRLRARSSDQEELLEVKSRSKNEMIKTLNWWDL  62

Query  299  IWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGGS  478
            +WFG+GAVIGAG+FVLTGQEA +HAGPA++LSY V+GLSAMLSVFCYTEFAVEIPVAGGS
Sbjct  63   MWFGIGAVIGAGVFVLTGQEAKEHAGPAIILSYAVAGLSAMLSVFCYTEFAVEIPVAGGS  122

Query  479  FAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHEG  658
            FAYLRVELGDF AFIAAGNI+LEY+IG AAVARSWT Y A L N     F I A +L + 
Sbjct  123  FAYLRVELGDFAAFIAAGNIVLEYIIGNAAVARSWTGYFAALLNHDSSDFRIYAPSLAKD  182

Query  659  YNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            YN L PIAV V      IA  ST+ +S LN+IAS+V+M+VI FII
Sbjct  183  YNYLDPIAVVVLCIAGAIACYSTRHASTLNWIASVVNMLVIAFII  227



>ref|NP_001042365.1| Os01g0209800 [Oryza sativa Japonica Group]
 dbj|BAA96139.1| putative amino acid permease [Oryza sativa Japonica Group]
 dbj|BAA96181.1| putative amino acid permease [Oryza sativa Japonica Group]
 dbj|BAF04279.1| Os01g0209800 [Oryza sativa Japonica Group]
 gb|EAY72982.1| hypothetical protein OsI_00855 [Oryza sativa Indica Group]
 gb|EAZ10995.1| hypothetical protein OsJ_00840 [Oryza sativa Japonica Group]
 dbj|BAG88024.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93920.1| unnamed protein product [Oryza sativa Japonica Group]
Length=616

 Score =   298 bits (764),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 174/226 (77%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K+DF PE SF SWG Y  AL  TPAR RDR   RS D  EL A + RS++EM+R L WWD
Sbjct  27   KEDFFPEPSFASWGAYRAALAATPARFRDRFAGRSTDADELGALRRRSENEMRRCLTWWD  86

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG G+VIGAGIFVLTGQEA+ HAGPA+VLSY  SGLSAMLSVFCYTEFAVEIPVAGG
Sbjct  87   LTWFGFGSVIGAGIFVLTGQEAHDHAGPAIVLSYVASGLSAMLSVFCYTEFAVEIPVAGG  146

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLRVELGD  AFIAA N++LE +IG AAVARSWT YLA+L NK P S L    +L E
Sbjct  147  SFAYLRVELGDVAAFIAAANLILESIIGTAAVARSWTSYLASLINK-PASALRIQTSLAE  205

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYN L PIAV V      +AILS KG+SR+N++AS VH++VI F+I
Sbjct  206  GYNELDPIAVVVIAVTATLAILSAKGTSRVNWVASAVHVLVIAFVI  251



>ref|XP_004487906.1| PREDICTED: LOW QUALITY PROTEIN: cationic amino acid transporter 
5-like [Cicer arietinum]
Length=577

 Score =   297 bits (760),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 180/226 (80%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKRNLNWWD  295
            K DFLPEESF+SW NYV AL QT  R  DR+ SRS D+ E    K +S++EMK+ LNWWD
Sbjct  21   KQDFLPEESFQSWNNYVYALSQTWLRFMDRLQSRSDDETETRELKKQSENEMKKCLNWWD  80

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L+WFG GAVIGAGIFVLTGQEA+ HAG A+VLSY  SG+SAMLSVFCYTEFAVE+P AGG
Sbjct  81   LMWFGFGAVIGAGIFVLTGQEAHNHAGAAIVLSYIASGISAMLSVFCYTEFAVEVPSAGG  140

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDFVAFIAAGNILLE ++GGAAV+RSWT Y  +L N+  +S  IK + L +
Sbjct  141  SFAYLRIELGDFVAFIAAGNILLECILGGAAVSRSWTSYFTSLLNRPKDSLRIKTH-LKD  199

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIAV V     +IA++ST+ +S LN+IAS ++ VVI+F+I
Sbjct  200  GYNLLDPIAVAVLVISGLIAMISTRKTSLLNWIASAINTVVIIFVI  245



>gb|KEH40544.1| cationic amino acid transporter [Medicago truncatula]
Length=601

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 180/233 (77%), Gaps = 5/233 (2%)
 Frame = +2

Query  110  SCGKDDFLPE----ESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-AKSRSQHEMK  274
            S G+++  P     +SF S  +Y  AL  TP RL DRV +RS D+VEL   + +SQHEMK
Sbjct  9    SIGEENVAPPSTKLKSFESLPSYGRALLYTPCRLLDRVTARSNDEVELVDVRKQSQHEMK  68

Query  275  RNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAV  454
            + L+WWDLIWFGMG+VIG+GIFVLTG E     GPAVVLSY VSG+SAMLSVFCYTEFAV
Sbjct  69   KTLSWWDLIWFGMGSVIGSGIFVLTGLEVKNTVGPAVVLSYIVSGISAMLSVFCYTEFAV  128

Query  455  EIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLI  634
            EIPVAGGSFAY+RVELG+FVAFIA+GNI+LEYVIGGAAV+RSWT Y ATL N+  + FLI
Sbjct  129  EIPVAGGSFAYIRVELGEFVAFIASGNIILEYVIGGAAVSRSWTSYFATLCNQPSDKFLI  188

Query  635  KANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
              ++L   YN L PIAV     I   AI STKGSSRLNYIASI+H++V++FII
Sbjct  189  IVDSLANDYNELDPIAVFALAIITTFAIFSTKGSSRLNYIASIIHVIVLMFII  241



>ref|XP_006468574.1| PREDICTED: cationic amino acid transporter 5-like [Citrus sinensis]
 gb|KDO77224.1| hypothetical protein CISIN_1g040051mg [Citrus sinensis]
Length=590

 Score =   295 bits (754),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 177/226 (78%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DFLPEESF+SWGNY +AL QT  R  DR+ SRS D  E+   + +S+++MKR L WWD
Sbjct  21   KQDFLPEESFQSWGNYKHALSQTHFRFMDRLISRSHDGNEICELRKQSENDMKRCLTWWD  80

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG GAVIGAGIFVLTGQEA++HAGPA+VLSY  SG+SAMLSVFCYTEFA+EIPVAGG
Sbjct  81   LTWFGFGAVIGAGIFVLTGQEAHKHAGPAIVLSYVASGVSAMLSVFCYTEFAIEIPVAGG  140

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDF AFI AGNILLE ++GGAAVAR+WT Y  TL N+ P S  I  N L E
Sbjct  141  SFAYLRIELGDFAAFITAGNILLESIVGGAAVARAWTSYFTTLLNREPNSLRIHTN-LRE  199

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIAV V      IA +ST+ +S LN+IAS ++ VVI+F+I
Sbjct  200  GYNLLDPIAVAVLATAATIASISTRKTSVLNWIASAINTVVILFVI  245



>tpg|DAA52890.1| TPA: hypothetical protein ZEAMMB73_769223 [Zea mays]
Length=620

 Score =   295 bits (754),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 175/226 (77%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            +DDF PE SF SWG Y  ALR+TPARLRDR+  RS D  EL A + RS+HEM+R L WWD
Sbjct  33   RDDFFPEPSFASWGAYRRALRETPARLRDRLAGRSTDAAELGALRRRSEHEMRRCLTWWD  92

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG G+VIGAGIFVLTGQEA  HAGPA+VLSY  SGLSAMLSVFCYTEFAVEIPVAGG
Sbjct  93   LTWFGFGSVIGAGIFVLTGQEARDHAGPAIVLSYVASGLSAMLSVFCYTEFAVEIPVAGG  152

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLRVELGD  AF+AA N++LE VIG AAVARSWT YLA+L N+   +  I A  L  
Sbjct  153  SFAYLRVELGDAAAFVAAANLILESVIGTAAVARSWTSYLASLVNRPASALRIHAPGLAG  212

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GY+ L PIAV V      +A+L+ KG+SR+N++AS VH++VI F+I
Sbjct  213  GYDELDPIAVLVIAVTATLAMLTAKGTSRVNWVASAVHVLVIAFVI  258



>ref|XP_006448600.1| hypothetical protein CICLE_v10014698mg [Citrus clementina]
 gb|ESR61840.1| hypothetical protein CICLE_v10014698mg [Citrus clementina]
Length=590

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 176/226 (78%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DFLPEESF+SWGNY  AL QT  R  DR+ SRS D +E+   + +S+++MKR L WWD
Sbjct  21   KQDFLPEESFQSWGNYKYALSQTHFRFMDRLISRSHDGIEICELRKQSENDMKRCLTWWD  80

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG GAVIGAGIFVLTGQEA++HAGPA+VLSY  SG+SAMLSVFCYTEFA+EIPVAGG
Sbjct  81   LTWFGFGAVIGAGIFVLTGQEAHKHAGPAIVLSYVASGVSAMLSVFCYTEFAIEIPVAGG  140

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDF AFI AGN LLE ++GGAAVAR+WT Y  TL N+ P S  I  N L E
Sbjct  141  SFAYLRIELGDFAAFITAGNTLLESIVGGAAVARAWTSYFTTLLNREPNSLRIHTN-LRE  199

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIAV V      IA +ST+ +S LN+IAS ++ VVI+F+I
Sbjct  200  GYNLLDPIAVAVLATAATIASISTRKTSVLNWIASAINTVVILFVI  245



>ref|XP_007040997.1| Cationic amino acid transporter 5 [Theobroma cacao]
 gb|EOX96828.1| Cationic amino acid transporter 5 [Theobroma cacao]
Length=588

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 178/227 (78%), Gaps = 2/227 (1%)
 Frame = +2

Query  116  GKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWW  292
            GKD+FLPEESF++W  Y +AL Q   R +DR+ SRS D  E+A  + +S+++MKR L WW
Sbjct  20   GKDEFLPEESFQNWSTYRSALLQICFRFKDRLISRSDDASEIAELRKQSENDMKRCLTWW  79

Query  293  DLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAG  472
            DL WFG G+VIGAGIFVLTG+EA+ HAGPA+VLSY  SG+SAMLSVFCYTEFAVEIPVAG
Sbjct  80   DLTWFGFGSVIGAGIFVLTGKEAHDHAGPAIVLSYVASGISAMLSVFCYTEFAVEIPVAG  139

Query  473  GSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALH  652
            GSFAYLR+ELGDFVAFI AGNILLE ++G AAVAR+WT Y  TL N+ P S  I  N   
Sbjct  140  GSFAYLRIELGDFVAFITAGNILLESIVGSAAVARAWTSYFTTLLNRQPNSLRIHTN-FR  198

Query  653  EGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            +GYNLL PIAV V      IA++ST+ +S+LN+IA+ ++ VVI+F+I
Sbjct  199  KGYNLLDPIAVAVLAISASIAMISTRKTSQLNWIATALNTVVILFVI  245



>emb|CDM82248.1| unnamed protein product [Triticum aestivum]
Length=615

 Score =   294 bits (752),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/218 (68%), Positives = 170/218 (78%), Gaps = 2/218 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            +DDF PE SF SWG Y +AL  TPARLRDR   RS D +EL A + RS++EM+R L WWD
Sbjct  27   RDDFFPEPSFASWGAYRSALAATPARLRDRFTGRSTDAIELGALRRRSENEMRRCLTWWD  86

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG G+VIGAGIFVLTGQEA+ HAGPA+VLSY VSGLSAMLSVFCYTEFAVEIPVAGG
Sbjct  87   LTWFGFGSVIGAGIFVLTGQEAHDHAGPAIVLSYVVSGLSAMLSVFCYTEFAVEIPVAGG  146

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLRVELGD  AFIAA N++LE +IG AAVARSWT Y A+L NK P S L    +L +
Sbjct  147  SFAYLRVELGDVAAFIAAANLILESIIGTAAVARSWTSYFASLINK-PASALRIQTSLRD  205

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVH  769
            GYN L PIAV V      +AILS KG+SR+N++AS +H
Sbjct  206  GYNELDPIAVVVIAVTATMAILSAKGTSRINWVASAIH  243



>ref|XP_008673559.1| PREDICTED: cationic amino acid transporter 5 [Zea mays]
Length=688

 Score =   295 bits (754),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 175/226 (77%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            +DDF PE SF SWG Y  ALR+TPARLRDR+  RS D  EL A + RS+HEM+R L WWD
Sbjct  101  RDDFFPEPSFASWGAYRRALRETPARLRDRLAGRSTDAAELGALRRRSEHEMRRCLTWWD  160

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG G+VIGAGIFVLTGQEA  HAGPA+VLSY  SGLSAMLSVFCYTEFAVEIPVAGG
Sbjct  161  LTWFGFGSVIGAGIFVLTGQEARDHAGPAIVLSYVASGLSAMLSVFCYTEFAVEIPVAGG  220

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLRVELGD  AF+AA N++LE VIG AAVARSWT YLA+L N+   +  I A  L  
Sbjct  221  SFAYLRVELGDAAAFVAAANLILESVIGTAAVARSWTSYLASLVNRPASALRIHAPGLAG  280

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GY+ L PIAV V      +A+L+ KG+SR+N++AS VH++VI F+I
Sbjct  281  GYDELDPIAVLVIAVTATLAMLTAKGTSRVNWVASAVHVLVIAFVI  326



>gb|KCW44978.1| hypothetical protein EUGRSUZ_L01436, partial [Eucalyptus grandis]
Length=546

 Score =   291 bits (744),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 174/226 (77%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF PEESFR+WG Y +AL Q   RL+DR+  RS D  EL   + +S+++MKR LNWWD
Sbjct  14   KQDFFPEESFRNWGTYRSALSQMCFRLKDRIKGRSDDVTELQELRKQSENDMKRCLNWWD  73

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIW G+G  IGAGIFVLTGQEA++HAGPA+VLSY V+G SAMLSVFCYTEFAVEIPVAGG
Sbjct  74   LIWVGLGGHIGAGIFVLTGQEAHEHAGPAIVLSYVVAGASAMLSVFCYTEFAVEIPVAGG  133

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLRVELGDFVAFIAAGNILLE V+G AAVAR+WT Y   L N+   S  I   +L  
Sbjct  134  SFAYLRVELGDFVAFIAAGNILLESVVGTAAVARAWTSYFTNLLNRPSNSLRIH-TSLRN  192

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIAV V      IA++STK +SR+N++AS ++ V I+FII
Sbjct  193  GYNLLDPIAVAVLVITATIAMISTKQASRINWVASAINTVAILFII  238



>ref|NP_181041.1| cationic amino acid transporter 5 [Arabidopsis thaliana]
 sp|O64759.1|CAAT5_ARATH RecName: Full=Cationic amino acid transporter 5 [Arabidopsis 
thaliana]
 gb|AAC12835.1| putative amino acid transporter [Arabidopsis thaliana]
 gb|AEC09043.1| cationic amino acid transporter 5 [Arabidopsis thaliana]
Length=569

 Score =   291 bits (745),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 178/226 (79%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVE-LAAKSRSQHEMKRNLNWWD  295
            K DF PEESF+S+G+Y  AL QT +R ++R+ SRS D+ E    K +S+HEMKR L WWD
Sbjct  13   KRDFFPEESFQSFGSYRAALSQTCSRFKNRLVSRSDDENERFELKKQSEHEMKRCLTWWD  72

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L+WFG G+VIGAGIFVLTGQEA++ AGPA+VLSY VSGLSAMLSVFCYTEFAVEIPVAGG
Sbjct  73   LVWFGFGSVIGAGIFVLTGQEAHEQAGPAIVLSYVVSGLSAMLSVFCYTEFAVEIPVAGG  132

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDF AFI AGNILLE ++G AAVAR+WT Y ATL N+ P +  IK + L  
Sbjct  133  SFAYLRIELGDFAAFITAGNILLESIVGTAAVARAWTSYFATLLNRSPNALRIKTD-LSS  191

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAV V  A   IA +ST+ +S LN+IAS ++ +VI F+I
Sbjct  192  GFNLLDPIAVVVIAASATIASISTRKTSLLNWIASAINTLVIFFVI  237



>ref|XP_009409403.1| PREDICTED: cationic amino acid transporter 5-like [Musa acuminata 
subsp. malaccensis]
Length=593

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 171/226 (76%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K+DF PEESF+SW  YV+AL QT  R RDR   RS D  EL   + +S ++MKR L WWD
Sbjct  22   KEDFFPEESFKSWPAYVSALGQTHRRFRDRFVGRSDDATELGDLRRQSVNDMKRCLTWWD  81

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG G+VIGAGIFVLTGQEA+ HAGPA+VLSY  SG+SAMLSVFCYTEFAVEIPVAGG
Sbjct  82   LTWFGFGSVIGAGIFVLTGQEAHDHAGPAIVLSYVASGISAMLSVFCYTEFAVEIPVAGG  141

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLRVELGDF AFIAA N++LE +IG AAVARSWT YL +L N    S  I  N L +
Sbjct  142  SFAYLRVELGDFAAFIAAANLILESIIGSAAVARSWTSYLTSLLNLPKNSLRIHTN-LAK  200

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             YNLL PIAV V FA   IA++STK +S  N+IAS VH VVI F+I
Sbjct  201  DYNLLDPIAVLVLFATATIAMISTKKTSYFNWIASAVHTVVIAFVI  246



>ref|XP_010040721.1| PREDICTED: cationic amino acid transporter 5-like, partial [Eucalyptus 
grandis]
Length=565

 Score =   291 bits (744),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 174/226 (77%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF PEESFR+WG Y +AL Q   RL+DR+  RS D  EL   + +S+++MKR LNWWD
Sbjct  23   KQDFFPEESFRNWGTYRSALSQMCFRLKDRIKGRSDDVTELQELRKQSENDMKRCLNWWD  82

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIW G+G  IGAGIFVLTGQEA++HAGPA+VLSY V+G SAMLSVFCYTEFAVEIPVAGG
Sbjct  83   LIWVGLGGHIGAGIFVLTGQEAHEHAGPAIVLSYVVAGASAMLSVFCYTEFAVEIPVAGG  142

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLRVELGDFVAFIAAGNILLE V+G AAVAR+WT Y   L N+   S  I   +L  
Sbjct  143  SFAYLRVELGDFVAFIAAGNILLESVVGTAAVARAWTSYFTNLLNRPSNSLRIH-TSLRN  201

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIAV V      IA++STK +SR+N++AS ++ V I+FII
Sbjct  202  GYNLLDPIAVAVLVITATIAMISTKQASRINWVASAINTVAILFII  247



>gb|KGN64456.1| hypothetical protein Csa_1G056920 [Cucumis sativus]
Length=588

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 176/226 (78%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DFLPEESF+SW NY  AL QT  R  DR+ SRS D+ E+   + RS++EMKR L WWD
Sbjct  19   KQDFLPEESFQSWSNYRTALSQTWFRFIDRLQSRSFDENEIGELRKRSENEMKRCLTWWD  78

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG GAVIGAGIFVLTGQEAN+HAGPA+VLSY  SG+SAMLSVFCYTEFA+EIPVAGG
Sbjct  79   LTWFGFGAVIGAGIFVLTGQEANEHAGPAIVLSYVASGISAMLSVFCYTEFAIEIPVAGG  138

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDF AFI AGNILLE ++G AAVARSWT Y  +L ++  +S LI  N L +
Sbjct  139  SFAYLRIELGDFAAFITAGNILLESIVGTAAVARSWTSYFTSLLDRPDKSLLIHTN-LKD  197

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIAV V      IA+ ST+ +S LN+IAS ++ VVI+F+I
Sbjct  198  GYNLLDPIAVAVLAIAATIAMTSTRKTSYLNWIASAINTVVILFVI  243



>ref|XP_010051809.1| PREDICTED: cationic amino acid transporter 5-like [Eucalyptus 
grandis]
 gb|KCW75643.1| hypothetical protein EUGRSUZ_D00009 [Eucalyptus grandis]
Length=623

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 180/226 (80%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF PEESF+SWG+Y +ALRQT  RL+DR+ SRS D  EL   + RS+++MKR LNWWD
Sbjct  23   KQDFFPEESFKSWGSYRSALRQTWFRLKDRIKSRSDDITELGELRKRSENDMKRCLNWWD  82

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG G+VIGAGIFVLTGQEA++HAGPA+VLSY  SG+SAMLSVFCYTEFAVEIPVAGG
Sbjct  83   LTWFGFGSVIGAGIFVLTGQEAHKHAGPAIVLSYVASGVSAMLSVFCYTEFAVEIPVAGG  142

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLRVELGDF AFI AGN+LLE ++G AAVAR+WT Y  +L N+   S  I   +LH+
Sbjct  143  SFAYLRVELGDFAAFITAGNLLLESIVGTAAVARAWTSYFTSLLNRPSNSLRIH-TSLHD  201

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIAV V      IA++ST+ +S +N++AS ++ VVI+F+I
Sbjct  202  GYNLLDPIAVAVLAIAATIAMISTRHTSSINWVASAINTVVILFVI  247



>ref|XP_004145133.2| PREDICTED: cationic amino acid transporter 5 [Cucumis sativus]
Length=598

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 176/226 (78%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DFLPEESF+SW NY  AL QT  R  DR+ SRS D+ E+   + RS++EMKR L WWD
Sbjct  29   KQDFLPEESFQSWSNYRTALSQTWFRFIDRLQSRSFDENEIGELRKRSENEMKRCLTWWD  88

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG GAVIGAGIFVLTGQEAN+HAGPA+VLSY  SG+SAMLSVFCYTEFA+EIPVAGG
Sbjct  89   LTWFGFGAVIGAGIFVLTGQEANEHAGPAIVLSYVASGISAMLSVFCYTEFAIEIPVAGG  148

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDF AFI AGNILLE ++G AAVARSWT Y  +L ++  +S LI  N L +
Sbjct  149  SFAYLRIELGDFAAFITAGNILLESIVGTAAVARSWTSYFTSLLDRPDKSLLIHTN-LKD  207

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIAV V      IA+ ST+ +S LN+IAS ++ VVI+F+I
Sbjct  208  GYNLLDPIAVAVLAIAATIAMTSTRKTSYLNWIASAINTVVILFVI  253



>ref|XP_010504987.1| PREDICTED: cationic amino acid transporter 5 [Camelina sativa]
Length=569

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 177/226 (78%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVE-LAAKSRSQHEMKRNLNWWD  295
            K DF PEESF+S+G+Y  AL QT +R ++R+ SRS D+ E    K +S+HEMKR L WWD
Sbjct  13   KRDFFPEESFQSFGSYRAALSQTCSRFKNRLVSRSDDETERFELKKQSEHEMKRCLTWWD  72

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L+WFG G+VIGAGIFVLTGQEA++ AGPA+VLSY VSG+SAMLSVFCYTEFAVE+PVAGG
Sbjct  73   LVWFGFGSVIGAGIFVLTGQEAHEQAGPAIVLSYVVSGVSAMLSVFCYTEFAVEVPVAGG  132

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDF AFI AGNILLE ++G AAVAR+WT Y ATL N+ P +  IK + L  
Sbjct  133  SFAYLRIELGDFAAFITAGNILLESIVGTAAVARAWTSYFATLLNRKPNALRIKTD-LSS  191

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAV V  A   IA +ST+ +S LN+IAS ++  VI F+I
Sbjct  192  GFNLLDPIAVVVIAAATTIASISTRKTSLLNWIASAINTFVIFFVI  237



>ref|XP_002303714.2| cationic amino acid transporter 5 family protein [Populus trichocarpa]
 gb|EEE78693.2| cationic amino acid transporter 5 family protein [Populus trichocarpa]
Length=589

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 176/226 (78%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DFLPEESF+SWGNY +AL +T  R +DR+ SRS D  E+   + +S++EMKR L WWD
Sbjct  21   KQDFLPEESFQSWGNYRSALSETCFRFKDRLISRSDDVNEIGELRKQSENEMKRCLTWWD  80

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG G+V+GAGIFVLTGQEA++HAGPA+VLSY  SG+SAMLSVFCYTEFAVE+PVAGG
Sbjct  81   LTWFGFGSVVGAGIFVLTGQEAHEHAGPAIVLSYVASGVSAMLSVFCYTEFAVEVPVAGG  140

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDFVAFI AGNILLE + G AAVAR+WT Y   L N+   S  I  N L E
Sbjct  141  SFAYLRIELGDFVAFITAGNILLESIAGSAAVARAWTSYFTNLLNRPSNSLRIHTN-LAE  199

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAVGV      IAI+ST+ +S +N+IA+ ++  VI+F+I
Sbjct  200  GFNLLDPIAVGVLVIAATIAIISTRKTSLINWIATALNTAVILFVI  245



>ref|XP_010028233.1| PREDICTED: cationic amino acid transporter 5-like [Eucalyptus 
grandis]
 gb|KCW54932.1| hypothetical protein EUGRSUZ_I00903 [Eucalyptus grandis]
Length=601

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 174/226 (77%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF PEESFR+WG Y +AL Q   RL+DR+  RS D  EL   + +S+++MKR LNWWD
Sbjct  23   KQDFFPEESFRNWGTYRSALSQMCFRLKDRIKGRSDDVTELQELRKQSENDMKRCLNWWD  82

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIW G+G  IGAGIFVLTGQEA++HAGPA+VLSY V+G SAMLSVFCYTEFAVEIPVAGG
Sbjct  83   LIWVGLGGHIGAGIFVLTGQEAHEHAGPAIVLSYVVAGASAMLSVFCYTEFAVEIPVAGG  142

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLRVELGDFVAFIAAGNILLE V+G AAVAR+WT Y   L N+   S  I   +L  
Sbjct  143  SFAYLRVELGDFVAFIAAGNILLESVVGTAAVARAWTSYFTNLLNRPSNSLRIH-TSLRN  201

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIAV V      IA++STK +SR+N++AS ++ V I+FII
Sbjct  202  GYNLLDPIAVAVLVITATIAMISTKQASRINWVASAINTVAILFII  247



>gb|KEH20726.1| cationic amino acid transporter-like protein [Medicago truncatula]
Length=582

 Score =   290 bits (742),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 151/229 (66%), Positives = 181/229 (79%), Gaps = 1/229 (0%)
 Frame = +2

Query  110  SCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLN  286
            S  +++F PE+SF+S G+Y  A  +TP RL+DR+F+RS D +E+   K+RS H+MK+ LN
Sbjct  6    SGARNEFFPEDSFKSLGDYGKAFMKTPYRLKDRMFTRSKDYMEIVEMKARSSHQMKKTLN  65

Query  287  WWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPV  466
             WDLIWFG+GAV+G+GIFVLTG EA + AGPAVVLSY VSG+SA+LSVFCYTEFAVEIPV
Sbjct  66   GWDLIWFGIGAVVGSGIFVLTGLEAREEAGPAVVLSYAVSGISALLSVFCYTEFAVEIPV  125

Query  467  AGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANA  646
            AGGSFAYLRVELGDFVAFIAAGNILLEYVIG AAVARSWT Y ATL NK+P  F I  + 
Sbjct  126  AGGSFAYLRVELGDFVAFIAAGNILLEYVIGAAAVARSWTSYFATLCNKNPNDFRIIFHN  185

Query  647  LHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            ++  Y  L PIAV    AI  +A+LST+ SS  N IA+I H+VVI FII
Sbjct  186  MNPDYGHLDPIAVIALIAIATLAVLSTRISSLFNKIATIFHLVVIAFII  234



>emb|CDY64649.1| BnaAnng19530D [Brassica napus]
Length=570

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 179/226 (79%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVE-LAAKSRSQHEMKRNLNWWD  295
            K DF PEESF+S+G+Y  AL QT +R ++R+ SRS D+ E +  + +S++EMKR L WWD
Sbjct  13   KRDFFPEESFQSFGSYRAALSQTCSRFKNRLVSRSDDETERVELRKQSENEMKRCLTWWD  72

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L+WFG G+V+GAGIFVLTGQEA + AGPA+VLSY VSG SAMLSVFCYTEF+VE+PVAGG
Sbjct  73   LVWFGFGSVVGAGIFVLTGQEAREEAGPAIVLSYVVSGFSAMLSVFCYTEFSVEVPVAGG  132

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDF AFI AGNILLE V+G AAV R+WT Y ATL N++P++  +K + L  
Sbjct  133  SFAYLRIELGDFAAFITAGNILLEGVVGTAAVGRAWTSYFATLLNRNPDNLRVKTDTLSP  192

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAV V  A   IA +ST+ +S LN+IAS V+ +VI+F+I
Sbjct  193  GFNLLDPIAVVVIAASATIASISTRKTSLLNWIASAVNTIVILFVI  238



>emb|CDY43646.1| BnaA04g20450D [Brassica napus]
Length=570

 Score =   289 bits (740),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 179/226 (79%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVE-LAAKSRSQHEMKRNLNWWD  295
            K DF PEESF+S+G+Y  AL QT +R ++R+ SRS D+ E +  + +S++EMKR L WWD
Sbjct  13   KRDFFPEESFQSFGSYRAALSQTCSRFKNRLVSRSDDETERVELRKQSENEMKRCLTWWD  72

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L+WFG G+V+GAGIFVLTGQEA + AGPA+VLSY VSG SAMLSVFCYTEF+VE+PVAGG
Sbjct  73   LVWFGFGSVVGAGIFVLTGQEAREEAGPAIVLSYVVSGFSAMLSVFCYTEFSVEVPVAGG  132

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDF AFI AGNILLE V+G AAV R+WT Y ATL N++P++  +K + L  
Sbjct  133  SFAYLRIELGDFAAFITAGNILLEGVVGTAAVGRAWTSYFATLLNRNPDNLRVKTDTLSP  192

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAV V  A   IA +ST+ +S LN+IAS V+ +VI+F+I
Sbjct  193  GFNLLDPIAVVVIAASATIASISTRKTSLLNWIASAVNTIVILFVI  238



>ref|XP_009141413.1| PREDICTED: cationic amino acid transporter 5 [Brassica rapa]
Length=570

 Score =   289 bits (740),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 179/226 (79%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVE-LAAKSRSQHEMKRNLNWWD  295
            K DF PEESF+S+G+Y  AL QT +R ++R+ SRS D+ E +  + +S++EMKR L WWD
Sbjct  13   KRDFFPEESFQSFGSYRAALSQTCSRFKNRLVSRSDDETERVELRKQSENEMKRCLTWWD  72

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L+WFG G+V+GAGIFVLTGQEA + AGPA+VLSY VSG SAMLSVFCYTEF+VE+PVAGG
Sbjct  73   LVWFGFGSVVGAGIFVLTGQEAREEAGPAIVLSYVVSGFSAMLSVFCYTEFSVEVPVAGG  132

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDF AFI AGNILLE V+G AAV R+WT Y ATL N++P++  +K + L  
Sbjct  133  SFAYLRIELGDFAAFITAGNILLEGVVGTAAVGRAWTSYFATLLNRNPDNLRVKTDTLSP  192

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAV V  A   IA +ST+ +S LN+IAS V+ +VI+F+I
Sbjct  193  GFNLLDPIAVVVIAASATIASISTRKTSLLNWIASAVNTIVILFVI  238



>ref|XP_003630017.1| High affinity cationic amino acid transporter [Medicago truncatula]
 gb|AET04493.1| cationic amino acid transporter-like protein [Medicago truncatula]
Length=599

 Score =   290 bits (742),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 158/258 (61%), Positives = 192/258 (74%), Gaps = 14/258 (5%)
 Frame = +2

Query  23   SSPSRSIEIKMEVETKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLR  202
            SSPS    I  ++ T+N G+            +++F PE+SF+S G+Y  A  +TP RL+
Sbjct  7    SSPS-CYPILHDMGTENSGA------------RNEFFPEDSFKSLGDYGKAFMKTPYRLK  53

Query  203  DRVFSRSLDQVELAA-KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGP  379
            DR+F+RS D +E+   K+RS H+MK+ LN WDLIWFG+GAV+G+GIFVLTG EA + AGP
Sbjct  54   DRMFTRSKDYMEIVEMKARSSHQMKKTLNGWDLIWFGIGAVVGSGIFVLTGLEAREEAGP  113

Query  380  AVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIG  559
            AVVLSY VSG+SA+LSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIG
Sbjct  114  AVVLSYAVSGISALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIG  173

Query  560  GAAVARSWTYYLATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSS  739
             AAVARSWT Y ATL NK+P  F I  + ++  Y  L PIAV    AI  +A+LST+ SS
Sbjct  174  AAAVARSWTSYFATLCNKNPNDFRIIFHNMNPDYGHLDPIAVIALIAIATLAVLSTRISS  233

Query  740  RLNYIASIVHMVVIVFII  793
              N IA+I H+VVI FII
Sbjct  234  LFNKIATIFHLVVIAFII  251



>ref|XP_010915551.1| PREDICTED: cationic amino acid transporter 5-like isoform X2 
[Elaeis guineensis]
Length=590

 Score =   289 bits (740),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 175/228 (77%), Gaps = 2/228 (1%)
 Frame = +2

Query  113  CGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-AKSRSQHEMKRNLNW  289
            C K DF PE+SF SW  Y  AL QT  R +DR+  RS D  EL   + +S+++MKR L+W
Sbjct  16   CSKKDFFPEKSFESWAAYKAALGQTHHRFKDRLLCRSSDATELGEVRKQSENDMKRCLSW  75

Query  290  WDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVA  469
            WDL WFG G+VIGAGIFVLTGQEA+ HAGPA++LSY  SG+SAMLSVFCYTEF+VEIPVA
Sbjct  76   WDLTWFGFGSVIGAGIFVLTGQEAHDHAGPAIILSYVASGISAMLSVFCYTEFSVEIPVA  135

Query  470  GGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANAL  649
            GGSFAYLRVELGDF AFIAA N++LE ++G AAVAR+WT YLATL N+   S  I  + L
Sbjct  136  GGSFAYLRVELGDFAAFIAAANLILEGIVGKAAVARAWTSYLATLLNRSSNSLRIHTH-L  194

Query  650  HEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             +G+NLL PIAV +      IA++STK +S+ N+IAS VH+VVIVF+I
Sbjct  195  DKGFNLLDPIAVIILAVTATIAMISTKRTSQFNWIASAVHLVVIVFVI  242



>dbj|BAJ88234.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=613

 Score =   290 bits (741),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 146/227 (64%), Positives = 171/227 (75%), Gaps = 2/227 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFS-RSLDQVELAA-KSRSQHEMKRNLNWW  292
            KDDF PE SF SWG Y  AL  TPARLRDR+ + RS D  EL A + RS++EM+R L WW
Sbjct  19   KDDFFPEPSFASWGAYRGALAATPARLRDRLLAGRSTDAAELGAMRRRSENEMRRCLTWW  78

Query  293  DLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAG  472
            DL W G G  +GAGIFVLTGQEA  HAGPAVVLSY V+G+SAMLSV  Y EFAVEIPVAG
Sbjct  79   DLTWLGFGCHLGAGIFVLTGQEARDHAGPAVVLSYAVAGISAMLSVLIYAEFAVEIPVAG  138

Query  473  GSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALH  652
            GSFAYLRVELGD  AF+AA N++LE VIG AAVAR+WT YLA++FN    +  +   +L 
Sbjct  139  GSFAYLRVELGDVAAFVAAANLILETVIGTAAVARAWTSYLASIFNMPVSALRVHVPSLG  198

Query  653  EGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            +GYN L PIA  V  A  I+A+LSTKGSSR N++AS VH++VI FII
Sbjct  199  DGYNELDPIASAVILATAIMAMLSTKGSSRFNWVASTVHLLVIAFII  245



>ref|XP_008372126.1| PREDICTED: cationic amino acid transporter 5-like, partial [Malus 
domestica]
Length=296

 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 172/228 (75%), Gaps = 2/228 (1%)
 Frame = +2

Query  113  CGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNW  289
            C K DFLPEESF++W  Y  AL QT  R ++R+ SRS D  E+   + +S+++MKR L W
Sbjct  19   CSKQDFLPEESFQNWSXYRTALSQTGHRFKNRLLSRSNDNDEIGELRKQSENDMKRCLTW  78

Query  290  WDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVA  469
            WDL+WFG G+VIGAGIFVLTG E  +HAGPA+VLSY  SGLSAMLSVFCYTEF++EIPVA
Sbjct  79   WDLMWFGFGSVIGAGIFVLTGLETQRHAGPAIVLSYVASGLSAMLSVFCYTEFSIEIPVA  138

Query  470  GGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANAL  649
            GG+FAYLR+ELGDFVAFI AGNILLE ++G A +AR+WT Y   L N HP + L     L
Sbjct  139  GGAFAYLRIELGDFVAFITAGNILLESIVGSAGLARAWTSYFTALLN-HPSNSLRIHTNL  197

Query  650  HEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             EG+NLL PIAV V      IA++ST+ +S LN+IAS V+ V+I+F+I
Sbjct  198  AEGFNLLDPIAVXVLAIAXTIAMISTRKTSYLNWIASAVNNVIILFVI  245



>ref|XP_002454959.1| hypothetical protein SORBIDRAFT_03g002130 [Sorghum bicolor]
 gb|EES00079.1| hypothetical protein SORBIDRAFT_03g002130 [Sorghum bicolor]
Length=612

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 175/226 (77%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            +DDF PE SF SWG Y  AL +TP+RLRDR+  RS D  EL A + RS++EM+R L WWD
Sbjct  25   RDDFFPEPSFASWGAYRRALGETPSRLRDRLAGRSTDAAELGALRRRSENEMRRCLTWWD  84

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG G+VIGAGIFVLTGQEA+ HAGPA+VLSY  SGLSAMLSVFCYTEFAVEIPVAGG
Sbjct  85   LTWFGFGSVIGAGIFVLTGQEAHDHAGPAIVLSYVASGLSAMLSVFCYTEFAVEIPVAGG  144

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLRVELGD  AFIAA N++LE VIG AAVARSWT YLA+L NK   +  I A  L  
Sbjct  145  SFAYLRVELGDAAAFIAAANLILESVIGTAAVARSWTSYLASLINKPASALRIHAPGLAP  204

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GY+ L PIAV V      +A+L+ KG+SR+N++AS VH+VVI F+I
Sbjct  205  GYDELDPIAVVVIAVTATLAMLTAKGTSRVNWVASAVHVVVIGFVI  250



>ref|XP_010915550.1| PREDICTED: cationic amino acid transporter 5-like isoform X1 
[Elaeis guineensis]
Length=611

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 175/228 (77%), Gaps = 2/228 (1%)
 Frame = +2

Query  113  CGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-AKSRSQHEMKRNLNW  289
            C K DF PE+SF SW  Y  AL QT  R +DR+  RS D  EL   + +S+++MKR L+W
Sbjct  37   CSKKDFFPEKSFESWAAYKAALGQTHHRFKDRLLCRSSDATELGEVRKQSENDMKRCLSW  96

Query  290  WDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVA  469
            WDL WFG G+VIGAGIFVLTGQEA+ HAGPA++LSY  SG+SAMLSVFCYTEF+VEIPVA
Sbjct  97   WDLTWFGFGSVIGAGIFVLTGQEAHDHAGPAIILSYVASGISAMLSVFCYTEFSVEIPVA  156

Query  470  GGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANAL  649
            GGSFAYLRVELGDF AFIAA N++LE ++G AAVAR+WT YLATL N+   S  I  + L
Sbjct  157  GGSFAYLRVELGDFAAFIAAANLILEGIVGKAAVARAWTSYLATLLNRSSNSLRIHTH-L  215

Query  650  HEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             +G+NLL PIAV +      IA++STK +S+ N+IAS VH+VVIVF+I
Sbjct  216  DKGFNLLDPIAVIILAVTATIAMISTKRTSQFNWIASAVHLVVIVFVI  263



>ref|XP_010516664.1| PREDICTED: cationic amino acid transporter 5-like [Camelina sativa]
Length=569

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 177/226 (78%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVE-LAAKSRSQHEMKRNLNWWD  295
            K DF PEESF+S+G+Y  AL QT +R ++R+ SRS D+ E    K +S+HEMKR L WWD
Sbjct  13   KRDFFPEESFQSFGSYRAALSQTCSRFKNRLVSRSDDETERFELKKQSEHEMKRCLTWWD  72

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L+WFG G+VIGAGIFVLTGQEA++ AGPA+VLSY VSG+SAMLSVFCYTEF++E+PVAGG
Sbjct  73   LVWFGFGSVIGAGIFVLTGQEAHEQAGPAIVLSYVVSGVSAMLSVFCYTEFSMEVPVAGG  132

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDF AFI AGNILLE ++G AAVAR+WT Y ATL N+ P +  IK + L  
Sbjct  133  SFAYLRIELGDFAAFITAGNILLESIVGTAAVARAWTSYFATLLNRKPNALRIKTD-LSS  191

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAV V  A   IA +ST+ +S LN+IAS ++  VI F+I
Sbjct  192  GFNLLDPIAVVVIAAATTIASISTRKTSLLNWIASAINTFVIFFVI  237



>ref|XP_008225925.1| PREDICTED: cationic amino acid transporter 5-like [Prunus mume]
Length=590

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 173/226 (77%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DFLPEESF+SW  Y  AL QT  R ++R+ SRS D  E+     RS+++MKR L WWD
Sbjct  21   KQDFLPEESFQSWSTYRTALSQTGYRFKNRLISRSDDNNEIGELPKRSENDMKRCLTWWD  80

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIWFG G+VIGAGIFVLTGQE + HAGPA+VLSY  SG+SAMLSVFCYTEF+VE+PVAGG
Sbjct  81   LIWFGFGSVIGAGIFVLTGQETHDHAGPAIVLSYVASGVSAMLSVFCYTEFSVEVPVAGG  140

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            +FAYLR+ELGDF+AFI AGNILLE  +G AAVARSWT Y  +L N+   S  I  N L E
Sbjct  141  AFAYLRIELGDFIAFITAGNILLEGFVGSAAVARSWTSYFTSLLNRPSNSLRIHTN-LTE  199

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIAV V      IA++ST+ +S LN+IASIV+ VVI+F+I
Sbjct  200  GYNLLDPIAVAVLTIAATIAMISTRKTSYLNWIASIVNNVVILFVI  245



>emb|CAA17531.1| amino acid transport protein AAT1 [Arabidopsis thaliana]
 emb|CAB79112.1| amino acid transport protein AAT1 [Arabidopsis thaliana]
Length=533

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = +2

Query  248  KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLS  427
            K+RS HEMK+ L WWDL+WFG+GAVIG+GIFVLTG EA  H+GPAVVLSY VSG+SAMLS
Sbjct  2    KARSGHEMKKTLTWWDLMWFGIGAVIGSGIFVLTGLEARNHSGPAVVLSYVVSGVSAMLS  61

Query  428  VFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLF  607
            VFCYTEFAVEIPVAGGSFAYLRVELGDF+AFIAAGNI+LEYV+GGAAVARSWT Y ATL 
Sbjct  62   VFCYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNIILEYVVGGAAVARSWTSYFATLL  121

Query  608  NKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVF  787
            N  PE F I  + L E Y+ L PIAVGVC  IC++A++ TKGSSR NYIASI+HMVVI+F
Sbjct  122  NHKPEDFRIIVHKLGEDYSHLDPIAVGVCAIICVLAVVGTKGSSRFNYIASIIHMVVILF  181

Query  788  II  793
            +I
Sbjct  182  VI  183



>ref|XP_011022320.1| PREDICTED: cationic amino acid transporter 5 [Populus euphratica]
Length=589

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 175/226 (77%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DFLPEESF+SWGNY +AL +T  R +DR+ SRS D  E+   + +S++EMKR L WWD
Sbjct  21   KQDFLPEESFQSWGNYRSALSETCFRFKDRLISRSDDVNEIGELRKQSENEMKRCLTWWD  80

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG G+V+GAGIFVLTGQEA++HAGPA+VLSY  SG+SAMLSVFCYTEFAVE+PVAGG
Sbjct  81   LTWFGFGSVVGAGIFVLTGQEAHEHAGPAIVLSYVASGVSAMLSVFCYTEFAVEVPVAGG  140

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGD+V FI AGNILLE + G AAVAR+WT Y   L N+   S  I  N L E
Sbjct  141  SFAYLRIELGDYVVFITAGNILLESIAGSAAVARAWTSYFTNLLNRPSNSLRIHTN-LAE  199

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAVGV      IAI+ST+ +S +N+IA+ ++  VI+F+I
Sbjct  200  GFNLLDPIAVGVLVIAATIAIISTRKTSLINWIATALNTAVILFVI  245



>ref|XP_006363175.1| PREDICTED: cationic amino acid transporter 5-like [Solanum tuberosum]
Length=583

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 175/226 (77%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF P +SF++W  Y +AL QT  RL++RV SRS D  E+   +  S++EMKR L+WWD
Sbjct  15   KHDFFPGDSFQNWSAYRSALSQTFTRLKERVASRSEDADEIVELRKESENEMKRCLSWWD  74

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIWFG G+VIGAGIFVLTGQEA++HAGPA+VLSY  SG+SAMLSVFCYTEFAVEIPVAGG
Sbjct  75   LIWFGFGSVIGAGIFVLTGQEAHEHAGPAIVLSYVASGISAMLSVFCYTEFAVEIPVAGG  134

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAY+RVELGDF AFI AGNI+L  + G AAVAR+WT Y  TL N+HP S  I  N L +
Sbjct  135  SFAYIRVELGDFAAFITAGNIILGSIAGSAAVARAWTSYFTTLLNRHPNSLRIHTN-LID  193

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAV +     IIAI ST+ +S LN+IAS V+MVVI F+I
Sbjct  194  GFNLLDPIAVAILAITSIIAISSTRRTSYLNWIASAVNMVVISFVI  239



>ref|XP_010540618.1| PREDICTED: cationic amino acid transporter 5 [Tarenaya hassleriana]
Length=584

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 177/228 (78%), Gaps = 6/228 (3%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRS---LDQVELAAKSRSQHEMKRNLNW  289
            K+DFLPEESF+SW +Y  AL QT  RL++R  SRS    ++VEL  K +S+++MKR L W
Sbjct  22   KNDFLPEESFQSWSHYTTALSQTCLRLKNRATSRSDEAHERVEL--KKQSENDMKRCLTW  79

Query  290  WDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVA  469
            WDL+WFG G+++GAGIFVLTGQEA+ HAGPA+VLSY  SG+SAMLSVFCYTEFAVEIPVA
Sbjct  80   WDLLWFGFGSIVGAGIFVLTGQEAHNHAGPAIVLSYVASGISAMLSVFCYTEFAVEIPVA  139

Query  470  GGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANAL  649
            GGSFAYLR+ELGDF AFI AGNILLE ++G AAVAR+WT Y ATL N+ P+S  IK    
Sbjct  140  GGSFAYLRIELGDFAAFITAGNILLESIVGTAAVARAWTSYFATLLNRQPDSLRIKTRFA  199

Query  650  HEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             E +NLL PIAV V      IA +ST+ +S LN+IAS ++ +VI F+I
Sbjct  200  RE-FNLLDPIAVVVLLVSATIASISTRKTSYLNWIASAINTLVIFFVI  246



>ref|XP_010509683.1| PREDICTED: cationic amino acid transporter 5-like [Camelina sativa]
Length=569

 Score =   287 bits (734),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 176/226 (78%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVE-LAAKSRSQHEMKRNLNWWD  295
            K DF PEESF+S+G+Y  AL QT +R ++R+ SRS D  E    K +S+HEMKR L WWD
Sbjct  13   KRDFFPEESFQSFGSYRAALSQTCSRFKNRLVSRSDDDTERFELKKQSEHEMKRCLTWWD  72

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L+WFG G+VIGAGIFVLTGQEA++ AGPA+VLSY VSG+SAMLSVFCYTEF+VE+PVAGG
Sbjct  73   LVWFGFGSVIGAGIFVLTGQEAHEQAGPAIVLSYVVSGVSAMLSVFCYTEFSVEVPVAGG  132

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDF AFI AGNI+LE ++G AAVAR+WT Y ATL N+ P +  IK + L  
Sbjct  133  SFAYLRIELGDFAAFITAGNIILESIVGTAAVARAWTSYFATLLNRKPNALRIKTD-LSS  191

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAV V  A   IA +ST+ +S LN+IAS ++  VI F+I
Sbjct  192  GFNLLDPIAVVVIAASTTIASISTRKTSLLNWIASAINTFVIFFVI  237



>ref|XP_001761522.1| predicted protein [Physcomitrella patens]
 gb|EDQ73590.1| predicted protein [Physcomitrella patens]
Length=594

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 181/228 (79%), Gaps = 3/228 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRS-LDQVELAAKSRSQHEMKRNLNWWD  295
            +  +LPEESF+SWGNY  AL  TP+RL+DRVF+R+ +++  ++ K+RS  +MK+NLNWWD
Sbjct  2    RGSWLPEESFQSWGNYRRALAATPSRLKDRVFARTEVNEEVISMKARSNVDMKKNLNWWD  61

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L+WFG+GAV+GAGIFV+TG EA  +AGPA+V+SY ++G SAMLSVFCYTEFAVEIPVAGG
Sbjct  62   LMWFGIGAVVGAGIFVITGVEAKNYAGPAIVISYAIAGFSAMLSVFCYTEFAVEIPVAGG  121

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPE--SFLIKANAL  649
            SFAYLRVELGDFVAFI AGNI+LEYVIGGAAVAR WT Y A+L     +    L     L
Sbjct  122  SFAYLRVELGDFVAFIGAGNIVLEYVIGGAAVARGWTSYFASLIFSGIDVGDRLRIHTDL  181

Query  650  HEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             EGYN L PIAVGV   + ++A  STKG+S +N+IASI++M +I F+I
Sbjct  182  AEGYNKLDPIAVGVLILVGLLATWSTKGTSFVNWIASILNMFIIAFVI  229



>ref|XP_004498422.1| PREDICTED: cationic amino acid transporter 1-like, partial [Cicer 
arietinum]
Length=598

 Score =   288 bits (736),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 170/219 (78%), Gaps = 2/219 (1%)
 Frame = +2

Query  140  ESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-AKSRSQHEMKRNLNWWDLIWFGMG  316
            ESF S  NY  AL  TP RL +RV +RS D+VEL   + +S+HEMK+ L+WWDLIWFGMG
Sbjct  23   ESFASLSNYGRALLYTPCRLLNRVTARSNDEVELVDVRKQSKHEMKKTLSWWDLIWFGMG  82

Query  317  AVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGGSFAYLRV  496
            +V+G+GIFVLTG E     GPAVVLSY VSG+SAMLSVFCYTEFAVEIPVAGGSFAY+RV
Sbjct  83   SVVGSGIFVLTGLEVRNIVGPAVVLSYVVSGISAMLSVFCYTEFAVEIPVAGGSFAYIRV  142

Query  497  ELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHEGYNLLXP  676
            ELG+F AFIA+GNILLEYVIGGAAV+RSWT Y ATL N+ P         L   YN L P
Sbjct  143  ELGEFAAFIASGNILLEYVIGGAAVSRSWTSYFATLCNQ-PSDXXXXXXTLSRNYNKLDP  201

Query  677  IAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            IAV V   IC  A+ STKGSSRLNYIASIVH++V++FII
Sbjct  202  IAVFVLAIICTFAVFSTKGSSRLNYIASIVHVIVLMFII  240



>ref|XP_007214132.1| hypothetical protein PRUPE_ppa018037mg [Prunus persica]
 gb|EMJ15331.1| hypothetical protein PRUPE_ppa018037mg [Prunus persica]
Length=600

 Score =   288 bits (736),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 173/226 (77%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DFLPEESF+SW  Y  AL QT  R ++R+ SRS D  E+     RS+++MKR L WWD
Sbjct  21   KQDFLPEESFQSWSTYRTALSQTGYRFKNRLISRSDDNNEIGELPKRSENDMKRCLTWWD  80

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIWFG G+VIGAGIFVLTGQE + HAGPA+VLSY  SG+SAMLSVFCYTEF+VE+PVAGG
Sbjct  81   LIWFGFGSVIGAGIFVLTGQETHDHAGPAIVLSYVASGVSAMLSVFCYTEFSVEVPVAGG  140

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            +FAYLR+ELGDF+AFI AGNILLE  +G AAVARSWT Y  +L N+   S  I  N L E
Sbjct  141  AFAYLRIELGDFIAFITAGNILLEGFVGSAAVARSWTSYFTSLLNRPSNSLRIHTN-LTE  199

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAV V      IA++ST+ +S LN+IASIV+ VVI+F+I
Sbjct  200  GFNLLDPIAVAVLTIAATIAMISTRKTSYLNWIASIVNNVVILFVI  245



>ref|XP_007138538.1| hypothetical protein PHAVU_009G217500g [Phaseolus vulgaris]
 gb|ESW10532.1| hypothetical protein PHAVU_009G217500g [Phaseolus vulgaris]
Length=588

 Score =   287 bits (734),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 174/218 (80%), Gaps = 1/218 (0%)
 Frame = +2

Query  101  RGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAAKS-RSQHEMKR  277
            RGCS  K+DFLPEESF+SWGNY  AL +TP RL+DR  +RS ++VE+   + RS H+MK+
Sbjct  10   RGCSVQKNDFLPEESFKSWGNYKAALLETPRRLKDRFLTRSNERVEIGEMTVRSSHQMKK  69

Query  278  NLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVE  457
             LNWWDLIW G+G+VIGAGIFVLTG EA    GPAV+LS+ VSG SAMLSVFCYTEFAVE
Sbjct  70   TLNWWDLIWLGVGSVIGAGIFVLTGMEARNVTGPAVILSFVVSGFSAMLSVFCYTEFAVE  129

Query  458  IPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIK  637
            IPVAGGSFAYLRVELGDFVAFIAAGNILLEYVI  AAVARSWT Y ATL NK+P+ F I 
Sbjct  130  IPVAGGSFAYLRVELGDFVAFIAAGNILLEYVISCAAVARSWTSYFATLCNKNPDDFRIV  189

Query  638  ANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNY  751
             + ++  Y+ L PIAV V   +CI+A+ STKGSS  NY
Sbjct  190  IHNMNSNYSHLDPIAVLVLVLVCILAVRSTKGSSIFNY  227



>ref|XP_009617281.1| PREDICTED: LOW QUALITY PROTEIN: cationic amino acid transporter 
5 [Nicotiana tomentosiformis]
Length=583

 Score =   287 bits (734),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 175/226 (77%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF PE+SF++W  Y +AL QT +R +DRV SRS D  E+   + +S++EMKR L+W D
Sbjct  15   KQDFFPEDSFQNWSTYRSALSQTFSRFKDRVASRSEDADEIGEIRKQSENEMKRCLSWXD  74

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG G+VIGAGIFVLTGQEA++HAGPA++LSY  SG+SAMLSVFCYTEFAVEIPVAGG
Sbjct  75   LTWFGFGSVIGAGIFVLTGQEAHKHAGPAIILSYVASGISAMLSVFCYTEFAVEIPVAGG  134

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAY+RVELGDF AFI AGNI+L  + GGAAVAR+WT Y  TL N HP S  I  N L +
Sbjct  135  SFAYIRVELGDFAAFITAGNIILGSIAGGAAVARAWTSYFTTLLNLHPNSLRIHTN-LAD  193

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAV V     IIAI ST+ +S  N+IAS V+M+VI+F+I
Sbjct  194  GFNLLDPIAVAVLVITSIIAISSTRRTSYFNWIASAVNMMVILFVI  239



>gb|ADB92669.1| cationic amino acid transporter 5 [Populus tremula x Populus 
alba]
Length=589

 Score =   287 bits (734),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 174/226 (77%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DFLPEESF+SWGNY +AL +T  R +DR+ SRS D  E+   + +S++EMKR L WWD
Sbjct  21   KQDFLPEESFQSWGNYRSALSETCFRFKDRLISRSDDVNEIGELRKQSENEMKRCLTWWD  80

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG G+V+GAGIFVLTGQEA++HAGPA+VLSY  SG+SAMLSVFCYTE AVE+PVAGG
Sbjct  81   LTWFGFGSVVGAGIFVLTGQEAHEHAGPAIVLSYVASGVSAMLSVFCYTELAVEVPVAGG  140

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDFVAFI AGNILLE + G AAVAR+WT Y   L N    S  I  N L E
Sbjct  141  SFAYLRIELGDFVAFITAGNILLESIAGSAAVARAWTSYFTNLLNLPSNSLRIHTN-LAE  199

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAVGV      IAI+ST+ +S +N+IA+ ++  VI+F+I
Sbjct  200  GFNLLDPIAVGVLVIAATIAIISTRKTSLINWIATALNTAVILFVI  245



>ref|XP_006410652.1| hypothetical protein EUTSA_v10016446mg [Eutrema salsugineum]
 gb|ESQ52105.1| hypothetical protein EUTSA_v10016446mg [Eutrema salsugineum]
Length=570

 Score =   286 bits (732),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 174/226 (77%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVE-LAAKSRSQHEMKRNLNWWD  295
            K DF PEESF+S  +Y  AL QT +R ++R+ SRS D+ E    + +S+HEMKR L WWD
Sbjct  13   KKDFFPEESFQSLASYRAALSQTCSRFKNRLVSRSDDENERFELRKQSEHEMKRCLTWWD  72

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L+WFG G+VIGAGIFVLTGQEA++ AGPA+VLSY VSG SAMLSVFCYTEFAVEIPVAGG
Sbjct  73   LLWFGFGSVIGAGIFVLTGQEAHEQAGPAIVLSYVVSGFSAMLSVFCYTEFAVEIPVAGG  132

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDF AFI AGNILLE ++G AAVAR+WT Y ATL N+ P +  IK +    
Sbjct  133  SFAYLRIELGDFAAFITAGNILLESIVGTAAVARAWTSYFATLLNRSPNALRIKTDLTSP  192

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAV V      +A +ST+ +S LN+IAS ++ +VI+F+I
Sbjct  193  GFNLLDPIAVLVLAVAATLASISTRKTSLLNWIASAINTLVILFVI  238



>ref|XP_002881367.1| hypothetical protein ARALYDRAFT_482460 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57626.1| hypothetical protein ARALYDRAFT_482460 [Arabidopsis lyrata subsp. 
lyrata]
Length=569

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 177/226 (78%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVE-LAAKSRSQHEMKRNLNWWD  295
            K DF PEESF+S+G+Y  AL QT +R ++R+ SRS D+ E    K +S+HEMKR L WWD
Sbjct  13   KSDFFPEESFQSFGSYRAALSQTCSRFKNRLVSRSDDENERFELKKQSEHEMKRCLTWWD  72

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L+WFG G+VIGAGIFVLTGQEA++ AGPA+VLSY VSGLSAMLSVF YTEFAVEIPVAGG
Sbjct  73   LVWFGFGSVIGAGIFVLTGQEAHEQAGPAIVLSYVVSGLSAMLSVFFYTEFAVEIPVAGG  132

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDF AFI AGNILLE ++G AAVAR+WT Y ATL N+ P +  I+ + L  
Sbjct  133  SFAYLRIELGDFAAFITAGNILLESIVGTAAVARAWTSYFATLLNRSPNALRIRTD-LSS  191

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAV V  A   IA +ST+ +S LN+IAS ++ +VI F+I
Sbjct  192  GFNLLDPIAVVVIAASATIASISTRKTSLLNWIASAINTLVIFFVI  237



>ref|XP_006295596.1| hypothetical protein CARUB_v10024707mg [Capsella rubella]
 gb|EOA28494.1| hypothetical protein CARUB_v10024707mg [Capsella rubella]
Length=576

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 179/228 (79%), Gaps = 2/228 (1%)
 Frame = +2

Query  113  CGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVE-LAAKSRSQHEMKRNLNW  289
            C K DF PEESF+++G+Y  AL QT +R ++R+ SRS D+ E    K +S+HEMKR L W
Sbjct  11   CSKRDFFPEESFQTFGSYRAALSQTCSRFKNRLVSRSDDENERFELKKQSEHEMKRCLTW  70

Query  290  WDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVA  469
            WDL+WFG G+VIGAGIFVLTGQEA++ AGPA+VLSY VSG+SAMLSVFCYTEFAVEIPVA
Sbjct  71   WDLVWFGFGSVIGAGIFVLTGQEAHEQAGPAIVLSYVVSGISAMLSVFCYTEFAVEIPVA  130

Query  470  GGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANAL  649
            GGSFAYLR+ELGDF AFI AGNILLE ++G AAVAR+WT Y +TL N+ P +  IK + L
Sbjct  131  GGSFAYLRIELGDFAAFITAGNILLESIVGTAAVARAWTSYFSTLLNRKPNALRIKTD-L  189

Query  650  HEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
              G+NLL PIAV V  A   IA +ST+ +S LN+IAS ++ +VI F+I
Sbjct  190  SSGFNLLDPIAVVVVAASATIASISTRKTSLLNWIASAINTLVIFFVI  237



>emb|CDP18179.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 167/215 (78%), Gaps = 2/215 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-AKSRSQHEMKRNLNWWD  295
            K DF PEESF+SW NY +AL QT  R +DR+  RS D  E+   +  S+++MK+ L+WWD
Sbjct  22   KKDFFPEESFQSWSNYRSALSQTGLRFKDRLVGRSDDANEVGEVRKESENDMKKCLSWWD  81

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIWFG G+VIGAGIFVLTGQEA++HAGPA+VLSY  SG+SAMLSVFCYTEFAVEIPVAGG
Sbjct  82   LIWFGFGSVIGAGIFVLTGQEAHKHAGPAIVLSYVASGISAMLSVFCYTEFAVEIPVAGG  141

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLRVELGDF AFIAAGNILLE ++G AAVAR+WT Y  TL N+HP S  I  N L +
Sbjct  142  SFAYLRVELGDFAAFIAAGNILLECMVGNAAVARAWTSYFTTLLNRHPNSLRIHTN-LAD  200

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
            GYNLL PIAV V      IA+ STK +S  N+IAS
Sbjct  201  GYNLLDPIAVVVLVVASTIAMTSTKKTSYFNWIAS  235



>ref|XP_009765076.1| PREDICTED: cationic amino acid transporter 5 [Nicotiana sylvestris]
Length=589

 Score =   286 bits (731),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 172/226 (76%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF PEESF++W  Y +AL QT  R +DRV SRS D  E+   + +S++EMK  L+WWD
Sbjct  21   KHDFFPEESFQNWSTYRSALSQTFTRFKDRVASRSEDADEIEELRKQSENEMKHCLSWWD  80

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG G+VIGAGIFVLTGQEA++HAGPA++LSY  SG+SAMLSVFCYTEFAVEIPVAGG
Sbjct  81   LTWFGFGSVIGAGIFVLTGQEAHEHAGPAIILSYVASGISAMLSVFCYTEFAVEIPVAGG  140

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAY+RVELGDF AFI AGNI+L  + GGAAVAR+WT Y  TL N HP S  I    L +
Sbjct  141  SFAYIRVELGDFAAFITAGNIILGSIAGGAAVARAWTSYFTTLLNLHPNSLRIHTK-LAD  199

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIA  V     IIAI ST+ +S  N+IAS V+M+VI+F+I
Sbjct  200  GFNLLDPIAAAVLVITSIIAISSTRRTSYFNWIASAVNMMVILFVI  245



>ref|XP_010678963.1| PREDICTED: cationic amino acid transporter 5 [Beta vulgaris subsp. 
vulgaris]
Length=578

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 170/226 (75%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DFLP ESF SW  Y   + QT  R +DR+ SRS D  EL   + +S+++MKR LNWWD
Sbjct  20   KCDFLPGESFTSWNAYKLEVSQTCYRFKDRMMSRSNDADELGEIRQQSKNDMKRCLNWWD  79

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIWFG G+VIG GIFVLTGQE + HAGPA+VLSY VSG SAMLSVFCYTEFAVEIPVAGG
Sbjct  80   LIWFGFGSVIGTGIFVLTGQETHDHAGPAIVLSYIVSGFSAMLSVFCYTEFAVEIPVAGG  139

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELG+FVAFIAA NILLE ++G AAVAR WT Y  TL N+ P S     N L +
Sbjct  140  SFAYLRIELGEFVAFIAAANILLEGIVGSAAVARGWTSYFTTLLNREPNSLRFHTN-LAK  198

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAVGV      +AILSTK +S  N+IAS V+ VVI+F+I
Sbjct  199  GFNLLDPIAVGVLIIASTLAILSTKKTSIFNWIASAVNTVVIIFVI  244



>ref|XP_004982336.1| PREDICTED: uncharacterized protein LOC101754459 [Setaria italica]
Length=1185

 Score =   295 bits (755),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 153/245 (62%), Positives = 182/245 (74%), Gaps = 2/245 (1%)
 Frame = +2

Query  32   SRSIEIKMEV-ETKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDR  208
            SR  +  M V +  NGG     R RGC C K DF PEESF SW  Y  ALR T +RL DR
Sbjct  577  SRPADTAMAVGDDANGGGGVRRRQRGCLCTKADFFPEESFSSWSAYGRALRSTGSRLADR  636

Query  209  VFSRSLDQVEL-AAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAV  385
            + SRS +  EL   ++RS  +M+R+L WWDL+WFG+GAVIGAGIFVLTGQEA+   GPA+
Sbjct  637  LTSRSAESAELHEVRARSGADMRRDLTWWDLVWFGVGAVIGAGIFVLTGQEAHDAVGPAI  696

Query  386  VLSYTVSGLSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGA  565
            V+SY +SG+SAMLSVFCYTEF VEIPVAGGSFAYLRVELGDF+AF+AAGNILLEY IGGA
Sbjct  697  VVSYVISGVSAMLSVFCYTEFGVEIPVAGGSFAYLRVELGDFMAFVAAGNILLEYCIGGA  756

Query  566  AVARSWTYYLATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRL  745
            AVAR+WT Y ATL N  P  F I A++L   Y+ L PIAV V   +C+ A++STKG+SR 
Sbjct  757  AVARAWTSYFATLLNHKPNDFRIHASSLSAEYSELDPIAVVVIALVCVFAVVSTKGTSRF  816

Query  746  NYIAS  760
            NY+ S
Sbjct  817  NYVLS  821



>ref|XP_004232627.2| PREDICTED: cationic amino acid transporter 5 [Solanum lycopersicum]
Length=592

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 173/226 (77%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF P +SF++W  Y +AL QT  RL+DRV +RS D  E+   +  S++EMKR L+WWD
Sbjct  24   KHDFFPGDSFQNWSAYRSALSQTFTRLKDRVANRSDDAEEIVELRKESENEMKRCLSWWD  83

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG G+VIGAGIFVLTGQEA++HAGPA+VLSY  SG+SAMLSVFCYTEFAVEIPVAGG
Sbjct  84   LTWFGFGSVIGAGIFVLTGQEAHEHAGPAIVLSYVASGISAMLSVFCYTEFAVEIPVAGG  143

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAY+RVELGDF AFI AGNI+L  + G AAVAR+WT Y  TL N+HP S  I  N L +
Sbjct  144  SFAYIRVELGDFAAFITAGNIILGSIAGSAAVARAWTSYFTTLLNRHPNSLRIHTN-LID  202

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAV +     IIAI ST+ +S  N+IAS V+MVVI F+I
Sbjct  203  GFNLLDPIAVAILAITSIIAISSTRRTSYFNWIASAVNMVVISFVI  248



>ref|XP_009340268.1| PREDICTED: cationic amino acid transporter 5-like [Pyrus x bretschneideri]
Length=590

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 176/228 (77%), Gaps = 2/228 (1%)
 Frame = +2

Query  113  CGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKRNLNW  289
            C K DFLPEESF++W  Y  AL QT  R ++R+ SRS D  E+   + +S+++MKR L W
Sbjct  19   CSKQDFLPEESFQNWSTYRAALSQTGHRFKNRLLSRSNDNDEIRELRKQSENDMKRCLTW  78

Query  290  WDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVA  469
            WDLIWFG G+VIGAGIFVLTGQE ++HAGPA+VLSY  SG+SAMLSVFCYTEF+VE+PVA
Sbjct  79   WDLIWFGFGSVIGAGIFVLTGQETHKHAGPAIVLSYVASGISAMLSVFCYTEFSVEVPVA  138

Query  470  GGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANAL  649
            GG+FAYLR+ELGDFVAFI AGNILLE ++G AAVAR+WT Y  TL N+   S  I  N L
Sbjct  139  GGAFAYLRIELGDFVAFITAGNILLESIVGSAAVARAWTSYFTTLLNRPSNSLRIHTN-L  197

Query  650  HEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             EG+NLL PIAV V      IA++ST+ +S LN+IAS V+ V+I+F+I
Sbjct  198  AEGFNLLDPIAVAVLAVAATIAMISTRKTSYLNWIASAVNNVIILFVI  245



>ref|XP_011085215.1| PREDICTED: cationic amino acid transporter 1-like isoform X1 
[Sesamum indicum]
Length=580

 Score =   283 bits (724),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 161/223 (72%), Gaps = 32/223 (14%)
 Frame = +2

Query  95   RIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAAKSRSQHEMK  274
            R RGC+C KDDFLPEESFRSW NYVNAL++TPARL DRV +RS +Q EL  K+RS+H+MK
Sbjct  16   RRRGCTCTKDDFLPEESFRSWSNYVNALKETPARLVDRVLTRSNEQGELEVKARSEHDMK  75

Query  275  RNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAV  454
            + LNWWDL+WFGMGAVIGAGIFVLTG EA   AGPAVVLSY VSG SA+LSVFCYTEFAV
Sbjct  76   KTLNWWDLMWFGMGAVIGAGIFVLTGLEARDEAGPAVVLSYVVSGTSALLSVFCYTEFAV  135

Query  455  EIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLI  634
            EIPV                                AAVARSWT Y ATL N  P+ F I
Sbjct  136  EIPV--------------------------------AAVARSWTSYFATLCNHKPDDFRI  163

Query  635  KANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASI  763
            +A+ L +GYN L PI++G+   +CI+A++STKGSSRLNYIAS+
Sbjct  164  QAHNLPDGYNQLDPISIGIIICVCILAVMSTKGSSRLNYIASV  206



>ref|XP_010687038.1| PREDICTED: cationic amino acid transporter 1-like [Beta vulgaris 
subsp. vulgaris]
Length=580

 Score =   282 bits (722),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 141/224 (63%), Positives = 180/224 (80%), Gaps = 1/224 (0%)
 Frame = +2

Query  92   MRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHE  268
            ++ RGCSC K+DFLPE SF+SW NY+NAL++ P R  DRV +RS D +EL   K+RSQ+E
Sbjct  2    IKRRGCSCTKEDFLPENSFQSWTNYLNALKEIPTRFIDRVVARSQDYIELHEVKARSQNE  61

Query  269  MKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEF  448
            M + L  WDLIWFG+G++IGAG+FVLTG EA +HAGPAVV+SY ++G SAMLSV CY EF
Sbjct  62   MIKILTGWDLIWFGVGSLIGAGVFVLTGLEAKEHAGPAVVVSYLIAGASAMLSVLCYIEF  121

Query  449  AVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESF  628
            A+EIPVAGGSFAYL+VELGDF+AF+AAGNILLEY++GGAA+AR+WT Y ATL +  P+ F
Sbjct  122  AIEIPVAGGSFAYLKVELGDFMAFLAAGNILLEYILGGAALARAWTSYFATLCDHVPDEF  181

Query  629  LIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
             + A +L + YN L PIAV V   IC++A+ STK SSR+N+ A+
Sbjct  182  RVTAPSLGKDYNQLDPIAVVVVAVICVLAVTSTKVSSRVNFFAT  225



>emb|CDP18177.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   282 bits (722),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 164/215 (76%), Gaps = 2/215 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-AKSRSQHEMKRNLNWWD  295
            K DF PEESF+SW NY +AL QT  R +DR   RS D  E+   +  S+++MK+ L+WWD
Sbjct  22   KKDFFPEESFQSWSNYRSALSQTGIRFKDRFVGRSDDANEVGEVRKESENDMKKCLSWWD  81

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIWFG G+VIGAGIFVLTGQEA++HAGPA+VLSY  SG+SAMLSVFCYTEFAVEIPVAGG
Sbjct  82   LIWFGFGSVIGAGIFVLTGQEAHKHAGPAIVLSYVASGISAMLSVFCYTEFAVEIPVAGG  141

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLRVELGDF AFIAAGNI LE ++G AAVAR+WT Y  TL N+HP S     N L +
Sbjct  142  SFAYLRVELGDFAAFIAAGNIFLECMVGNAAVARAWTSYFTTLLNRHPNSLRFHTN-LAD  200

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
            GYNLL PIAV V      IA+ STK +S  N+IAS
Sbjct  201  GYNLLDPIAVVVLVVASTIAMTSTKKTSYFNWIAS  235



>gb|ABA99390.1| Amino acid permease family protein [Oryza sativa Japonica Group]
 gb|EEE53600.1| hypothetical protein OsJ_36854 [Oryza sativa Japonica Group]
Length=601

 Score =   282 bits (721),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 168/223 (75%), Gaps = 1/223 (0%)
 Frame = +2

Query  128  FLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKRNLNWWDLIW  304
              PEESF SWG Y  AL +T  RL +R  +RS   VE+   + RS  EMKRNL WWDL W
Sbjct  26   LFPEESFASWGAYGRALMETGPRLVERPTARSAAAVEVNEVRGRSGAEMKRNLTWWDLAW  85

Query  305  FGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGGSFA  484
            FG+GAVIGAGIFVLTGQEA   AGPAVVLSY VSG+SAMLSV CYTEFA+EIPVAGGSFA
Sbjct  86   FGVGAVIGAGIFVLTGQEARDAAGPAVVLSYAVSGVSAMLSVLCYTEFAIEIPVAGGSFA  145

Query  485  YLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHEGYN  664
            YLRVELGDFVAFIAAGNILLEY IGGAAVAR+WT Y ATL N  P  F I A +L   Y+
Sbjct  146  YLRVELGDFVAFIAAGNILLEYCIGGAAVARAWTSYFATLLNHRPNDFRIHAASLAADYS  205

Query  665  LLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             L PIAV V   +C +++LSTK SSR NY  SI H+ V+VFI+
Sbjct  206  RLDPIAVAVIAVVCALSVLSTKASSRFNYALSIAHLAVLVFIV  248



>ref|XP_008383266.1| PREDICTED: cationic amino acid transporter 5-like [Malus domestica]
Length=590

 Score =   281 bits (719),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 176/228 (77%), Gaps = 2/228 (1%)
 Frame = +2

Query  113  CGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKRNLNW  289
            C K DFLPEESF++W  Y  AL QT  R ++R+ SRS D  E+   + +S+++MKR L W
Sbjct  19   CSKQDFLPEESFQNWSTYGAALSQTGHRFKNRLLSRSNDNDEIRELRKQSENDMKRCLTW  78

Query  290  WDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVA  469
            WDLIWFG G+VIGAGIFVLTGQE ++HAGPA+VLSY  SG+SAMLSVFCYTEF+VE+PVA
Sbjct  79   WDLIWFGFGSVIGAGIFVLTGQETHKHAGPAIVLSYVASGISAMLSVFCYTEFSVEVPVA  138

Query  470  GGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANAL  649
            GG+FAYLR+ELGDFVAFI AGNILLE ++G AAVAR+WT Y  TL N+   S  I  N L
Sbjct  139  GGAFAYLRIELGDFVAFITAGNILLESIVGSAAVARAWTSYFTTLLNRPSNSLRIHTN-L  197

Query  650  HEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             EG+NLL PIAV V      IA++ST+ +S LN+IAS V+ V+I+F+I
Sbjct  198  AEGFNLLDPIAVAVLAIAATIAMISTRKTSYLNWIASAVNNVIILFVI  245



>ref|XP_004293806.1| PREDICTED: cationic amino acid transporter 5 [Fragaria vesca 
subsp. vesca]
Length=593

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 173/226 (77%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVE-LAAKSRSQHEMKRNLNWWD  295
            K DFLPEESF+SW  Y  AL QT  R +DR+ SRS D  E +  + +S+++MKR L WWD
Sbjct  21   KQDFLPEESFQSWSAYQTALSQTHHRFKDRLISRSNDANETVELRKQSENDMKRCLTWWD  80

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIWFG G+VIGAGIFVLTGQE + HAGPA+VLSY  SG+SAMLSVFCYTEF+VEIPVAGG
Sbjct  81   LIWFGFGSVIGAGIFVLTGQETHDHAGPAIVLSYVASGISAMLSVFCYTEFSVEIPVAGG  140

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDFVAFI AGNILLE V+G AAV+R+WT Y  +L N+   S  +  N L E
Sbjct  141  SFAYLRIELGDFVAFITAGNILLESVVGSAAVSRAWTSYFTSLLNRPSNSLRLHTN-LTE  199

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIAV V      I ++ST+ +S LN+IAS ++ VVI+F++
Sbjct  200  GYNLLDPIAVVVLAVAATITMISTRKTSYLNWIASAINNVVILFVL  245



>gb|KFK36400.1| hypothetical protein AALP_AA4G119400 [Arabis alpina]
Length=572

 Score =   279 bits (714),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 178/228 (78%), Gaps = 1/228 (0%)
 Frame = +2

Query  113  CGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVE-LAAKSRSQHEMKRNLNW  289
            C K DF PEESF+S+G+Y  AL QT  R ++R  SRS D+ E    + +S++EMKR+L W
Sbjct  13   CSKKDFYPEESFQSFGSYRAALSQTCFRFKNRFVSRSDDENERFELRKQSENEMKRSLTW  72

Query  290  WDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVA  469
            WDL+WFG G+VIGAGIFVLTGQEA++ AGPA+VLSY VSG SAMLSVFCYTEFAVEIPVA
Sbjct  73   WDLVWFGFGSVIGAGIFVLTGQEAHEQAGPAIVLSYVVSGFSAMLSVFCYTEFAVEIPVA  132

Query  470  GGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANAL  649
            GGSFAYLR+ELGDF AFI AGNILLE ++G AAVAR+WT Y ATL N++P +  IK +  
Sbjct  133  GGSFAYLRIELGDFAAFITAGNILLESIVGTAAVARAWTSYFATLLNRNPNALRIKTDLT  192

Query  650  HEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
              G++LL PIAV V  A   IA +ST+ +S +N+IAS V+ +VI+F+I
Sbjct  193  SPGFDLLDPIAVVVIVAAATIASISTRKTSLINWIASAVNTLVIIFVI  240



>gb|KJB48037.1| hypothetical protein B456_008G051200 [Gossypium raimondii]
Length=585

 Score =   278 bits (712),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 176/226 (78%), Gaps = 6/226 (3%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DFLPEESF++W  Y++AL Q  +R  DR+ SRS D  E+   + +S+++MKR L WWD
Sbjct  20   KVDFLPEESFQNWNTYLSALSQIYSRFNDRLLSRSDDANEITQLRKQSENDMKRCLTWWD  79

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG G+VIGAGIFVLTGQEA+ HAGPA+VLSY  SG+SAMLSVFCYTEFAVEIPVAGG
Sbjct  80   LTWFGFGSVIGAGIFVLTGQEAHHHAGPAIVLSYVASGISAMLSVFCYTEFAVEIPVAGG  139

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDFVAFI AGNILLE ++GGAAVAR+WT Y ATL N+ P+S  I      +
Sbjct  140  SFAYLRIELGDFVAFITAGNILLESIVGGAAVARAWTSYFATLLNRQPDSLRIP-----K  194

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G  LL PIAV V      IA++STK +S+LN+IA+ ++ +VI+F++
Sbjct  195  GNYLLDPIAVAVLAIAATIAMISTKKTSQLNWIATALNTLVILFVL  240



>ref|XP_003565484.1| PREDICTED: cationic amino acid transporter 5 [Brachypodium distachyon]
Length=621

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 167/215 (78%), Gaps = 2/215 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            KDDF PE SF SWG Y +AL  TPARLRDR   RS D +EL A + RS++EM+R L WWD
Sbjct  28   KDDFFPEPSFSSWGAYRSALAATPARLRDRFTGRSTDAIELGALRRRSENEMRRCLTWWD  87

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG G+VIGAGIFVLTGQEA+  AGPA+VLSY VSGLSAMLSVFCYTEFAVEIPVAGG
Sbjct  88   LTWFGFGSVIGAGIFVLTGQEAHDDAGPAIVLSYVVSGLSAMLSVFCYTEFAVEIPVAGG  147

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLRVELGD  AFIAA N++LE +IG AAVARSWT YLA+L N  P S L    +L E
Sbjct  148  SFAYLRVELGDVAAFIAAANLILESIIGTAAVARSWTSYLASLINM-PVSKLRIHTSLVE  206

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
            GYN L P+AV V      +A+LS KG+SR+N++AS
Sbjct  207  GYNELDPVAVVVIAVTATMAMLSAKGTSRINWVAS  241



>ref|XP_002273828.1| PREDICTED: cationic amino acid transporter 5 [Vitis vinifera]
Length=589

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 174/226 (77%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DFLPEESF++W +Y +AL QT  R +DR+ SRS D +E+   + +S+++MKR L WWD
Sbjct  21   KQDFLPEESFKNWASYRSALSQTCFRFKDRLTSRSEDAIEIGEMRKQSENDMKRCLTWWD  80

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG G+VIGAGIFVLTGQEA+ HAGPA+VLSY  SG+SA+LSVFCYTEFAVEIPVAGG
Sbjct  81   LTWFGFGSVIGAGIFVLTGQEAHDHAGPAIVLSYVASGVSALLSVFCYTEFAVEIPVAGG  140

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLR+ELGDF AFI AGNILLE ++G A VAR+WT Y  TL N+   S  I  N L +
Sbjct  141  SFAYLRIELGDFAAFITAGNILLESIVGSAGVARAWTSYFTTLLNRPTNSLRIHTN-LTK  199

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIAV V      +A++ST+ +S  N+IAS ++ VVI+F+I
Sbjct  200  GYNLLDPIAVAVLAIAATLAMISTRKTSVFNWIASAINTVVILFVI  245



>gb|EAY83876.1| hypothetical protein OsI_39096 [Oryza sativa Indica Group]
Length=601

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 148/223 (66%), Positives = 166/223 (74%), Gaps = 1/223 (0%)
 Frame = +2

Query  128  FLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKRNLNWWDLIW  304
              PEESF SWG Y  AL +T  RL +R  + S   VE+   + RS  EMKRNL WWDL W
Sbjct  26   LFPEESFASWGAYGRALMETGPRLVERATAGSAAAVEVNEVRGRSGAEMKRNLTWWDLAW  85

Query  305  FGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGGSFA  484
            FG+GAVIGAGIFVLTGQEA   AGPAVVLSY VSG+SAMLSV CYTEFA+EIPVAGGSFA
Sbjct  86   FGVGAVIGAGIFVLTGQEARDAAGPAVVLSYAVSGVSAMLSVLCYTEFAIEIPVAGGSFA  145

Query  485  YLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHEGYN  664
            YLRVELGDFV FIAAGNILLEY IGGAAVAR+WT Y ATL N  P  F I A +L   Y+
Sbjct  146  YLRVELGDFVVFIAAGNILLEYCIGGAAVARAWTSYFATLLNHRPNDFRIHAASLAADYS  205

Query  665  LLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             L PIAV V   +C +++LSTK SSR NY  SI H+ V+VFI+
Sbjct  206  RLDPIAVAVIAVVCALSVLSTKASSRFNYALSIAHLAVLVFIV  248



>ref|XP_003576816.1| PREDICTED: cationic amino acid transporter 5-like [Brachypodium 
distachyon]
Length=620

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 165/227 (73%), Gaps = 2/227 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFS-RSLDQVELAA-KSRSQHEMKRNLNWW  292
            KDDF PE SF SW  Y  AL  TP+RL DR  + RS D  EL A + RS++EM+R L WW
Sbjct  31   KDDFFPEPSFASWATYRAALAATPSRLADRFLAGRSTDAAELGAMRRRSENEMRRCLTWW  90

Query  293  DLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAG  472
            DL W G G  +GAGIFVLTGQE+  HAGPA+VLSY V+G SAMLSV CY EFAVEIPVAG
Sbjct  91   DLTWLGFGCHLGAGIFVLTGQESRDHAGPAIVLSYVVAGASAMLSVLCYAEFAVEIPVAG  150

Query  473  GSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALH  652
            GSFAYLRVELGD  AF+AA N++LE  IG AAVAR+WT YLA+L NK   +  +   +L 
Sbjct  151  GSFAYLRVELGDVAAFVAAANLMLESAIGTAAVARAWTSYLASLLNKPASALRVHLASLP  210

Query  653  EGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            +GYN L PIA  V      +A+ STKGSSR+N+IAS VH++VI FII
Sbjct  211  DGYNDLDPIAASVIAVTACLAMASTKGSSRVNWIASAVHLLVIAFII  257



>gb|KJB32882.1| hypothetical protein B456_005G266500 [Gossypium raimondii]
Length=566

 Score =   276 bits (706),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 148/236 (63%), Positives = 171/236 (72%), Gaps = 31/236 (13%)
 Frame = +2

Query  89   GMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQH  265
            G+R RGCSC KDDFLPEESF+SWGNYV AL+QTP R  DRVF+RSLD  EL   K+RSQH
Sbjct  11   GVRRRGCSCTKDDFLPEESFKSWGNYVQALQQTPERFMDRVFTRSLDSTELHEIKARSQH  70

Query  266  EMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTE  445
            EMK+ L+WWDLIWFG+GAVIGAGIFVLTG +A + +GPAVV+SY VSG+SAMLSVFCYTE
Sbjct  71   EMKKTLSWWDLIWFGIGAVIGAGIFVLTGLQAREVSGPAVVISYVVSGISAMLSVFCYTE  130

Query  446  FAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPES  625
            FAVEIPVAG                              AAVARSWT Y ATL N  PE 
Sbjct  131  FAVEIPVAG------------------------------AAVARSWTSYFATLCNHKPED  160

Query  626  FLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            F I  +++ E Y  L PIAV V   IC++A+LSTKGSSR NYIASI+H++VI+FII
Sbjct  161  FRIIVHSMSEDYGHLDPIAVVVVCVICVLAVLSTKGSSRFNYIASIIHVIVILFII  216



>ref|XP_004504191.1| PREDICTED: cationic amino acid transporter 1-like [Cicer arietinum]
Length=556

 Score =   275 bits (703),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 165/205 (80%), Gaps = 1/205 (0%)
 Frame = +2

Query  182  QTPARLRDRVFSRSLDQVELA-AKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQE  358
            + P RL+DR F+RS D +E+   K+RS ++MK+ LNWWDLIWFG+GAV+G+GIFVLTG E
Sbjct  2    EIPFRLKDRAFTRSKDYMEIVEMKARSNNQMKKTLNWWDLIWFGIGAVVGSGIFVLTGLE  61

Query  359  ANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNI  538
            A +  GPAVVLSY VSG+SA+LSVFCYTEFAVEIPVAGGSFAYLRVE+GDFVA+IAAGNI
Sbjct  62   AREEVGPAVVLSYVVSGISALLSVFCYTEFAVEIPVAGGSFAYLRVEMGDFVAYIAAGNI  121

Query  539  LLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAI  718
            LLEYVIG AAVARSWT Y ATL NK+P+ F I  + ++  ++ L PIAV    AI  +A+
Sbjct  122  LLEYVIGAAAVARSWTSYFATLCNKNPDDFRIIVHNMNPDFSHLDPIAVVALIAISTLAV  181

Query  719  LSTKGSSRLNYIASIVHMVVIVFII  793
             STK SS  N IA+IVH++VI FII
Sbjct  182  CSTKASSAFNKIATIVHLIVISFII  206



>emb|CBI27231.3| unnamed protein product [Vitis vinifera]
Length=702

 Score =   278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/260 (57%), Positives = 185/260 (71%), Gaps = 3/260 (1%)
 Frame = +2

Query  20   CSSPSRSIEIKMEVETKNGGSESGMRIRGC-SCGKDDFLPEESFRSWGNYVNALRQTPAR  196
            C     S+ I+  V    G     ++ RG     K DFLPEESF++W +Y +AL QT  R
Sbjct  102  CIHHLSSLPIREAVMGSMGEVGDEIQPRGYWRWSKQDFLPEESFKNWASYRSALSQTCFR  161

Query  197  LRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHA  373
             +DR+ SRS D +E+   + +S+++MKR L WWDL WFG G+VIGAGIFVLTGQEA+ HA
Sbjct  162  FKDRLTSRSEDAIEIGEMRKQSENDMKRCLTWWDLTWFGFGSVIGAGIFVLTGQEAHDHA  221

Query  374  GPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYV  553
            GPA+VLSY  SG+SA+LSVFCYTEFAVEIPVAGGSFAYLR+ELGDF AFI AGNILLE +
Sbjct  222  GPAIVLSYVASGVSALLSVFCYTEFAVEIPVAGGSFAYLRIELGDFAAFITAGNILLESI  281

Query  554  IGGAAVARSWTYYLATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKG  733
            +G A VAR+WT Y  TL N+   S  I  N L +GYNLL PIAV V      +A++ST+ 
Sbjct  282  VGSAGVARAWTSYFTTLLNRPTNSLRIHTN-LTKGYNLLDPIAVAVLAIAATLAMISTRK  340

Query  734  SSRLNYIASIVHMVVIVFII  793
            +S  N+IAS ++ VVI+F+I
Sbjct  341  TSVFNWIASAINTVVILFVI  360



>ref|XP_010092716.1| Cationic amino acid transporter 8 [Morus notabilis]
 gb|EXB52061.1| Cationic amino acid transporter 8 [Morus notabilis]
Length=588

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 170/226 (75%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K+DF PE SF ++  Y  A+ +T +RL+DR+  RS D+ EL   + +S+HEMKR L WWD
Sbjct  26   KEDFFPEPSFENFTAYRAAVSETCSRLKDRLLDRSTDETELVELRKQSEHEMKRCLTWWD  85

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIW   G+V+G+GIF +TGQE  + AGPA+V+SY +SGLSA+LSVFCYTEFAVEIP AGG
Sbjct  86   LIWLSFGSVVGSGIFTITGQETRETAGPAIVVSYAISGLSALLSVFCYTEFAVEIPCAGG  145

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SF+YLR+ELGDFVAFIAAGNILLE V+G A + RSW+ YL ++F   P+   IK N+  E
Sbjct  146  SFSYLRIELGDFVAFIAAGNILLEAVVGAAGLGRSWSSYLVSIFWDDPDFLRIKVNSFAE  205

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAV V      IA+  TK +SRLN+I+SI+  ++IVFII
Sbjct  206  GFNLLDPIAVVVLLIANGIAMTGTKLTSRLNWISSIMSAMIIVFII  251



>ref|XP_010915549.1| PREDICTED: cationic amino acid transporter 5-like [Elaeis guineensis]
Length=593

 Score =   271 bits (693),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 161/217 (74%), Gaps = 2/217 (1%)
 Frame = +2

Query  113  CGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-AKSRSQHEMKRNLNW  289
            C K DF PE+SF SW  Y  AL QT  R +DR+  RS D  EL   + +S+++MKR L W
Sbjct  19   CSKKDFFPEKSFESWAAYKAALGQTHHRFKDRLLGRSSDATELGEVRKQSENDMKRCLGW  78

Query  290  WDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVA  469
            WDL WFG G+ +GAGIFVLTGQEA  HAGPA+VLSY  SG+SAMLSVFCYTEF+VEIPVA
Sbjct  79   WDLTWFGFGSALGAGIFVLTGQEARHHAGPAIVLSYVASGISAMLSVFCYTEFSVEIPVA  138

Query  470  GGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANAL  649
            GGSFAYLRVELGDF AFIAA N++LE V+G AAVAR+WT YLATL N+   S  I  + L
Sbjct  139  GGSFAYLRVELGDFAAFIAAANLILESVVGSAAVARAWTSYLATLLNRPSNSLRIHTH-L  197

Query  650  HEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
             +G+NLL PIA  V  A   IA++STK +S  N+IAS
Sbjct  198  AKGFNLLDPIAAIVLAATATIAMISTKRTSYFNWIAS  234



>ref|XP_008781696.1| PREDICTED: cationic amino acid transporter 5-like [Phoenix dactylifera]
Length=594

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 164/226 (73%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAAKSR-SQHEMKRNLNWWD  295
            K DF PE SFRSW  Y +AL  T  RLRDR+  RS    EL A  R S+H ++R LNWWD
Sbjct  23   KADFFPEPSFRSWSAYRSALSATGPRLRDRLLHRSDSAAELRALPRQSEHGLRRCLNWWD  82

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L+W G G+V+G GIFVLTGQEA  ++GPA+ L+Y  +GLSA+LSVFCY EFAVEIP AGG
Sbjct  83   LVWLGFGSVVGTGIFVLTGQEARFNSGPAIPLAYAAAGLSALLSVFCYAEFAVEIPSAGG  142

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SF+YLRVELGDFVAF+AAGNILLE ++G A + RSWT Y ATL ++ P+S  I A AL +
Sbjct  143  SFSYLRVELGDFVAFLAAGNILLEALVGAAGLGRSWTSYFATLLDRDPDSLRIHAPALAD  202

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAV V      I I  T+ +S LN++ S++ + VI FII
Sbjct  203  GFNLLDPIAVVVLLTCSTITIFGTRHTSTLNWLTSLLSVAVIAFII  248



>ref|XP_010279630.1| PREDICTED: cationic amino acid transporter 8, vacuolar-like [Nelumbo 
nucifera]
 ref|XP_010279631.1| PREDICTED: cationic amino acid transporter 8, vacuolar-like [Nelumbo 
nucifera]
Length=588

 Score =   269 bits (688),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 166/226 (73%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF PE+SF+SW  Y +A+ QT  RL+DR+  RS +  EL   + +S+++MKR L WWD
Sbjct  20   KKDFFPEQSFQSWATYRSAVSQTCFRLKDRLLDRSTEMNELDVLRRQSENDMKRCLTWWD  79

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIW   G+V+G GIFVLTGQEA+ HAGP++VLSY  SG+SA+LSVFCYTEFAVEIPVAGG
Sbjct  80   LIWLSFGSVVGTGIFVLTGQEAHNHAGPSIVLSYAASGISALLSVFCYTEFAVEIPVAGG  139

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SF+YLRVELGDFVAFIAAGNILLE ++G A + RSW+ Y  T  N  P +  I  +   E
Sbjct  140  SFSYLRVELGDFVAFIAAGNILLESIVGAAGLGRSWSSYFQTFINLKPNALCIHVSKFAE  199

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAV       +IA+  T+ +S LN+I S++  V+IVFI+
Sbjct  200  GFNLLDPIAVFALIIPSVIAMSGTRLTSHLNWIPSLLSAVLIVFIV  245



>ref|XP_010028234.1| PREDICTED: cationic amino acid transporter 5-like [Eucalyptus 
grandis]
 gb|KCW54934.1| hypothetical protein EUGRSUZ_I00905 [Eucalyptus grandis]
Length=601

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 172/226 (76%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF PEESFR+WG Y +AL Q   RL+DR+  RS D  EL   + RS+++MKR L+WWD
Sbjct  23   KQDFFPEESFRNWGTYRSALSQMCFRLKDRIQGRSDDVTELQELRKRSENDMKRCLSWWD  82

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L W G+G  IGAGIFVLTGQEA++HAGPA+VLSY V+G SAML+VFCYTEFAVEIPVAGG
Sbjct  83   LTWVGLGGHIGAGIFVLTGQEAHKHAGPAIVLSYVVAGASAMLAVFCYTEFAVEIPVAGG  142

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAYLRVELGDF AFIAAGNILLE V+G AAVAR+WT Y   L N+   S  I   +L  
Sbjct  143  SFAYLRVELGDFAAFIAAGNILLESVVGAAAVARAWTSYFTNLLNRPSNSLRIH-TSLRN  201

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYNLL PIAV V      IA++STK +SR+N++AS ++ V I+FII
Sbjct  202  GYNLLDPIAVAVLVITATIAMISTKQASRINWVASAINTVAILFII  247



>ref|XP_011082871.1| PREDICTED: cationic amino acid transporter 8, vacuolar [Sesamum 
indicum]
Length=611

 Score =   270 bits (690),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 168/216 (78%), Gaps = 1/216 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVEL-AAKSRSQHEMKRNLNWWD  295
            K+DF PE +FR++  Y++AL +TP RL+DRV  RS D  EL  +K +S++EMK+ L WWD
Sbjct  43   KEDFFPEPTFRNFSTYLSALSETPHRLKDRVLGRSSDANELIQSKKQSENEMKKCLTWWD  102

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L+W G G+V+G+GIF +TGQE + HAGPA+VLSY VSGLSA+LSVFCYTEFAVEIP+AGG
Sbjct  103  LVWLGFGSVVGSGIFSITGQETHDHAGPAIVLSYAVSGLSALLSVFCYTEFAVEIPIAGG  162

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SF++LRVELGDF+AFIAAGNI LE ++G A + RSW+ Y+A++F   P+   IK ++  E
Sbjct  163  SFSFLRVELGDFIAFIAAGNIFLEALVGAAGLGRSWSSYVASIFKSDPDFLRIKVDSFAE  222

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASI  763
            G+NLL P+AV V   +  IA++ TK SS LN++ SI
Sbjct  223  GFNLLDPLAVVVLAIVNGIAVMGTKRSSILNWVGSI  258



>ref|XP_004983495.1| PREDICTED: cationic amino acid transporter 5-like [Setaria italica]
Length=594

 Score =   269 bits (687),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 174/226 (77%), Gaps = 2/226 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            KDDF PE SF SW  Y  AL  TPARLRDR+  RS D  EL A + RS++EM+R L WWD
Sbjct  32   KDDFFPEPSFGSWAAYRAALAATPARLRDRLVGRSTDAAELGALRRRSENEMRRCLTWWD  91

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L WFG G+VIGAGIFVLTGQEA  HAGPA+VLSY  SGLSA+LSVFCYTEFAVEIPVAGG
Sbjct  92   LTWFGFGSVIGAGIFVLTGQEARDHAGPAIVLSYAASGLSAILSVFCYTEFAVEIPVAGG  151

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SFAY+RVELGD  AF+AA N++LE VIG AAVARSWT YLA+L NK P S L    +L E
Sbjct  152  SFAYIRVELGDAAAFVAAANLILESVIGKAAVARSWTSYLASLMNK-PASALRIQTSLAE  210

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYN L PIAV V      +A+ S+KG+SR+N++AS VH++VI F+I
Sbjct  211  GYNELDPIAVAVIAVTAALAMASSKGTSRVNWVASAVHVLVIAFVI  256



>ref|XP_010062740.1| PREDICTED: cationic amino acid transporter 8, vacuolar-like [Eucalyptus 
grandis]
 gb|KCW69872.1| hypothetical protein EUGRSUZ_F03210 [Eucalyptus grandis]
Length=584

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 164/226 (73%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF PEESF ++ +Y  AL QT  RLRDR+ +RS    EL   K  S++EMKR LNWWD
Sbjct  16   KRDFYPEESFVNFASYGKALSQTWPRLRDRILTRSTQSKELVELKKESENEMKRCLNWWD  75

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIW   G+V+G+GIFVLTGQEA+ HAGPA+VLSY +SGLSA+LS FCYTEFAVEIPVAGG
Sbjct  76   LIWLCFGSVVGSGIFVLTGQEAHDHAGPAIVLSYAISGLSALLSAFCYTEFAVEIPVAGG  135

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SF+YLR+ELGDF+AFIAAGNILLE ++G A + RSWT Y  ++    P+ F      L E
Sbjct  136  SFSYLRIELGDFIAFIAAGNILLEAIVGAAGLGRSWTSYFTSMIKNDPDFFRFHVKGLPE  195

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL P+AV V      IA+  TK +S LN+I S++   VIV I+
Sbjct  196  GFNLLDPMAVAVLVVANSIAMAGTKQASCLNWIGSVISAGVIVLIL  241



>ref|XP_010911512.1| PREDICTED: LOW QUALITY PROTEIN: cationic amino acid transporter 
5-like [Elaeis guineensis]
Length=595

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 164/226 (73%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAAKSR-SQHEMKRNLNWWD  295
            K DF PE SF+SW  Y +AL  T  RLRDR+  RS    EL A  R S+H ++R LNWWD
Sbjct  23   KADFFPEPSFQSWSAYRSALSSTCPRLRDRLLHRSDSAAELHALPRQSEHGLRRCLNWWD  82

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L+W G G+V+G GIFVLTG+EA  ++GPA+ L+Y  +GLSA+LSVFCY EFAVEIP AGG
Sbjct  83   LVWLGFGSVVGTGIFVLTGEEARVNSGPAIPLAYAAAGLSALLSVFCYAEFAVEIPSAGG  142

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SF+YLRVELGDFVAF+AA NILLE ++G A VARSWT Y ATL ++ P+S  I A AL +
Sbjct  143  SFSYLRVELGDFVAFLAAANILLEALVGAAGVARSWTSYFATLIDRDPDSLRIHAPALAD  202

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAV V      I I  T+ +S LN++ S++ + VI FII
Sbjct  203  GFNLLDPIAVVVLLTCSTITIFGTRHASTLNWLTSLLSVAVIAFII  248



>gb|KDO45646.1| hypothetical protein CISIN_1g007913mg [Citrus sinensis]
Length=396

 Score =   261 bits (666),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 136/253 (54%), Positives = 178/253 (70%), Gaps = 9/253 (4%)
 Frame = +2

Query  53   MEVETKNGGSESGMRIRGCSC----GKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSR  220
            M VET+   +E    +RG SC     K  F PE SF +  +Y +AL+QT  RL++R+FSR
Sbjct  1    MAVETE---TELETPLRGTSCWHQWNKQAFFPEPSFENTTSYKSALKQTYPRLKNRLFSR  57

Query  221  SLDQVELAA-KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSY  397
            S D  EL   +  S+  +++ L WWDL W   G+V+G+GIFV+TGQEA +HAGPA+VLSY
Sbjct  58   STDATELITLQQESKQPLQKCLTWWDLTWLCFGSVVGSGIFVITGQEAKKHAGPAIVLSY  117

Query  398  TVSGLSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVAR  577
              SGLSA+LS FCYTEFAVEIPVAGGSF++LRVELGDFVA+IAAGNILLE V+G A +AR
Sbjct  118  LASGLSALLSAFCYTEFAVEIPVAGGSFSFLRVELGDFVAYIAAGNILLEAVVGAAGLAR  177

Query  578  SWTYYLATLFNKHPESFL-IKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYI  754
            SW+ YLA++ + +    L  K +   +G+NLL P+AV +      IA+  T+ SS LN+I
Sbjct  178  SWSSYLASMIDSNNSDLLRFKVDCFADGFNLLDPVAVLILLVCNGIAMSGTRRSSWLNWI  237

Query  755  ASIVHMVVIVFII  793
            +SIV   VIVF+I
Sbjct  238  SSIVSSCVIVFVI  250



>ref|XP_004251831.1| PREDICTED: cationic amino acid transporter 8, vacuolar [Solanum 
lycopersicum]
Length=617

 Score =   267 bits (682),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 171/226 (76%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF PE SF ++G+Y NAL QTP RL++R+FSRS D  EL   K  S++EMK  L WWD
Sbjct  50   KQDFFPEPSFHNFGSYKNALSQTPNRLKNRLFSRSSDTSELIELKKESENEMKLCLTWWD  109

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIW G G+V+G+GIF +TGQE    AGPA+VLSY +SGLSA+LSVFCYTEF+V+IPVAGG
Sbjct  110  LIWLGFGSVVGSGIFSITGQETRNDAGPAIVLSYAISGLSALLSVFCYTEFSVDIPVAGG  169

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SF++LR+ELGDFVAFIAA NILLE ++G A + RSW+ Y A++ N +P+   IK ++  E
Sbjct  170  SFSFLRIELGDFVAFIAAANILLEAMVGAAGLGRSWSSYFASIINNNPDFLRIKIDSFVE  229

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAV V     ++AI  TK +S LN+I+SI+   VIVFII
Sbjct  230  GFNLLDPIAVVVLALANVVAITGTKMTSTLNWISSIISAGVIVFII  275



>ref|XP_006650336.1| PREDICTED: cationic amino acid transporter 1-like [Oryza brachyantha]
Length=522

 Score =   264 bits (675),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = +2

Query  269  MKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEF  448
            MKR+LNWWDL WFG+GAVIGAGIFVLTGQEA    GPAVVLSY VSG+SAMLSVFCYTEF
Sbjct  1    MKRDLNWWDLAWFGIGAVIGAGIFVLTGQEAKNAVGPAVVLSYVVSGVSAMLSVFCYTEF  60

Query  449  AVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESF  628
            AVEIPVAGGSFAYLRVELGDF+AF+AAGNILLEY I GAAVAR+WT Y ATL N+HP  F
Sbjct  61   AVEIPVAGGSFAYLRVELGDFMAFVAAGNILLEYCISGAAVARAWTSYFATLLNRHPNDF  120

Query  629  LIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             I A +L   Y+ L PIAV V   +C  A+LSTKGSSR NY+ SIVH+ VI+FII
Sbjct  121  RIHAASLSADYSRLDPIAVVVIALVCAFAVLSTKGSSRFNYVLSIVHVAVILFII  175



>ref|XP_008382964.1| PREDICTED: LOW QUALITY PROTEIN: cationic amino acid transporter 
8, vacuolar [Malus domestica]
Length=589

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/244 (55%), Positives = 172/244 (70%), Gaps = 2/244 (1%)
 Frame = +2

Query  68   KNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA  247
            + G  +S  R       K DF PE +F+++ +Y +AL  TP+RL+DR+  RS D  EL  
Sbjct  7    QEGQQDSKPRSYWSRWSKQDFFPENTFQNFNSYKDALSHTPSRLKDRLLHRSSDSFELLQ  66

Query  248  -KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAML  424
               +S++ MKR L WWDLIW G GAV+G+GIFV+TGQ     AGPA+VLSY VSGLSAML
Sbjct  67   LPKQSENLMKRCLTWWDLIWLGFGAVVGSGIFVITGQATRDDAGPAIVLSYAVSGLSAML  126

Query  425  SVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATL  604
            SV CYTEFAVE+PVAGGSF+YLR+ELGDFVAFIAAGNILLE ++G A + RSW+ Y A++
Sbjct  127  SVLCYTEFAVEVPVAGGSFSYLRIELGDFVAFIAAGNILLEALVGSAGLGRSWSSYFASI  186

Query  605  FNKHPESFL-IKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVI  781
            F      FL I+  +L +G+NLL PIAV V   +  IA+  T+ +S LN+IAS    ++I
Sbjct  187  FRTDDTDFLRIRVKSLPDGFNLLDPIAVVVLLVVNSIAMSGTRRTSVLNWIASJASGLII  246

Query  782  VFII  793
            VFI+
Sbjct  247  VFIL  250



>ref|XP_009783431.1| PREDICTED: cationic amino acid transporter 8, vacuolar [Nicotiana 
sylvestris]
Length=619

 Score =   264 bits (675),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 168/226 (74%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF PE SF+++  Y  AL QTP RL++R+F RS +  EL   K +S++EMK+ L WWD
Sbjct  52   KQDFFPEPSFQNFSTYKTALSQTPTRLKNRLFCRSTETTELVELKKQSENEMKQCLTWWD  111

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L+W G G+V+G+GIF +TGQE   HAGPA+VLSY +SGLSA+LSVFCYTEFAV+IP+AGG
Sbjct  112  LLWLGFGSVVGSGIFNITGQETRLHAGPAIVLSYAISGLSALLSVFCYTEFAVDIPIAGG  171

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SF++LRVELGDFVA+IAAGNILLE ++G A + RSWT Y A++ N   +   IK ++  E
Sbjct  172  SFSFLRVELGDFVAYIAAGNILLEAIVGAAGLGRSWTSYFASIINSDADFLRIKIDSFAE  231

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL P+AV +      IA+  TK +S LN ++SIV   VI+FI+
Sbjct  232  GFNLLDPLAVVILAVANGIAMTGTKRTSILNSVSSIVSAGVILFIV  277



>ref|XP_006477927.1| PREDICTED: cationic amino acid transporter 8, vacuolar-like [Citrus 
sinensis]
Length=618

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/258 (53%), Positives = 180/258 (70%), Gaps = 9/258 (3%)
 Frame = +2

Query  38   SIEIKMEVETKNGGSESGMRIRGCSC----GKDDFLPEESFRSWGNYVNALRQTPARLRD  205
            +I   M VET+   +E    +RG SC     K  F PE SF +  +Y +AL+QT  RL++
Sbjct  29   TITTTMAVETE---TELETPLRGTSCWHQWNKQAFFPEPSFENTTSYKSALKQTYPRLKN  85

Query  206  RVFSRSLDQVEL-AAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPA  382
            R+FSRS D  EL   +  S+  +++ L WWDL W   G+V+G+GIFV+TGQEA +HAGPA
Sbjct  86   RLFSRSTDATELITLQQESKQPLQKCLTWWDLTWLCFGSVVGSGIFVITGQEAKKHAGPA  145

Query  383  VVLSYTVSGLSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGG  562
            +VLSY  SGLSA+LS FCYTEFAVEIPVAGGSF++LRVELGDFVA+IAAGNILLE V+G 
Sbjct  146  IVLSYLASGLSALLSAFCYTEFAVEIPVAGGSFSFLRVELGDFVAYIAAGNILLEAVVGA  205

Query  563  AAVARSWTYYLATLFNKHPESFL-IKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSS  739
            A +ARSW+ YLA++ + +    L  K +   +G+NLL P+AV +      IA+  T+ SS
Sbjct  206  AGLARSWSSYLASMIDSNNSDLLRFKVDCFADGFNLLDPVAVLILLVCNGIAMSGTRRSS  265

Query  740  RLNYIASIVHMVVIVFII  793
             LN+I+SIV   VIVF+I
Sbjct  266  WLNWISSIVSSCVIVFVI  283



>gb|KDO45645.1| hypothetical protein CISIN_1g007913mg [Citrus sinensis]
Length=495

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/253 (54%), Positives = 178/253 (70%), Gaps = 9/253 (4%)
 Frame = +2

Query  53   MEVETKNGGSESGMRIRGCSC----GKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSR  220
            M VET+   +E    +RG SC     K  F PE SF +  +Y +AL+QT  RL++R+FSR
Sbjct  1    MAVETE---TELETPLRGTSCWHQWNKQAFFPEPSFENTTSYKSALKQTYPRLKNRLFSR  57

Query  221  SLDQVELAA-KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSY  397
            S D  EL   +  S+  +++ L WWDL W   G+V+G+GIFV+TGQEA +HAGPA+VLSY
Sbjct  58   STDATELITLQQESKQPLQKCLTWWDLTWLCFGSVVGSGIFVITGQEAKKHAGPAIVLSY  117

Query  398  TVSGLSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVAR  577
              SGLSA+LS FCYTEFAVEIPVAGGSF++LRVELGDFVA+IAAGNILLE V+G A +AR
Sbjct  118  LASGLSALLSAFCYTEFAVEIPVAGGSFSFLRVELGDFVAYIAAGNILLEAVVGAAGLAR  177

Query  578  SWTYYLATLFNKHPESFL-IKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYI  754
            SW+ YLA++ + +    L  K +   +G+NLL P+AV +      IA+  T+ SS LN+I
Sbjct  178  SWSSYLASMIDSNNSDLLRFKVDCFADGFNLLDPVAVLILLVCNGIAMSGTRRSSWLNWI  237

Query  755  ASIVHMVVIVFII  793
            +SIV   VIVF+I
Sbjct  238  SSIVSSCVIVFVI  250



>gb|KDO45644.1| hypothetical protein CISIN_1g007913mg [Citrus sinensis]
Length=585

 Score =   261 bits (666),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 136/253 (54%), Positives = 178/253 (70%), Gaps = 9/253 (4%)
 Frame = +2

Query  53   MEVETKNGGSESGMRIRGCSC----GKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSR  220
            M VET+   +E    +RG SC     K  F PE SF +  +Y +AL+QT  RL++R+FSR
Sbjct  1    MAVETE---TELETPLRGTSCWHQWNKQAFFPEPSFENTTSYKSALKQTYPRLKNRLFSR  57

Query  221  SLDQVELAA-KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSY  397
            S D  EL   +  S+  +++ L WWDL W   G+V+G+GIFV+TGQEA +HAGPA+VLSY
Sbjct  58   STDATELITLQQESKQPLQKCLTWWDLTWLCFGSVVGSGIFVITGQEAKKHAGPAIVLSY  117

Query  398  TVSGLSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVAR  577
              SGLSA+LS FCYTEFAVEIPVAGGSF++LRVELGDFVA+IAAGNILLE V+G A +AR
Sbjct  118  LASGLSALLSAFCYTEFAVEIPVAGGSFSFLRVELGDFVAYIAAGNILLEAVVGAAGLAR  177

Query  578  SWTYYLATLFNKHPESFL-IKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYI  754
            SW+ YLA++ + +    L  K +   +G+NLL P+AV +      IA+  T+ SS LN+I
Sbjct  178  SWSSYLASMIDSNNSDLLRFKVDCFADGFNLLDPVAVLILLVCNGIAMSGTRRSSWLNWI  237

Query  755  ASIVHMVVIVFII  793
            +SIV   VIVF+I
Sbjct  238  SSIVSSCVIVFVI  250



>ref|XP_010062739.1| PREDICTED: cationic amino acid transporter 8, vacuolar-like [Eucalyptus 
grandis]
 gb|KCW69871.1| hypothetical protein EUGRSUZ_F03209 [Eucalyptus grandis]
Length=587

 Score =   261 bits (666),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 162/226 (72%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF PEESF ++ +Y  AL QT  RLRDR+  RS    EL   +  S ++MKR L+WWD
Sbjct  19   KQDFFPEESFANFASYRKALSQTFPRLRDRILDRSTQSRELVELRKESVNDMKRCLSWWD  78

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIW   G+V+G+GIFV+TGQEA+ HAGPA+VLSY +SGLSA+LS FCYTEFAVEIPVAGG
Sbjct  79   LIWLCFGSVVGSGIFVITGQEAHDHAGPAIVLSYALSGLSALLSAFCYTEFAVEIPVAGG  138

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SF+YLR+ELGDFVAF+AAGNILLE ++G A + RSWT Y A++    P+        L E
Sbjct  139  SFSYLRIELGDFVAFLAAGNILLEAIVGAAGLGRSWTSYFASMIKDDPDFLRFHVKGLAE  198

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL P+AV V      IA+  TK +S LN+I S++   VIV I+
Sbjct  199  GFNLLDPMAVAVLVVANSIAMAGTKQASCLNWIGSVISAGVIVLIL  244



>ref|XP_011045597.1| PREDICTED: cationic amino acid transporter 8, vacuolar [Populus 
euphratica]
Length=604

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 166/229 (72%), Gaps = 2/229 (1%)
 Frame = +2

Query  113  CGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAAKSR-SQHEMKRNLNW  289
            C K DF PE SF+   +Y  AL Q   RL+DR+ SRS D  EL    R S++ M++ L W
Sbjct  41   CSKQDFFPEPSFKDLSSYRTALSQICPRLKDRLLSRSTDTHELVTLRRESENPMQKCLTW  100

Query  290  WDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVA  469
            WDL+W   G+V+G+GIFV+TGQEA  +AGPA+VLSY +SG SA+LSVFCYTEFAVEIPVA
Sbjct  101  WDLMWMSFGSVVGSGIFVITGQEARDNAGPAIVLSYALSGFSALLSVFCYTEFAVEIPVA  160

Query  470  GGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFN-KHPESFLIKANA  646
            GGSF+YLRVELGDF+A++AAGNILLE VIG A + RSW+ Y A++ N K+P+   IK ++
Sbjct  161  GGSFSYLRVELGDFIAYLAAGNILLEAVIGAAGLGRSWSSYFASMINSKNPDFMRIKIDS  220

Query  647  LHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
              +G+NLL P+AV V      IA+  TK +S LN+IASI    +I FII
Sbjct  221  FADGFNLLDPLAVVVLLVANSIAMSGTKRTSFLNWIASIATAFIIAFII  269



>ref|XP_009354858.1| PREDICTED: cationic amino acid transporter 8, vacuolar-like [Pyrus 
x bretschneideri]
Length=589

 Score =   259 bits (661),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 168/227 (74%), Gaps = 2/227 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF PE SF+++ +Y +AL  TP+RL+DR+F RS D  EL     +S++ MKR L WWD
Sbjct  24   KQDFFPEPSFQNFNSYKDALSHTPSRLKDRLFHRSSDSFELLQLPKQSENSMKRCLTWWD  83

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIW G G+V+G+GIFV+TGQ   ++AGPA+VLSY +SG SA+LSV CY+EFAVE+PVAGG
Sbjct  84   LIWLGFGSVVGSGIFVITGQATRENAGPAIVLSYAISGFSALLSVLCYSEFAVEVPVAGG  143

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFL-IKANALH  652
            SF+YLR+ELGDFVAFIAAGNILLE ++G A + RSW+ Y A++       FL I+  +L 
Sbjct  144  SFSYLRIELGDFVAFIAAGNILLEALVGSAGLGRSWSSYFASILRTDDTDFLRIRVKSLP  203

Query  653  EGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            +G+NLL PIAV V      IA+  T+ +S LN+IASI   ++IVFI+
Sbjct  204  DGFNLLDPIAVVVLLVANSIAMSGTRRTSVLNWIASIASGLIIVFIL  250



>ref|XP_006307083.1| hypothetical protein CARUB_v10008669mg [Capsella rubella]
 gb|EOA39981.1| hypothetical protein CARUB_v10008669mg [Capsella rubella]
Length=586

 Score =   258 bits (660),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 172/251 (69%), Gaps = 4/251 (2%)
 Frame = +2

Query  53   MEVETKNGGSESGMRIRGCS---CGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRS  223
            ME   +      G+  RG S     K DF PE SF+S+ +Y +AL  T  RL DR+ SRS
Sbjct  1    MEAHQQRESGSDGLSQRGRSYWRWRKQDFFPEFSFQSFSSYKSALSATCPRLADRLLSRS  60

Query  224  LDQVEL-AAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYT  400
             D  EL AA+  S++ M+R L WWDL+W   G+V+G+G+FV+TGQEA   AGPAVVLSY 
Sbjct  61   SDAYELDAARRESENPMRRCLTWWDLLWLSFGSVVGSGVFVITGQEARTGAGPAVVLSYA  120

Query  401  VSGLSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARS  580
            +SGLSA+LSV CY EF VEIPVAGGSF+YLR+ELGDF+AFIAAGNILLE ++G A + RS
Sbjct  121  ISGLSALLSVLCYAEFGVEIPVAGGSFSYLRIELGDFIAFIAAGNILLEAIVGAAGLGRS  180

Query  581  WTYYLATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
            W+ YLA+L     + F IK ++  +G++LL P+AV V      IA+  TK +S LN I S
Sbjct  181  WSSYLASLVKNDSDYFRIKVDSFAKGFDLLDPVAVAVLLVANGIAMTGTKRTSWLNLITS  240

Query  761  IVHMVVIVFII  793
            IV + VI FI+
Sbjct  241  IVTICVIGFIV  251



>ref|XP_008356194.1| PREDICTED: cationic amino acid transporter 8, vacuolar-like [Malus 
domestica]
Length=589

 Score =   258 bits (660),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 167/227 (74%), Gaps = 2/227 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF PE SF+++ +Y +AL  TP+RL+DR+F RS D  EL     +S++ MKR L WWD
Sbjct  24   KQDFFPEPSFQNFNSYKDALSHTPSRLKDRLFHRSSDSFELLQLPKQSENRMKRCLTWWD  83

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIW G+G+V+G+GIFV+TGQ    +AGPA+VLSY +SG SA+LSV CY+EFAVE+PVAGG
Sbjct  84   LIWLGVGSVVGSGIFVITGQATRXNAGPAIVLSYAISGFSALLSVLCYSEFAVEVPVAGG  143

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFL-IKANALH  652
            SF+YLR+ELGDFVAFIA GNILLE ++G A + RSW+ Y A++       FL I+  +L 
Sbjct  144  SFSYLRIELGDFVAFIAXGNILLEALVGSAGLGRSWSSYFASILRTDDTDFLRIRVKSLP  203

Query  653  EGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            +G+NLL PIAV V      IAI  T+ +S LN+IASI   ++IVFI+
Sbjct  204  DGFNLLDPIAVVVLLVANXIAISGTRRTSVLNWIASIASGLIIVFIL  250



>ref|XP_006442252.1| hypothetical protein CICLE_v10019753mg [Citrus clementina]
 gb|ESR55492.1| hypothetical protein CICLE_v10019753mg [Citrus clementina]
Length=514

 Score =   256 bits (655),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 135/255 (53%), Positives = 178/255 (70%), Gaps = 6/255 (2%)
 Frame = +2

Query  38   SIEIKMEVETKNGGSESGMRIRGC-SCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVF  214
            +I   M VET+   +E    +RG     K  F PE SF +  +Y +AL+QT  RL++R+F
Sbjct  18   TITTTMAVETE---TELETPLRGWHQWNKQAFFPEPSFENTTSYKSALKQTYPRLKNRLF  74

Query  215  SRSLDQVEL-AAKSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVL  391
            SRS D  EL   +  S+  +++ L WWDL W   G+V+G+GIFV+TGQEA +HAGPA+VL
Sbjct  75   SRSTDATELITLQQESKQPLQKCLTWWDLTWLCFGSVVGSGIFVITGQEAKKHAGPAIVL  134

Query  392  SYTVSGLSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAV  571
            SY  SGLSA+LS FCYTEFAVEIPVAGGSF++LRVELGDFVA+IAAGNILLE V+G A +
Sbjct  135  SYLASGLSALLSAFCYTEFAVEIPVAGGSFSFLRVELGDFVAYIAAGNILLEAVVGAAGL  194

Query  572  ARSWTYYLATLFNKHPESFL-IKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLN  748
            ARSW+ YLA++ + +    L  K +   +G+NLL P+AV +      IA+  T+ SS LN
Sbjct  195  ARSWSSYLASMIDSNNSDLLRFKVDCFADGFNLLDPVAVLILLVCNGIALSGTRRSSWLN  254

Query  749  YIASIVHMVVIVFII  793
            +I+SIV   VIVF+I
Sbjct  255  WISSIVSSCVIVFVI  269



>ref|XP_002300432.2| cationic amino acid transporter 8 family protein [Populus trichocarpa]
 gb|EEE85237.2| cationic amino acid transporter 8 family protein [Populus trichocarpa]
Length=604

 Score =   258 bits (660),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 166/229 (72%), Gaps = 2/229 (1%)
 Frame = +2

Query  113  CGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAAKSR-SQHEMKRNLNW  289
            C K DF PE SF+   +Y  AL Q   RL+DR+ SRS +  EL    R S++ M++ L W
Sbjct  41   CSKQDFFPEPSFKDLSSYRTALSQICPRLKDRLLSRSTETHELVTLRRESENPMQKCLTW  100

Query  290  WDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVA  469
            WDL+W   G+V+G+GIFV+TGQEA  +AGPA+VLSY +SG SA+LSVFCYTEFAVEIPVA
Sbjct  101  WDLMWMSFGSVVGSGIFVITGQEARDNAGPAIVLSYALSGFSALLSVFCYTEFAVEIPVA  160

Query  470  GGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFN-KHPESFLIKANA  646
            GGSF+YLRVELGDF+A++AAGNILLE +IG A + RSW+ Y A++ N K+P+   IK ++
Sbjct  161  GGSFSYLRVELGDFIAYLAAGNILLEAIIGAAGLGRSWSSYFASMINSKNPDFMRIKIDS  220

Query  647  LHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
              +G+NLL P+AV V      IA+  TK +S LN+IASI    +I FII
Sbjct  221  FADGFNLLDPLAVVVLLVANSIAMSGTKRTSFLNWIASIATAFIIAFII  269



>ref|XP_009367760.1| PREDICTED: cationic amino acid transporter 8, vacuolar-like [Pyrus 
x bretschneideri]
Length=589

 Score =   258 bits (659),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 170/244 (70%), Gaps = 2/244 (1%)
 Frame = +2

Query  68   KNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA  247
            +    +S  R       K DF PE +F+++ +Y +AL  TP+RL+DR+  RS D  EL  
Sbjct  7    QEDQQDSKPRSYWSRWSKQDFFPEYTFQNFNSYKDALSHTPSRLKDRLLHRSSDSFELLQ  66

Query  248  -KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAML  424
               +S++ MKR L WWDLIW G G+V+G+GIFV+TGQ     AGPA+VLSY VSG SAML
Sbjct  67   LPKQSENLMKRCLTWWDLIWLGFGSVVGSGIFVITGQATRDDAGPAIVLSYAVSGFSAML  126

Query  425  SVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATL  604
            SV CYTEFAVE+PVAGGSF+YLR+ELGDFVAFIAAGN+LLE ++G A + RSW+ Y A++
Sbjct  127  SVLCYTEFAVEVPVAGGSFSYLRIELGDFVAFIAAGNVLLEALVGSAGLGRSWSSYFASI  186

Query  605  FNKHPESFL-IKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVI  781
            F      FL I+  +L +G+NLL PIAV V      IA+  T+ +S LN+IASI   ++I
Sbjct  187  FRTDDTDFLRIRVKSLPDGFNLLDPIAVVVLLVANSIAMSGTRRTSVLNWIASIASGLII  246

Query  782  VFII  793
            VFI+
Sbjct  247  VFIL  250



>ref|XP_008356146.1| PREDICTED: LOW QUALITY PROTEIN: cationic amino acid transporter 
5-like [Malus domestica]
Length=576

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/228 (58%), Positives = 165/228 (72%), Gaps = 2/228 (1%)
 Frame = +2

Query  113  CGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNW  289
            C K DFLPEESF++W  Y  AL QT  R ++R+ SRS D  E+   + +S+++MKR L W
Sbjct  19   CSKQDFLPEESFQNWSTYRXALSQTGHRFKNRLLSRSNDNDEIGELRKQSENDMKRCLTW  78

Query  290  WDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVA  469
            WDL WFG G+V+GAGIF  TG E   HAGPA+VLSY  SGLSAMLSVF YTEF+VEIP A
Sbjct  79   WDLXWFGFGSVLGAGIFXXTGXETXXHAGPAIVLSYVXSGLSAMLSVFXYTEFSVEIPAA  138

Query  470  GGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANAL  649
            GG+FAYLR+ELGDFVAFI AGNILLE ++  A VAR+WT Y   L N+  +S  I  N L
Sbjct  139  GGAFAYLRIELGDFVAFITAGNILLESIVXSAXVARAWTSYFTXLLNRPXBSLXIHTN-L  197

Query  650  HEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
              G+NLL PIAV V      IA++ST+ +S LN+IAS V++V+ +F+I
Sbjct  198  AXGFNLLDPIAVAVLAIAATIAMISTRKTSFLNWIASAVNIVIXLFVI  245



>ref|XP_009409402.1| PREDICTED: cationic amino acid transporter 5-like [Musa acuminata 
subsp. malaccensis]
Length=589

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 163/226 (72%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K+DF PE SFR+WG Y  AL +T  RLRDR+  RS D  EL A   RS+H ++R L+WWD
Sbjct  28   KNDFFPEPSFRNWGAYRAALSRTGPRLRDRLLHRSTDAAELLALPRRSEHGLRRCLSWWD  87

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L W G G+V+G GIFV+TGQEA   AGPA+ LSY  +GLSA+LS F Y EFA ++P AGG
Sbjct  88   LAWLGFGSVVGTGIFVITGQEARFAAGPAIPLSYAAAGLSALLSSFVYAEFASDVPSAGG  147

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SF+YLR+ELG+F+A++AA NILLE ++G A +ARSWT Y ATL  + P+S  I A AL  
Sbjct  148  SFSYLRIELGEFLAYLAAANILLEALVGAAGLARSWTSYFATLLGREPDSLRIHAPALAA  207

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G++LL PIAV V  A   +AI  T+G+S LN+I S++ + VI FII
Sbjct  208  GFDLLDPIAVVVLIACSSVAIFGTRGTSTLNWITSLLSVAVIGFII  253



>ref|XP_009604320.1| PREDICTED: cationic amino acid transporter 8, vacuolar [Nicotiana 
tomentosiformis]
 ref|XP_009604321.1| PREDICTED: cationic amino acid transporter 8, vacuolar [Nicotiana 
tomentosiformis]
 ref|XP_009604322.1| PREDICTED: cationic amino acid transporter 8, vacuolar [Nicotiana 
tomentosiformis]
 ref|XP_009604323.1| PREDICTED: cationic amino acid transporter 8, vacuolar [Nicotiana 
tomentosiformis]
Length=619

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 167/226 (74%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF PE SF+++  Y  AL QTP RL++R+F RS +  EL   K +S++EMK+ L WWD
Sbjct  52   KQDFFPEPSFQNFSTYKTALSQTPTRLKNRLFCRSTETTELVELKKQSENEMKQCLTWWD  111

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L+W G G+V+G+GIF +TGQE   +AGPA++LSY +SGLSA+LSVFCYTEFAV+IP+AGG
Sbjct  112  LLWLGFGSVVGSGIFSITGQETRLNAGPAIILSYAISGLSALLSVFCYTEFAVDIPIAGG  171

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SF++LRVELGDFVA+IAAGNILLE ++G A + RSWT Y +++     +   IK ++  +
Sbjct  172  SFSFLRVELGDFVAYIAAGNILLEAIVGAAGLGRSWTSYFSSIIKSDADFLRIKIDSFAD  231

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL P+AV +      IA+  TK +S LN ++SIV   VI+FI+
Sbjct  232  GFNLLDPLAVVILVIANGIAMTGTKRTSILNTVSSIVSAGVILFIV  277



>ref|XP_008801990.1| PREDICTED: cationic amino acid transporter 5-like [Phoenix dactylifera]
Length=565

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = +2

Query  113  CGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNW  289
            C K+DF PE+SF SW  Y  AL QT  R +DR+  RS D  EL   + +S+++MKR LNW
Sbjct  16   CSKEDFFPEKSFESWAAYRTALSQTHHRFKDRLLGRSSDAAELGELRKQSENDMKRCLNW  75

Query  290  WDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVA  469
            WDL WFG G+VIGAGIFVLTGQEA+ HAGPA++LSY  SG+SAMLSVFCYTEF+VEIPVA
Sbjct  76   WDLTWFGFGSVIGAGIFVLTGQEAHDHAGPAIILSYVASGISAMLSVFCYTEFSVEIPVA  135

Query  470  GGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKAN  643
            GGSFAYLRVELGDF AFIAA N++LE ++G AAVARSWT YLATL N+ P S  I  +
Sbjct  136  GGSFAYLRVELGDFAAFIAAANLILESIVGSAAVARSWTSYLATLLNRPPNSLTIHTH  193



>gb|KJB82108.1| hypothetical protein B456_013G176800 [Gossypium raimondii]
 gb|KJB82109.1| hypothetical protein B456_013G176800 [Gossypium raimondii]
Length=574

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 164/226 (73%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAAKSR-SQHEMKRNLNWWD  295
            K DF PE SF++  +Y  AL QT  RL DR+ +RS    EL    + S++ M++ L WWD
Sbjct  20   KTDFFPETSFQTLSSYKTALSQTCPRLSDRLLARSSSTDELVTLQKVSENPMQKCLTWWD  79

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIW   G+V+G+GIFV+TGQEA+ +AGPA+VLSY +SGLSA+LSVFCYTEFA EIPVAGG
Sbjct  80   LIWLSFGSVVGSGIFVITGQEAHNNAGPAIVLSYAISGLSALLSVFCYTEFAAEIPVAGG  139

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SF+YLRVELGDFVAFIAAGNILLE ++G A + RSW+ Y A++     +   IK ++L  
Sbjct  140  SFSYLRVELGDFVAFIAAGNILLEALVGAAGLGRSWSSYFASMIKNDSDFLRIKVDSLPV  199

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL P+AV V      IA+  TK +S LN+IAS+V   VIVF+I
Sbjct  200  GFNLLDPLAVVVLLVANGIAMSGTKRTSWLNWIASLVSGAVIVFVI  245



>ref|XP_006349994.1| PREDICTED: cationic amino acid transporter 8, vacuolar-like [Solanum 
tuberosum]
Length=618

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 160/215 (74%), Gaps = 1/215 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF PE SF + G+Y NAL QTP RL++R+F+RS D  EL   K  S++EMK  L WWD
Sbjct  51   KQDFFPEPSFHNLGSYKNALSQTPNRLKNRLFARSSDSSELIELKKESENEMKLCLTWWD  110

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIW G G+V+G+GIF +TGQE    AGPA+VLSY +SGLSA+LSVFCYTEF+V+IPVAGG
Sbjct  111  LIWLGFGSVVGSGIFSITGQETRNDAGPAIVLSYAISGLSALLSVFCYTEFSVDIPVAGG  170

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SF++LR+ELGDFVAFIAA NILLE ++G A + RSW+ Y A++   +P+   IK ++  E
Sbjct  171  SFSFLRIELGDFVAFIAAANILLEAMVGAAGLGRSWSSYFASIIKNNPDFLRIKIDSFVE  230

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIAS  760
            G+NLL PIAV V      +A+  TK +S LN+++S
Sbjct  231  GFNLLDPIAVVVLALANGVAMTGTKMTSTLNWMSS  265



>ref|XP_010694567.1| PREDICTED: cationic amino acid transporter 8, vacuolar [Beta 
vulgaris subsp. vulgaris]
Length=609

 Score =   254 bits (648),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 161/226 (71%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF PE SF S  +Y  AL Q   RL+DR+ SRS D  EL   K  S + M + L WWD
Sbjct  41   KQDFFPESSFNSLSDYKTALSQICPRLKDRLLSRSSDSFELVELKKESVNNMSKCLTWWD  100

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIW   G+V+G+GIF +TGQEA+ HAGPA+VLSY +SG SA+LSVFCYTEF VE+PVAGG
Sbjct  101  LIWLSFGSVVGSGIFSITGQEAHNHAGPAIVLSYAISGFSALLSVFCYTEFTVEVPVAGG  160

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SF++LR+ELGDF+AFIAA NILLE ++G A + RSW+ Y A++     + F I+ ++  +
Sbjct  161  SFSFLRIELGDFIAFIAASNILLEAIVGAAGLGRSWSSYFASMIKNDSDFFRIRVHSFAD  220

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAV V      IA+  TK +S LN+++SI+  +VIVFII
Sbjct  221  GFNLLDPIAVVVLLVANGIAMSGTKHTSCLNWLSSIMSALVIVFII  266



>ref|XP_007022159.1| Cationic amino acid transporter 8 [Theobroma cacao]
 gb|EOY13684.1| Cationic amino acid transporter 8 [Theobroma cacao]
Length=693

 Score =   255 bits (652),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 166/226 (73%), Gaps = 1/226 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAAKSR-SQHEMKRNLNWWD  295
            K DF PE SF++  +Y  AL QT  RL DR+ +RS    EL    + S++ M++ L WWD
Sbjct  20   KKDFFPETSFQTMSSYKTALSQTCPRLTDRLLARSSSTNELVTLQKVSENPMQKCLTWWD  79

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIW   G+V+G+GIFV+TGQEA+ +AGPA+VLSY +SGLSA+LSVFCYTEFA EIPVAGG
Sbjct  80   LIWLSFGSVVGSGIFVITGQEAHVNAGPAIVLSYAISGLSALLSVFCYTEFAAEIPVAGG  139

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SF+YLR+ELGDF+AFIAAGNILLE ++G A + RSW+ Y A++ N   +   IK ++L +
Sbjct  140  SFSYLRIELGDFIAFIAAGNILLEALVGAAGLGRSWSSYFASMINNDSDFLRIKVDSLPK  199

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL P+AV V      IA+  TK +S LN+I+S+V   +IVF+I
Sbjct  200  GFNLLDPLAVLVLLVANGIAMSGTKRTSSLNWISSLVSGALIVFVI  245



>ref|XP_001753423.1| predicted protein [Physcomitrella patens]
 gb|EDQ81646.1| predicted protein [Physcomitrella patens]
Length=585

 Score =   253 bits (645),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 170/226 (75%), Gaps = 5/226 (2%)
 Frame = +2

Query  128  FLPEESFRSWGNYVNALRQTPARLRDRVFSRS-LDQVELAAKSRSQHEMKRNLNWWDLIW  304
            +LPE+SF+SWGNY  AL   P+RL DR+ +R+ L++     K+RS  +M +NL WWDLIW
Sbjct  5    WLPEQSFQSWGNYRRALASIPSRLIDRMSARTQLNEEVTDIKARSNVDMNKNLTWWDLIW  64

Query  305  FGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGGSFA  484
            FG+GAVIGAGIFVLTG EA  HAGPA+V+SY ++G SAMLS FCYTEFA EIP+AGG+FA
Sbjct  65   FGIGAVIGAGIFVLTGVEAKNHAGPAIVISYVIAGSSAMLSAFCYTEFADEIPLAGGAFA  124

Query  485  YLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKH---PESFLIKANALHE  655
            YLRVELGDF+AFI AGNI+L  VIG AAVAR WT Y A+L        +   I+ N L E
Sbjct  125  YLRVELGDFIAFIGAGNIVLGNVIGSAAVARGWTSYFASLIFSGVDVGDKLRIETN-LAE  183

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            GYN L PIAV V   + ++AI STKG+S +N+IAS+V+M +I FII
Sbjct  184  GYNQLDPIAVAVLVLVGLVAIWSTKGASYVNWIASLVNMFIIAFII  229



>ref|XP_008801991.1| PREDICTED: cationic amino acid transporter 5-like [Phoenix dactylifera]
Length=565

 Score =   252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = +2

Query  113  CGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNW  289
            C K+DF PE+SF SW  Y  AL QT  R +DR+  RS D  EL   + +S++EMKR LNW
Sbjct  16   CSKEDFFPEKSFESWAAYRAALSQTHHRFKDRLLGRSSDATELGELRKQSENEMKRCLNW  75

Query  290  WDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVA  469
            WDL WFG G+VIGAGIFVLTGQEA+ HAGPA++LSY  SG+SAMLSVFCYTEF+VEIPVA
Sbjct  76   WDLTWFGFGSVIGAGIFVLTGQEAHNHAGPAIILSYIASGISAMLSVFCYTEFSVEIPVA  135

Query  470  GGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKAN  643
            GGSFAYLRVELGD  AFIAA N++LE ++G AAVARSWT YLATL N+ P S  I  +
Sbjct  136  GGSFAYLRVELGDLAAFIAAANMILESIVGSAAVARSWTSYLATLLNRPPNSLTIHTH  193



>ref|XP_007214017.1| hypothetical protein PRUPE_ppa016270mg [Prunus persica]
 gb|EMJ15216.1| hypothetical protein PRUPE_ppa016270mg [Prunus persica]
Length=523

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 160/226 (71%), Gaps = 13/226 (6%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DFLPEESF+SW  Y  AL QT  R ++R+ SRS D  E+     RS+++MKR L WWD
Sbjct  6    KQDFLPEESFQSWSTYRTALSQTGYRFKNRLISRSDDNNEIGELPKRSENDMKRCLTWWD  65

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIWFG G+VIGAGIFVLTGQE + HAGPA+VLSY  SG+SAMLSVF  TEF+VE+PVA  
Sbjct  66   LIWFGFGSVIGAGIFVLTGQEIHDHAGPAIVLSYVASGVSAMLSVFSNTEFSVEVPVA--  123

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
                     GDF+AF  AGNILLE ++G AA+ARSWT Y  +L N+   S  I  N L E
Sbjct  124  ---------GDFIAFTTAGNILLEGIVGSAAIARSWTSYFTSLLNRPSNSLRIHTN-LTE  173

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            G+NLL PIAV V      IA++ST+ +S LN+IAS+V+ VVI+F+I
Sbjct  174  GFNLLDPIAVAVLTIAATIAMISTRKTSYLNWIASVVNNVVILFVI  219



>ref|XP_004301950.1| PREDICTED: cationic amino acid transporter 8, vacuolar [Fragaria 
vesca subsp. vesca]
Length=587

 Score =   251 bits (641),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 168/227 (74%), Gaps = 3/227 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-AKSRSQHEMKRNLNWWD  295
            K DF PE +F++  +Y +AL  TP+RL+DR+ +RS D  EL     +S+H MKR L WWD
Sbjct  19   KQDFFPEPTFQNLTSYKDALSHTPSRLKDRLLNRSSDSFELLHLPKQSEHHMKRCLTWWD  78

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIW G G+V+G+GIFV+TG EA    GPA+VLSY +SGLSA+LSV CYTEFAVE+PVAGG
Sbjct  79   LIWLGFGSVVGSGIFVITG-EAALMVGPAIVLSYAISGLSALLSVLCYTEFAVEVPVAGG  137

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFL-IKANALH  652
            SF+YLR+ELGDFVAFIAAGNILLE ++G A + RSWT YLA++ N +   FL  + ++L 
Sbjct  138  SFSYLRIELGDFVAFIAAGNILLEAIVGAAGLGRSWTSYLASMINTNNTDFLRFRVSSLP  197

Query  653  EGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            +G+NLL P+AV V      IA+  T  +S LN+IASI   +VI+FII
Sbjct  198  DGFNLLDPVAVVVLLVANGIAMSGTARTSMLNWIASIASALVILFII  244



>ref|XP_002518795.1| cationic amino acid transporter, putative [Ricinus communis]
 gb|EEF43720.1| cationic amino acid transporter, putative [Ricinus communis]
Length=575

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 167/227 (74%), Gaps = 3/227 (1%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAA-KSRSQHEMKRNLNWWD  295
            K DF PE +F++   Y  AL QT  RL+DR+ SRS +  EL   +  S++ +++ L WWD
Sbjct  16   KQDFFPEPTFQNLSTYTCALSQTYPRLKDRLLSRSSETNELVTLQKESENPLRKCLTWWD  75

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            L+W   G+V+G+GIFV+TGQEA + +GPA++LSY +SGLSA+LSVFCYTEFAVEIPVAGG
Sbjct  76   LMWLSFGSVVGSGIFVITGQEA-RVSGPAILLSYAISGLSALLSVFCYTEFAVEIPVAGG  134

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFL-IKANALH  652
            SF+YLR+ELGDF+AF+AAGNILLE V+G A + RSW+ Y A++ N     FL I+ ++  
Sbjct  135  SFSYLRIELGDFIAFLAAGNILLEGVVGAAGLGRSWSSYFASMINTKNSDFLRIRIDSFP  194

Query  653  EGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            +G+NLL PIAV V      IA+  TK +S LN+++S+V   +IVFII
Sbjct  195  DGFNLLDPIAVVVLLVANTIAMTGTKRTSTLNWLSSVVTACIIVFII  241



>gb|EYU45055.1| hypothetical protein MIMGU_mgv1a003403mg [Erythranthe guttata]
Length=587

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 166/216 (77%), Gaps = 1/216 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELA-AKSRSQHEMKRNLNWWD  295
            K DF PE +F+++  Y++AL +TP RL+DR+  RS D  EL  +K +S++EMK+ L WWD
Sbjct  19   KQDFFPEPTFQNFSTYLSALSKTPHRLKDRLTGRSSDADELVRSKLQSENEMKKCLTWWD  78

Query  296  LIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGG  475
            LIW G G+V+G+GIF +TGQE + HAGPA+VLSY VSGLSA+LSVFCYTEFAVEIP+AGG
Sbjct  79   LIWLGFGSVVGSGIFSITGQETHNHAGPAIVLSYAVSGLSALLSVFCYTEFAVEIPIAGG  138

Query  476  SFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHE  655
            SF+YLRVELGDF+AFIAAGNILLE ++G A + RSW+ Y A++   +P+   IK  +  E
Sbjct  139  SFSYLRVELGDFIAFIAAGNILLEGLVGAAGLGRSWSSYFASIIKSNPDFLRIKIESFAE  198

Query  656  GYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASI  763
            G+NLL P+AV V   +  IA+  TK +S LN+I+SI
Sbjct  199  GFNLLDPLAVVVLLVVNGIAMTGTKRTSMLNWISSI  234



>emb|CDP06088.1| unnamed protein product [Coffea canephora]
Length=617

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/241 (50%), Positives = 173/241 (72%), Gaps = 8/241 (3%)
 Frame = +2

Query  50   KMEVETKNGGSESGMRIRGCSCGKDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLD  229
            KME   +     S  R       K+DF PE +F ++  Y +A+ +TP RL+DR+ SRS D
Sbjct  31   KMEQPPEPTAKRSYWRF-----SKEDFFPEPTFENFSTYRSAVAKTPQRLKDRLLSRSSD  85

Query  230  QVELAA-KSRSQHEMKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVS  406
              EL   K +S++ M + L WWDL+W G G+V+G+GIF LTGQE + HAGPA+VLSY +S
Sbjct  86   DTELVVLKKQSENSMHQCLTWWDLMWLGFGSVVGSGIFSLTGQEIHDHAGPAIVLSYAIS  145

Query  407  GLSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWT  586
            GLSA+LSVFCYTEF+V+IP AGGSF++LR+ELGDF+A+IAAGNILLE ++G A + RSW+
Sbjct  146  GLSALLSVFCYTEFSVDIPTAGGSFSFLRIELGDFLAYIAAGNILLEAIVGAAGLGRSWS  205

Query  587  YYLATLFNKHPESFLIKANALHEGYNLLXPIAVGVCFAICI-IAILSTKGSSRLNYIASI  763
             Y A++ + +P+   IK ++  EG+NLL P+AVG+  A+C  IA+  ++ +S L +++S+
Sbjct  206  SYFASVISSNPDLLRIKIDSFPEGFNLLDPLAVGI-LALCNGIAMSGSRRTSILTWVSSL  264

Query  764  V  766
            +
Sbjct  265  I  265



>gb|ACJ85737.1| unknown [Medicago truncatula]
Length=520

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = +2

Query  269  MKRNLNWWDLIWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEF  448
            MK+ LNWWDLIWFG GAVIGAGIFVLTGQEA+ HAG A+VLSY  SG+SAMLSVFCYTEF
Sbjct  1    MKKCLNWWDLIWFGFGAVIGAGIFVLTGQEAHNHAGAAIVLSYVASGISAMLSVFCYTEF  60

Query  449  AVEIPVAGGSFAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESF  628
            AVE+P AGGSFAYLR+ELGDFVAFIAAGNILLE V+G AAV+RSWT Y  +L N+  +S 
Sbjct  61   AVEVPAAGGSFAYLRIELGDFVAFIAAGNILLECVLGSAAVSRSWTSYFTSLLNRPKDSL  120

Query  629  LIKANALHEGYNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
             IKA+ L +GYNLL PIAVGV     +IA++ST+ +S LN+IAS V++ VI+F+I
Sbjct  121  RIKAHHLKDGYNLLDPIAVGVLVISAMIAMISTRKTSLLNWIASAVNIGVIIFVI  175



>ref|XP_002278606.1| PREDICTED: cationic amino acid transporter 8, vacuolar-like [Vitis 
vinifera]
Length=571

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 161/225 (72%), Gaps = 0/225 (0%)
 Frame = +2

Query  119  KDDFLPEESFRSWGNYVNALRQTPARLRDRVFSRSLDQVELAAKSRSQHEMKRNLNWWDL  298
            K DF PEESF++  +Y  AL  T  RL+DR+ +RS    E+     S++ MK+ L WWDL
Sbjct  19   KQDFFPEESFQNLASYKTALSHTCFRLKDRLLNRSSVANEMLLFQESENAMKKCLTWWDL  78

Query  299  IWFGMGAVIGAGIFVLTGQEANQHAGPAVVLSYTVSGLSAMLSVFCYTEFAVEIPVAGGS  478
            +W   G+V+G+GIFV+TGQE    AGPA++LSY VSG SA+LSV CYTEFAVEIPVAGGS
Sbjct  79   VWMSFGSVVGSGIFVITGQETRYDAGPAIILSYAVSGFSALLSVLCYTEFAVEIPVAGGS  138

Query  479  FAYLRVELGDFVAFIAAGNILLEYVIGGAAVARSWTYYLATLFNKHPESFLIKANALHEG  658
            F+YLRVELGDFVAFIAAGNILLE ++G A +ARSW+ Y A++ N   +   I+ +   +G
Sbjct  139  FSYLRVELGDFVAFIAAGNILLEAIVGAAGLARSWSSYFASMINTDTDFLRIRVSYFADG  198

Query  659  YNLLXPIAVGVCFAICIIAILSTKGSSRLNYIASIVHMVVIVFII  793
            +NLL PIA  V      IA+  T+ +S LN+I+S++  +VI+FII
Sbjct  199  FNLLDPIAAVVLLIADGIAMSGTRRTSILNWISSVLSFMVILFII  243



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1614230233668