BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10887

Length=812
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO96226.1|  sugar-porter family protein 7                          304   1e-96   Solanum lycopersicum
ref|XP_009614908.1|  PREDICTED: sugar transporter ERD6-like 7           304   1e-96   Nicotiana tomentosiformis
ref|XP_009777420.1|  PREDICTED: sugar transporter ERD6-like 7           303   2e-96   Nicotiana sylvestris
ref|XP_007050715.1|  Major facilitator superfamily protein isoform 1    303   4e-96   
ref|XP_006358441.1|  PREDICTED: sugar transporter ERD6-like 7-like      301   1e-95   Solanum tuberosum [potatoes]
ref|XP_002270927.2|  PREDICTED: sugar transporter ERD6-like 7           301   2e-95   Vitis vinifera
gb|KJB47013.1|  hypothetical protein B456_008G006300                    299   7e-95   Gossypium raimondii
gb|KJB47011.1|  hypothetical protein B456_008G006300                    299   8e-95   Gossypium raimondii
gb|EYU43551.1|  hypothetical protein MIMGU_mgv1a005532mg                298   2e-94   Erythranthe guttata [common monkey flower]
ref|XP_002302812.2|  sugar transporter family protein                   296   8e-94   Populus trichocarpa [western balsam poplar]
ref|NP_001233882.1|  st3 protein                                        294   7e-93   
ref|XP_011009473.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    294   8e-93   Populus euphratica
ref|XP_012092321.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    292   1e-92   
ref|XP_012092318.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    293   3e-92   Jatropha curcas
ref|XP_004493632.1|  PREDICTED: sugar transporter ERD6-like 7-like      292   5e-92   Cicer arietinum [garbanzo]
ref|XP_007162379.1|  hypothetical protein PHAVU_001G147100g             291   7e-92   Phaseolus vulgaris [French bean]
gb|AJU57222.1|  sugar transporter ERD6-like 7                           291   1e-91   Camellia sinensis [black tea]
ref|XP_010242566.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    290   1e-91   
ref|XP_010242564.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    290   2e-91   Nelumbo nucifera [Indian lotus]
emb|CBI32306.3|  unnamed protein product                                288   6e-91   Vitis vinifera
ref|XP_011079781.1|  PREDICTED: sugar transporter ERD6-like 7           289   8e-91   Sesamum indicum [beniseed]
ref|XP_003521224.1|  PREDICTED: sugar transporter ERD6-like 7-like      288   1e-90   Glycine max [soybeans]
gb|KHN19852.1|  Sugar transporter ERD6-like 7                           288   1e-90   Glycine soja [wild soybean]
ref|XP_002524779.1|  sugar transporter, putative                        288   3e-90   Ricinus communis
gb|KJB23160.1|  hypothetical protein B456_004G084300                    286   6e-90   Gossypium raimondii
gb|ACU24439.1|  unknown                                                 278   6e-90   Glycine max [soybeans]
emb|CDP03586.1|  unnamed protein product                                284   1e-89   Coffea canephora [robusta coffee]
ref|XP_006409064.1|  hypothetical protein EUTSA_v10022677mg             285   2e-89   Eutrema salsugineum [saltwater cress]
ref|XP_006479816.1|  PREDICTED: sugar transporter ERD6-like 7-lik...    280   2e-89   
ref|XP_007162380.1|  hypothetical protein PHAVU_001G147200g             285   2e-89   Phaseolus vulgaris [French bean]
ref|XP_006444173.1|  hypothetical protein CICLE_v10024572mg             280   2e-89   
emb|CDY39145.1|  BnaA07g01410D                                          284   3e-89   Brassica napus [oilseed rape]
ref|XP_006479815.1|  PREDICTED: sugar transporter ERD6-like 7-lik...    280   3e-89   
emb|CDY12861.1|  BnaC07g15720D                                          284   4e-89   Brassica napus [oilseed rape]
emb|CDY01404.1|  BnaA07g11770D                                          284   4e-89   
ref|XP_007222121.1|  hypothetical protein PRUPE_ppa004636mg             285   5e-89   Prunus persica
ref|XP_009103393.1|  PREDICTED: sugar transporter ERD6-like 7           284   5e-89   Brassica rapa
ref|XP_011033659.1|  PREDICTED: sugar transporter ERD6-like 7           284   5e-89   Populus euphratica
gb|KFK37554.1|  hypothetical protein AALP_AA4G271800                    283   7e-89   Arabis alpina [alpine rockcress]
ref|XP_006479811.1|  PREDICTED: sugar transporter ERD6-like 7-lik...    281   8e-89   
gb|KJB28576.1|  hypothetical protein B456_005G056400                    280   8e-89   Gossypium raimondii
ref|XP_008223080.1|  PREDICTED: sugar transporter ERD6-like 16          284   9e-89   Prunus mume [ume]
emb|CDX82668.1|  BnaC07g01980D                                          283   1e-88   
ref|XP_006444171.1|  hypothetical protein CICLE_v10019923mg             283   2e-88   Citrus clementina [clementine]
ref|XP_006444169.1|  hypothetical protein CICLE_v10019923mg             282   3e-88   
gb|KJB28574.1|  hypothetical protein B456_005G056400                    280   3e-88   Gossypium raimondii
ref|XP_002880340.1|  hypothetical protein ARALYDRAFT_483991             281   4e-88   
ref|XP_003554233.1|  PREDICTED: sugar transporter ERD6-like 7-lik...    280   1e-87   Glycine max [soybeans]
gb|KJB28575.1|  hypothetical protein B456_005G056400                    280   1e-87   Gossypium raimondii
ref|NP_566120.1|  sugar transporter ERD6-like 7                         280   2e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010070313.1|  PREDICTED: sugar transporter ERD6-like 7           280   2e-87   Eucalyptus grandis [rose gum]
gb|KJB28573.1|  hypothetical protein B456_005G056400                    280   3e-87   Gossypium raimondii
ref|XP_010545070.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    279   3e-87   
ref|XP_004292608.2|  PREDICTED: sugar transporter ERD6-like 7           279   5e-87   Fragaria vesca subsp. vesca
ref|XP_010424172.1|  PREDICTED: sugar transporter ERD6-like 16          273   5e-87   Camelina sativa [gold-of-pleasure]
ref|XP_010070278.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    278   6e-87   
ref|XP_010070277.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    279   7e-87   Eucalyptus grandis [rose gum]
ref|XP_011009474.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    277   1e-86   Populus euphratica
gb|AAM61246.1|  putative sugar transporter                              278   1e-86   Arabidopsis thaliana [mouse-ear cress]
gb|EPS59997.1|  hypothetical protein M569_14807                         277   1e-86   Genlisea aurea
ref|XP_007035424.1|  Major facilitator superfamily protein              278   2e-86   Theobroma cacao [chocolate]
ref|XP_010070290.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    278   2e-86   Eucalyptus grandis [rose gum]
ref|XP_008235073.1|  PREDICTED: sugar transporter ERD6-like 7           277   2e-86   Prunus mume [ume]
ref|XP_004140089.1|  PREDICTED: sugar transporter ERD6-like 7           277   3e-86   Cucumis sativus [cucumbers]
ref|XP_007200994.1|  hypothetical protein PRUPE_ppa005144mg             277   4e-86   Prunus persica
ref|XP_010279404.1|  PREDICTED: sugar transporter ERD6-like 16 is...    276   5e-86   
emb|CDY13924.1|  BnaC09g39020D                                          270   6e-86   Brassica napus [oilseed rape]
ref|XP_008234934.1|  PREDICTED: sugar transporter ERD6-like 7           276   6e-86   
ref|XP_010507821.1|  PREDICTED: sugar transporter ERD6-like 7           275   9e-86   
ref|XP_010667578.1|  PREDICTED: sugar transporter ERD6-like 7           276   1e-85   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010279395.1|  PREDICTED: sugar transporter ERD6-like 16 is...    276   1e-85   Nelumbo nucifera [Indian lotus]
ref|XP_007201571.1|  hypothetical protein PRUPE_ppa018319mg             276   1e-85   
ref|XP_006444168.1|  hypothetical protein CICLE_v10019918mg             275   1e-85   Citrus clementina [clementine]
ref|NP_568367.1|  sugar transporter ERD6-like 16                        275   2e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008386584.1|  PREDICTED: sugar transporter ERD6-like 7           275   2e-85   
ref|XP_010454136.1|  PREDICTED: sugar transporter ERD6-like 16 is...    275   3e-85   
ref|XP_002315546.2|  hypothetical protein POPTR_0010s02740g             275   4e-85   
ref|XP_004290697.1|  PREDICTED: sugar transporter ERD6-like 7           274   4e-85   Fragaria vesca subsp. vesca
ref|XP_009102177.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    273   5e-85   
ref|XP_010492922.1|  PREDICTED: sugar transporter ERD6-like 16          273   1e-84   Camelina sativa [gold-of-pleasure]
gb|KCW58947.1|  hypothetical protein EUGRSUZ_H01571                     272   2e-84   Eucalyptus grandis [rose gum]
ref|XP_004290698.1|  PREDICTED: sugar transporter ERD6-like 7           271   3e-84   Fragaria vesca subsp. vesca
gb|KEH23721.1|  sugar porter (SP) family MFS transporter                272   3e-84   Medicago truncatula
gb|KEH23691.1|  sugar porter (SP) family MFS transporter                271   3e-84   Medicago truncatula
gb|AAM64736.1|  sugar transporter-like protein                          272   3e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010112685.1|  Sugar transporter ERD6-like 7                      271   4e-84   
ref|XP_008449464.1|  PREDICTED: sugar transporter ERD6-like 7           271   4e-84   Cucumis melo [Oriental melon]
ref|XP_010420663.1|  PREDICTED: sugar transporter ERD6-like 16 is...    271   5e-84   Camelina sativa [gold-of-pleasure]
gb|KEH23690.1|  sugar porter (SP) family MFS transporter                271   6e-84   Medicago truncatula
ref|XP_006400439.1|  hypothetical protein EUTSA_v10013389mg             268   8e-84   
ref|XP_006287631.1|  hypothetical protein CARUB_v10000842mg             271   8e-84   Capsella rubella
ref|XP_008368891.1|  PREDICTED: sugar transporter ERD6-like 7           270   9e-84   
ref|XP_010024483.1|  PREDICTED: sugar transporter ERD6-like 16 is...    271   1e-83   Eucalyptus grandis [rose gum]
ref|XP_004296777.1|  PREDICTED: sugar transporter ERD6-like 16 is...    270   2e-83   Fragaria vesca subsp. vesca
ref|XP_008234933.1|  PREDICTED: sugar transporter ERD6-like 7           270   2e-83   
ref|XP_008340870.1|  PREDICTED: sugar transporter ERD6-like 16          270   3e-83   
ref|XP_004292610.1|  PREDICTED: sugar transporter ERD6-like 7           270   3e-83   Fragaria vesca subsp. vesca
ref|XP_010242562.1|  PREDICTED: sugar transporter ERD6-like 7           269   4e-83   Nelumbo nucifera [Indian lotus]
emb|CDX92578.1|  BnaA10g16170D                                          269   5e-83   
ref|XP_009120937.1|  PREDICTED: sugar transporter ERD6-like 16          269   6e-83   Brassica rapa
ref|XP_002320384.1|  sugar transporter family protein                   267   7e-83   
ref|XP_008458507.1|  PREDICTED: sugar transporter ERD6-like 16          268   1e-82   Cucumis melo [Oriental melon]
ref|XP_010420662.1|  PREDICTED: sugar transporter ERD6-like 16 is...    267   2e-82   Camelina sativa [gold-of-pleasure]
gb|KCW58966.1|  hypothetical protein EUGRSUZ_H01593                     260   2e-82   Eucalyptus grandis [rose gum]
ref|XP_002871845.1|  hypothetical protein ARALYDRAFT_488771             267   3e-82   
ref|XP_010107672.1|  Sugar transporter ERD6-like 7                      266   3e-82   
ref|XP_006400440.1|  hypothetical protein EUTSA_v10013389mg             267   3e-82   Eutrema salsugineum [saltwater cress]
gb|AJU57223.1|  sugar transporter ERD6-like 16                          266   5e-82   Camellia sinensis [black tea]
ref|XP_008386586.1|  PREDICTED: sugar transporter ERD6-like 7           266   5e-82   
gb|KGN46180.1|  hypothetical protein Csa_6G067380                       265   7e-82   Cucumis sativus [cucumbers]
ref|XP_008386585.1|  PREDICTED: sugar transporter ERD6-like 7           265   1e-81   
ref|XP_006419727.1|  hypothetical protein CICLE_v10004839mg             263   1e-81   
ref|XP_004153836.1|  PREDICTED: sugar transporter ERD6-like 16          265   1e-81   Cucumis sativus [cucumbers]
ref|XP_011011018.1|  PREDICTED: sugar transporter ERD6-like 16          265   2e-81   Populus euphratica
gb|KHN45387.1|  Sugar transporter ERD6-like 7                           263   2e-81   Glycine soja [wild soybean]
ref|XP_009352178.1|  PREDICTED: sugar transporter ERD6-like 16          264   6e-81   Pyrus x bretschneideri [bai li]
ref|XP_010649814.1|  PREDICTED: sugar transporter ERD6-like 16 is...    263   7e-81   
ref|XP_002516838.1|  sugar transporter, putative                        264   8e-81   
ref|XP_002278197.1|  PREDICTED: sugar transporter ERD6-like 16 is...    263   9e-81   Vitis vinifera
emb|CAN63855.1|  hypothetical protein VITISV_008852                     265   1e-80   Vitis vinifera
ref|XP_010546910.1|  PREDICTED: sugar transporter ERD6-like 16          263   2e-80   Tarenaya hassleriana [spider flower]
ref|XP_006419729.1|  hypothetical protein CICLE_v10004839mg             263   2e-80   Citrus clementina [clementine]
ref|XP_011651013.1|  PREDICTED: sugar transporter ERD6-like 16 is...    261   2e-80   Cucumis sativus [cucumbers]
gb|KFK26120.1|  hypothetical protein AALP_AA8G206400                    261   3e-80   Arabis alpina [alpine rockcress]
ref|XP_004134178.1|  PREDICTED: sugar transporter ERD6-like 16 is...    261   3e-80   Cucumis sativus [cucumbers]
emb|CDO98940.1|  unnamed protein product                                261   7e-80   Coffea canephora [robusta coffee]
ref|XP_010105671.1|  Sugar transporter ERD6-like 16                     259   1e-79   
ref|XP_011090877.1|  PREDICTED: sugar transporter ERD6-like 16          260   1e-79   Sesamum indicum [beniseed]
ref|XP_009774897.1|  PREDICTED: sugar transporter ERD6-like 16 is...    259   3e-79   Nicotiana sylvestris
ref|XP_006356995.1|  PREDICTED: sugar transporter ERD6-like 16-like     258   5e-79   Solanum tuberosum [potatoes]
ref|XP_004229493.1|  PREDICTED: sugar transporter ERD6-like 16          257   1e-78   Solanum lycopersicum
emb|CBI26138.3|  unnamed protein product                                256   1e-78   Vitis vinifera
ref|XP_009603614.1|  PREDICTED: sugar transporter ERD6-like 16 is...    258   1e-78   Nicotiana tomentosiformis
ref|XP_008223079.1|  PREDICTED: sugar transporter ERD6-like 16          256   6e-78   
ref|XP_007226898.1|  hypothetical protein PRUPE_ppa016361mg             255   8e-78   
gb|KJB72535.1|  hypothetical protein B456_011G183500                    253   2e-77   Gossypium raimondii
ref|XP_007050737.1|  Major facilitator superfamily protein              254   4e-77   
gb|KJB72537.1|  hypothetical protein B456_011G183500                    253   4e-77   Gossypium raimondii
gb|KJB72536.1|  hypothetical protein B456_011G183500                    253   5e-77   Gossypium raimondii
ref|XP_008438775.1|  PREDICTED: sugar transporter ERD6-like 16 is...    252   9e-77   Cucumis melo [Oriental melon]
ref|XP_008438773.1|  PREDICTED: sugar transporter ERD6-like 16 is...    253   1e-76   Cucumis melo [Oriental melon]
gb|KEH32265.1|  sugar porter (SP) family MFS transporter                250   3e-76   Medicago truncatula
gb|EYU43869.1|  hypothetical protein MIMGU_mgv1a018596mg                250   5e-76   Erythranthe guttata [common monkey flower]
ref|XP_003609563.1|  Sugar transporter ERD6-like protein                251   6e-76   Medicago truncatula
gb|KEH36719.1|  sugar porter (SP) family MFS transporter                247   8e-76   Medicago truncatula
ref|XP_004508324.1|  PREDICTED: sugar transporter ERD6-like 16-like     248   4e-75   Cicer arietinum [garbanzo]
ref|XP_010242565.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    247   7e-75   
gb|KEH36718.1|  sugar porter (SP) family MFS transporter                246   8e-75   Medicago truncatula
gb|KDP40049.1|  hypothetical protein JCGZ_02047                         248   8e-75   Jatropha curcas
gb|KEH36720.1|  sugar porter (SP) family MFS transporter                246   8e-75   Medicago truncatula
ref|XP_012069444.1|  PREDICTED: sugar transporter ERD6-like 16 is...    248   9e-75   Jatropha curcas
ref|XP_009419855.1|  PREDICTED: sugar transporter ERD6-like 16 is...    246   2e-74   
ref|XP_009419854.1|  PREDICTED: sugar transporter ERD6-like 16 is...    246   3e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006594463.1|  PREDICTED: sugar transporter ERD6-like 16-li...    248   4e-74   Glycine max [soybeans]
ref|XP_003594043.1|  Sugar transporter ERD6-like protein                246   4e-74   Medicago truncatula
ref|XP_007147846.1|  hypothetical protein PHAVU_006G159600g             246   5e-74   Phaseolus vulgaris [French bean]
ref|XP_003547222.2|  PREDICTED: sugar transporter ERD6-like 16-like     244   2e-73   Glycine max [soybeans]
ref|XP_010941736.1|  PREDICTED: sugar transporter ERD6-like 16          243   2e-73   Elaeis guineensis
gb|KHN33102.1|  Sugar transporter ERD6-like 16                          244   3e-73   Glycine soja [wild soybean]
gb|KHN37528.1|  Sugar transporter ERD6-like 16                          243   4e-73   Glycine soja [wild soybean]
ref|XP_011090879.1|  PREDICTED: sugar transporter ERD6-like 16 is...    239   4e-73   
ref|XP_006594464.1|  PREDICTED: sugar transporter ERD6-like 16-li...    243   5e-73   
ref|XP_003541648.2|  PREDICTED: sugar transporter ERD6-like 16-li...    243   5e-73   Glycine max [soybeans]
ref|XP_003541649.1|  PREDICTED: sugar transporter ERD6-like 16-like     242   7e-73   Glycine max [soybeans]
ref|XP_010024484.1|  PREDICTED: sugar transporter ERD6-like 16 is...    241   7e-73   Eucalyptus grandis [rose gum]
ref|XP_006594462.1|  PREDICTED: sugar transporter ERD6-like 16-li...    244   9e-73   
ref|XP_004486078.1|  PREDICTED: sugar transporter ERD6-like 16-like     241   3e-72   Cicer arietinum [garbanzo]
ref|XP_010666329.1|  PREDICTED: sugar transporter ERD6-like 16          241   5e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008795112.1|  PREDICTED: sugar transporter ERD6-like 16 is...    240   7e-72   Phoenix dactylifera
ref|XP_010660047.1|  PREDICTED: sugar transporter ERD6-like 8           239   8e-72   
gb|ADP37168.1|  putative ERD6-like transporter                          239   8e-72   Vitis vinifera
ref|XP_010912096.1|  PREDICTED: sugar transporter ERD6-like 16          239   1e-71   Elaeis guineensis
gb|KJB22569.1|  hypothetical protein B456_004G054600                    239   1e-71   Gossypium raimondii
ref|XP_010242561.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    238   1e-71   Nelumbo nucifera [Indian lotus]
ref|XP_011090878.1|  PREDICTED: sugar transporter ERD6-like 16 is...    239   2e-71   Sesamum indicum [beniseed]
ref|XP_010242560.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    238   2e-71   Nelumbo nucifera [Indian lotus]
gb|ERN07483.1|  hypothetical protein AMTR_s00019p00256320               238   3e-71   Amborella trichopoda
ref|XP_011623901.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    238   4e-71   Amborella trichopoda
ref|XP_006845811.2|  PREDICTED: sugar transporter ERD6-like 16          238   4e-71   Amborella trichopoda
ref|XP_010485917.1|  PREDICTED: sugar transporter ERD6-like 8           238   4e-71   Camelina sativa [gold-of-pleasure]
ref|XP_006845806.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    237   9e-71   Amborella trichopoda
gb|KDP26380.1|  hypothetical protein JCGZ_17538                         238   1e-70   Jatropha curcas
ref|XP_009603503.1|  PREDICTED: sugar transporter ERD6-like 8           229   1e-70   
ref|XP_012085835.1|  PREDICTED: sugar transporter ERD6-like 16          235   2e-70   
ref|XP_010070295.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    228   2e-70   
ref|XP_010546662.1|  PREDICTED: sugar transporter ERD6-like 8           236   2e-70   Tarenaya hassleriana [spider flower]
ref|XP_010464026.1|  PREDICTED: sugar transporter ERD6-like 8           235   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006299027.1|  hypothetical protein CARUB_v10015164mg             234   8e-70   Capsella rubella
ref|XP_010660043.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    234   1e-69   
emb|CBI34326.3|  unnamed protein product                                241   1e-69   Vitis vinifera
emb|CBI34327.3|  unnamed protein product                                236   2e-69   Vitis vinifera
ref|XP_010660042.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    234   2e-69   
ref|XP_002882396.1|  sugar transporter family protein                   233   3e-69   
ref|NP_187166.2|  sugar transporter ERD6-like 8                         233   4e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010660044.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    232   6e-69   
gb|AAF27021.1|AC009177_11  putative sugar transporter                   230   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007030767.1|  Sugar transporter, putative                        231   2e-68   
ref|XP_010244606.1|  PREDICTED: sugar transporter ERD6-like 16          227   8e-68   
emb|CDY30026.1|  BnaC01g39820D                                          229   9e-68   Brassica napus [oilseed rape]
ref|XP_010070291.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    228   1e-67   Eucalyptus grandis [rose gum]
ref|XP_009124970.1|  PREDICTED: sugar transporter ERD6-like 8           228   1e-67   Brassica rapa
gb|KJB82599.1|  hypothetical protein B456_013G203800                    227   1e-67   Gossypium raimondii
ref|XP_010070279.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    226   5e-67   
ref|XP_009414205.1|  PREDICTED: sugar transporter ERD6-like 16          226   9e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010649823.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    226   1e-66   Vitis vinifera
gb|ERN00836.1|  hypothetical protein AMTR_s00103p00071860               225   3e-66   Amborella trichopoda
dbj|BAH01094.1|  unnamed protein product                                224   4e-66   Oryza sativa Japonica Group [Japonica rice]
gb|KDO44994.1|  hypothetical protein CISIN_1g011956mg                   220   6e-66   Citrus sinensis [apfelsine]
ref|XP_006838267.2|  PREDICTED: sugar transporter ERD6-like 5           222   2e-65   
ref|XP_003575758.2|  PREDICTED: sugar transporter ERD6-like 16          221   4e-65   
ref|XP_011623902.1|  PREDICTED: sugar transporter ERD6-like 7           222   5e-65   Amborella trichopoda
ref|XP_010649824.1|  PREDICTED: sugar transporter ERD6-like 16 is...    221   6e-65   Vitis vinifera
gb|KCW58929.1|  hypothetical protein EUGRSUZ_H015511                    216   7e-65   Eucalyptus grandis [rose gum]
ref|XP_006433199.1|  hypothetical protein CICLE_v10001032mg             218   9e-65   
ref|XP_010649825.1|  PREDICTED: sugar transporter ERD6-like 16 is...    221   9e-65   
ref|XP_004248997.1|  PREDICTED: sugar transporter ERD6-like 8           222   1e-64   
ref|XP_002512323.1|  sugar transporter, putative                        221   1e-64   Ricinus communis
ref|XP_006663074.1|  PREDICTED: sugar transporter ERD6-like 16-like     219   2e-64   Oryza brachyantha
ref|XP_002278654.3|  PREDICTED: sugar transporter ERD6-like 7 iso...    219   6e-64   Vitis vinifera
gb|KDO44991.1|  hypothetical protein CISIN_1g011956mg                   218   7e-64   Citrus sinensis [apfelsine]
ref|XP_012089453.1|  PREDICTED: sugar transporter ERD6-like 8           219   7e-64   
gb|KDO44992.1|  hypothetical protein CISIN_1g011956mg                   219   8e-64   Citrus sinensis [apfelsine]
ref|XP_006471873.1|  PREDICTED: sugar transporter ERD6-like 5-lik...    218   1e-63   Citrus sinensis [apfelsine]
ref|XP_006433198.1|  hypothetical protein CICLE_v10001032mg             218   2e-63   Citrus clementina [clementine]
ref|XP_011023524.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    213   1e-62   Populus euphratica
gb|KJB45167.1|  hypothetical protein B456_007G293200                    216   1e-62   Gossypium raimondii
ref|XP_012089129.1|  PREDICTED: sugar transporter ERD6-like 5           214   4e-62   
ref|XP_006375782.1|  hypothetical protein POPTR_0013s02850g             213   4e-62   
gb|AAC64898.1|  Similar to Beta integral membrane protein homolog...    214   8e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003557831.1|  PREDICTED: sugar transporter ERD6-like 16          214   1e-61   Brachypodium distachyon [annual false brome]
emb|CBI26146.3|  unnamed protein product                                214   1e-61   Vitis vinifera
ref|XP_011023522.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    213   2e-61   Populus euphratica
ref|XP_002894602.1|  hypothetical protein ARALYDRAFT_474748             212   2e-61   Arabidopsis lyrata subsp. lyrata
emb|CDP17983.1|  unnamed protein product                                212   2e-61   Coffea canephora [robusta coffee]
ref|XP_006375783.1|  hypothetical protein POPTR_0013s02850g             211   3e-61   
ref|XP_002319570.2|  sugar transporter family protein                   211   5e-61   
ref|XP_007030780.1|  Major facilitator superfamily protein              211   6e-61   
ref|XP_010684724.1|  PREDICTED: sugar transporter ERD6-like 16 is...    209   8e-61   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG12383.1|  hypothetical protein F383_10647                         210   1e-60   Gossypium arboreum [tree cotton]
ref|XP_010684723.1|  PREDICTED: sugar transporter ERD6-like 16 is...    209   1e-60   
gb|KHG12382.1|  hypothetical protein F383_10647                         211   1e-60   Gossypium arboreum [tree cotton]
gb|ADW40547.1|  vacuolar monosaccharide symporter 1                     211   2e-60   Saccharum hybrid cultivar Q117
ref|XP_008674205.1|  PREDICTED: LOC100281158 isoform X2                 208   2e-60   Zea mays [maize]
ref|XP_002465229.1|  hypothetical protein SORBIDRAFT_01g034610          210   2e-60   
ref|XP_006301882.1|  hypothetical protein CARUB_v10022354mg             209   3e-60   Capsella rubella
gb|KFK35614.1|  hypothetical protein AALP_AA4G014000                    209   4e-60   Arabis alpina [alpine rockcress]
ref|XP_010684722.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    209   4e-60   
ref|XP_006361887.1|  PREDICTED: sugar transporter ERD6-like 5-like      209   4e-60   Solanum tuberosum [potatoes]
ref|NP_850964.1|  sugar transporter ERD6-like 5                         209   4e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010684721.1|  PREDICTED: sugar transporter ERD6-like 16 is...    209   4e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011462680.1|  PREDICTED: sugar transporter ERD6-like 16 is...    206   7e-60   Fragaria vesca subsp. vesca
ref|XP_002263418.1|  PREDICTED: sugar transporter ERD6-like 5           208   9e-60   
ref|XP_010470371.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    207   1e-59   
ref|XP_010470369.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    207   1e-59   Camelina sativa [gold-of-pleasure]
emb|CBI34338.3|  unnamed protein product                                208   1e-59   Vitis vinifera
ref|XP_009620982.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    207   1e-59   Nicotiana tomentosiformis
ref|XP_003580968.1|  PREDICTED: sugar transporter ERD6-like 5           207   2e-59   Brachypodium distachyon [annual false brome]
ref|XP_006651406.1|  PREDICTED: sugar transporter ERD6-like 16-like     207   2e-59   Oryza brachyantha
tpg|DAA45486.1|  TPA: solute carrier family 2, facilitated glucos...    207   2e-59   
ref|XP_010111870.1|  Sugar transporter ERD6-like 5                      205   6e-59   
ref|XP_010511206.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    205   1e-58   
ref|XP_004230159.2|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    205   1e-58   
ref|XP_010511205.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    205   1e-58   Camelina sativa [gold-of-pleasure]
ref|NP_001147549.1|  LOC100281158                                       205   2e-58   
ref|NP_001050166.1|  Os03g0363600                                       205   2e-58   
ref|XP_008350755.1|  PREDICTED: sugar transporter ERD6-like 5           204   3e-58   
ref|XP_003520821.1|  PREDICTED: sugar transporter ERD6-like 5-like      204   4e-58   Glycine max [soybeans]
ref|XP_009119515.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    200   5e-58   Brassica rapa
ref|XP_008795113.1|  PREDICTED: sugar transporter ERD6-like 16 is...    203   6e-58   
emb|CDP17977.1|  unnamed protein product                                203   6e-58   Coffea canephora [robusta coffee]
ref|XP_011466327.1|  PREDICTED: sugar transporter ERD6-like 5           203   7e-58   Fragaria vesca subsp. vesca
ref|XP_010912098.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    202   9e-58   
ref|XP_010912097.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    202   1e-57   Elaeis guineensis
ref|XP_008246532.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    203   1e-57   Prunus mume [ume]
ref|XP_009373955.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    203   2e-57   Pyrus x bretschneideri [bai li]
dbj|BAJ94581.1|  predicted protein                                      199   2e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009119512.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    200   2e-57   
ref|XP_009119507.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    200   2e-57   Brassica rapa
ref|XP_004984296.1|  PREDICTED: sugar transporter ERD6-like 16-like     202   2e-57   Setaria italica
ref|XP_008450689.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    201   3e-57   
ref|XP_008450688.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    201   3e-57   
gb|EPS60298.1|  hypothetical protein M569_14507                         193   3e-57   
ref|XP_009417911.1|  PREDICTED: sugar transporter ERD6-like 5           201   3e-57   
ref|XP_010070297.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    192   3e-57   
ref|XP_009119503.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    200   4e-57   
ref|XP_007147087.1|  hypothetical protein PHAVU_006G095200g             201   4e-57   
ref|XP_010070296.1|  PREDICTED: sugar transporter ERD6-like 16 is...    194   4e-57   
gb|AHG94614.1|  sugar transporter ERD6-like protein                     201   4e-57   
ref|XP_009119495.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    200   5e-57   
emb|CDY32140.1|  BnaCnng06490D                                          200   6e-57   
emb|CDY43482.1|  BnaA01g21370D                                          200   6e-57   
ref|XP_009110867.1|  PREDICTED: sugar transporter ERD6-like 3           200   6e-57   
ref|XP_008438774.1|  PREDICTED: sugar transporter ERD6-like 16 is...    200   7e-57   
ref|XP_009119491.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    200   7e-57   
ref|XP_009119487.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    200   7e-57   
ref|XP_010528860.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    198   7e-57   
emb|CDY31121.1|  BnaA08g26710D                                          200   8e-57   
ref|XP_008450691.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    200   1e-56   
ref|XP_010043109.1|  PREDICTED: sugar transporter ERD6-like 5           200   1e-56   
ref|XP_009119480.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    200   1e-56   
ref|XP_010550039.1|  PREDICTED: sugar transporter ERD6-like 3           199   1e-56   
ref|XP_006651405.1|  PREDICTED: sugar transporter ERD6-like 16-like     199   1e-56   
gb|KGN66112.1|  hypothetical protein Csa_1G571840                       201   2e-56   
ref|XP_011087867.1|  PREDICTED: sugar transporter ERD6-like 5           199   2e-56   
gb|KCW85184.1|  hypothetical protein EUGRSUZ_B02014                     200   2e-56   
gb|ADE75821.1|  unknown                                                 199   3e-56   
ref|XP_010489519.1|  PREDICTED: sugar transporter ERD6-like 3           198   4e-56   
ref|XP_012069445.1|  PREDICTED: sugar transporter ERD6-like 16 is...    197   4e-56   
ref|XP_008681389.1|  PREDICTED: hypothetical protein isoform X2         198   4e-56   
gb|KEH24531.1|  sugar porter (SP) family MFS transporter                196   4e-56   
ref|XP_010475711.1|  PREDICTED: sugar transporter ERD6-like 3           198   5e-56   
ref|XP_010528859.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    198   6e-56   
ref|XP_006444170.1|  hypothetical protein CICLE_v10019923mg             196   6e-56   
ref|XP_010674993.1|  PREDICTED: sugar transporter ERD6-like 5           197   7e-56   
gb|EAZ27016.1|  hypothetical protein OsJ_10945                          197   7e-56   
ref|XP_008366851.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    198   9e-56   
gb|KHG16714.1|  Sugar transporter ERD6-like 18                          197   1e-55   
emb|CDY22657.1|  BnaC08g42910D                                          197   1e-55   
gb|KJB45166.1|  hypothetical protein B456_007G293100                    197   1e-55   
ref|XP_008681387.1|  PREDICTED: hypothetical protein isoform X1         198   2e-55   
gb|KJB45165.1|  hypothetical protein B456_007G293100                    197   2e-55   
ref|XP_003553740.2|  PREDICTED: sugar transporter ERD6-like 5-like      197   2e-55   
gb|ABN09011.1|  General substrate transporter; Sugar transporter ...    196   5e-55   
ref|XP_003626331.1|  Sugar transporter ERD6, putative                   196   5e-55   
ref|XP_006417632.1|  hypothetical protein EUTSA_v10007539mg             195   5e-55   
ref|XP_007147091.1|  hypothetical protein PHAVU_006G095600g             196   7e-55   
emb|CDP17978.1|  unnamed protein product                                194   7e-55   
ref|XP_009118335.1|  PREDICTED: sugar transporter ERD6-like 3           195   8e-55   
ref|XP_002512324.1|  sugar transporter, putative                        194   1e-54   
emb|CDX95022.1|  BnaC05g06490D                                          194   1e-54   
ref|XP_010043108.1|  PREDICTED: sugar transporter ERD6-like 5           194   2e-54   
ref|XP_002889722.1|  hypothetical protein ARALYDRAFT_470966             194   2e-54   
ref|NP_001050165.1|  Os03g0363500                                       195   3e-54   
ref|XP_006577261.1|  PREDICTED: sugar transporter ERD6-like 5-lik...    194   3e-54   
ref|XP_003521722.1|  PREDICTED: sugar transporter ERD6-like 5-lik...    193   3e-54   
ref|NP_001031005.1|  sugar transporter ERD6-like 3                      192   5e-54   
gb|EEC75308.1|  hypothetical protein OsI_11676                          194   5e-54   
gb|AAB70413.1|  Similar to Beta integral membrane protein (gb|U43...    192   5e-54   
ref|XP_010660071.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    193   6e-54   
ref|XP_007030778.1|  Major facilitator superfamily protein, putative    193   6e-54   
ref|XP_009148150.1|  PREDICTED: sugar transporter ERD6-like 3           192   7e-54   
emb|CDX93528.1|  BnaA06g05200D                                          192   7e-54   
ref|NP_849618.1|  sugar transporter ERD6-like 3                         192   8e-54   
ref|NP_563829.1|  sugar transporter ERD6-like 3                         192   8e-54   
emb|CAB64733.1|  putative sugar transporter                             192   9e-54   
ref|XP_009782756.1|  PREDICTED: sugar transporter ERD6-like 5           191   9e-54   
ref|XP_004494647.1|  PREDICTED: sugar transporter ERD6-like 5-like      192   1e-53   
gb|KCW61728.1|  hypothetical protein EUGRSUZ_H04438                     190   2e-53   
gb|KEH24532.1|  sugar porter (SP) family MFS transporter                190   3e-53   
ref|NP_001159247.1|  hypothetical protein                               189   4e-53   
gb|KFK43197.1|  hypothetical protein AALP_AA1G093000                    190   4e-53   
ref|XP_004984297.1|  PREDICTED: sugar transporter ERD6-like 16-like     192   4e-53   
ref|XP_010040756.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    185   4e-53   
ref|XP_010043131.1|  PREDICTED: sugar transporter ERD6-like 5           188   5e-53   
ref|XP_010043132.1|  PREDICTED: sugar transporter ERD6-like 5           190   6e-53   
ref|XP_002512320.1|  sugar transporter, putative                        189   6e-53   
ref|XP_010025134.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    190   1e-52   
ref|XP_010660062.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    189   1e-52   
emb|CBI34328.3|  unnamed protein product                                189   1e-52   
dbj|BAJ93725.1|  predicted protein                                      189   1e-52   
ref|XP_010545075.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    187   1e-52   
ref|XP_010528843.1|  PREDICTED: sugar transporter ERD6-like 3           189   1e-52   
ref|XP_003626332.1|  Sugar transporter ERD6-like protein                189   1e-52   
ref|XP_010528847.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    188   2e-52   
gb|KCW44953.1|  hypothetical protein EUGRSUZ_L01459                     185   2e-52   
gb|KCW61736.1|  hypothetical protein EUGRSUZ_H04441                     187   3e-52   
ref|XP_010025139.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    187   3e-52   
ref|XP_006304417.1|  hypothetical protein CARUB_v10010993mg             187   4e-52   
ref|NP_001140461.1|  hypothetical protein                               187   4e-52   
gb|KCW61735.1|  hypothetical protein EUGRSUZ_H04441                     187   6e-52   
ref|XP_010025138.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    186   8e-52   
ref|XP_010550074.1|  PREDICTED: sugar transporter ERD6-like 3           187   1e-51   
ref|XP_008672346.1|  PREDICTED: hypothetical protein isoform X1         187   1e-51   
ref|XP_010025137.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    186   1e-51   
gb|EMT10929.1|  Sugar transporter ERD6-like protein 16                  186   1e-51   
ref|XP_006471867.1|  PREDICTED: sugar transporter ERD6-like 11-li...    182   2e-51   
gb|EMS60488.1|  Sugar transporter ERD6-like 5                           185   2e-51   
ref|XP_007205125.1|  hypothetical protein PRUPE_ppa004943mg             186   3e-51   
gb|EEC80176.1|  hypothetical protein OsI_22030                          184   3e-51   
gb|KFK43198.1|  hypothetical protein AALP_AA1G093100                    185   4e-51   
ref|XP_006419726.1|  hypothetical protein CICLE_v10004839mg             183   5e-51   
ref|XP_010550028.1|  PREDICTED: sugar transporter ERD6                  186   5e-51   
ref|XP_010660049.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    184   6e-51   
gb|ADP37159.1|  putative ERD6-like transporter                          184   6e-51   
ref|XP_011048905.1|  PREDICTED: sugar transporter ERD6-like 5           184   7e-51   
ref|XP_006433208.1|  hypothetical protein CICLE_v10000980mg             184   8e-51   
ref|XP_010228594.1|  PREDICTED: sugar transporter ERD6-like 16 is...    183   8e-51   
ref|XP_010660061.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    184   1e-50   
ref|XP_010052634.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    181   1e-50   
ref|XP_010660046.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    183   1e-50   
ref|XP_010027218.1|  PREDICTED: sugar transporter ERD6-like 5           183   2e-50   
emb|CDX93527.1|  BnaA06g05210D                                          184   2e-50   
gb|KCW61729.1|  hypothetical protein EUGRSUZ_H04439                     183   2e-50   
emb|CDX95021.1|  BnaC05g06500D                                          184   2e-50   
ref|XP_006417630.1|  hypothetical protein EUTSA_v10007451mg             183   2e-50   
ref|XP_006417631.1|  hypothetical protein EUTSA_v10007451mg             183   3e-50   
ref|XP_010551192.1|  PREDICTED: sugar transporter ERD6-like 3           183   3e-50   
ref|XP_010674995.1|  PREDICTED: sugar transporter ERD6-like 5           182   4e-50   
ref|XP_009148151.1|  PREDICTED: sugar transporter ERD6-like             183   4e-50   
ref|XP_012089135.1|  PREDICTED: sugar transporter ERD6-like 5           182   4e-50   
ref|XP_010228593.1|  PREDICTED: sugar transporter ERD6-like 16 is...    183   6e-50   
ref|XP_010052633.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    181   6e-50   
ref|XP_009118334.1|  PREDICTED: sugar transporter ERD6                  182   7e-50   
ref|XP_002457561.1|  hypothetical protein SORBIDRAFT_03g009340          181   7e-50   
ref|XP_009603615.1|  PREDICTED: sugar transporter ERD6-like 16 is...    179   9e-50   
ref|XP_010040747.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    176   9e-50   
ref|XP_010040746.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    176   9e-50   
gb|ADP37162.1|  putative ERD6-like transporter                          181   1e-49   
ref|NP_563830.1|  sugar transporter ERD6                                182   1e-49   
ref|XP_009774898.1|  PREDICTED: sugar transporter ERD6-like 16 is...    179   1e-49   
emb|CDY32141.1|  BnaCnng06500D                                          182   1e-49   
ref|XP_010052632.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    181   1e-49   
ref|XP_006433201.1|  hypothetical protein CICLE_v10000960mg             180   1e-49   
gb|KCW85201.1|  hypothetical protein EUGRSUZ_B02026                     179   1e-49   
gb|KCW76710.1|  hypothetical protein EUGRSUZ_D01066                     181   2e-49   
ref|XP_004967879.1|  PREDICTED: sugar transporter ERD6-like 5-like      181   2e-49   
gb|ACN26851.1|  unknown                                                 181   2e-49   
ref|NP_001146190.1|  uncharacterized protein LOC100279760               181   2e-49   
ref|XP_006406379.1|  hypothetical protein EUTSA_v10020647mg             180   2e-49   
emb|CDY22656.1|  BnaC08g42900D                                          181   3e-49   
emb|CBI34335.3|  unnamed protein product                                180   3e-49   
gb|ADP37160.1|  putative ERD6-like transporter                          180   3e-49   
ref|XP_006382627.1|  hypothetical protein POPTR_0005s03920g             180   3e-49   
ref|XP_010660053.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    180   3e-49   
ref|XP_011466331.1|  PREDICTED: sugar transporter ERD6-like 3           180   3e-49   
ref|XP_010043133.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    180   3e-49   
ref|XP_010660048.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    180   3e-49   
ref|XP_010660057.1|  PREDICTED: sugar transporter ERD6-like 10 is...    180   3e-49   
ref|XP_010528849.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    180   4e-49   
ref|XP_009110866.1|  PREDICTED: sugar transporter ERD6-like             180   4e-49   
ref|XP_010660052.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    180   5e-49   
gb|KEH36721.1|  sugar porter (SP) family MFS transporter                178   5e-49   
gb|ABK24356.1|  unknown                                                 179   6e-49   
ref|XP_006433202.1|  hypothetical protein CICLE_v10000960mg             179   6e-49   
ref|XP_002889723.1|  hypothetical protein ARALYDRAFT_888127             179   6e-49   
gb|KCW76704.1|  hypothetical protein EUGRSUZ_D01064                     176   7e-49   
ref|XP_010043129.1|  PREDICTED: sugar transporter ERD6-like 5           179   8e-49   
ref|XP_010052631.1|  PREDICTED: sugar transporter ERD6-like 17 is...    177   9e-49   
ref|XP_010674987.1|  PREDICTED: sugar transporter ERD6-like 5           178   1e-48   
emb|CAN83661.1|  hypothetical protein VITISV_037729                     181   1e-48   
emb|CDP17979.1|  unnamed protein product                                177   2e-48   
ref|XP_006471871.1|  PREDICTED: sugar transporter ERD6-like 3-lik...    178   2e-48   
gb|ABR16538.1|  unknown                                                 178   2e-48   
ref|XP_011036750.1|  PREDICTED: sugar transporter ERD6-like 3           178   2e-48   
ref|XP_010043118.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    177   2e-48   
ref|XP_010052630.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    177   3e-48   
gb|AET03897.2|  sugar porter (SP) family MFS transporter                176   4e-48   
ref|XP_009145627.1|  PREDICTED: putative sugar transporter ERD6-l...    176   4e-48   
ref|XP_006471866.1|  PREDICTED: sugar transporter ERD6-like 5-lik...    177   4e-48   
ref|XP_010660054.1|  PREDICTED: sugar transporter ERD6-like 5           177   4e-48   
ref|XP_010424124.1|  PREDICTED: sugar transporter ERD6-like 9           177   5e-48   
ref|XP_010052629.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    177   5e-48   
ref|XP_010674988.1|  PREDICTED: sugar transporter ERD6-like 5           177   5e-48   
emb|CDY31120.1|  BnaA08g26700D                                          177   5e-48   
gb|KCW76709.1|  hypothetical protein EUGRSUZ_D01065                     175   6e-48   
ref|XP_010485922.1|  PREDICTED: sugar transporter ERD6-like 9           176   6e-48   
gb|KCW76707.1|  hypothetical protein EUGRSUZ_D01065                     175   6e-48   
ref|XP_011466332.1|  PREDICTED: sugar transporter ERD6-like 17 is...    179   6e-48   
ref|XP_003520312.1|  PREDICTED: sugar transporter ERD6-like 6-like      177   7e-48   
ref|XP_012089451.1|  PREDICTED: uncharacterized protein LOC105647834    181   8e-48   
gb|KCW76708.1|  hypothetical protein EUGRSUZ_D01065                     175   9e-48   
ref|XP_006655599.1|  PREDICTED: sugar transporter ERD6-like 6-like      176   1e-47   
ref|XP_006878598.1|  PREDICTED: sugar transporter ERD6-like 6 iso...    176   1e-47   
ref|XP_004291871.1|  PREDICTED: sugar transporter ERD6-like 6           176   1e-47   
ref|XP_010464028.1|  PREDICTED: sugar transporter ERD6-like 9 iso...    175   1e-47   
ref|XP_010052628.1|  PREDICTED: sugar transporter ERD6-like 5           176   1e-47   
ref|XP_009364925.1|  PREDICTED: sugar transporter ERD6-like 6           176   1e-47   
emb|CBI34330.3|  unnamed protein product                                176   1e-47   
ref|XP_003547984.1|  PREDICTED: sugar transporter ERD6-like 6-lik...    176   1e-47   
ref|XP_006297579.1|  hypothetical protein CARUB_v10013612mg             175   2e-47   
emb|CDY17555.1|  BnaC01g26790D                                          174   2e-47   
ref|XP_003629420.1|  Sugar transporter ERD6-like protein                176   2e-47   
ref|XP_010464027.1|  PREDICTED: sugar transporter ERD6-like 9 iso...    175   2e-47   
ref|XP_010046270.1|  PREDICTED: sugar transporter ERD6-like 5           175   2e-47   
gb|KCW76706.1|  hypothetical protein EUGRSUZ_D01065                     175   2e-47   
ref|XP_008220809.1|  PREDICTED: sugar transporter ERD6-like 6           175   2e-47   
ref|XP_010660051.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    176   2e-47   
ref|XP_004509267.1|  PREDICTED: sugar transporter ERD6-like 6-like      175   2e-47   
gb|EMS53743.1|  Sugar transporter ERD6-like 6                           175   2e-47   
ref|XP_009145626.1|  PREDICTED: putative sugar transporter ERD6-l...    175   2e-47   
ref|XP_007222428.1|  hypothetical protein PRUPE_ppa004911mg             175   2e-47   
emb|CDP07507.1|  unnamed protein product                                175   2e-47   
ref|NP_001147831.1|  solute carrier family 2, facilitated glucose...    176   2e-47   
emb|CDY05164.1|  BnaC05g46390D                                          175   3e-47   
gb|EYU45170.1|  hypothetical protein MIMGU_mgv1a004641mg                175   3e-47   
ref|XP_006394977.1|  hypothetical protein EUTSA_v10004135mg             175   3e-47   
ref|XP_009145624.1|  PREDICTED: putative sugar transporter ERD6-l...    175   3e-47   
ref|XP_008444718.1|  PREDICTED: sugar transporter ERD6-like 6           175   3e-47   
ref|XP_010052626.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    175   3e-47   
ref|XP_011466330.1|  PREDICTED: sugar transporter ERD6-like 3           175   3e-47   
emb|CDY54651.1|  BnaA05g36160D                                          174   3e-47   
dbj|BAB02829.1|  sugar transporter-like protein                         174   4e-47   
ref|XP_003567863.1|  PREDICTED: sugar transporter ERD6-like 4           175   4e-47   
gb|KCW68238.1|  hypothetical protein EUGRSUZ_F01888                     172   4e-47   
gb|KDP38511.1|  hypothetical protein JCGZ_04436                         174   4e-47   
ref|XP_010458157.1|  PREDICTED: sugar transporter ERD6-like 1 iso...    174   4e-47   
ref|XP_002510395.1|  sugar transporter, putative                        174   4e-47   
ref|XP_008795114.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    173   4e-47   
ref|XP_003544408.1|  PREDICTED: sugar transporter ERD6-like 6-like      174   4e-47   
dbj|BAJ86023.1|  predicted protein                                      175   5e-47   



>dbj|BAO96226.1| sugar-porter family protein 7, partial [Solanum lycopersicum]
Length=468

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = +1

Query  268  DSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAM  447
            + K DR MVYLSTFVAVCGS +FGSCAGYSSPTQSAI +DLN SIAE+SLFGSILTFGAM
Sbjct  24   EKKQDRCMVYLSTFVAVCGSYSFGSCAGYSSPTQSAIREDLNLSIAEFSLFGSILTFGAM  83

Query  448  AGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVV  627
             GAITSGPIAD++GRKGAMRMSS FC+AGWLAIFFA+GAL +DIGRLATGYGMGVFSYVV
Sbjct  84   IGAITSGPIADYIGRKGAMRMSSGFCVAGWLAIFFAQGALALDIGRLATGYGMGVFSYVV  143

Query  628  PVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCI  807
            PVFIAEIAPK+LRGALTT+NQLMI  GVSV+F+IGTM+TWRTLALTG++PC +L  GL I
Sbjct  144  PVFIAEIAPKDLRGALTTINQLMICCGVSVSFIIGTMMTWRTLALTGLIPCAILLFGLFI  203

Query  808  I  810
            I
Sbjct  204  I  204



>ref|XP_009614908.1| PREDICTED: sugar transporter ERD6-like 7 [Nicotiana tomentosiformis]
Length=483

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 179/218 (82%), Gaps = 14/218 (6%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGK------ED-------DSKTDRWMVYLSTFVAVCGSCAF  336
            +DIE  +N      + APLI +      E+       + K +R MVYL+TFVAVCGS AF
Sbjct  3    EDIEQSENRLHEE-IRAPLITQTYKRVTEEQAENGCYEKKQNRCMVYLTTFVAVCGSFAF  61

Query  337  GSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSS  516
            GSCAGYSSPTQSAI +DLN SIAE+SLFGSILTFGAM GAITSGPIAD++GRKGAMRMSS
Sbjct  62   GSCAGYSSPTQSAIREDLNLSIAEFSLFGSILTFGAMIGAITSGPIADYIGRKGAMRMSS  121

Query  517  VFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLM  696
             FC+AGWLAI+FA+GAL +DIGRLATGYGMGVFSYVVPVFIAEIAP++LRGALTT+NQLM
Sbjct  122  AFCVAGWLAIYFAQGALSLDIGRLATGYGMGVFSYVVPVFIAEIAPRDLRGALTTINQLM  181

Query  697  IVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            I  GVSVAF+IGTM+TWR LALTG++PC +L  GL II
Sbjct  182  ICCGVSVAFIIGTMLTWRALALTGLIPCAILLFGLFII  219



>ref|XP_009777420.1| PREDICTED: sugar transporter ERD6-like 7 [Nicotiana sylvestris]
Length=483

 Score =   303 bits (777),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 179/218 (82%), Gaps = 14/218 (6%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGK------ED-------DSKTDRWMVYLSTFVAVCGSCAF  336
            +DI+  +N      + APLI +      E+       + K +R MVYLSTFVAVCGS AF
Sbjct  3    EDIQQSENRLQEE-IRAPLITQTYKRATEEQAENGCYEKKQNRCMVYLSTFVAVCGSFAF  61

Query  337  GSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSS  516
            GSCAGYSSPTQSAI +DLN SIAE+SLFGSILTFGAM GAITSGPIAD++GRKGAMRMSS
Sbjct  62   GSCAGYSSPTQSAIREDLNLSIAEFSLFGSILTFGAMIGAITSGPIADYIGRKGAMRMSS  121

Query  517  VFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLM  696
             FC+AGW AI+FA+GAL +DIGRLATGYGMGVFSYVVPVFIAEIAP++LRGALTT+NQLM
Sbjct  122  AFCVAGWFAIYFAQGALSLDIGRLATGYGMGVFSYVVPVFIAEIAPRDLRGALTTINQLM  181

Query  697  IVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            I  GVSVAF+IGTM+TWRTLALTG++PC +L  GL II
Sbjct  182  ICCGVSVAFIIGTMLTWRTLALTGLIPCAILLFGLFII  219



>ref|XP_007050715.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007050716.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX94872.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX94873.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=484

 Score =   303 bits (775),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 180/222 (81%), Gaps = 14/222 (6%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGK------EDDSKTDR-------WMVYLSTFVAVCG  324
            MA  +DIE G N+        PL+ +      E+D  TD+       WMVYLSTFVAVCG
Sbjct  1    MAIREDIEKG-NDSVHEEARVPLLQEQKTMADEEDGHTDQTSSKASLWMVYLSTFVAVCG  59

Query  325  SCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAM  504
            S  FGSCAGYSSPTQ+AI++DL+ ++AEYS+FGSILTFGAM GAITSGPIADF+GRKGAM
Sbjct  60   SFEFGSCAGYSSPTQTAITEDLSLTLAEYSVFGSILTFGAMIGAITSGPIADFIGRKGAM  119

Query  505  RMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTL  684
            R ++ FC+AGWLAI+FAKGAL +DIGRLATGYGMGVFSYVVPVFIAEIAPK LRGALTT+
Sbjct  120  RTATGFCVAGWLAIYFAKGALPLDIGRLATGYGMGVFSYVVPVFIAEIAPKNLRGALTTI  179

Query  685  NQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            NQLMI TGVSVAF+IGT++TWRTLALTG++PC +L  GL  I
Sbjct  180  NQLMICTGVSVAFIIGTVLTWRTLALTGLIPCAILLCGLFFI  221



>ref|XP_006358441.1| PREDICTED: sugar transporter ERD6-like 7-like [Solanum tuberosum]
Length=480

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 177/215 (82%), Gaps = 11/215 (5%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDS----------KTDRWMVYLSTFVAVCGSCAFGSC  345
            +DIE  +N  +   +  PLI + + S          K DR MVYLSTFVAVCGS +FGSC
Sbjct  3    EDIEPSENRVNEE-IRTPLIIQTNKSEKVENGCYEKKQDRCMVYLSTFVAVCGSYSFGSC  61

Query  346  AGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFC  525
            AGYSSP QSAI +DLN SIAE+SLFGSILTFGAM GAITSGPIAD++GRKGAMRMSS FC
Sbjct  62   AGYSSPIQSAIREDLNLSIAEFSLFGSILTFGAMIGAITSGPIADYIGRKGAMRMSSGFC  121

Query  526  LAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVT  705
            +AGWLAI+FA+GAL +DIGRLATGYGMGVFSYVVPVFIAEIAPK+LRGALTT+NQLMI  
Sbjct  122  VAGWLAIYFAQGALALDIGRLATGYGMGVFSYVVPVFIAEIAPKDLRGALTTINQLMICC  181

Query  706  GVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            GVSV+F+IGTM+TWR LALTG++PC +L  GL II
Sbjct  182  GVSVSFIIGTMMTWRMLALTGLIPCAILIFGLFII  216



>ref|XP_002270927.2| PREDICTED: sugar transporter ERD6-like 7 [Vitis vinifera]
 gb|ADP37173.1| putative ERD6-like transporter [Vitis vinifera]
Length=490

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 177/225 (79%), Gaps = 17/225 (8%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLI------------GKEDD----SKTDRWMVYLSTFVA  315
            M   QD+E G++  +   +  PL+            G ED     SK   WMVYLSTFVA
Sbjct  4    MNIKQDVEKGEDS-TQEEIRKPLMQGQKNLPDAGGSGSEDQTDQSSKEHLWMVYLSTFVA  62

Query  316  VCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRK  495
            VCGS  FGSCAGYSSPTQ+AI +DL+ S+ EYS+FGSILTFGAM GAITSGPIADF+GRK
Sbjct  63   VCGSFEFGSCAGYSSPTQTAIREDLDLSLGEYSVFGSILTFGAMIGAITSGPIADFIGRK  122

Query  496  GAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGAL  675
            GAMR+SS FC AGWLAI+FA+GAL +DIGRLATGYGMGVFSYVVPVFIAEIAPK LRGAL
Sbjct  123  GAMRVSSAFCAAGWLAIYFAEGALALDIGRLATGYGMGVFSYVVPVFIAEIAPKNLRGAL  182

Query  676  TTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            TTLNQLMI TGVSVAF+IGT++TWR LALTG+VPC V+  GL +I
Sbjct  183  TTLNQLMICTGVSVAFIIGTVLTWRVLALTGLVPCAVVLFGLFLI  227



>gb|KJB47013.1| hypothetical protein B456_008G006300 [Gossypium raimondii]
Length=478

 Score =   299 bits (766),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 152/222 (68%), Positives = 175/222 (79%), Gaps = 14/222 (6%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDD-------------SKTDRWMVYLSTFVAVCG  324
            MA  +DIE G N+      A  L+ +E+D             SK   WMVY STFVAVCG
Sbjct  1    MAIKEDIERG-NDSVLESAAVSLLQEENDMADKEDGYTDQTSSKASLWMVYFSTFVAVCG  59

Query  325  SCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAM  504
            S  FGSCAGYSSPTQ+AI  DL+ S+AEYS+FGSILTFGAM GAITSGPIADF+GRKGAM
Sbjct  60   SFEFGSCAGYSSPTQTAIRTDLSLSLAEYSVFGSILTFGAMIGAITSGPIADFIGRKGAM  119

Query  505  RMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTL  684
            R ++ FC+ GWLAI+FAKGAL++D+GRLATGYGMGVFSYVVPVFIAEIAPK LRGALTT+
Sbjct  120  RTATGFCVGGWLAIYFAKGALLLDVGRLATGYGMGVFSYVVPVFIAEIAPKNLRGALTTI  179

Query  685  NQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            NQLMI TGVSVAF+IGT++TWR LALTG++PC VL  GL  I
Sbjct  180  NQLMICTGVSVAFIIGTVLTWRALALTGLIPCAVLLFGLFFI  221



>gb|KJB47011.1| hypothetical protein B456_008G006300 [Gossypium raimondii]
 gb|KJB47012.1| hypothetical protein B456_008G006300 [Gossypium raimondii]
 gb|KJB47014.1| hypothetical protein B456_008G006300 [Gossypium raimondii]
Length=484

 Score =   299 bits (766),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 152/222 (68%), Positives = 175/222 (79%), Gaps = 14/222 (6%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDD-------------SKTDRWMVYLSTFVAVCG  324
            MA  +DIE G N+      A  L+ +E+D             SK   WMVY STFVAVCG
Sbjct  1    MAIKEDIERG-NDSVLESAAVSLLQEENDMADKEDGYTDQTSSKASLWMVYFSTFVAVCG  59

Query  325  SCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAM  504
            S  FGSCAGYSSPTQ+AI  DL+ S+AEYS+FGSILTFGAM GAITSGPIADF+GRKGAM
Sbjct  60   SFEFGSCAGYSSPTQTAIRTDLSLSLAEYSVFGSILTFGAMIGAITSGPIADFIGRKGAM  119

Query  505  RMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTL  684
            R ++ FC+ GWLAI+FAKGAL++D+GRLATGYGMGVFSYVVPVFIAEIAPK LRGALTT+
Sbjct  120  RTATGFCVGGWLAIYFAKGALLLDVGRLATGYGMGVFSYVVPVFIAEIAPKNLRGALTTI  179

Query  685  NQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            NQLMI TGVSVAF+IGT++TWR LALTG++PC VL  GL  I
Sbjct  180  NQLMICTGVSVAFIIGTVLTWRALALTGLIPCAVLLFGLFFI  221



>gb|EYU43551.1| hypothetical protein MIMGU_mgv1a005532mg [Erythranthe guttata]
Length=480

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 176/220 (80%), Gaps = 15/220 (7%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDS-----------KTDRWMVYLSTFVAVCGSC  330
            MA  QDIE  +N+     M APLI   D+            K DR M+YL+TFVAVCGS 
Sbjct  1    MAKDQDIEKTENDD----MRAPLITARDEISENGDRIKKAIKEDRCMIYLTTFVAVCGSY  56

Query  331  AFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRM  510
            AFG+CAGYSSPTQ+AI +D+N S+AEYSLFGSILTFGAM GAITSG IAD++GRKGAM  
Sbjct  57   AFGACAGYSSPTQAAIREDVNLSLAEYSLFGSILTFGAMIGAITSGKIADYIGRKGAMIT  116

Query  511  SSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQ  690
            SS FC AGWL+IFFA+G +++D+GRLATGYGMGVFSYVVPVFIAEIAPKELRGALTT+NQ
Sbjct  117  SSGFCTAGWLSIFFAQGPVLLDVGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTINQ  176

Query  691  LMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            LMI  GVSV+F+IGT++TWR LAL GIVPC VL +GL II
Sbjct  177  LMICMGVSVSFIIGTLLTWRVLALVGIVPCAVLLIGLAII  216



>ref|XP_002302812.2| sugar transporter family protein [Populus trichocarpa]
 gb|EEE82085.2| sugar transporter family protein [Populus trichocarpa]
Length=484

 Score =   296 bits (759),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 174/221 (79%), Gaps = 12/221 (5%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDS------------KTDRWMVYLSTFVAVCGS  327
            M   +D+E  KN      +  PL+ K++ S            K   WMVYLSTFVAVCGS
Sbjct  1    MGIQEDLEQCKNRAEHEEVREPLMDKKNQSGEQDGSFAQSSSKESAWMVYLSTFVAVCGS  60

Query  328  CAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMR  507
             AFGSCAGYSSPT++A+ +DL+ S+AEYS+FGSILTFGAM GAITSGPIADF+GRKGA+R
Sbjct  61   FAFGSCAGYSSPTENAVREDLSLSLAEYSVFGSILTFGAMIGAITSGPIADFIGRKGALR  120

Query  508  MSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLN  687
            +++ FC+AGWLAI+FA+G L +D+GRLATGYGMGVFSYVVPVFIAEIAPK LRGALT  N
Sbjct  121  VATSFCIAGWLAIYFAQGVLALDLGRLATGYGMGVFSYVVPVFIAEIAPKNLRGALTATN  180

Query  688  QLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            QLMI  GVSVAF+IGT++TWR LALTG+VPC +L  GL +I
Sbjct  181  QLMICGGVSVAFIIGTVLTWRALALTGLVPCAILVFGLFLI  221



>ref|NP_001233882.1| st3 protein [Solanum lycopersicum]
 emb|CAC00697.2| putative sugar transporter [Solanum lycopersicum]
Length=480

 Score =   294 bits (753),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 176/215 (82%), Gaps = 11/215 (5%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLI------GKED----DSKTDRWMVYLSTFVAVCGSCAFGSC  345
            +DIE+ +N  +   +  PLI       KE+    + K DR MVYLST VAV GS + GSC
Sbjct  3    EDIEHSENRVNEE-ITTPLIIQTNKRVKEENGCYEKKQDRCMVYLSTLVAVRGSYSLGSC  61

Query  346  AGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFC  525
            AGYSSPTQSAI +DLN SIA+ SLFGSI TFGAM GAITSGPIAD++GRKGAMRMSS FC
Sbjct  62   AGYSSPTQSAIREDLNLSIAQISLFGSIWTFGAMIGAITSGPIADYIGRKGAMRMSSGFC  121

Query  526  LAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVT  705
            +AGWLAIFFA+GAL +DIGRLATGYGMGVFSYVVPVFIAEIAPK+LRGALTT+NQLMI  
Sbjct  122  VAGWLAIFFAQGALALDIGRLATGYGMGVFSYVVPVFIAEIAPKDLRGALTTINQLMICC  181

Query  706  GVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            GVSV+F+IGTM+TWRTLALTG++PC +L  GL II
Sbjct  182  GVSVSFIIGTMMTWRTLALTGLIPCAILLFGLFII  216



>ref|XP_011009473.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Populus 
euphratica]
Length=478

 Score =   294 bits (752),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 144/215 (67%), Positives = 173/215 (80%), Gaps = 6/215 (3%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKED------DSKTDRWMVYLSTFVAVCGSCAFGSC  345
            M   +D+E  KN      +  PL+ ++D       SK    MVYLSTFVAVCGS AFGSC
Sbjct  1    MGIQEDLEQCKNRAEHEDVREPLMDEQDGSFAQSSSKESARMVYLSTFVAVCGSFAFGSC  60

Query  346  AGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFC  525
            AGYSSPT++A+ +DL+ S+AEYS+FGSILTFGAM GAITSGPIAD +GRKGA+R+++ FC
Sbjct  61   AGYSSPTENAVREDLSLSLAEYSVFGSILTFGAMIGAITSGPIADLIGRKGALRVATSFC  120

Query  526  LAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVT  705
            +AGWLAI+FA+G L +D+GRLATGYGMGVFSYVVPVFIAEIAPK LRGALTT NQLMI  
Sbjct  121  VAGWLAIYFAQGVLALDLGRLATGYGMGVFSYVVPVFIAEIAPKSLRGALTTTNQLMICG  180

Query  706  GVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            GVSVAF+IGT++TWR LALTG+VPC +L  GL +I
Sbjct  181  GVSVAFIIGTVLTWRALALTGLVPCAILVFGLFLI  215



>ref|XP_012092321.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Jatropha 
curcas]
Length=446

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 172/218 (79%), Gaps = 12/218 (6%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMA-APLIGK-----------EDDSKTDRWMVYLSTFVAVCGS  327
            MA  ++IENG  +      A  PL+ K           ++ SK   WMVY STFVAVCGS
Sbjct  1    MAIKEEIENGNGKNGVHQEAREPLMRKNLADEENGSREQNSSKESVWMVYQSTFVAVCGS  60

Query  328  CAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMR  507
              FG CAGYSSPTQ AI++DL+ S+AEYS+FGSILTFGAM GAITSGPIADF+GRKGAMR
Sbjct  61   FEFGCCAGYSSPTQDAITEDLSLSLAEYSVFGSILTFGAMIGAITSGPIADFIGRKGAMR  120

Query  508  MSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLN  687
            +S+ FC+AGWLAI+FAKG L +D GRLATGYGMGVFSYVVPVFIAEIAPK LRGALTTLN
Sbjct  121  VSAAFCVAGWLAIYFAKGVLALDFGRLATGYGMGVFSYVVPVFIAEIAPKNLRGALTTLN  180

Query  688  QLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGL  801
            QLMI  GVSV ++IGT++TWR LALTG+VPC +L LGL
Sbjct  181  QLMICGGVSVFYIIGTVLTWRALALTGLVPCGILLLGL  218



>ref|XP_012092318.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Jatropha 
curcas]
 ref|XP_012092319.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Jatropha 
curcas]
 ref|XP_012092320.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Jatropha 
curcas]
 gb|KDP21525.1| hypothetical protein JCGZ_21996 [Jatropha curcas]
Length=484

 Score =   293 bits (749),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 172/218 (79%), Gaps = 12/218 (6%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMA-APLIGK-----------EDDSKTDRWMVYLSTFVAVCGS  327
            MA  ++IENG  +      A  PL+ K           ++ SK   WMVY STFVAVCGS
Sbjct  1    MAIKEEIENGNGKNGVHQEAREPLMRKNLADEENGSREQNSSKESVWMVYQSTFVAVCGS  60

Query  328  CAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMR  507
              FG CAGYSSPTQ AI++DL+ S+AEYS+FGSILTFGAM GAITSGPIADF+GRKGAMR
Sbjct  61   FEFGCCAGYSSPTQDAITEDLSLSLAEYSVFGSILTFGAMIGAITSGPIADFIGRKGAMR  120

Query  508  MSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLN  687
            +S+ FC+AGWLAI+FAKG L +D GRLATGYGMGVFSYVVPVFIAEIAPK LRGALTTLN
Sbjct  121  VSAAFCVAGWLAIYFAKGVLALDFGRLATGYGMGVFSYVVPVFIAEIAPKNLRGALTTLN  180

Query  688  QLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGL  801
            QLMI  GVSV ++IGT++TWR LALTG+VPC +L LGL
Sbjct  181  QLMICGGVSVFYIIGTVLTWRALALTGLVPCGILLLGL  218



>ref|XP_004493632.1| PREDICTED: sugar transporter ERD6-like 7-like [Cicer arietinum]
Length=473

 Score =   292 bits (747),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 172/213 (81%), Gaps = 7/213 (3%)
 Frame = +1

Query  181  KMAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDR---WMVYLSTFVAVCGSCAFGSCAG  351
            KM   +D+E G ++G T     PL+  +  ++ D    WMVY +TF+AVCGS  FG+CAG
Sbjct  2    KMEIKEDVEGGTHKGITE----PLLEGKHHARKDHHHPWMVYFTTFIAVCGSYEFGACAG  57

Query  352  YSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLA  531
            YSSPTQ AI +DL+ S+AEYSLFGSILTFGAM GAITSGPIADFVGRKGAMR+SS FC+A
Sbjct  58   YSSPTQEAIRKDLSLSLAEYSLFGSILTFGAMIGAITSGPIADFVGRKGAMRVSSAFCIA  117

Query  532  GWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGV  711
            GWL I+F++  + +DIGRLATGYGMGVFSYVVPVF+AEIAPKELRGALTTLNQ MIVT V
Sbjct  118  GWLVIYFSQNPVPLDIGRLATGYGMGVFSYVVPVFVAEIAPKELRGALTTLNQFMIVTAV  177

Query  712  SVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            SV+F+IGT+++WR LA+ G++P  VL LGL  I
Sbjct  178  SVSFIIGTVLSWRALAIIGLIPTAVLLLGLFFI  210



>ref|XP_007162379.1| hypothetical protein PHAVU_001G147100g [Phaseolus vulgaris]
 gb|ESW34373.1| hypothetical protein PHAVU_001G147100g [Phaseolus vulgaris]
Length=473

 Score =   291 bits (746),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 173/214 (81%), Gaps = 9/214 (4%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDD-----SKTDRWMVYLSTFVAVCGSCAFGSCA  348
            MA  +D+E+G  +G    +  PL+G+++      +    WMVY STFVAV GS  FG+C 
Sbjct  1    MAIKEDVEDGTQKG----IREPLVGEQNHQLVQPTTGHPWMVYFSTFVAVWGSYEFGTCV  56

Query  349  GYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCL  528
            GYSSPTQ AIS+DLN S+AEYSLFGSIL+FGAM GAITSGPIADF+GRKGAMR+SS FC+
Sbjct  57   GYSSPTQEAISKDLNLSLAEYSLFGSILSFGAMVGAITSGPIADFIGRKGAMRVSSAFCV  116

Query  529  AGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTG  708
            AGWL I+FA+G + +DI R+ATGYGMGVFSYVVPVFIAEIAPKELRG LTTLNQ MIV+G
Sbjct  117  AGWLIIYFAEGPVPLDIARIATGYGMGVFSYVVPVFIAEIAPKELRGTLTTLNQFMIVSG  176

Query  709  VSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            VSV+F+IG +++WRTLALTGI+P  +L LGL  I
Sbjct  177  VSVSFIIGNVLSWRTLALTGIIPAAILLLGLFFI  210



>gb|AJU57222.1| sugar transporter ERD6-like 7 [Camellia sinensis]
Length=489

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 170/211 (81%), Gaps = 3/211 (1%)
 Frame = +1

Query  178  RKMAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYS  357
            R++   +D      E    G  A     +  +    WMVYLSTFVAVCGS AFG+CAGYS
Sbjct  19   RELLIPEDKNQADEED---GYGAKDQSHKSSTAEHEWMVYLSTFVAVCGSYAFGTCAGYS  75

Query  358  SPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGW  537
            SPTQSAI+ DL+ S+AEYSLFGSILTFGAM GAITSGPIADF+GRK AMR+SS FC+AGW
Sbjct  76   SPTQSAITDDLDLSLAEYSLFGSILTFGAMIGAITSGPIADFIGRKWAMRVSSGFCVAGW  135

Query  538  LAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSV  717
            LAI+FA+GALV+DIGRLATGY MGVFSYVVPVFIAEIAP  LRGALTTLNQ+MIV GVSV
Sbjct  136  LAIYFAEGALVLDIGRLATGYAMGVFSYVVPVFIAEIAPTSLRGALTTLNQVMIVAGVSV  195

Query  718  AFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            +++IGT++TWR LAL G++PC +L LGL +I
Sbjct  196  SYIIGTVLTWRVLALIGLIPCAILLLGLFLI  226



>ref|XP_010242566.1| PREDICTED: sugar transporter ERD6-like 7 isoform X3 [Nelumbo 
nucifera]
Length=452

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 172/215 (80%), Gaps = 6/215 (3%)
 Frame = +1

Query  184  MAAGQDIENGKNEGS-TAGMAAPLI-----GKEDDSKTDRWMVYLSTFVAVCGSCAFGSC  345
            MA  QD E  +N  S    +  PLI     G+    K   WMVY STFVAVCGS  FGSC
Sbjct  1    MAVDQDAEAAENIISIQQRIREPLIRNIEHGENKGGKEQVWMVYFSTFVAVCGSFEFGSC  60

Query  346  AGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFC  525
            AGYSSPTQSAI +DL  S+A+YS+FGSILTFGAM GAITSGPIADF+GRKGAM MS+ FC
Sbjct  61   AGYSSPTQSAIREDLGLSLAQYSVFGSILTFGAMIGAITSGPIADFIGRKGAMWMSAAFC  120

Query  526  LAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVT  705
              GWLAI+FA+GAL++DIGRL+TGYGMGVFSYVVPVFIAE+APK+LRG LTT+NQLMI +
Sbjct  121  TGGWLAIYFAEGALLLDIGRLSTGYGMGVFSYVVPVFIAEMAPKDLRGGLTTVNQLMICS  180

Query  706  GVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            GVSVA++IGT++TWR LALTG++PC +L LGL  I
Sbjct  181  GVSVAYIIGTVLTWRALALTGLIPCFILFLGLFFI  215



>ref|XP_010242564.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Nelumbo 
nucifera]
Length=479

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 172/215 (80%), Gaps = 6/215 (3%)
 Frame = +1

Query  184  MAAGQDIENGKNEGS-TAGMAAPLI-----GKEDDSKTDRWMVYLSTFVAVCGSCAFGSC  345
            MA  QD E  +N  S    +  PLI     G+    K   WMVY STFVAVCGS  FGSC
Sbjct  1    MAVDQDAEAAENIISIQQRIREPLIRNIEHGENKGGKEQVWMVYFSTFVAVCGSFEFGSC  60

Query  346  AGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFC  525
            AGYSSPTQSAI +DL  S+A+YS+FGSILTFGAM GAITSGPIADF+GRKGAM MS+ FC
Sbjct  61   AGYSSPTQSAIREDLGLSLAQYSVFGSILTFGAMIGAITSGPIADFIGRKGAMWMSAAFC  120

Query  526  LAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVT  705
              GWLAI+FA+GAL++DIGRL+TGYGMGVFSYVVPVFIAE+APK+LRG LTT+NQLMI +
Sbjct  121  TGGWLAIYFAEGALLLDIGRLSTGYGMGVFSYVVPVFIAEMAPKDLRGGLTTVNQLMICS  180

Query  706  GVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            GVSVA++IGT++TWR LALTG++PC +L LGL  I
Sbjct  181  GVSVAYIIGTVLTWRALALTGLIPCFILFLGLFFI  215



>emb|CBI32306.3| unnamed protein product [Vitis vinifera]
Length=437

 Score =   288 bits (737),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MVYLSTFVAVCGS  FGSCAGYSSPTQ+AI +DL+ S+ EYS+FGSILTFGAM GAITSG
Sbjct  1    MVYLSTFVAVCGSFEFGSCAGYSSPTQTAIREDLDLSLGEYSVFGSILTFGAMIGAITSG  60

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
            PIADF+GRKGAMR+SS FC AGWLAI+FA+GAL +DIGRLATGYGMGVFSYVVPVFIAEI
Sbjct  61   PIADFIGRKGAMRVSSAFCAAGWLAIYFAEGALALDIGRLATGYGMGVFSYVVPVFIAEI  120

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            APK LRGALTTLNQLMI TGVSVAF+IGT++TWR LALTG+VPC V+  GL +I
Sbjct  121  APKNLRGALTTLNQLMICTGVSVAFIIGTVLTWRVLALTGLVPCAVVLFGLFLI  174



>ref|XP_011079781.1| PREDICTED: sugar transporter ERD6-like 7 [Sesamum indicum]
Length=485

 Score =   289 bits (740),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 176/222 (79%), Gaps = 14/222 (6%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGK-------------EDDSKTDRWMVYLSTFVAVCG  324
            MA  +D +NG++      + APL+ +             +  SK +R MVYL+TF+AVCG
Sbjct  1    MANNEDTDNGES-CVQEEIRAPLLSRVEIAGNGDEEKPLKTSSKEERCMVYLTTFIAVCG  59

Query  325  SCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAM  504
            S AFG CAGYSSPTQ+AI +D+  S+AEYSLFGSILTFGAM GAITSG IAD++GRKGAM
Sbjct  60   SYAFGCCAGYSSPTQAAIREDVKLSLAEYSLFGSILTFGAMIGAITSGKIADYIGRKGAM  119

Query  505  RMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTL  684
             +SS FC AGWL+I+FA+GAL++DIGRLATGYGMGVFSYVVPVFIAEIAPK+LRGALTT+
Sbjct  120  IVSSAFCTAGWLSIYFAQGALLLDIGRLATGYGMGVFSYVVPVFIAEIAPKDLRGALTTV  179

Query  685  NQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            NQLMI TGVSV+F+IGT +TWR LAL GIVPC VL  GL II
Sbjct  180  NQLMICTGVSVSFIIGTFLTWRALALVGIVPCAVLLFGLVII  221



>ref|XP_003521224.1| PREDICTED: sugar transporter ERD6-like 7-like [Glycine max]
Length=471

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 171/212 (81%), Gaps = 7/212 (3%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDR---WMVYLSTFVAVCGSCAFGSCAGY  354
            MA  +D+E+   +G    +  PL+  E +   ++   WMVY STF+AVCGS  FG+CAGY
Sbjct  1    MAIKEDVEDRTQKG----IREPLVVGEQNHHANKGHPWMVYFSTFIAVCGSYEFGACAGY  56

Query  355  SSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAG  534
            SSPTQ AI +DL+ S+AEYSLFGSILTFGAM GAITSGP+ADF+GRKGAMR+SS FC+AG
Sbjct  57   SSPTQDAIRKDLSLSLAEYSLFGSILTFGAMVGAITSGPLADFIGRKGAMRVSSAFCVAG  116

Query  535  WLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVS  714
            WL I+F++G + +DIGRLATGYGMGVFSYVVPVF+AEIAPKELRGALTTLNQ MIVT VS
Sbjct  117  WLVIYFSEGPVPLDIGRLATGYGMGVFSYVVPVFVAEIAPKELRGALTTLNQFMIVTAVS  176

Query  715  VAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            V+F+IG +++WR LA+ G+VP  VL LGL  I
Sbjct  177  VSFIIGNVLSWRALAIIGLVPTAVLLLGLFFI  208



>gb|KHN19852.1| Sugar transporter ERD6-like 7 [Glycine soja]
Length=478

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 171/212 (81%), Gaps = 7/212 (3%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDR---WMVYLSTFVAVCGSCAFGSCAGY  354
            MA  +D+E+   +G    +  PL+  E +   ++   WMVY STF+AVCGS  FG+CAGY
Sbjct  1    MAIKEDVEDRTQKG----IREPLVVGEQNHHANKGHPWMVYFSTFIAVCGSYEFGACAGY  56

Query  355  SSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAG  534
            SSPTQ AI +DL+ S+AEYSLFGSILTFGAM GAITSGP+ADF+GRKGAMR+SS FC+AG
Sbjct  57   SSPTQDAIRKDLSLSLAEYSLFGSILTFGAMVGAITSGPLADFIGRKGAMRVSSAFCVAG  116

Query  535  WLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVS  714
            WL I+F++G + +DIGRLATGYGMGVFSYVVPVF+AEIAPKELRGALTTLNQ MIVT VS
Sbjct  117  WLVIYFSEGPVPLDIGRLATGYGMGVFSYVVPVFVAEIAPKELRGALTTLNQFMIVTAVS  176

Query  715  VAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            V+F+IG +++WR LA+ G+VP  VL LGL  I
Sbjct  177  VSFIIGNVLSWRALAIIGLVPTAVLLLGLFFI  208



>ref|XP_002524779.1| sugar transporter, putative [Ricinus communis]
 gb|EEF37622.1| sugar transporter, putative [Ricinus communis]
Length=481

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 173/218 (79%), Gaps = 9/218 (4%)
 Frame = +1

Query  184  MAAGQDIENGKNEGST-AGMAAPLIGKE--DDSKTDR------WMVYLSTFVAVCGSCAF  336
            MA  +DI NG  +      +  PL+GK   D+    R      WMVYLSTFV+VCGS  F
Sbjct  1    MAIQKDIGNGSGDNDVQEEVREPLMGKNLADEENGSREQNISNWMVYLSTFVSVCGSFEF  60

Query  337  GSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSS  516
            G CAGYSSPTQ AI++DL+ S+AEYS+FGSILTFGAM GAITSG IADF+GRKGAMR+++
Sbjct  61   GCCAGYSSPTQDAITEDLSLSLAEYSVFGSILTFGAMIGAITSGLIADFIGRKGAMRVAA  120

Query  517  VFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLM  696
              C+AGWL I+FAKGAL +DIGRLATGYGMGVFSYVVPVF+AEIAPK LRGALTTLNQLM
Sbjct  121  ALCVAGWLFIYFAKGALALDIGRLATGYGMGVFSYVVPVFVAEIAPKNLRGALTTLNQLM  180

Query  697  IVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            I +GVSV ++IGT++TWRTLAL G+VPC +L  GL +I
Sbjct  181  ICSGVSVFYIIGTVITWRTLALCGLVPCAILIFGLFLI  218



>gb|KJB23160.1| hypothetical protein B456_004G084300 [Gossypium raimondii]
Length=480

 Score =   286 bits (733),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 166/203 (82%), Gaps = 3/203 (1%)
 Frame = +1

Query  202  IENGKNEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAIS  381
            +E GKN G    +      +E   K   WMVYLSTFVAVCGS AFGS AGYSSPTQ+AI+
Sbjct  18   LEEGKNIGDEENV---YTDEETSGKASLWMVYLSTFVAVCGSFAFGSSAGYSSPTQTAIT  74

Query  382  QDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKG  561
            +DL+ ++AEYS+FGSILTFGAM GA TSGPIADF+GRKGAMR ++ F +AGWLAI+FAKG
Sbjct  75   KDLSLTLAEYSVFGSILTFGAMIGATTSGPIADFIGRKGAMRTATGFSVAGWLAIYFAKG  134

Query  562  ALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMV  741
            AL +DIGRLATGYGMGVFSYVVPVFIAEIAPK LRGALTT NQLMI   VSVAF+IGT++
Sbjct  135  ALSLDIGRLATGYGMGVFSYVVPVFIAEIAPKNLRGALTTANQLMICCAVSVAFIIGTVL  194

Query  742  TWRTLALTGIVPCVVLGLGLCII  810
            TWRTLALTG++PC +L  GL  I
Sbjct  195  TWRTLALTGLIPCAILLFGLFFI  217



>gb|ACU24439.1| unknown [Glycine max]
Length=223

 Score =   278 bits (711),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 163/209 (78%), Gaps = 6/209 (3%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSP  363
            MA  +D+E    EG   G+  PL+ +   SK   WMVY + FVAVCGS  FG+CAGYSSP
Sbjct  1    MAIKEDVE----EGMQKGVREPLVVRA--SKGHPWMVYFTAFVAVCGSYEFGACAGYSSP  54

Query  364  TQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLA  543
            TQ AI +D + S+AEYSLFGSILTFGAM GAITSGPIADF+GRKGAMR+SS FC+AGWL 
Sbjct  55   TQDAIRKDFSLSLAEYSLFGSILTFGAMVGAITSGPIADFIGRKGAMRVSSAFCVAGWLV  114

Query  544  IFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAF  723
            I+FA+G + +DIGRL+TGYGMGVFSYVVPVF+AEIAPKELRG LTTLNQ MI   VSV+F
Sbjct  115  IYFAEGPVYLDIGRLSTGYGMGVFSYVVPVFVAEIAPKELRGTLTTLNQFMITAAVSVSF  174

Query  724  VIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             IG + +WR LA+ G++P  VL LGL  I
Sbjct  175  TIGNVFSWRVLAIIGLIPTAVLLLGLFFI  203



>emb|CDP03586.1| unnamed protein product [Coffea canephora]
Length=439

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MVYLSTFVAVCG+  FG CAGYSSPTQSAI +DLN SI+EYSLFGSILTFGAM GAITSG
Sbjct  1    MVYLSTFVAVCGAYEFGCCAGYSSPTQSAIREDLNLSISEYSLFGSILTFGAMIGAITSG  60

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
            PIADFVGRKGAMR++S FC+AGWLAI+F+KGA+ +DIGR+ATGYGMGVFSYVVPVFIAEI
Sbjct  61   PIADFVGRKGAMRLASGFCVAGWLAIYFSKGAVPLDIGRMATGYGMGVFSYVVPVFIAEI  120

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            APK+LRGALTT+NQ MIV GVSV+F+IGT++ WRTLAL G++PC VL LGL +I
Sbjct  121  APKDLRGALTTINQFMIVAGVSVSFIIGTLLAWRTLALVGLLPCAVLLLGLFMI  174



>ref|XP_006409064.1| hypothetical protein EUTSA_v10022677mg [Eutrema salsugineum]
 gb|ESQ50517.1| hypothetical protein EUTSA_v10022677mg [Eutrema salsugineum]
Length=468

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 165/190 (87%), Gaps = 3/190 (2%)
 Frame = +1

Query  247  PLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  420
            PL+ K+  +SK ++ WMVYLSTFVAVCGS AFGSCAGYSSP Q+AI  D++ SIAE+SLF
Sbjct  16   PLVHKDMAESKPEQPWMVYLSTFVAVCGSFAFGSCAGYSSPAQAAIRNDISLSIAEFSLF  75

Query  421  GSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGY  600
            GS+LTFGAM GAITSGPIAD +GRKGAMR+SS FC+AGWLAIFFAKG + +D+GRLATGY
Sbjct  76   GSLLTFGAMIGAITSGPIADLIGRKGAMRVSSAFCVAGWLAIFFAKGVVALDLGRLATGY  135

Query  601  GMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPC  780
            GMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F+IGT+VTWR LAL GI+PC
Sbjct  136  GMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVSVSFIIGTVVTWRVLALIGIIPC  195

Query  781  VVLGLGL-CI  807
             V  LGL CI
Sbjct  196  AVSFLGLFCI  205



>ref|XP_006479816.1| PREDICTED: sugar transporter ERD6-like 7-like isoform X6 [Citrus 
sinensis]
Length=324

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +1

Query  259  KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  438
            + ++ K +  MVY ST +AVCGS AFGSCAGYSSPTQSAI +D+  S+AEYS+FGSILTF
Sbjct  32   RTNNKKVNPCMVYFSTPIAVCGSYAFGSCAGYSSPTQSAIREDIALSLAEYSVFGSILTF  91

Query  439  GAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFS  618
            GAM GAITSGPIA++VGRKGAMR+SSVFC+AGWLAI+FA+G   +DIGRLATGYGMGVFS
Sbjct  92   GAMIGAITSGPIANYVGRKGAMRVSSVFCVAGWLAIYFAEGVWPLDIGRLATGYGMGVFS  151

Query  619  YVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLG  798
            YVVPVFIAEIAPK LRGALT  NQLMI  GVSVAF+IGT++TWR LALTGI+PC +L LG
Sbjct  152  YVVPVFIAEIAPKNLRGALTAANQLMICAGVSVAFIIGTVLTWRALALTGIIPCAILFLG  211

Query  799  LCII  810
            L  I
Sbjct  212  LFFI  215



>ref|XP_007162380.1| hypothetical protein PHAVU_001G147200g [Phaseolus vulgaris]
 gb|ESW34374.1| hypothetical protein PHAVU_001G147200g [Phaseolus vulgaris]
Length=472

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 164/210 (78%), Gaps = 9/210 (4%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDD-----SKTDRWMVYLSTFVAVCGSCAFGSCAGYSS  360
            +D+E    E    G+  PL+GK D      SK   WMVY  TFVAVCGS  FG+CAGYSS
Sbjct  4    KDVE----ESVQKGIREPLVGKPDQQLVHTSKGHPWMVYFCTFVAVCGSYEFGACAGYSS  59

Query  361  PTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWL  540
            PTQ AI +D + S+AEYSLFGSILTFGAMAGAITSGPIADF+GRKGAMR+SS FC+ GWL
Sbjct  60   PTQDAIRKDFSLSLAEYSLFGSILTFGAMAGAITSGPIADFIGRKGAMRVSSAFCVVGWL  119

Query  541  AIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  720
            AI+F++G + +DIGRLATGYGMGVFSYVVPVF+AEIAPKELRG LTTLNQ MI   VSVA
Sbjct  120  AIYFSEGPVPLDIGRLATGYGMGVFSYVVPVFVAEIAPKELRGTLTTLNQFMITAAVSVA  179

Query  721  FVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            F IG +++WR LALTG++P  VL  GL  I
Sbjct  180  FTIGNVLSWRALALTGLIPTAVLLFGLFFI  209



>ref|XP_006444173.1| hypothetical protein CICLE_v10024572mg [Citrus clementina]
 gb|ESR57413.1| hypothetical protein CICLE_v10024572mg [Citrus clementina]
Length=330

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +1

Query  259  KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  438
            + ++ K +  MVY ST +AVCGS AFGSCAGYSSPTQSAI +D+  S+AEYS+FGSILTF
Sbjct  32   RTNNKKVNPCMVYFSTPIAVCGSYAFGSCAGYSSPTQSAIREDIALSLAEYSVFGSILTF  91

Query  439  GAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFS  618
            GAM GAITSGPIA++VGRKGAMR+SSVFC+AGWLAI+FA+G   +DIGRLATGYGMGVFS
Sbjct  92   GAMIGAITSGPIANYVGRKGAMRVSSVFCVAGWLAIYFAEGVWPLDIGRLATGYGMGVFS  151

Query  619  YVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLG  798
            YVVPVFIAEIAPK LRGALT  NQLMI  GVSVAF+IGT++TWR LALTGI+PC +L LG
Sbjct  152  YVVPVFIAEIAPKNLRGALTAANQLMICAGVSVAFIIGTVLTWRALALTGIIPCAILFLG  211

Query  799  LCII  810
            L  I
Sbjct  212  LFFI  215



>emb|CDY39145.1| BnaA07g01410D [Brassica napus]
Length=463

 Score =   284 bits (727),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 164/190 (86%), Gaps = 3/190 (2%)
 Frame = +1

Query  247  PLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  420
            PL+ K   +SK ++ WMVYLSTFVAVCGS AFGSCAGYSSP Q+AI  DL+ +IAE+SLF
Sbjct  11   PLVEKHVAESKQEQPWMVYLSTFVAVCGSFAFGSCAGYSSPAQAAIRNDLSLTIAEFSLF  70

Query  421  GSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGY  600
            GS+LTFGAM GAITSGPIAD +GRKGAMR+SS FC+AGWLAIFFAKG + +D+GRLATGY
Sbjct  71   GSLLTFGAMFGAITSGPIADSIGRKGAMRVSSAFCVAGWLAIFFAKGVVALDLGRLATGY  130

Query  601  GMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPC  780
            GMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F+IGTMVTWR LAL G++PC
Sbjct  131  GMGAFSYVVPIFIAEIAPKAFRGALTTLNQILICTGVSVSFIIGTMVTWRVLALIGLIPC  190

Query  781  VVLGLGL-CI  807
             V  LGL CI
Sbjct  191  AVSFLGLFCI  200



>ref|XP_006479815.1| PREDICTED: sugar transporter ERD6-like 7-like isoform X5 [Citrus 
sinensis]
Length=341

 Score =   280 bits (717),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +1

Query  259  KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  438
            + ++ K +  MVY ST +AVCGS AFGSCAGYSSPTQSAI +D+  S+AEYS+FGSILTF
Sbjct  32   RTNNKKVNPCMVYFSTPIAVCGSYAFGSCAGYSSPTQSAIREDIALSLAEYSVFGSILTF  91

Query  439  GAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFS  618
            GAM GAITSGPIA++VGRKGAMR+SSVFC+AGWLAI+FA+G   +DIGRLATGYGMGVFS
Sbjct  92   GAMIGAITSGPIANYVGRKGAMRVSSVFCVAGWLAIYFAEGVWPLDIGRLATGYGMGVFS  151

Query  619  YVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLG  798
            YVVPVFIAEIAPK LRGALT  NQLMI  GVSVAF+IGT++TWR LALTGI+PC +L LG
Sbjct  152  YVVPVFIAEIAPKNLRGALTAANQLMICAGVSVAFIIGTVLTWRALALTGIIPCAILFLG  211

Query  799  LCII  810
            L  I
Sbjct  212  LFFI  215



>emb|CDY12861.1| BnaC07g15720D [Brassica napus]
Length=466

 Score =   284 bits (727),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 164/190 (86%), Gaps = 3/190 (2%)
 Frame = +1

Query  247  PLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  420
            PL+ K+  +SK ++ WMVYLSTFVAVCGS AFGSCAGYSSP Q+AI  DL+ +IAE+SLF
Sbjct  14   PLVDKDMAESKPEQTWMVYLSTFVAVCGSFAFGSCAGYSSPAQAAIRNDLSLTIAEFSLF  73

Query  421  GSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGY  600
            GS+LTFGAM GAITSGPIAD VGRKGAMR+SS FC+ GWLAIFFAKG + +D+GRLATGY
Sbjct  74   GSLLTFGAMIGAITSGPIADLVGRKGAMRVSSAFCVVGWLAIFFAKGVVALDLGRLATGY  133

Query  601  GMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPC  780
            GMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F++GTMVTWR LAL G++PC
Sbjct  134  GMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVSVSFIVGTMVTWRVLALIGLIPC  193

Query  781  VVLGLGL-CI  807
             V  LGL CI
Sbjct  194  AVSILGLFCI  203



>emb|CDY01404.1| BnaA07g11770D [Brassica napus]
Length=468

 Score =   284 bits (727),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 172/212 (81%), Gaps = 11/212 (5%)
 Frame = +1

Query  181  KMAAGQDIENGKNEGSTAGMAAPLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGY  354
            KM++  D   G  E     +  PL+ K+  +SK ++ WMVYLSTFVAVCGS AFGSCAGY
Sbjct  2    KMSSASD---GSRE-----VREPLVDKDMAESKPEQPWMVYLSTFVAVCGSFAFGSCAGY  53

Query  355  SSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAG  534
            SSP Q+AI  DL+ +IAE+SLFGS+LTFGAM GAITSGPIAD +GRKGAMR+SS FC+ G
Sbjct  54   SSPAQAAIRNDLSLTIAEFSLFGSLLTFGAMIGAITSGPIADLIGRKGAMRVSSAFCVVG  113

Query  535  WLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVS  714
            WLAIFFAKG + +D+GRLATGYGMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVS
Sbjct  114  WLAIFFAKGVVALDLGRLATGYGMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVS  173

Query  715  VAFVIGTMVTWRTLALTGIVPCVVLGLGL-CI  807
            V+F+IGTMVTWR LAL G++PC V  LGL CI
Sbjct  174  VSFIIGTMVTWRVLALIGLIPCAVSILGLFCI  205



>ref|XP_007222121.1| hypothetical protein PRUPE_ppa004636mg [Prunus persica]
 gb|EMJ23320.1| hypothetical protein PRUPE_ppa004636mg [Prunus persica]
Length=499

 Score =   285 bits (729),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 148/227 (65%), Positives = 175/227 (77%), Gaps = 19/227 (8%)
 Frame = +1

Query  184  MAAGQ--DIENGKNEGSTAGMAAPLIGKE------------DDSKTDR----WMVYLSTF  309
            MA GQ  D+ENG+N  +   +  PL  K+            D+  T++    WMV LST 
Sbjct  1    MAIGQFRDVENGENN-TLEDLEQPLFIKQEKIVSYEEEYGSDEKSTEKSGSIWMVLLSTC  59

Query  310  VAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVG  489
            VAVCGS  FGSC GYS+PTQSAI +DLN S+A++S+FGSILT GAM GAITSG IADF+G
Sbjct  60   VAVCGSFEFGSCVGYSAPTQSAIREDLNLSLAQFSMFGSILTIGAMLGAITSGRIADFLG  119

Query  490  RKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRG  669
            RKGAMRMS+ FC+ GWLAIFF+KGAL +DIGR  TGYG+GVFSYVVP+FIAEIAPK LRG
Sbjct  120  RKGAMRMSASFCITGWLAIFFSKGALSLDIGRFFTGYGIGVFSYVVPIFIAEIAPKNLRG  179

Query  670  ALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            ALTTLNQLMIVTG SVAFVIGT+++W TLALTGIVPC+ L +GL  +
Sbjct  180  ALTTLNQLMIVTGASVAFVIGTIISWTTLALTGIVPCIFLLVGLWFV  226



>ref|XP_009103393.1| PREDICTED: sugar transporter ERD6-like 7 [Brassica rapa]
Length=468

 Score =   284 bits (726),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 164/190 (86%), Gaps = 3/190 (2%)
 Frame = +1

Query  247  PLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  420
            PL+ K+  +SK ++ WMVYLSTFVAVCGS AFGSCAGYSSP Q+AI  DL+ +IAE+SLF
Sbjct  16   PLVDKDMAESKPEQPWMVYLSTFVAVCGSFAFGSCAGYSSPAQAAIRNDLSLTIAEFSLF  75

Query  421  GSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGY  600
            GS+LTFGAM GAITSGPIAD +GRKGAMR+SS FC+ GWLAIFFAKG + +D+GRLATGY
Sbjct  76   GSLLTFGAMIGAITSGPIADLIGRKGAMRVSSAFCVVGWLAIFFAKGVVALDLGRLATGY  135

Query  601  GMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPC  780
            GMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F+IGTMVTWR LAL G++PC
Sbjct  136  GMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVSVSFIIGTMVTWRVLALIGLIPC  195

Query  781  VVLGLGL-CI  807
             V  LGL CI
Sbjct  196  AVSILGLFCI  205



>ref|XP_011033659.1| PREDICTED: sugar transporter ERD6-like 7 [Populus euphratica]
Length=482

 Score =   284 bits (727),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 170/221 (77%), Gaps = 13/221 (6%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKED------------DSKTDRWMVYLSTFVAVCGS  327
            MA  ++IEN  N+G+      PL+ K              ++    WMVYLSTFVAV GS
Sbjct  1    MAIRENIEN-DNDGALEDAREPLMPKNSSYEEGSGSQCSSNNTGTAWMVYLSTFVAVAGS  59

Query  328  CAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMR  507
               GSC+GYSSPTQ A+ +DL+ SIAEYSLFGSILT GAM GAITSGPIAD++GRKGAMR
Sbjct  60   FEVGSCSGYSSPTQKAMREDLSLSIAEYSLFGSILTVGAMIGAITSGPIADYIGRKGAMR  119

Query  508  MSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLN  687
             SS FC+AGWLAI+FAKGAL +DIGRLATGYGMG  S+VVPVFIAEIAPK LRG LTT+ 
Sbjct  120  FSSTFCVAGWLAIYFAKGALALDIGRLATGYGMGALSFVVPVFIAEIAPKNLRGTLTTVT  179

Query  688  QLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            QLM+ TGVSVAF+IGT++ WR LALTG++PCV+L +GL +I
Sbjct  180  QLMVATGVSVAFIIGTVLRWRVLALTGVIPCVILHVGLFLI  220



>gb|KFK37554.1| hypothetical protein AALP_AA4G271800 [Arabis alpina]
Length=468

 Score =   283 bits (725),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 163/190 (86%), Gaps = 3/190 (2%)
 Frame = +1

Query  247  PLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  420
            PL+ KE   SK ++ WMVYLSTFVAVCGS AFGSCAGYSSP QSAI  DL+ +IAE+SLF
Sbjct  16   PLVHKEMAGSKPEQPWMVYLSTFVAVCGSFAFGSCAGYSSPAQSAIRNDLSLTIAEFSLF  75

Query  421  GSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGY  600
            GS+LTFGAM GAITSGPIAD +GRKGAMR+SS FC+ GWLAIFFAKG + +D+GRLATGY
Sbjct  76   GSLLTFGAMIGAITSGPIADLLGRKGAMRVSSAFCVVGWLAIFFAKGVVALDLGRLATGY  135

Query  601  GMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPC  780
            GMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F+IGT+VTWR LAL GI+PC
Sbjct  136  GMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVSVSFIIGTVVTWRVLALIGIIPC  195

Query  781  VVLGLGL-CI  807
             V  LGL CI
Sbjct  196  AVSFLGLFCI  205



>ref|XP_006479811.1| PREDICTED: sugar transporter ERD6-like 7-like isoform X1 [Citrus 
sinensis]
 ref|XP_006479812.1| PREDICTED: sugar transporter ERD6-like 7-like isoform X2 [Citrus 
sinensis]
 ref|XP_006479813.1| PREDICTED: sugar transporter ERD6-like 7-like isoform X3 [Citrus 
sinensis]
 ref|XP_006479814.1| PREDICTED: sugar transporter ERD6-like 7-like isoform X4 [Citrus 
sinensis]
Length=407

 Score =   281 bits (720),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +1

Query  259  KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  438
            + ++ K +  MVY ST +AVCGS AFGSCAGYSSPTQSAI +D+  S+AEYS+FGSILTF
Sbjct  32   RTNNKKVNPCMVYFSTPIAVCGSYAFGSCAGYSSPTQSAIREDIALSLAEYSVFGSILTF  91

Query  439  GAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFS  618
            GAM GAITSGPIA++VGRKGAMR+SSVFC+AGWLAI+FA+G   +DIGRLATGYGMGVFS
Sbjct  92   GAMIGAITSGPIANYVGRKGAMRVSSVFCVAGWLAIYFAEGVWPLDIGRLATGYGMGVFS  151

Query  619  YVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLG  798
            YVVPVFIAEIAPK LRGALT  NQLMI  GVSVAF+IGT++TWR LALTGI+PC +L LG
Sbjct  152  YVVPVFIAEIAPKNLRGALTAANQLMICAGVSVAFIIGTVLTWRALALTGIIPCAILFLG  211

Query  799  LCII  810
            L  I
Sbjct  212  LFFI  215



>gb|KJB28576.1| hypothetical protein B456_005G056400 [Gossypium raimondii]
Length=373

 Score =   280 bits (717),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 169/211 (80%), Gaps = 7/211 (3%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDSKTDR------WMVYLSTFVAVCGSCAFGSCAGYS  357
            +D+E+G+  G    +  PLIG +D+           WMV L TFVAVCGS  FGSC GYS
Sbjct  7    KDVESGEING-LEDLEKPLIGADDEKIVVHHENGSIWMVLLCTFVAVCGSFEFGSCVGYS  65

Query  358  SPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGW  537
            +PTQSAIS+DLN S++E+S+FGSILT GAM GA+TSG IAD +GRKGAMR+S+ FC+ GW
Sbjct  66   APTQSAISEDLNLSLSEFSMFGSILTIGAMLGAVTSGRIADMIGRKGAMRLSAGFCITGW  125

Query  538  LAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSV  717
            LA++F+KGA+ +DIGR +TGYG+GVFSYVVP+FIAEIAPK LRG LTTLNQLMIVTG SV
Sbjct  126  LAVYFSKGAVSLDIGRFSTGYGIGVFSYVVPIFIAEIAPKNLRGGLTTLNQLMIVTGSSV  185

Query  718  AFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            AF+IGT++ WR LALTG+VPC+ L +GLC I
Sbjct  186  AFLIGTIIPWRELALTGLVPCIFLFVGLCFI  216



>ref|XP_008223080.1| PREDICTED: sugar transporter ERD6-like 16 [Prunus mume]
Length=499

 Score =   284 bits (727),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 147/227 (65%), Positives = 176/227 (78%), Gaps = 19/227 (8%)
 Frame = +1

Query  184  MAAGQ--DIENGKNEGSTAGMAAPLIGKE------------DDSKTDR----WMVYLSTF  309
            MA GQ  D+ENG+N  +   +  PL+ K+            D+  T++    WMV LST 
Sbjct  1    MAIGQFRDVENGENN-TLEDLEQPLVIKQEKIVSYEDEYGSDEKSTEKSGSIWMVLLSTC  59

Query  310  VAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVG  489
            VAVCGS  FGSC GYS+PTQSAI +DLN S+A++S+FGSILT GAM GAITSG IADF+G
Sbjct  60   VAVCGSFEFGSCVGYSAPTQSAIREDLNLSLAQFSMFGSILTIGAMLGAITSGRIADFLG  119

Query  490  RKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRG  669
            RKGAMRMS+ FC+ GWLAIFF+KGAL ++IGR  TGYG+GVFSYVVP+FIAEIAPK LRG
Sbjct  120  RKGAMRMSASFCITGWLAIFFSKGALSLEIGRFFTGYGIGVFSYVVPIFIAEIAPKNLRG  179

Query  670  ALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            ALTTLNQLMIVTG SVAFVIGT+++W TLALTGIVPC+ L +GL  +
Sbjct  180  ALTTLNQLMIVTGASVAFVIGTIISWTTLALTGIVPCIFLLVGLWFV  226



>emb|CDX82668.1| BnaC07g01980D [Brassica napus]
Length=463

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 160/190 (84%), Gaps = 3/190 (2%)
 Frame = +1

Query  247  PLIGKE--DDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  420
            PL+ K   +  +   WMVYLSTFVAVCGS AFGSCAGYSSP Q+AI  DL+ +IAE+SLF
Sbjct  11   PLVEKHLAESKQEQPWMVYLSTFVAVCGSFAFGSCAGYSSPAQAAIRNDLSLTIAEFSLF  70

Query  421  GSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGY  600
            GS+LTFGAM GAITSGPIAD +GRKGAMR+SS FC+AGWLAIFFA G + +D+GRLATGY
Sbjct  71   GSLLTFGAMFGAITSGPIADSIGRKGAMRVSSAFCVAGWLAIFFANGVVALDLGRLATGY  130

Query  601  GMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPC  780
            GMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F+IGTMVTWR LAL G+VPC
Sbjct  131  GMGAFSYVVPIFIAEIAPKAFRGALTTLNQILICTGVSVSFIIGTMVTWRVLALIGLVPC  190

Query  781  VVLGLGL-CI  807
             V  LGL CI
Sbjct  191  AVSFLGLFCI  200



>ref|XP_006444171.1| hypothetical protein CICLE_v10019923mg [Citrus clementina]
 ref|XP_006479808.1| PREDICTED: sugar transporter ERD6-like 7-like [Citrus sinensis]
 gb|ESR57411.1| hypothetical protein CICLE_v10019923mg [Citrus clementina]
Length=478

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +1

Query  259  KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  438
            + ++ K +  MVY ST +AVCGS AFGSCAGYSSPTQSAI +D+  S+AEYS+FGSILTF
Sbjct  32   QANNKKVNPCMVYFSTLIAVCGSYAFGSCAGYSSPTQSAIREDIALSLAEYSVFGSILTF  91

Query  439  GAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFS  618
            GAM GAITSGPIAD++GRKGAMR+SSVFC+AGWLAI+FA+G   +DIGRLATGYGMGVFS
Sbjct  92   GAMIGAITSGPIADYIGRKGAMRVSSVFCVAGWLAIYFAEGVWPLDIGRLATGYGMGVFS  151

Query  619  YVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLG  798
            YVVPVFIAEIAPK LRGALT  NQLMI  GVSVAF+IGT++TWR LALTGI+PC +L LG
Sbjct  152  YVVPVFIAEIAPKNLRGALTAANQLMICAGVSVAFIIGTVLTWRALALTGIIPCAILFLG  211

Query  799  LCII  810
            L  I
Sbjct  212  LFFI  215



>ref|XP_006444169.1| hypothetical protein CICLE_v10019923mg [Citrus clementina]
 gb|ESR57409.1| hypothetical protein CICLE_v10019923mg [Citrus clementina]
Length=483

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 169/217 (78%), Gaps = 10/217 (5%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKED--------DSKTDRWMVYLSTFVAVCGSCAFG  339
            MA  +D++    E         ++ +ED        + K +  MVY ST +AVCGS AFG
Sbjct  6    MAVKEDVQENIREPLMP--IENILDREDGGAGDQANNKKVNPCMVYFSTLIAVCGSYAFG  63

Query  340  SCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSV  519
            SCAGYSSPTQSAI +D+  S+AEYS+FGSILTFGAM GAITSGPIAD++GRKGAMR+SSV
Sbjct  64   SCAGYSSPTQSAIREDIALSLAEYSVFGSILTFGAMIGAITSGPIADYIGRKGAMRVSSV  123

Query  520  FCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMI  699
            FC+AGWLAI+FA+G   +DIGRLATGYGMGVFSYVVPVFIAEIAPK LRGALT  NQLMI
Sbjct  124  FCVAGWLAIYFAEGVWPLDIGRLATGYGMGVFSYVVPVFIAEIAPKNLRGALTAANQLMI  183

Query  700  VTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
              GVSVAF+IGT++TWR LALTGI+PC +L LGL  I
Sbjct  184  CAGVSVAFIIGTVLTWRALALTGIIPCAILFLGLFFI  220



>gb|KJB28574.1| hypothetical protein B456_005G056400 [Gossypium raimondii]
Length=413

 Score =   280 bits (716),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 169/211 (80%), Gaps = 7/211 (3%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDSKTDR------WMVYLSTFVAVCGSCAFGSCAGYS  357
            +D+E+G+  G    +  PLIG +D+           WMV L TFVAVCGS  FGSC GYS
Sbjct  7    KDVESGEING-LEDLEKPLIGADDEKIVVHHENGSIWMVLLCTFVAVCGSFEFGSCVGYS  65

Query  358  SPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGW  537
            +PTQSAIS+DLN S++E+S+FGSILT GAM GA+TSG IAD +GRKGAMR+S+ FC+ GW
Sbjct  66   APTQSAISEDLNLSLSEFSMFGSILTIGAMLGAVTSGRIADMIGRKGAMRLSAGFCITGW  125

Query  538  LAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSV  717
            LA++F+KGA+ +DIGR +TGYG+GVFSYVVP+FIAEIAPK LRG LTTLNQLMIVTG SV
Sbjct  126  LAVYFSKGAVSLDIGRFSTGYGIGVFSYVVPIFIAEIAPKNLRGGLTTLNQLMIVTGSSV  185

Query  718  AFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            AF+IGT++ WR LALTG+VPC+ L +GLC I
Sbjct  186  AFLIGTIIPWRELALTGLVPCIFLFVGLCFI  216



>ref|XP_002880340.1| hypothetical protein ARALYDRAFT_483991 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56599.1| hypothetical protein ARALYDRAFT_483991 [Arabidopsis lyrata subsp. 
lyrata]
Length=464

 Score =   281 bits (720),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 164/200 (82%), Gaps = 2/200 (1%)
 Frame = +1

Query  217  NEGSTAGMAAPLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDL  390
            ++  +  +  PL+ K    SK D+ WMVYLSTFVAVCGS AFGSCAGYSSP Q+AI  DL
Sbjct  2    SKAKSDAVREPLVDKNMAGSKPDQPWMVYLSTFVAVCGSFAFGSCAGYSSPAQAAIRNDL  61

Query  391  NFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALV  570
            + +IAE+SLFGS+LTFGAM GAITSGPIAD VGRKGAMR+SS FC+ GWLAIFFAKG + 
Sbjct  62   SLTIAEFSLFGSLLTFGAMIGAITSGPIADLVGRKGAMRVSSAFCVVGWLAIFFAKGVVP  121

Query  571  MDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWR  750
            +D+GRLATGYGMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F+IGT+VTWR
Sbjct  122  LDLGRLATGYGMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVSVSFIIGTLVTWR  181

Query  751  TLALTGIVPCVVLGLGLCII  810
             LAL GI+PC    LGL  I
Sbjct  182  VLALIGIIPCAASFLGLFFI  201



>ref|XP_003554233.1| PREDICTED: sugar transporter ERD6-like 7-like isoform 1 [Glycine 
max]
Length=466

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 164/209 (78%), Gaps = 6/209 (3%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSP  363
            MA  +D+E    EG   G+  PL+ +   SK   WMVY +TFVAVCGS  FG+CAGYSSP
Sbjct  1    MAIKEDVE----EGMQKGVREPLVVRA--SKGHPWMVYFTTFVAVCGSYEFGACAGYSSP  54

Query  364  TQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLA  543
            TQ AI +D + S+AEYSLFGSILTFGAM GAITSGPIADF+GRKGAMR+SS FC+AGWL 
Sbjct  55   TQDAIRKDFSLSLAEYSLFGSILTFGAMVGAITSGPIADFIGRKGAMRVSSAFCVAGWLV  114

Query  544  IFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAF  723
            I+FA+G + +DIGRL+TGYGMGVFSYVVPVF+AEIAPKELRG LTTLNQ MI   VSV+F
Sbjct  115  IYFAEGPVYLDIGRLSTGYGMGVFSYVVPVFVAEIAPKELRGTLTTLNQFMITAAVSVSF  174

Query  724  VIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             IG + +WR LA+ G++P  VL LGL  I
Sbjct  175  TIGNVFSWRVLAIIGLIPTAVLLLGLFFI  203



>gb|KJB28575.1| hypothetical protein B456_005G056400 [Gossypium raimondii]
Length=444

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 169/211 (80%), Gaps = 7/211 (3%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDSKTDR------WMVYLSTFVAVCGSCAFGSCAGYS  357
            +D+E+G+  G    +  PLIG +D+           WMV L TFVAVCGS  FGSC GYS
Sbjct  7    KDVESGEING-LEDLEKPLIGADDEKIVVHHENGSIWMVLLCTFVAVCGSFEFGSCVGYS  65

Query  358  SPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGW  537
            +PTQSAIS+DLN S++E+S+FGSILT GAM GA+TSG IAD +GRKGAMR+S+ FC+ GW
Sbjct  66   APTQSAISEDLNLSLSEFSMFGSILTIGAMLGAVTSGRIADMIGRKGAMRLSAGFCITGW  125

Query  538  LAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSV  717
            LA++F+KGA+ +DIGR +TGYG+GVFSYVVP+FIAEIAPK LRG LTTLNQLMIVTG SV
Sbjct  126  LAVYFSKGAVSLDIGRFSTGYGIGVFSYVVPIFIAEIAPKNLRGGLTTLNQLMIVTGSSV  185

Query  718  AFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            AF+IGT++ WR LALTG+VPC+ L +GLC I
Sbjct  186  AFLIGTIIPWRELALTGLVPCIFLFVGLCFI  216



>ref|NP_566120.1| sugar transporter ERD6-like 7 [Arabidopsis thaliana]
 ref|NP_850483.1| sugar transporter ERD6-like 7 [Arabidopsis thaliana]
 sp|P93051.2|ERDL7_ARATH RecName: Full=Sugar transporter ERD6-like 7 [Arabidopsis thaliana]
 gb|AAD13706.2| putative sugar transporter [Arabidopsis thaliana]
 gb|AAM53273.1| putative putative sister-chromatide cohesion protein [Arabidopsis 
thaliana]
 gb|AAN15372.1| putative putative sister-chromatide cohesion protein [Arabidopsis 
thaliana]
 gb|AEC10924.1| sugar transporter ERD6-like 7 [Arabidopsis thaliana]
 gb|AEC10925.1| sugar transporter ERD6-like 7 [Arabidopsis thaliana]
Length=463

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 159/190 (84%), Gaps = 2/190 (1%)
 Frame = +1

Query  247  PLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  420
            PL+ K    SK D+ WMVYLSTFVAVCGS AFGSCAGYSSP Q+AI  DL+ +IAE+SLF
Sbjct  11   PLVDKNMAGSKPDQPWMVYLSTFVAVCGSFAFGSCAGYSSPAQAAIRNDLSLTIAEFSLF  70

Query  421  GSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGY  600
            GS+LTFGAM GAITSGPIAD VGRKGAMR+SS FC+ GWLAI FAKG + +D+GRLATGY
Sbjct  71   GSLLTFGAMIGAITSGPIADLVGRKGAMRVSSAFCVVGWLAIIFAKGVVALDLGRLATGY  130

Query  601  GMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPC  780
            GMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F+IGT+VTWR LAL GI+PC
Sbjct  131  GMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVSVSFIIGTLVTWRVLALIGIIPC  190

Query  781  VVLGLGLCII  810
                LGL  I
Sbjct  191  AASFLGLFFI  200



>ref|XP_010070313.1| PREDICTED: sugar transporter ERD6-like 7 [Eucalyptus grandis]
 gb|KCW58972.1| hypothetical protein EUGRSUZ_H01602 [Eucalyptus grandis]
Length=479

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 167/218 (77%), Gaps = 11/218 (5%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKED------DSKTDR---WMVYLSTFVAVCGSCAF  336
            MA  +DIEN   E    G+   L+  ++      D  TD+   WMVY STFVAVCGS  F
Sbjct  1    MAINEDIEN--RETRERGVREQLLVPQEKDQAGQDEGTDKGHPWMVYFSTFVAVCGSYEF  58

Query  337  GSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSS  516
            G+CAGYSSPTQ AI ++L+ S AEYS+FGSILTFGAM GAIT GPIADFVGRK  MRM+S
Sbjct  59   GTCAGYSSPTQDAIVEELSLSTAEYSVFGSILTFGAMIGAITGGPIADFVGRKWTMRMAS  118

Query  517  VFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLM  696
             FC+AGWLAI+FA+GAL +DIGRLATGYGMGVFSYVVP+FIAEI PK LRGALT +NQLM
Sbjct  119  AFCVAGWLAIYFAEGALALDIGRLATGYGMGVFSYVVPIFIAEITPKNLRGALTAVNQLM  178

Query  697  IVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            I  GVS++F+IG +++WR LAL G++PC VL  GL  I
Sbjct  179  ICAGVSISFIIGIILSWRVLALIGLIPCAVLLFGLLFI  216



>gb|KJB28573.1| hypothetical protein B456_005G056400 [Gossypium raimondii]
Length=480

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 169/211 (80%), Gaps = 7/211 (3%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDSKTDR------WMVYLSTFVAVCGSCAFGSCAGYS  357
            +D+E+G+  G    +  PLIG +D+           WMV L TFVAVCGS  FGSC GYS
Sbjct  7    KDVESGEING-LEDLEKPLIGADDEKIVVHHENGSIWMVLLCTFVAVCGSFEFGSCVGYS  65

Query  358  SPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGW  537
            +PTQSAIS+DLN S++E+S+FGSILT GAM GA+TSG IAD +GRKGAMR+S+ FC+ GW
Sbjct  66   APTQSAISEDLNLSLSEFSMFGSILTIGAMLGAVTSGRIADMIGRKGAMRLSAGFCITGW  125

Query  538  LAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSV  717
            LA++F+KGA+ +DIGR +TGYG+GVFSYVVP+FIAEIAPK LRG LTTLNQLMIVTG SV
Sbjct  126  LAVYFSKGAVSLDIGRFSTGYGIGVFSYVVPIFIAEIAPKNLRGGLTTLNQLMIVTGSSV  185

Query  718  AFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            AF+IGT++ WR LALTG+VPC+ L +GLC I
Sbjct  186  AFLIGTIIPWRELALTGLVPCIFLFVGLCFI  216



>ref|XP_010545070.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010545071.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010545072.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010545074.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Tarenaya 
hassleriana]
Length=464

 Score =   279 bits (714),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 163/199 (82%), Gaps = 2/199 (1%)
 Frame = +1

Query  217  NEGSTAGMAAPLIGKEDDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLN  393
            N G       PL+ K+   K ++ WM YLSTFVAVCGS AFGSCAGYSSP Q+AI +DL+
Sbjct  3    NGGGDGEAREPLVQKKLAEKEEQLWMGYLSTFVAVCGSFAFGSCAGYSSPAQAAIREDLS  62

Query  394  FSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVM  573
             S+AE+SLFGS+LTFGAM GAI  GPIAD VGRKGAMR+SS FC+ GWLAIFFAKG + +
Sbjct  63   LSLAEFSLFGSLLTFGAMIGAIMCGPIADLVGRKGAMRVSSAFCVVGWLAIFFAKGPVAL  122

Query  574  DIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRT  753
            DIGRLATGYGMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSVAF+IGT++TWR 
Sbjct  123  DIGRLATGYGMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVSVAFIIGTVLTWRV  182

Query  754  LALTGIVPCVVLGLGL-CI  807
            LALTGI+PC +  +GL CI
Sbjct  183  LALTGIIPCAISFIGLFCI  201



>ref|XP_004292608.2| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
Length=476

 Score =   279 bits (713),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 165/206 (80%), Gaps = 2/206 (1%)
 Frame = +1

Query  199  DIENGKNEGSTAGMAAPLI--GKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQS  372
            ++ + +   +   +  PL+  G +  SK D+WMVYLSTFVAVCGS  FG C GYSSPTQS
Sbjct  8    NMASREENSAHHEVKRPLVDGGLDHGSKGDQWMVYLSTFVAVCGSYEFGCCVGYSSPTQS  67

Query  373  AISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFF  552
            AI +DLN ++A++++FGSILTFGAM GAIT GPI DF+GRKGA+R SS+ CLAGWLAI+F
Sbjct  68   AIREDLNLTLAQFAMFGSILTFGAMIGAITIGPITDFIGRKGALRFSSIVCLAGWLAIYF  127

Query  553  AKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIG  732
            ++GA+V+DIGR+A GYGMG FSYVVPVF+AEIAPK LRG LT LNQLMIV GVSV+F+IG
Sbjct  128  SEGAVVLDIGRMAKGYGMGAFSYVVPVFVAEIAPKHLRGTLTALNQLMIVAGVSVSFIIG  187

Query  733  TMVTWRTLALTGIVPCVVLGLGLCII  810
             +V+WRTLAL G+VPC V   GL  I
Sbjct  188  VVVSWRTLALIGLVPCAVTIFGLFFI  213



>ref|XP_010424172.1| PREDICTED: sugar transporter ERD6-like 16, partial [Camelina 
sativa]
Length=284

 Score =   273 bits (697),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 161/210 (77%), Gaps = 5/210 (2%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSS  360
            +D+E G        +  P +  +DD K         MV  STFVAVCGS  FGSC GYS+
Sbjct  7    KDVERGDIANKVEDLGKPFLTDQDDEKESEVNESYLMVIFSTFVAVCGSFEFGSCVGYSA  66

Query  361  PTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWL  540
            PTQS+I QDLN S+AE+S+FGSILT GAM GA+ SG ++DF GRKGAMR S+ FC+ GW+
Sbjct  67   PTQSSIRQDLNLSLAEFSMFGSILTIGAMIGAVMSGKVSDFSGRKGAMRTSACFCITGWV  126

Query  541  AIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  720
            A+FF+KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G SV+
Sbjct  127  AVFFSKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKHLRGGLTTLNQLMIVIGSSVS  186

Query  721  FVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            F+IG++++W+TLALTG+ PC+VL  GLC I
Sbjct  187  FLIGSLISWKTLALTGLAPCIVLLFGLCFI  216



>ref|XP_010070278.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Eucalyptus 
grandis]
Length=463

 Score =   278 bits (712),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 166/217 (76%), Gaps = 8/217 (4%)
 Frame = +1

Query  184  MAAGQDIEN---GKNEGSTAGMAAP----LIGKEDDSKTDR-WMVYLSTFVAVCGSCAFG  339
            MA  +DIEN   G  EG    +  P      GK++     R WMVY +TFVAVCGS  FG
Sbjct  1    MAINEDIENQETGDREGIRERLLVPQEKDRAGKDEGIDKGRPWMVYFTTFVAVCGSYEFG  60

Query  340  SCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSV  519
            +CAGYSSPTQ AI ++L+ S AEYS+FGSILTFGAM GAIT GPIADFVGRK  MR++S 
Sbjct  61   TCAGYSSPTQDAIVEELSLSTAEYSVFGSILTFGAMIGAITGGPIADFVGRKWTMRIASA  120

Query  520  FCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMI  699
             C+AGWLAI+FA+GAL +DIGRLATGYGMGVFSYVVP+FIAEI PK LRGALT +NQLMI
Sbjct  121  LCVAGWLAIYFAEGALALDIGRLATGYGMGVFSYVVPIFIAEITPKNLRGALTAVNQLMI  180

Query  700  VTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            V GVSV+F+IGT++ WR LAL G++PC VL  GL  I
Sbjct  181  VAGVSVSFIIGTVLAWRVLALIGLIPCAVLLFGLFFI  217



>ref|XP_010070277.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Eucalyptus 
grandis]
 gb|KCW58937.1| hypothetical protein EUGRSUZ_H01560 [Eucalyptus grandis]
Length=481

 Score =   279 bits (713),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 166/217 (76%), Gaps = 8/217 (4%)
 Frame = +1

Query  184  MAAGQDIEN---GKNEGSTAGMAAP----LIGKEDDSKTDR-WMVYLSTFVAVCGSCAFG  339
            MA  +DIEN   G  EG    +  P      GK++     R WMVY +TFVAVCGS  FG
Sbjct  1    MAINEDIENQETGDREGIRERLLVPQEKDRAGKDEGIDKGRPWMVYFTTFVAVCGSYEFG  60

Query  340  SCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSV  519
            +CAGYSSPTQ AI ++L+ S AEYS+FGSILTFGAM GAIT GPIADFVGRK  MR++S 
Sbjct  61   TCAGYSSPTQDAIVEELSLSTAEYSVFGSILTFGAMIGAITGGPIADFVGRKWTMRIASA  120

Query  520  FCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMI  699
             C+AGWLAI+FA+GAL +DIGRLATGYGMGVFSYVVP+FIAEI PK LRGALT +NQLMI
Sbjct  121  LCVAGWLAIYFAEGALALDIGRLATGYGMGVFSYVVPIFIAEITPKNLRGALTAVNQLMI  180

Query  700  VTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            V GVSV+F+IGT++ WR LAL G++PC VL  GL  I
Sbjct  181  VAGVSVSFIIGTVLAWRVLALIGLIPCAVLLFGLFFI  217



>ref|XP_011009474.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Populus 
euphratica]
Length=437

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MVYLSTFVAVCGS AFGSCAGYSSPT++A+ +DL+ S+AEYS+FGSILTFGAM GAITSG
Sbjct  1    MVYLSTFVAVCGSFAFGSCAGYSSPTENAVREDLSLSLAEYSVFGSILTFGAMIGAITSG  60

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
            PIAD +GRKGA+R+++ FC+AGWLAI+FA+G L +D+GRLATGYGMGVFSYVVPVFIAEI
Sbjct  61   PIADLIGRKGALRVATSFCVAGWLAIYFAQGVLALDLGRLATGYGMGVFSYVVPVFIAEI  120

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            APK LRGALTT NQLMI  GVSVAF+IGT++TWR LALTG+VPC +L  GL +I
Sbjct  121  APKSLRGALTTTNQLMICGGVSVAFIIGTVLTWRALALTGLVPCAILVFGLFLI  174



>gb|AAM61246.1| putative sugar transporter [Arabidopsis thaliana]
Length=463

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 158/190 (83%), Gaps = 2/190 (1%)
 Frame = +1

Query  247  PLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  420
            PL+ K    SK D+ WMVYLSTFVAVCG  AFGSCAGYSSP Q+AI  DL+ +IAE+SLF
Sbjct  11   PLVDKNMAGSKPDQPWMVYLSTFVAVCGPFAFGSCAGYSSPAQAAIRNDLSLTIAEFSLF  70

Query  421  GSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGY  600
            GS+LTFGAM GAITSGPIAD VGRKGAMR+SS FC+ GWLAI FAKG + +D+GRLATGY
Sbjct  71   GSLLTFGAMIGAITSGPIADLVGRKGAMRVSSAFCVVGWLAIIFAKGVVALDLGRLATGY  130

Query  601  GMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPC  780
            GMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F+IGT+VTWR LAL GI+PC
Sbjct  131  GMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVSVSFIIGTLVTWRVLALIGIIPC  190

Query  781  VVLGLGLCII  810
                LGL  I
Sbjct  191  AASFLGLFFI  200



>gb|EPS59997.1| hypothetical protein M569_14807, partial [Genlisea aurea]
Length=454

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 160/191 (84%), Gaps = 3/191 (2%)
 Frame = +1

Query  247  PLIGKED---DSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSL  417
            PLI  E+   + K  RWMVY ST +A+CGS +FGSCAGYSSPTQ+AI +D+N S+ EYSL
Sbjct  5    PLIPPEESPENGKEQRWMVYFSTLIAICGSYSFGSCAGYSSPTQAAIREDVNLSLPEYSL  64

Query  418  FGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATG  597
            FGSILTFGAM GAITSG IAD  GR+GAM +SS FC AGWL I+FA+G +++D+GRLATG
Sbjct  65   FGSILTFGAMIGAITSGKIADSSGRRGAMLVSSGFCTAGWLFIYFAQGTVLLDVGRLATG  124

Query  598  YGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVP  777
            YGMGVFSYVVPVFIAEI+PK+LRGALTTLNQLMI TGVSV+F+IGT++ WR LAL GIVP
Sbjct  125  YGMGVFSYVVPVFIAEISPKDLRGALTTLNQLMICTGVSVSFIIGTLLPWRVLALVGIVP  184

Query  778  CVVLGLGLCII  810
            C VL +GL  I
Sbjct  185  CAVLVVGLLFI  195



>ref|XP_007035424.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY06350.1| Major facilitator superfamily protein [Theobroma cacao]
Length=479

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 167/216 (77%), Gaps = 8/216 (4%)
 Frame = +1

Query  184  MAAGQ--DIENGKNEGSTAGMAAPLIGKED-----DSKTDRWMVYLSTFVAVCGSCAFGS  342
            MA GQ  D+E G+  G    +  PLI +E      D     WMV + TFVAVCGS  FGS
Sbjct  1    MAIGQLKDVETGEING-LEDLEKPLIVEEQTVVGSDESGSIWMVLICTFVAVCGSFEFGS  59

Query  343  CAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVF  522
            C GYS+PTQSAI +DLN S+AE+S+FGSILT GAM GA+TSG IAD +GRKGAMR+S+ F
Sbjct  60   CVGYSAPTQSAIREDLNLSLAEFSMFGSILTIGAMLGAVTSGRIADLIGRKGAMRLSAAF  119

Query  523  CLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  702
            C  GWLA++F+KGAL +DIGR +TGYG+GVFSYVVP+FIAEIAPK LRG L TLNQLMIV
Sbjct  120  CSTGWLAVYFSKGALSLDIGRFSTGYGIGVFSYVVPIFIAEIAPKNLRGGLATLNQLMIV  179

Query  703  TGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            TG SVAF+IGT++ WR LALTG+VPC+ L +GLC I
Sbjct  180  TGSSVAFLIGTIIPWRALALTGLVPCIFLLVGLCFI  215



>ref|XP_010070290.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Eucalyptus 
grandis]
Length=481

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 163/217 (75%), Gaps = 8/217 (4%)
 Frame = +1

Query  184  MAAGQDIEN---GKNEGSTAGMAAPLIGKE--DDSKTDR---WMVYLSTFVAVCGSCAFG  339
            MA  +DIEN   G  EG    +  P        D  TD+   WMVY +TF+AVCGS  FG
Sbjct  1    MAINEDIENQETGDREGVRERLLVPQEKDRAGKDEGTDKVRPWMVYFTTFIAVCGSYEFG  60

Query  340  SCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSV  519
            +CAGYSSPTQ AI ++L  S AEYS+FGSILTFGAM GAIT GPIADFVGRK  MR++S 
Sbjct  61   TCAGYSSPTQDAIVEELGLSTAEYSVFGSILTFGAMIGAITGGPIADFVGRKWTMRIASA  120

Query  520  FCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMI  699
             C+AGWLAI+FA+G L +DIGRLATGYGMGVFSYVVP+FIAEI PK LRGALT +NQLMI
Sbjct  121  LCVAGWLAIYFAEGELALDIGRLATGYGMGVFSYVVPIFIAEITPKNLRGALTAVNQLMI  180

Query  700  VTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            V GVSV+F+IGT++ WR LAL G++PC VL  GL  I
Sbjct  181  VAGVSVSFIIGTVLAWRVLALIGLIPCAVLLFGLFFI  217



>ref|XP_008235073.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
Length=480

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 161/204 (79%), Gaps = 10/204 (5%)
 Frame = +1

Query  199  DIENGKNEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAI  378
            D   G  +GS+ G           +K D+WMVYLSTFVAVCGS  FG   GYSSPTQSAI
Sbjct  24   DSNLGAGDGSSHG----------STKGDQWMVYLSTFVAVCGSYEFGCGVGYSSPTQSAI  73

Query  379  SQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAK  558
             +DLN S+AEYS+FGSILTFGAM GAIT GPI DF+GRKGA+RMS VFC+AGWLAI+F+K
Sbjct  74   RKDLNLSLAEYSMFGSILTFGAMIGAITIGPITDFLGRKGALRMSCVFCVAGWLAIYFSK  133

Query  559  GALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTM  738
            GAL +DIGRLATGYG G FSY+VPVFIAEIAPK LRG LT +NQLMIVTGVSV+F+IG +
Sbjct  134  GALSLDIGRLATGYGSGAFSYIVPVFIAEIAPKNLRGRLTAINQLMIVTGVSVSFIIGVV  193

Query  739  VTWRTLALTGIVPCVVLGLGLCII  810
            V+WR LA+ GIVPC V+  GL  I
Sbjct  194  VSWRALAIIGIVPCAVIIFGLFFI  217



>ref|XP_004140089.1| PREDICTED: sugar transporter ERD6-like 7 [Cucumis sativus]
 gb|KGN47881.1| hypothetical protein Csa_6G409380 [Cucumis sativus]
Length=473

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 166/214 (78%), Gaps = 9/214 (4%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKE----DDSKTDR-WMVYLSTFVAVCGSCAFGSCA  348
            MA  QD+E    E +      P +  E     +S+  R WMVYLST VAVCGS  FG+CA
Sbjct  1    MAISQDVEESGQEAA----GQPFLQDESKWTHNSEERRPWMVYLSTLVAVCGSYEFGTCA  56

Query  349  GYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCL  528
            GYSSPTQSAI  DL+ S+AE+SLFGSILTFGAM GAITSGPI D +GRKGAMR+++  C+
Sbjct  57   GYSSPTQSAIINDLHLSLAEFSLFGSILTFGAMIGAITSGPIGDLLGRKGAMRVATGACV  116

Query  529  AGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTG  708
            AGWLAI+FA+G + +DIGR ATGYGMGVFSYVVP+FIAEIAPK LRGALTTLNQ MI T 
Sbjct  117  AGWLAIYFAQGVVALDIGRFATGYGMGVFSYVVPIFIAEIAPKNLRGALTTLNQFMICTA  176

Query  709  VSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            VS++F+IG +++WRTLAL G+VPCV+L  GL  I
Sbjct  177  VSISFIIGNVLSWRTLALIGLVPCVILTFGLFFI  210



>ref|XP_007200994.1| hypothetical protein PRUPE_ppa005144mg [Prunus persica]
 gb|EMJ02193.1| hypothetical protein PRUPE_ppa005144mg [Prunus persica]
Length=475

 Score =   277 bits (708),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 168/216 (78%), Gaps = 11/216 (5%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKT-------DRWMVYLSTFVAVCGSCAFGS  342
            MA  +D+E+   EG T     PL+  E +          ++WMVYLSTFVAVCGS  FG 
Sbjct  1    MAIKEDVESDLQEGITD----PLMRVEKNLADGGSSRGGNQWMVYLSTFVAVCGSYEFGC  56

Query  343  CAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVF  522
            C GYSSPTQSAI +DL+ ++AEYS+FGSI+TFGAM GAIT GPI+DF+GRKGA+R+S  F
Sbjct  57   CIGYSSPTQSAIREDLSLTLAEYSVFGSIVTFGAMIGAITIGPISDFLGRKGALRVSCAF  116

Query  523  CLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  702
            C+AGWLAI+F+KGAL +DIGRLATGYGMG FSYVVPVFIAEIAPK LRG LT +NQLMI+
Sbjct  117  CVAGWLAIYFSKGALSLDIGRLATGYGMGAFSYVVPVFIAEIAPKNLRGRLTAINQLMII  176

Query  703  TGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            +GVS++F+IG +V+WR LAL G+VPC V   GL  I
Sbjct  177  SGVSISFIIGVLVSWRALALIGLVPCAVTIFGLFFI  212



>ref|XP_010279404.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Nelumbo 
nucifera]
Length=462

 Score =   276 bits (705),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 167/217 (77%), Gaps = 16/217 (7%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIG-------KEDDSKTDRW-----MVYLSTFVAVCGSCAFG  339
            QD+E G+ E     +  PLI        KED S  +       MV LSTFVAVCGS  FG
Sbjct  3    QDVEKGEKEE----LIQPLIEQQNIVACKEDGSHKNENRGTIGMVLLSTFVAVCGSFEFG  58

Query  340  SCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSV  519
            SC GYS+PTQSAI  DL+ SI+EYSLFGS+LT GAMAGA+TSG IADF+GRK AMRMS+ 
Sbjct  59   SCVGYSAPTQSAIRNDLHLSISEYSLFGSVLTIGAMAGAVTSGRIADFIGRKEAMRMSAT  118

Query  520  FCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMI  699
            FC+ GWLA++F+KGAL +D GR+ TGYG+GVFSYVVPV+IAEI PK LRG LTT+NQLMI
Sbjct  119  FCITGWLAVYFSKGALPLDTGRVFTGYGIGVFSYVVPVYIAEITPKNLRGGLTTVNQLMI  178

Query  700  VTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            VTG SVAF+IGT+VTWRTLALTG++PC+ L LGL  I
Sbjct  179  VTGSSVAFLIGTIVTWRTLALTGLIPCIFLLLGLFFI  215



>emb|CDY13924.1| BnaC09g39020D [Brassica napus]
Length=283

 Score =   270 bits (690),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 164/213 (77%), Gaps = 8/213 (4%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGK---EDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAG  351
            +D+E G+      G+  PL+ K   +DD +        +MV  STFVAVCGS  FGSC G
Sbjct  7    KDVERGEIVSRVEGLGNPLLKKVADQDDVEESEINESYFMVLFSTFVAVCGSFEFGSCVG  66

Query  352  YSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLA  531
            YS+PTQS+I QDLN S+AE+S+FGSILT GAM GA+ SG I+D  GRKGAMR S+ FC+ 
Sbjct  67   YSAPTQSSIRQDLNLSLAEFSMFGSILTIGAMLGAVMSGHISDLTGRKGAMRTSACFCIT  126

Query  532  GWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGV  711
            GWLA+FF+K AL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRGALTTLNQLMIV G 
Sbjct  127  GWLAVFFSKSALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGALTTLNQLMIVIGS  186

Query  712  SVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            SV+F+IG++++W+ LALTG+ PC+VL  GLC I
Sbjct  187  SVSFLIGSLISWKILALTGLAPCIVLLFGLCFI  219



>ref|XP_008234934.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
 ref|XP_008234935.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
 ref|XP_008234936.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
 ref|XP_008234938.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
 ref|XP_008234939.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
 ref|XP_008234940.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
Length=475

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 167/216 (77%), Gaps = 11/216 (5%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKT-------DRWMVYLSTFVAVCGSCAFGS  342
            MA  +D+E+   EG T     PL+  E +          ++WMVYLSTFVAVCGS  FG 
Sbjct  1    MAIKEDVESDLQEGITD----PLMRVEKNLADGGSSRGGNQWMVYLSTFVAVCGSYEFGC  56

Query  343  CAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVF  522
            C GYSSPTQSAI +DL+ ++AEYS+FGSI+TFGAM GAIT GPI DF+GRKGA+R+S  F
Sbjct  57   CIGYSSPTQSAIREDLSLTLAEYSVFGSIVTFGAMIGAITIGPITDFLGRKGALRVSCAF  116

Query  523  CLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  702
            C+AGWLAI+F+KGAL +DIGRLATGYGMG FSYVVPVFIAEIAPK LRG LT +NQLMI+
Sbjct  117  CVAGWLAIYFSKGALSLDIGRLATGYGMGAFSYVVPVFIAEIAPKNLRGRLTAINQLMII  176

Query  703  TGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            +GVS++F+IG +V+WR LAL G+VPC V   GL  I
Sbjct  177  SGVSISFIIGVLVSWRALALIGLVPCAVTIFGLFFI  212



>ref|XP_010507821.1| PREDICTED: sugar transporter ERD6-like 7 [Camelina sativa]
Length=437

 Score =   275 bits (702),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MVYLSTFVAVCGS AFGSCAG+SSPTQ+AI  DL+ +IAE+SLFGS+LTFGAM GAITSG
Sbjct  1    MVYLSTFVAVCGSFAFGSCAGFSSPTQAAIRNDLSLTIAEFSLFGSLLTFGAMIGAITSG  60

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
            PIAD VGRKGAMR+SS FC+ GWLAIFFAKG + +D+GRLATGYGMG FSYVVP+FIAEI
Sbjct  61   PIADLVGRKGAMRVSSAFCVVGWLAIFFAKGVVTLDLGRLATGYGMGAFSYVVPIFIAEI  120

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            APK  RGALTTLNQ++I TGVSV+F+IGT+VTWR LAL GI+PC    LGL +I
Sbjct  121  APKTFRGALTTLNQILICTGVSVSFIIGTLVTWRVLALIGIIPCAASFLGLFLI  174



>ref|XP_010667578.1| PREDICTED: sugar transporter ERD6-like 7 [Beta vulgaris subsp. 
vulgaris]
Length=486

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 155/183 (85%), Gaps = 0/183 (0%)
 Frame = +1

Query  262  EDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFG  441
            E+ S+   WMVYLSTFVAVCGS  FG+CAGYSSPTQSAI+ +L  S A+Y+LFGSILT G
Sbjct  41   ENGSRRHPWMVYLSTFVAVCGSYEFGACAGYSSPTQSAITAELGLSTAQYALFGSILTVG  100

Query  442  AMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSY  621
            AM GAITSGPIADF+GRKGAMR+ S FC+ GWLAI+FAKG+L +DIGRLA GYGMG FSY
Sbjct  101  AMIGAITSGPIADFIGRKGAMRVYSAFCVGGWLAIYFAKGSLALDIGRLAGGYGMGAFSY  160

Query  622  VVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGL  801
            VVPV+IAEIAP  LRGALTTLNQ+MI  GVSVAF+IG ++ WR LALTG++PCV+L LGL
Sbjct  161  VVPVYIAEIAPVHLRGALTTLNQVMICAGVSVAFIIGIVLPWRALALTGLIPCVILLLGL  220

Query  802  CII  810
              I
Sbjct  221  FFI  223



>ref|XP_010279395.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Nelumbo 
nucifera]
Length=478

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 167/217 (77%), Gaps = 16/217 (7%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIG-------KEDDSKTDRW-----MVYLSTFVAVCGSCAFG  339
            QD+E G+ E     +  PLI        KED S  +       MV LSTFVAVCGS  FG
Sbjct  3    QDVEKGEKEE----LIQPLIEQQNIVACKEDGSHKNENRGTIGMVLLSTFVAVCGSFEFG  58

Query  340  SCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSV  519
            SC GYS+PTQSAI  DL+ SI+EYSLFGS+LT GAMAGA+TSG IADF+GRK AMRMS+ 
Sbjct  59   SCVGYSAPTQSAIRNDLHLSISEYSLFGSVLTIGAMAGAVTSGRIADFIGRKEAMRMSAT  118

Query  520  FCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMI  699
            FC+ GWLA++F+KGAL +D GR+ TGYG+GVFSYVVPV+IAEI PK LRG LTT+NQLMI
Sbjct  119  FCITGWLAVYFSKGALPLDTGRVFTGYGIGVFSYVVPVYIAEITPKNLRGGLTTVNQLMI  178

Query  700  VTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            VTG SVAF+IGT+VTWRTLALTG++PC+ L LGL  I
Sbjct  179  VTGSSVAFLIGTIVTWRTLALTGLIPCIFLLLGLFFI  215



>ref|XP_007201571.1| hypothetical protein PRUPE_ppa018319mg [Prunus persica]
 gb|EMJ02770.1| hypothetical protein PRUPE_ppa018319mg [Prunus persica]
Length=494

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 159/204 (78%), Gaps = 14/204 (7%)
 Frame = +1

Query  199  DIENGKNEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAI  378
            D+ +G   GST G              D+WMVYLSTFVAVCGS  FG   GYSSPTQSAI
Sbjct  28   DVGDGSGHGSTKG--------------DQWMVYLSTFVAVCGSYEFGCGVGYSSPTQSAI  73

Query  379  SQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAK  558
             +DLN S+AEYS+FGSILTFGAM GAIT GPI DF+GRKGA+RMS  FC+AGWLAI+F+K
Sbjct  74   RKDLNLSLAEYSMFGSILTFGAMIGAITIGPITDFLGRKGALRMSCGFCVAGWLAIYFSK  133

Query  559  GALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTM  738
            GAL +DIGRLATGYG G FSY+VPVFIAEIAPK LRG LT +NQLMIVTGVSV+F+IG +
Sbjct  134  GALSLDIGRLATGYGSGAFSYIVPVFIAEIAPKNLRGRLTAINQLMIVTGVSVSFIIGVV  193

Query  739  VTWRTLALTGIVPCVVLGLGLCII  810
            V+WR LA+ GIVPC V+  GL  I
Sbjct  194  VSWRALAIIGIVPCAVIIFGLFFI  217



>ref|XP_006444168.1| hypothetical protein CICLE_v10019918mg [Citrus clementina]
 ref|XP_006479807.1| PREDICTED: sugar transporter ERD6-like 7-like [Citrus sinensis]
 gb|ESR57408.1| hypothetical protein CICLE_v10019918mg [Citrus clementina]
 gb|KDO87481.1| hypothetical protein CISIN_1g011565mg [Citrus sinensis]
Length=483

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 169/220 (77%), Gaps = 14/220 (6%)
 Frame = +1

Query  190  AGQDIENGKNEGSTAGMAAPLI-------------GKEDDSKTDRWMVYLSTFVAVCGSC  330
            A +D +N  N  +   M  PL+             GK+  SK   +MVYLST VAV GS 
Sbjct  2    ANKD-QNVVNNAADDKMTEPLLRGEQNLADENGGSGKKTGSKDSLYMVYLSTLVAVSGSY  60

Query  331  AFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRM  510
            +FG+  GYSSPTQ+AI +DL+ S+AEYS+FGSILTFGAM GAITSGPIADF+GRKGAMR+
Sbjct  61   SFGTGVGYSSPTQNAIREDLSLSLAEYSVFGSILTFGAMIGAITSGPIADFIGRKGAMRV  120

Query  511  SSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQ  690
            SS  C+AGWLAI+F++GAL +D+GRLATGYGMG+FSYVVPVF AEIAPKELRGALT+ NQ
Sbjct  121  SSFVCIAGWLAIYFSEGALSLDLGRLATGYGMGIFSYVVPVFTAEIAPKELRGALTSANQ  180

Query  691  LMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            L+IV G S  F+IGT+ TWRTLAL G++PC VL LGL +I
Sbjct  181  LLIVIGASTFFIIGTVATWRTLALVGVIPCAVLLLGLFLI  220



>ref|NP_568367.1| sugar transporter ERD6-like 16 [Arabidopsis thaliana]
 sp|Q8LBI9.2|EDL16_ARATH RecName: Full=Sugar transporter ERD6-like 16 [Arabidopsis thaliana]
 gb|AAL36051.1| AT5g18840/F17K4_90 [Arabidopsis thaliana]
 gb|AAN18269.1| At5g18840/F17K4_90 [Arabidopsis thaliana]
 gb|AED92620.1| sugar transporter ERD6-like 16 [Arabidopsis thaliana]
Length=482

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 161/210 (77%), Gaps = 5/210 (2%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSS  360
            +D+E G+       +  P +  EDD K         MV  STFVAVCGS  FGSC GYS+
Sbjct  7    KDVERGEIVNKVEDLGKPFLTHEDDEKESENNESYLMVLFSTFVAVCGSFEFGSCVGYSA  66

Query  361  PTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWL  540
            PTQS+I QDLN S+AE+S+FGSILT GAM GA+ SG I+DF GRKGAMR S+ FC+ GWL
Sbjct  67   PTQSSIRQDLNLSLAEFSMFGSILTIGAMLGAVMSGKISDFSGRKGAMRTSACFCITGWL  126

Query  541  AIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  720
            A+FF KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G SV+
Sbjct  127  AVFFTKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGGLTTLNQLMIVIGSSVS  186

Query  721  FVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            F+IG++++W+TLALTG+ PC+VL  GLC I
Sbjct  187  FLIGSLISWKTLALTGLAPCIVLLFGLCFI  216



>ref|XP_008386584.1| PREDICTED: sugar transporter ERD6-like 7 [Malus domestica]
Length=473

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 162/210 (77%), Gaps = 1/210 (0%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAG-MAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSS  360
            MA  +D+E+   EG  A  MA            + WMVYLSTFVA+CGS  FG CAGYSS
Sbjct  1    MATKEDVESDAQEGVRAPLMANVAGSAGGSGGGNLWMVYLSTFVAICGSYEFGCCAGYSS  60

Query  361  PTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWL  540
            PT+SAI +DL+ S++EYS+FGSILTFGAM GAIT GPIADF+GRKGA+R+S  FC+AGWL
Sbjct  61   PTESAIQEDLSLSLSEYSMFGSILTFGAMVGAITIGPIADFLGRKGALRVSCAFCVAGWL  120

Query  541  AIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  720
            AI+F+K A  +DIGRL TGYGMG FSYVVP+F+AEIAPK LRG LT  NQLMIVTGVS +
Sbjct  121  AIYFSKAAWSLDIGRLLTGYGMGAFSYVVPIFVAEIAPKNLRGRLTAANQLMIVTGVSAS  180

Query  721  FVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            F+IG +V+WRTLAL G++PC V  LGL  I
Sbjct  181  FIIGVLVSWRTLALIGLIPCAVTLLGLFFI  210



>ref|XP_010454136.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Camelina 
sativa]
 ref|XP_010454137.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Camelina 
sativa]
Length=482

 Score =   275 bits (702),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 162/210 (77%), Gaps = 5/210 (2%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSS  360
            +D+E G        +  P +  +DD K         MV  STFVAVCGS  FGSC GYS+
Sbjct  7    KDVERGDIANKVEDLGKPFLTDQDDEKESEVNESYLMVIFSTFVAVCGSFEFGSCVGYSA  66

Query  361  PTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWL  540
            PTQS+I QDLN S+AE+S+FGSILT GAM GA+ SG I+DF GRKGAMR S+ FC+ GWL
Sbjct  67   PTQSSIRQDLNLSLAEFSMFGSILTIGAMIGAVMSGKISDFSGRKGAMRTSACFCITGWL  126

Query  541  AIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  720
            A+FF+KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G SV+
Sbjct  127  AVFFSKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKHLRGGLTTLNQLMIVIGSSVS  186

Query  721  FVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            F+IG++++W+TLALTGI PC+VL +GLC I
Sbjct  187  FLIGSLISWKTLALTGIAPCIVLLVGLCFI  216



>ref|XP_002315546.2| hypothetical protein POPTR_0010s02740g [Populus trichocarpa]
 gb|EEF01717.2| hypothetical protein POPTR_0010s02740g [Populus trichocarpa]
Length=488

 Score =   275 bits (702),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 169/218 (78%), Gaps = 15/218 (7%)
 Frame = +1

Query  199  DIENGKNEGSTAGMAAPLIGKE------DDSKTDR--------WMVYLSTFVAVCGSCAF  336
            D+E G+  G    +  PLI +E      D+++TD+         MV L TFVAVCGS  F
Sbjct  8    DVEQGEIIG-LEDLEKPLIFEEKIVVINDNNETDQDQESTGSIGMVLLCTFVAVCGSFEF  66

Query  337  GSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSS  516
            GSC GYS+PTQSAI +DLN SIAEYS+FGSILT GAM GAITSG IADF+GRKGAMRMS+
Sbjct  67   GSCVGYSAPTQSAIREDLNLSIAEYSMFGSILTIGAMLGAITSGRIADFIGRKGAMRMSA  126

Query  517  VFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLM  696
             FC+ GWLA+FF++G   +D+GR+ TGYG+GVFSYVVP+FIAEIAPK LRG LTTLNQLM
Sbjct  127  CFCITGWLAVFFSRGPFSLDVGRILTGYGIGVFSYVVPIFIAEIAPKNLRGGLTTLNQLM  186

Query  697  IVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            IVTG S AF+IG+++TWR LALTG+VPC+ L +GLC +
Sbjct  187  IVTGSSTAFLIGSVITWRGLALTGLVPCIFLLVGLCFV  224



>ref|XP_004290697.1| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
 ref|XP_011458634.1| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
 ref|XP_011458635.1| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
Length=480

 Score =   274 bits (701),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 162/215 (75%), Gaps = 10/215 (5%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLI------GKEDDSKTDRWMVYLSTFVAVCGSCAFGSC  345
            MA  +D+EN   E     +  PL+            K D+WMVYLSTFVAVCGS  FG C
Sbjct  1    MAIKEDVENVVQEN----IREPLVRSSGEGSGHGSGKEDQWMVYLSTFVAVCGSYEFGCC  56

Query  346  AGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFC  525
             GYSSPTQSAI++DL+ + +EYS+FGSILTFGAM GAIT GPI D VGRKGA+RMS  FC
Sbjct  57   VGYSSPTQSAITEDLSLTTSEYSVFGSILTFGAMIGAITIGPITDLVGRKGALRMSCAFC  116

Query  526  LAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVT  705
            + GWLAI+FA+GA  +DIGRLATGYGMG FSYVVPVF++EIAPK LRG LT LNQLMIV+
Sbjct  117  VVGWLAIYFAEGAWALDIGRLATGYGMGAFSYVVPVFVSEIAPKHLRGRLTALNQLMIVS  176

Query  706  GVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            GVSV+F+IG +V+WR LAL G++PC V   GL  I
Sbjct  177  GVSVSFIIGLVVSWRALALIGLIPCAVTLFGLFFI  211



>ref|XP_009102177.1| PREDICTED: LOW QUALITY PROTEIN: sugar transporter ERD6-like 7 
[Brassica rapa]
Length=463

 Score =   273 bits (699),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 160/190 (84%), Gaps = 3/190 (2%)
 Frame = +1

Query  247  PLIGKE-DDSKTDR-WMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLF  420
            PL+ K   +SK ++ WMVYLSTFVAVCGS AFGSCAGYSSP Q+AI  DL+ +IAE+SLF
Sbjct  11   PLVEKHVAESKQEQPWMVYLSTFVAVCGSFAFGSCAGYSSPAQAAIRNDLSLTIAEFSLF  70

Query  421  GSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGY  600
            GS+LTFGAM GAITSGPIAD +GRKGAMR+SS FC+AGWLAIFFAKG + +D+GRLATGY
Sbjct  71   GSLLTFGAMFGAITSGPIADSIGRKGAMRVSSAFCVAGWLAIFFAKGVVALDLGRLATGY  130

Query  601  GMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPC  780
            GMG FSYVVP+FIAEIAPK  RGALTTLNQ++I TGVSV+F+IGTMVTWR LAL G    
Sbjct  131  GMGAFSYVVPIFIAEIAPKAFRGALTTLNQILICTGVSVSFIIGTMVTWRVLALIGXDTI  190

Query  781  VVLGLGL-CI  807
             V  LGL CI
Sbjct  191  AVSFLGLFCI  200



>ref|XP_010492922.1| PREDICTED: sugar transporter ERD6-like 16 [Camelina sativa]
Length=482

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 162/210 (77%), Gaps = 5/210 (2%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSS  360
            +D+E G    +   +  P +   DD K         MV  STFVAVCGS  FGSC GYS+
Sbjct  7    KDVERGDIANNVEDLGKPFLTDRDDEKESEVNESYLMVIFSTFVAVCGSFEFGSCVGYSA  66

Query  361  PTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWL  540
            PTQ++I QDLN SIAE+S+FGSILT GAM GA+ SG I+DF GRKGAMR S+ FC+ GWL
Sbjct  67   PTQASIRQDLNLSIAEFSMFGSILTIGAMIGAVMSGKISDFSGRKGAMRTSACFCITGWL  126

Query  541  AIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  720
            A+FF+KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G SV+
Sbjct  127  AVFFSKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKHLRGGLTTLNQLMIVIGSSVS  186

Query  721  FVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            F+IG++++W+TLALTG+ PC+VL +GLC I
Sbjct  187  FLIGSLISWKTLALTGLAPCIVLLVGLCFI  216



>gb|KCW58947.1| hypothetical protein EUGRSUZ_H01571 [Eucalyptus grandis]
Length=484

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 163/220 (74%), Gaps = 11/220 (5%)
 Frame = +1

Query  184  MAAGQDIEN---GKNEGSTAGMAAPLIGKE--DDSKTDR---WMVYLSTFVAVCGSCAFG  339
            MA  +DIEN   G  EG    +  P        D  TD+   WMVY +TF+AVCGS  FG
Sbjct  1    MAINEDIENQETGDREGVRERLLVPQEKDRAGKDEGTDKVRPWMVYFTTFIAVCGSYEFG  60

Query  340  SCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSV  519
            +CAGYSSPTQ AI ++L  S AEYS+FGSILTFGAM GAIT GPIADFVGRK  MR++S 
Sbjct  61   TCAGYSSPTQDAIVEELGLSTAEYSVFGSILTFGAMIGAITGGPIADFVGRKWTMRIASA  120

Query  520  FCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMI  699
             C+AGWLAI+FA+G L +DIGRLATGYGMGVFSYVVP+FIAEI PK LRGALT +NQLMI
Sbjct  121  LCVAGWLAIYFAEGELALDIGRLATGYGMGVFSYVVPIFIAEITPKNLRGALTAVNQLMI  180

Query  700  VTGVSVAFVIGTMVTWRTLAL---TGIVPCVVLGLGLCII  810
            V GVSV+F+IGT++ WR LAL    G++PC VL  GL  I
Sbjct  181  VAGVSVSFIIGTVLAWRVLALIVYAGLIPCAVLLFGLFFI  220



>ref|XP_004290698.1| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
Length=464

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 160/207 (77%), Gaps = 10/207 (5%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKT-DRWMVYLSTFVAVCGSCAFGSCAGYSS  360
            MA  +D+E  +          PL+ +E  +    RWMVYLSTFVAVCGS  FG CAG+SS
Sbjct  1    MANKEDVETSRE---------PLLNREGSAHEGHRWMVYLSTFVAVCGSYEFGCCAGFSS  51

Query  361  PTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWL  540
            PTQ AI+ DL+ S+AEYS+FGSILTFGAM GAIT GPIADF+GRKGAMR+SS FC+AGWL
Sbjct  52   PTQDAITDDLSLSLAEYSMFGSILTFGAMIGAITIGPIADFIGRKGAMRVSSAFCVAGWL  111

Query  541  AIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  720
            AI+FA+    +DIGRLA GYGMG FSYVVPVFIAEIAPK LRG LT +NQLMI  GVSV+
Sbjct  112  AIYFAESIWPLDIGRLANGYGMGAFSYVVPVFIAEIAPKNLRGRLTAVNQLMICAGVSVS  171

Query  721  FVIGTMVTWRTLALTGIVPCVVLGLGL  801
            ++IG +V+WR LAL G++PC V+  GL
Sbjct  172  YIIGVVVSWRALALIGLIPCAVIISGL  198



>gb|KEH23721.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=475

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 168/216 (78%), Gaps = 11/216 (5%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDD----SKTDR---WMVYLSTFVAVCGSCAFGS  342
            M   +++E+GK +G    M  PLIG+ ++    +  D    WM+Y +TF+AVCGS  FG+
Sbjct  1    MEIKEEMEDGKQKG----MREPLIGEHNNQLVHANKDHHYPWMLYFTTFIAVCGSYEFGA  56

Query  343  CAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVF  522
            C GYSSP Q AI +DLN S+ EYSLFGSILTFGAM GAITSGPIA+FVGRKGAMR+SS F
Sbjct  57   CTGYSSPAQDAIRRDLNLSLEEYSLFGSILTFGAMIGAITSGPIAEFVGRKGAMRVSSAF  116

Query  523  CLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  702
             +AGWL I+F++G + +DIGRL TGYGMGVFS+VVP+F+AEIAPKE RGALTTLNQ MIV
Sbjct  117  SIAGWLVIYFSEGIVPLDIGRLLTGYGMGVFSFVVPIFVAEIAPKERRGALTTLNQFMIV  176

Query  703  TGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            +G S +F+IGT+++WR LA+ G++P  VL LGL  I
Sbjct  177  SGASGSFIIGTVLSWRALAIIGLIPTAVLLLGLLFI  212



>gb|KEH23691.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=457

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 174/217 (80%), Gaps = 11/217 (5%)
 Frame = +1

Query  181  KMAAGQDIENGKNEGSTAGMAAPLIGKEDDS-------KTDRWMVYLSTFVAVCGSCAFG  339
            KM   +D+E GK +G    +  PLIG++++            WMVY +TF+AVCGS  FG
Sbjct  2    KMDIKEDVEGGKQKG----IREPLIGEQNNQLVHANKDHHHPWMVYFTTFIAVCGSYEFG  57

Query  340  SCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSV  519
            +CAGYSSPTQ AI +DL+ S+AEYSLFGSILTFGAM GAITSGPIADFVGRKGAMR+SS 
Sbjct  58   ACAGYSSPTQEAIRKDLSLSLAEYSLFGSILTFGAMIGAITSGPIADFVGRKGAMRVSSA  117

Query  520  FCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMI  699
            FC+AGWL I+F++G + +DIGRLATGYGMGVFS+VVPVF+AEIAPKELRGALTTLNQ MI
Sbjct  118  FCIAGWLVIYFSEGPVPLDIGRLATGYGMGVFSFVVPVFVAEIAPKELRGALTTLNQFMI  177

Query  700  VTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            VT VSV+F+IGT+++WR LA+ G++P  VL LGL  I
Sbjct  178  VTAVSVSFIIGTVLSWRALAIIGLIPTAVLLLGLFFI  214



>gb|AAM64736.1| sugar transporter-like protein [Arabidopsis thaliana]
Length=482

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 160/210 (76%), Gaps = 5/210 (2%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSS  360
            +D+E G+       +  P +  EDD K         MV  STFVAVCGS  FGSC GYS+
Sbjct  7    KDVERGEIVNKVEDLGKPFLTHEDDEKESENNESYLMVLFSTFVAVCGSFEFGSCVGYSA  66

Query  361  PTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWL  540
            PTQS+I QDLN S+AE+S+FGSILT GAM GA+ SG I+DF GRKGAMR S+ FC+ GWL
Sbjct  67   PTQSSIRQDLNLSLAEFSMFGSILTIGAMLGAVMSGKISDFSGRKGAMRTSACFCITGWL  126

Query  541  AIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  720
            A+FF KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G SV+
Sbjct  127  AVFFTKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGGLTTLNQLMIVIGSSVS  186

Query  721  FVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            F+IG++++W+TLALT + PC+VL  GLC I
Sbjct  187  FLIGSLISWKTLALTVLAPCIVLLFGLCFI  216



>ref|XP_010112685.1| Sugar transporter ERD6-like 7 [Morus notabilis]
 gb|EXC34643.1| Sugar transporter ERD6-like 7 [Morus notabilis]
Length=450

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 152/194 (78%), Gaps = 6/194 (3%)
 Frame = +1

Query  247  PLIGKEDDS------KTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAE  408
            PL   ED S      K + WMVYLSTFVAVCGS  FG+CAGYSSPTQSAI +DLN S+A+
Sbjct  14   PLFAVEDGSPAHEYSKDNPWMVYLSTFVAVCGSYEFGTCAGYSSPTQSAIREDLNLSLAD  73

Query  409  YSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRL  588
            YSLFGSILTFGAM GAITSG IAD VGRKGAMR+ + FC+ GWL+I+FAK AL +DIGRL
Sbjct  74   YSLFGSILTFGAMIGAITSGTIADLVGRKGAMRVYTAFCVTGWLSIYFAKDALALDIGRL  133

Query  589  ATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTG  768
            ATGYGMG FSYVVPVFIAEIAPK  RG LT  NQ MI  GVSV+F+IG ++TWR LAL  
Sbjct  134  ATGYGMGAFSYVVPVFIAEIAPKNHRGLLTASNQFMICAGVSVSFIIGNVLTWRALALVA  193

Query  769  IVPCVVLGLGLCII  810
            ++PC VL  GL  I
Sbjct  194  LIPCAVLLFGLSFI  207



>ref|XP_008449464.1| PREDICTED: sugar transporter ERD6-like 7 [Cucumis melo]
Length=473

 Score =   271 bits (694),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 164/214 (77%), Gaps = 9/214 (4%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKE----DDSKTDR-WMVYLSTFVAVCGSCAFGSCA  348
            MA  QD E    E +      P +  E     +S+  R WMVYLS+ VAVCGS  FG+CA
Sbjct  1    MAIRQDEEESGQEAA----GQPFLQDESKWTHNSEERRPWMVYLSSLVAVCGSYEFGTCA  56

Query  349  GYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCL  528
            GYSSPTQSAI  DL+ S+AE+SLFGSILTFGAM GAITSGPI D +GRKGAMR+++  C+
Sbjct  57   GYSSPTQSAIINDLHLSLAEFSLFGSILTFGAMIGAITSGPIGDLLGRKGAMRVATGACV  116

Query  529  AGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTG  708
            AGWL I+FA+G + +D+GR ATGYGMGVFSYVVPVFIAEIAPK LRGALTTLNQ MI T 
Sbjct  117  AGWLTIYFAQGVVALDVGRFATGYGMGVFSYVVPVFIAEIAPKNLRGALTTLNQFMICTA  176

Query  709  VSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            VS++F+IG +++WRTLALT +VPCV+L  GL  I
Sbjct  177  VSISFIIGNVLSWRTLALTALVPCVILTFGLFFI  210



>ref|XP_010420663.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Camelina 
sativa]
Length=482

 Score =   271 bits (694),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 161/210 (77%), Gaps = 5/210 (2%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSS  360
            +D+E G        +  P +  +DD K         MV  STFVAVCGS  FGSC GYS+
Sbjct  7    KDVERGDIANKVEDLGKPFLTDQDDEKESEVNESYLMVIFSTFVAVCGSFEFGSCVGYSA  66

Query  361  PTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWL  540
            PTQS+I QDLN S+AE+S+FGSILT GAM GA+ SG ++DF GRKGAMR S+ FC+ GW+
Sbjct  67   PTQSSIRQDLNLSLAEFSMFGSILTIGAMIGAVMSGKVSDFSGRKGAMRTSACFCITGWV  126

Query  541  AIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  720
            A+FF+KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G SV+
Sbjct  127  AVFFSKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKHLRGGLTTLNQLMIVIGSSVS  186

Query  721  FVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            F+IG++++W+TLALTG+ PC+VL  GLC I
Sbjct  187  FLIGSLISWKTLALTGLAPCIVLLFGLCFI  216



>gb|KEH23690.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=477

 Score =   271 bits (693),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 174/217 (80%), Gaps = 11/217 (5%)
 Frame = +1

Query  181  KMAAGQDIENGKNEGSTAGMAAPLIGKEDDS-------KTDRWMVYLSTFVAVCGSCAFG  339
            KM   +D+E GK +G    +  PLIG++++            WMVY +TF+AVCGS  FG
Sbjct  2    KMDIKEDVEGGKQKG----IREPLIGEQNNQLVHANKDHHHPWMVYFTTFIAVCGSYEFG  57

Query  340  SCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSV  519
            +CAGYSSPTQ AI +DL+ S+AEYSLFGSILTFGAM GAITSGPIADFVGRKGAMR+SS 
Sbjct  58   ACAGYSSPTQEAIRKDLSLSLAEYSLFGSILTFGAMIGAITSGPIADFVGRKGAMRVSSA  117

Query  520  FCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMI  699
            FC+AGWL I+F++G + +DIGRLATGYGMGVFS+VVPVF+AEIAPKELRGALTTLNQ MI
Sbjct  118  FCIAGWLVIYFSEGPVPLDIGRLATGYGMGVFSFVVPVFVAEIAPKELRGALTTLNQFMI  177

Query  700  VTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            VT VSV+F+IGT+++WR LA+ G++P  VL LGL  I
Sbjct  178  VTAVSVSFIIGTVLSWRALAIIGLIPTAVLLLGLFFI  214



>ref|XP_006400439.1| hypothetical protein EUTSA_v10013389mg [Eutrema salsugineum]
 gb|ESQ41892.1| hypothetical protein EUTSA_v10013389mg [Eutrema salsugineum]
Length=393

 Score =   268 bits (685),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 162/215 (75%), Gaps = 10/215 (5%)
 Frame = +1

Query  196  QDIENGKNE---GSTAGMAAPLIGKEDDSKTDR-------WMVYLSTFVAVCGSCAFGSC  345
            +D+E G+N         +  PL+ K  D   ++        MV  STFVAVCGS  FGSC
Sbjct  7    KDVERGENREIVNKVEDLKNPLLKKVADHDGEKSEINESYLMVLFSTFVAVCGSFEFGSC  66

Query  346  AGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFC  525
             GYS+PTQS+I  DLN S+AE+S+FGSILT GAM GA+ SG I+D  GRKGAMR S+ FC
Sbjct  67   VGYSAPTQSSIRHDLNLSLAEFSMFGSILTIGAMLGAVMSGQISDLTGRKGAMRTSACFC  126

Query  526  LAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVT  705
            + GWLA+FF+KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV 
Sbjct  127  ITGWLAVFFSKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGGLTTLNQLMIVI  186

Query  706  GVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            G SV+F+IG++++W+TLALTG+ PC+VL  GLC I
Sbjct  187  GSSVSFMIGSLISWKTLALTGLAPCIVLLFGLCFI  221



>ref|XP_006287631.1| hypothetical protein CARUB_v10000842mg [Capsella rubella]
 gb|EOA20529.1| hypothetical protein CARUB_v10000842mg [Capsella rubella]
Length=483

 Score =   271 bits (692),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 159/211 (75%), Gaps = 6/211 (3%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDSKTDR------WMVYLSTFVAVCGSCAFGSCAGYS  357
             D+E G        +  PL+    D K          MV+ STFVAVCGS  FGSC GYS
Sbjct  7    HDVEKGDTANKVKDLGKPLLTDRYDEKESEVNDESYLMVFFSTFVAVCGSFEFGSCVGYS  66

Query  358  SPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGW  537
            +PTQS+I QDLN S+AE+S+FGSILT GAM GA+ SG I+DF GRKGAMR S+ FC+ GW
Sbjct  67   APTQSSIRQDLNLSLAEFSMFGSILTIGAMLGAVMSGKISDFSGRKGAMRTSACFCIIGW  126

Query  538  LAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSV  717
            LA+FF+KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G SV
Sbjct  127  LAVFFSKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGGLTTLNQLMIVIGSSV  186

Query  718  AFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            +F+IG++++W+TLALTG+ PC+ L  GLC I
Sbjct  187  SFLIGSLISWKTLALTGLAPCIALLFGLCFI  217



>ref|XP_008368891.1| PREDICTED: sugar transporter ERD6-like 7 [Malus domestica]
Length=473

 Score =   270 bits (691),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 163/214 (76%), Gaps = 9/214 (4%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSK-----TDRWMVYLSTFVAVCGSCAFGSCA  348
            M   +D+E+   EG    +  PL+ + D+S       + WMVYLSTFVAVCG   FG C 
Sbjct  1    MGIKEDVESDVQEG----VRVPLMAEGDESAGGSXGXNLWMVYLSTFVAVCGXYEFGCCV  56

Query  349  GYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCL  528
            GYSSPTQSAI +DL+ S++EYS+FGSILT GAM GAIT GPI DF+GRKGA+R+S  FC+
Sbjct  57   GYSSPTQSAIREDLSLSLSEYSVFGSILTXGAMIGAITIGPITDFLGRKGALRVSCAFCV  116

Query  529  AGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTG  708
            AGWLAI+F+KGA  +DIGRL TGYGMG FSYVVP+FIAEIAPK LRG LT  NQLMIVTG
Sbjct  117  AGWLAIYFSKGAWSLDIGRLLTGYGMGAFSYVVPIFIAEIAPKSLRGRLTAANQLMIVTG  176

Query  709  VSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            VSV+F+IG +V+WRTLAL G++PC V   GL  I
Sbjct  177  VSVSFIIGVVVSWRTLALIGLIPCAVTLFGLFFI  210



>ref|XP_010024483.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Eucalyptus 
grandis]
 gb|KCW60928.1| hypothetical protein EUGRSUZ_H03662 [Eucalyptus grandis]
Length=497

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 166/219 (76%), Gaps = 15/219 (7%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDSKTDRW--------------MVYLSTFVAVCGSCA  333
            +D+EN  N+G    +  PL+  E    +                 MV LST VAVCGS  
Sbjct  7    KDVENCDNQG-LEDLQEPLVKLEKKVVSYEDSESDESVESSCSIAMVLLSTSVAVCGSFE  65

Query  334  FGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMS  513
            FGSC GYS+PTQSAI +DL  S+AEYS+FGSILT GAM GAITSG IADF+GRKGAMRMS
Sbjct  66   FGSCVGYSAPTQSAIREDLGLSLAEYSMFGSILTIGAMLGAITSGRIADFIGRKGAMRMS  125

Query  514  SVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQL  693
            ++FC+AGWLA++F+ GA  +D+GR  TGYG+GVFSYVVP+FIAEIAPK LRG LTTLNQL
Sbjct  126  AIFCIAGWLAVYFSNGASCLDMGRFFTGYGIGVFSYVVPIFIAEIAPKHLRGGLTTLNQL  185

Query  694  MIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            MIV G SVAF+IGT+VTWRTLALTG+VPC+VL +GL +I
Sbjct  186  MIVVGASVAFLIGTIVTWRTLALTGLVPCIVLFVGLFLI  224



>ref|XP_004296777.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=490

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 168/219 (77%), Gaps = 11/219 (5%)
 Frame = +1

Query  184  MAAGQ--DIENGKNEGSTAGMAAPLIGKEDD--------SKTDRWMVYLSTFVAVCGSCA  333
            MA GQ  D+ENG    S   +  P I +E          S     MV LST VAVCGS  
Sbjct  1    MAIGQCRDVENGGTN-SLEDLEQPFIKQEKKIVGNYEGGSTGSIGMVLLSTGVAVCGSFE  59

Query  334  FGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMS  513
            FGSC GYS+PTQSAI +DL  S+A++S+FGSILT GAM GAITSG IADF+GRKGAMRMS
Sbjct  60   FGSCVGYSAPTQSAIREDLYLSLAQFSMFGSILTIGAMLGAITSGRIADFLGRKGAMRMS  119

Query  514  SVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQL  693
            + FC+ GWLAI+F++GAL +DIGR  TGYG+GVFSYVVP+FIAEIAPK LRG LTTLNQL
Sbjct  120  ATFCITGWLAIYFSEGALSLDIGRFLTGYGIGVFSYVVPIFIAEIAPKNLRGGLTTLNQL  179

Query  694  MIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            MIVTG SV+FVIGT+++WRTLA+TGI+PC+VL +GL  +
Sbjct  180  MIVTGASVSFVIGTIISWRTLAMTGILPCIVLLVGLWFV  218



>ref|XP_008234933.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
Length=475

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 164/216 (76%), Gaps = 11/216 (5%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKT-------DRWMVYLSTFVAVCGSCAFGS  342
            MA  +D+E+   EG    + APL+  E++          + WMVYLSTFVAVCGS  FG 
Sbjct  1    MAIKEDVESDLQEG----IRAPLMRVENNLADGGSSIGGNPWMVYLSTFVAVCGSYEFGC  56

Query  343  CAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVF  522
            CAGYSSPTQSAI +DL+ S+AEYS+FGSILTFGAM GAIT GPI D +GRKGA+R+SS F
Sbjct  57   CAGYSSPTQSAIREDLSLSLAEYSVFGSILTFGAMIGAITIGPITDLLGRKGALRVSSAF  116

Query  523  CLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  702
            C+AGWLAI+F+K A  +DIGRLA GYGMG FSYVVPVFIAEIAPK LRG LT +NQLMI 
Sbjct  117  CVAGWLAIYFSKEAWSLDIGRLANGYGMGAFSYVVPVFIAEIAPKNLRGRLTAINQLMIC  176

Query  703  TGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             GVSV+F++G +V+WR LAL G++PC V   GL  I
Sbjct  177  CGVSVSFILGVLVSWRALALIGLIPCAVNIFGLFFI  212



>ref|XP_008340870.1| PREDICTED: sugar transporter ERD6-like 16 [Malus domestica]
Length=496

 Score =   270 bits (690),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 139/226 (62%), Positives = 174/226 (77%), Gaps = 19/226 (8%)
 Frame = +1

Query  184  MAAGQ--DIENGKNEGSTAG---MAAPLIGKED--------DSKTDRW----MVYLSTFV  312
            MA G+  D+E+G  EG+  G   +  PL+ K+D        D  +D+     MV +STFV
Sbjct  1    MAXGECRDVESG--EGNNLGDLDLKQPLVIKKDKIFAHEDGDQGSDKSGSIGMVLVSTFV  58

Query  313  AVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGR  492
            AVCGS  FGSC GYS+PTQSAI +DLN S+A++S+FGSILT G M GA+TSG  ADF+GR
Sbjct  59   AVCGSFEFGSCVGYSAPTQSAIREDLNLSLAQFSMFGSILTIGGMLGAVTSGRTADFLGR  118

Query  493  KGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGA  672
            KGAMRMS+ FC+ GWLAI+F+KGAL +D+GR  TG+G+GVFSYVVP+FIAEI PK LRG 
Sbjct  119  KGAMRMSASFCITGWLAIYFSKGALSLDVGRFFTGFGIGVFSYVVPIFIAEIXPKNLRGG  178

Query  673  LTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            LTTLNQLMIVTG SV+FVIGT+++W TLALTGI+PC+ L +GLC +
Sbjct  179  LTTLNQLMIVTGSSVSFVIGTIISWETLALTGIIPCIFLLVGLCFV  224



>ref|XP_004292610.1| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
Length=491

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 162/215 (75%), Gaps = 10/215 (5%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDS------KTDRWMVYLSTFVAVCGSCAFGSC  345
            MA  +D+EN   E     +  PL+    +       K D+ MVYLSTFVAVCGS  FG C
Sbjct  1    MAIKEDVENVVQEN----IREPLMRGGREGSGRGGSKEDQGMVYLSTFVAVCGSYEFGCC  56

Query  346  AGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFC  525
             GYSSPTQSAI++DLN S +EYSLFGSILTFGAM GAIT GPI DF+GRKGA+RMS  FC
Sbjct  57   LGYSSPTQSAITEDLNLSTSEYSLFGSILTFGAMIGAITIGPITDFIGRKGALRMSCAFC  116

Query  526  LAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVT  705
            + GWLAI+FA+GA  +DIGRLATGYGMG FSYVVP+FI+EIAPK LRG LT L QLMIV+
Sbjct  117  VVGWLAIYFAEGAWALDIGRLATGYGMGAFSYVVPIFISEIAPKNLRGRLTALTQLMIVS  176

Query  706  GVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            G+SV+F++G +V+WR LAL G++PC V   GL  I
Sbjct  177  GISVSFIVGLVVSWRALALIGLIPCAVTLFGLFFI  211



>ref|XP_010242562.1| PREDICTED: sugar transporter ERD6-like 7 [Nelumbo nucifera]
Length=497

 Score =   269 bits (688),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 167/218 (77%), Gaps = 23/218 (11%)
 Frame = +1

Query  196  QDIENGK-NEGSTAGMAAPLIGK---------------EDDSKT----DR---WMVYLST  306
            +D+E G+ N+  +  +A PLIG+               ED+SK     DR   WMV LST
Sbjct  6    EDVEVGQSNDDRSDEIAEPLIGRQHKTTPPTTEEDQDQEDESKRKSYDDRGSLWMVLLST  65

Query  307  FVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFV  486
            F+AV GS  FGSC GYS+PTQS I+ DL  S+AEYS+FGSI   GAM GA+TSG +ADF+
Sbjct  66   FIAVAGSFEFGSCVGYSAPTQSEITDDLGLSLAEYSVFGSIGNIGAMVGAVTSGRVADFI  125

Query  487  GRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELR  666
            GRKGAMR+SSVFC+AGWLA++F+KGA+ +DIGR+ TGYGMGVFSYVVPVFIAEIAPK LR
Sbjct  126  GRKGAMRVSSVFCIAGWLAVYFSKGAVSLDIGRVCTGYGMGVFSYVVPVFIAEIAPKNLR  185

Query  667  GALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPC  780
            GAL T+NQLMIV GVSV F+IGT+V+WRTLAL GI+PC
Sbjct  186  GALATMNQLMIVGGVSVTFIIGTLVSWRTLALIGIIPC  223



>emb|CDX92578.1| BnaA10g16170D [Brassica napus]
Length=485

 Score =   269 bits (687),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 164/213 (77%), Gaps = 8/213 (4%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGK---EDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAG  351
            +D+E G+      G+  PL+ K   +DD +        +MV  STFVAVCGS  FGSC G
Sbjct  7    KDVERGEIVSRVEGLGHPLLKKVADQDDVEESEINESYFMVLFSTFVAVCGSFEFGSCVG  66

Query  352  YSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLA  531
            YS+PTQS+I QDLN S+AE+S+FGSILT GAM GA+ SG I+D  GRKGAMR S+ FC+ 
Sbjct  67   YSAPTQSSIRQDLNLSLAEFSMFGSILTIGAMLGAVMSGHISDLTGRKGAMRTSACFCIT  126

Query  532  GWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGV  711
            GWLA+FF+K AL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRGALTTLNQLMIV G 
Sbjct  127  GWLAVFFSKSALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGALTTLNQLMIVIGS  186

Query  712  SVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            SV+F+IG++++W+ LALTG+ PC+VL  GLC I
Sbjct  187  SVSFLIGSLISWKILALTGLAPCIVLLFGLCFI  219



>ref|XP_009120937.1| PREDICTED: sugar transporter ERD6-like 16 [Brassica rapa]
Length=485

 Score =   269 bits (687),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 164/213 (77%), Gaps = 8/213 (4%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGK---EDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAG  351
            +D+E G+      G+  PL+ K   +DD +        +MV  STFVAVCGS  FGSC G
Sbjct  7    KDVERGEIVSRVEGLGNPLLKKVADQDDVEESEINESYFMVLFSTFVAVCGSFEFGSCVG  66

Query  352  YSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLA  531
            YS+PTQS+I QDLN S+AE+S+FGSILT GAM GA+ SG I+D  GRKGAMR S+ FC+ 
Sbjct  67   YSAPTQSSIRQDLNLSLAEFSMFGSILTIGAMLGAVMSGHISDLTGRKGAMRTSACFCIT  126

Query  532  GWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGV  711
            GWLA+FF+K AL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRGALTTLNQLMIV G 
Sbjct  127  GWLAVFFSKSALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGALTTLNQLMIVIGS  186

Query  712  SVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            SV+F+IG++++W+ LALTG+ PC+VL  GLC I
Sbjct  187  SVSFLIGSLISWKILALTGLAPCIVLLFGLCFI  219



>ref|XP_002320384.1| sugar transporter family protein [Populus trichocarpa]
 gb|EEE98699.1| sugar transporter family protein [Populus trichocarpa]
Length=436

 Score =   267 bits (683),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MVYLSTFVAV GS   GSC+GYSSPTQ+AI +DL+ SIAEYSLFGSILT GAM GAITSG
Sbjct  1    MVYLSTFVAVAGSFEVGSCSGYSSPTQNAIREDLSLSIAEYSLFGSILTVGAMIGAITSG  60

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
            PIAD++GRKGAMR SS  C AGWLAI+FAKGAL +DIGRLATGYGMG  S+VVPVFIAEI
Sbjct  61   PIADYIGRKGAMRFSSTSCAAGWLAIYFAKGALALDIGRLATGYGMGALSFVVPVFIAEI  120

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            APK LRG LT + QLM+ TGVSVAF+IGT++ WR LALTG++PCV+L +GL +I
Sbjct  121  APKNLRGTLTAVTQLMVATGVSVAFIIGTVLRWRVLALTGLIPCVILHVGLFLI  174



>ref|XP_008458507.1| PREDICTED: sugar transporter ERD6-like 16 [Cucumis melo]
 ref|XP_008458508.1| PREDICTED: sugar transporter ERD6-like 16 [Cucumis melo]
 ref|XP_008458509.1| PREDICTED: sugar transporter ERD6-like 16 [Cucumis melo]
Length=494

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 164/214 (77%), Gaps = 9/214 (4%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKED---------DSKTDRWMVYLSTFVAVCGSCAFGSCA  348
            ++ ENG+N G  A   + L+   D          S++  WMV + T VAVCGS  FGSC 
Sbjct  8    KNFENGENNGLQALEESLLVSSSDCEGCEKAVKKSESSLWMVLICTLVAVCGSFEFGSCV  67

Query  349  GYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCL  528
            GYS+PTQS I ++L+ S+ +YS+FGSILT GAM GA+TSGPIADF+GRKGAMR+S+ FC+
Sbjct  68   GYSAPTQSVIREELHLSLPQYSMFGSILTIGAMVGAVTSGPIADFIGRKGAMRVSATFCI  127

Query  529  AGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTG  708
             GWLA++ + GAL +D GR+ TGYG+GVFSYVVPVFIAEIAPK LRG LTTLNQLMIVTG
Sbjct  128  TGWLAVYLSTGALSLDSGRVLTGYGIGVFSYVVPVFIAEIAPKNLRGGLTTLNQLMIVTG  187

Query  709  VSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             S++F++GT++TWR LALTGI+PCV L +GL  +
Sbjct  188  ASISFLLGTVITWRNLALTGIIPCVFLIVGLWFV  221



>ref|XP_010420662.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Camelina 
sativa]
Length=483

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 161/211 (76%), Gaps = 6/211 (3%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSS  360
            +D+E G        +  P +  +DD K         MV  STFVAVCGS  FGSC GYS+
Sbjct  7    KDVERGDIANKVEDLGKPFLTDQDDEKESEVNESYLMVIFSTFVAVCGSFEFGSCVGYSA  66

Query  361  PTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWL  540
            PTQS+I QDLN S+AE+S+FGSILT GAM GA+ SG ++DF GRKGAMR S+ FC+ GW+
Sbjct  67   PTQSSIRQDLNLSLAEFSMFGSILTIGAMIGAVMSGKVSDFSGRKGAMRTSACFCITGWV  126

Query  541  AIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  720
            A+FF+KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G SV+
Sbjct  127  AVFFSKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKHLRGGLTTLNQLMIVIGSSVS  186

Query  721  FVIGTMVTWRTLALT-GIVPCVVLGLGLCII  810
            F+IG++++W+TLALT G+ PC+VL  GLC I
Sbjct  187  FLIGSLISWKTLALTEGLAPCIVLLFGLCFI  217



>gb|KCW58966.1| hypothetical protein EUGRSUZ_H01593 [Eucalyptus grandis]
Length=261

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MVY + FVAVCGS  FG+CAGYSSPTQ AI ++L+ S AEYS+FGSILTFGAM GAIT G
Sbjct  1    MVYFTPFVAVCGSYEFGTCAGYSSPTQDAIVEELSLSTAEYSVFGSILTFGAMIGAITGG  60

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
            PIADFVGRK  MR++S  C+AGWLAI+FA+GAL +DIGRLATGYGMGVFSYVVP+FIAEI
Sbjct  61   PIADFVGRKWTMRIASALCVAGWLAIYFAEGALALDIGRLATGYGMGVFSYVVPIFIAEI  120

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             PK LRGALT +NQLMI+  VSV+F+IGT++ WR LAL G++PCVVL  GL  I
Sbjct  121  TPKNLRGALTAVNQLMIIARVSVSFIIGTVLAWRVLALIGLIPCVVLLFGLFFI  174



>ref|XP_002871845.1| hypothetical protein ARALYDRAFT_488771 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48104.1| hypothetical protein ARALYDRAFT_488771 [Arabidopsis lyrata subsp. 
lyrata]
Length=483

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 161/211 (76%), Gaps = 6/211 (3%)
 Frame = +1

Query  196  QDIENGK-NEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYS  357
            +D E G+       G+  P +  +DD K         MV  STFVAVCGS  FGSC GYS
Sbjct  7    KDEERGEIVHKVEEGLGKPFLTHQDDEKESENNESYLMVLFSTFVAVCGSFEFGSCVGYS  66

Query  358  SPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGW  537
            +PTQS+I QDLN S+AE+S+FGSILT GAM GA+ SG I+DF GRKGAMR S+ FC+ GW
Sbjct  67   APTQSSIRQDLNLSLAEFSMFGSILTIGAMLGAVMSGKISDFSGRKGAMRTSACFCITGW  126

Query  538  LAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSV  717
            LA+FF+KGAL++D+GR  TG+G+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G SV
Sbjct  127  LAVFFSKGALLLDVGRFFTGFGIGVFSYVVPVYIAEISPKNLRGGLTTLNQLMIVIGSSV  186

Query  718  AFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            +F+IG++++W+ LALTG+ PC+VL  GLC I
Sbjct  187  SFLIGSLISWKALALTGLAPCIVLFFGLCFI  217



>ref|XP_010107672.1| Sugar transporter ERD6-like 7 [Morus notabilis]
 gb|EXC16583.1| Sugar transporter ERD6-like 7 [Morus notabilis]
Length=448

 Score =   266 bits (679),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 152/194 (78%), Gaps = 6/194 (3%)
 Frame = +1

Query  247  PLIGKEDDS------KTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAE  408
            PL+  ED S      K + WMVYLSTFVAVCGS  FG+CAGYSSPTQSAI +DLN S+A+
Sbjct  14   PLMAVEDGSSAHEYSKDNPWMVYLSTFVAVCGSYEFGTCAGYSSPTQSAIREDLNLSLAD  73

Query  409  YSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRL  588
            YSLFGSILTFGAM GAITSG IAD +GRKGAMR+ + FC+ GWL+I+FAK AL +DIGRL
Sbjct  74   YSLFGSILTFGAMIGAITSGTIADLIGRKGAMRVYTAFCVTGWLSIYFAKEALALDIGRL  133

Query  589  ATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTG  768
            ATGYGMG FSYVVPVFIAEIAPK LRG LT   + M   GVSV+F+IG ++TWR LAL  
Sbjct  134  ATGYGMGAFSYVVPVFIAEIAPKNLRGLLTASTEFMNCAGVSVSFIIGNVLTWRALALVA  193

Query  769  IVPCVVLGLGLCII  810
            ++PC VL  GL  I
Sbjct  194  LIPCAVLLFGLSFI  207



>ref|XP_006400440.1| hypothetical protein EUTSA_v10013389mg [Eutrema salsugineum]
 gb|ESQ41893.1| hypothetical protein EUTSA_v10013389mg [Eutrema salsugineum]
Length=487

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 162/215 (75%), Gaps = 10/215 (5%)
 Frame = +1

Query  196  QDIENGKNE---GSTAGMAAPLIGKEDDSKTDR-------WMVYLSTFVAVCGSCAFGSC  345
            +D+E G+N         +  PL+ K  D   ++        MV  STFVAVCGS  FGSC
Sbjct  7    KDVERGENREIVNKVEDLKNPLLKKVADHDGEKSEINESYLMVLFSTFVAVCGSFEFGSC  66

Query  346  AGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFC  525
             GYS+PTQS+I  DLN S+AE+S+FGSILT GAM GA+ SG I+D  GRKGAMR S+ FC
Sbjct  67   VGYSAPTQSSIRHDLNLSLAEFSMFGSILTIGAMLGAVMSGQISDLTGRKGAMRTSACFC  126

Query  526  LAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVT  705
            + GWLA+FF+KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV 
Sbjct  127  ITGWLAVFFSKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGGLTTLNQLMIVI  186

Query  706  GVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            G SV+F+IG++++W+TLALTG+ PC+VL  GLC I
Sbjct  187  GSSVSFMIGSLISWKTLALTGLAPCIVLLFGLCFI  221



>gb|AJU57223.1| sugar transporter ERD6-like 16 [Camellia sinensis]
Length=490

 Score =   266 bits (681),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 167/217 (77%), Gaps = 13/217 (6%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLI------GKEDDS------KTDRWMVYLSTFVAVCGSCAFG  339
            +DIENG ++G    +  PLI        EDD+      K    MV LST VAVCGS  FG
Sbjct  7    KDIENGDSDG-IEDLGKPLIENKKVVDSEDDNSDLGDQKGSNAMVLLSTAVAVCGSFEFG  65

Query  340  SCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSV  519
            SC GYS+PTQSAI +DLN S+ EYS+FGSILT GAM GAI+SG I+DF GRK AMR+S+ 
Sbjct  66   SCVGYSAPTQSAIREDLNLSLPEYSMFGSILTIGAMIGAISSGRISDFFGRKTAMRLSAA  125

Query  520  FCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMI  699
            FC+ GWLA++F+ GAL++D+GR  TGYG+G+FS+VVPVFIAEIAPK LRG LTTLNQLMI
Sbjct  126  FCITGWLAVYFSMGALLLDVGRFFTGYGIGIFSFVVPVFIAEIAPKNLRGGLTTLNQLMI  185

Query  700  VTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            V G S+AF++GT++TWR+LALTG++PCVVL LGL  I
Sbjct  186  VAGSSLAFLMGTVITWRSLALTGLLPCVVLLLGLFFI  222



>ref|XP_008386586.1| PREDICTED: sugar transporter ERD6-like 7 [Malus domestica]
Length=478

 Score =   266 bits (680),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 159/213 (75%), Gaps = 10/213 (5%)
 Frame = +1

Query  202  IENGKNEGSTAGMAAPLI----------GKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAG  351
            IE+     +   M  PL+               +K D+WMVYLSTFVAVCGS  FG   G
Sbjct  3    IEDLSKNAAWEEMREPLVRAVQAADGDGSGHGSAKGDQWMVYLSTFVAVCGSYEFGCGVG  62

Query  352  YSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLA  531
            YSSPTQS I +DL  S+AEYS+FGSILTFGAM GAIT GPI DF+GRKGA+RMS VFC+A
Sbjct  63   YSSPTQSGIMKDLGLSLAEYSMFGSILTFGAMIGAITIGPITDFLGRKGALRMSCVFCVA  122

Query  532  GWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGV  711
            GWLAI+F+KGA+ +D+GR+ATGYG G FSY+VPVF+AEIAPK LRG LT +NQLMIV+GV
Sbjct  123  GWLAIYFSKGAVSLDVGRVATGYGSGAFSYIVPVFVAEIAPKNLRGRLTAVNQLMIVSGV  182

Query  712  SVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            SV+F+IG +V WR LAL GIVPC V+  GL  I
Sbjct  183  SVSFIIGVVVHWRALALIGIVPCAVIIFGLFFI  215



>gb|KGN46180.1| hypothetical protein Csa_6G067380 [Cucumis sativus]
Length=458

 Score =   265 bits (677),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 163/215 (76%), Gaps = 10/215 (5%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDD----------SKTDRWMVYLSTFVAVCGSCAFGSC  345
            +  ENG + G  A   + L+    D          S++  WMV++ T VAVCGS  FGSC
Sbjct  7    KSFENGDSNGLQALEESLLVSHSSDCEGCEKAVKRSESSLWMVFICTLVAVCGSFEFGSC  66

Query  346  AGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFC  525
             GYS+PTQS I ++L+ S+ +YS+FGSILT GAM GA+TSGPIADF+GRKGAMR+S+ FC
Sbjct  67   VGYSAPTQSVIREELHLSLPQYSMFGSILTIGAMVGAVTSGPIADFIGRKGAMRVSATFC  126

Query  526  LAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVT  705
            + GWLA++ + GAL +D GR+ TGYG+GVFSYVVPVFIAEIAPK LRG LTTLNQLMIVT
Sbjct  127  ITGWLAVYLSTGALSLDSGRVLTGYGIGVFSYVVPVFIAEIAPKNLRGGLTTLNQLMIVT  186

Query  706  GVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            G S++F++GT++TWR LALTGI+PCV L +GL  +
Sbjct  187  GASISFLLGTVITWRNLALTGIIPCVFLIVGLWFV  221



>ref|XP_008386585.1| PREDICTED: sugar transporter ERD6-like 7 [Malus domestica]
Length=476

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 159/210 (76%), Gaps = 8/210 (4%)
 Frame = +1

Query  205  ENGKNEGSTAGMAAPLI--------GKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSS  360
            EN + +     +  PL+        G++  S+ D+WMVYLSTFVAVCGS  FGSC GYSS
Sbjct  5    ENVERDVQKEEVREPLMRVVENKMDGEDGSSRGDQWMVYLSTFVAVCGSFEFGSCVGYSS  64

Query  361  PTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWL  540
            PTQSAI +DL  ++AE+S+FGSILTFGAM GAIT GPI DF+GRKGA+R+S  FC+ GWL
Sbjct  65   PTQSAIREDLGLTLAEFSVFGSILTFGAMIGAITIGPITDFLGRKGALRVSCAFCVVGWL  124

Query  541  AIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  720
            AI+F+KG L +DIGRLA+GYGMG FSYVVPVF+AEIAPK LRG LT +NQLMI  G  ++
Sbjct  125  AIYFSKGVLSLDIGRLASGYGMGAFSYVVPVFVAEIAPKHLRGRLTAVNQLMICIGGXMS  184

Query  721  FVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            F+ G +V+WR LAL GIVPC V  LGL  I
Sbjct  185  FIFGVVVSWRDLALIGIVPCAVTILGLFFI  214



>ref|XP_006419727.1| hypothetical protein CICLE_v10004839mg [Citrus clementina]
 ref|XP_006419728.1| hypothetical protein CICLE_v10004839mg [Citrus clementina]
 gb|ESR32967.1| hypothetical protein CICLE_v10004839mg [Citrus clementina]
 gb|ESR32968.1| hypothetical protein CICLE_v10004839mg [Citrus clementina]
Length=399

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 168/225 (75%), Gaps = 16/225 (7%)
 Frame = +1

Query  184  MAAG--QDIENGKNE-GSTAGMAAPLIGKE---------DDSKTDRW----MVYLSTFVA  315
            MA G  +D+ENG+        +  P I KE         DD + +      MV LSTFVA
Sbjct  1    MAIGHCKDVENGEIVINGLEDLEEPFIQKEGKVVSYQDEDDDQENNGGSVGMVLLSTFVA  60

Query  316  VCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRK  495
            VC S  FGSC GYS+PTQSA+  DL+ S+AE+S FGSILT GAM GAITSG IAD VGRK
Sbjct  61   VCASFEFGSCVGYSAPTQSAVRDDLHLSLAEFSTFGSILTIGAMLGAITSGRIADIVGRK  120

Query  496  GAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGAL  675
            GAMR+S+ FC+ GWLA++F+ G+L++DIGR  TGYG+GVFSYVVP+FIAEIAP+ LRG L
Sbjct  121  GAMRISACFCITGWLAVYFSNGSLLLDIGRFFTGYGIGVFSYVVPIFIAEIAPRNLRGLL  180

Query  676  TTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            TTLNQL+IVTG SVA++IG+++ WR LALTG+VPCV+L +GLC +
Sbjct  181  TTLNQLLIVTGSSVAYIIGSIIPWRILALTGLVPCVLLLVGLCFV  225



>ref|XP_004153836.1| PREDICTED: sugar transporter ERD6-like 16 [Cucumis sativus]
 ref|XP_011656657.1| PREDICTED: sugar transporter ERD6-like 16 [Cucumis sativus]
Length=494

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 163/215 (76%), Gaps = 10/215 (5%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDD----------SKTDRWMVYLSTFVAVCGSCAFGSC  345
            +  ENG + G  A   + L+    D          S++  WMV++ T VAVCGS  FGSC
Sbjct  7    KSFENGDSNGLQALEESLLVSHSSDCEGCEKAVKRSESSLWMVFICTLVAVCGSFEFGSC  66

Query  346  AGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFC  525
             GYS+PTQS I ++L+ S+ +YS+FGSILT GAM GA+TSGPIADF+GRKGAMR+S+ FC
Sbjct  67   VGYSAPTQSVIREELHLSLPQYSMFGSILTIGAMVGAVTSGPIADFIGRKGAMRVSATFC  126

Query  526  LAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVT  705
            + GWLA++ + GAL +D GR+ TGYG+GVFSYVVPVFIAEIAPK LRG LTTLNQLMIVT
Sbjct  127  ITGWLAVYLSTGALSLDSGRVLTGYGIGVFSYVVPVFIAEIAPKNLRGGLTTLNQLMIVT  186

Query  706  GVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            G S++F++GT++TWR LALTGI+PCV L +GL  +
Sbjct  187  GASISFLLGTVITWRNLALTGIIPCVFLIVGLWFV  221



>ref|XP_011011018.1| PREDICTED: sugar transporter ERD6-like 16 [Populus euphratica]
Length=488

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 159/205 (78%), Gaps = 14/205 (7%)
 Frame = +1

Query  238  MAAPLIGKE------DDSKTDR--------WMVYLSTFVAVCGSCAFGSCAGYSSPTQSA  375
            +  PLI +E      DD +TD          MV L TFVAVCGS  FGSC GYS+PTQSA
Sbjct  20   LEKPLILEEKIVVINDDYETDHDQESTGSIGMVLLCTFVAVCGSFEFGSCVGYSAPTQSA  79

Query  376  ISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFA  555
            I +DL  SIAEYS+FGSILT GAM GAITSG IADF+GRKGAMR+S+ FC+ GWLA+FF+
Sbjct  80   IREDLTLSIAEYSMFGSILTIGAMFGAITSGRIADFIGRKGAMRLSACFCITGWLAVFFS  139

Query  556  KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGT  735
             G   +D+GR+ TGYG+GVFSYVVP+FIAEIAPK LRG LTTLNQLMIVTG S AF+IG+
Sbjct  140  GGPFSLDVGRILTGYGIGVFSYVVPIFIAEIAPKNLRGGLTTLNQLMIVTGSSTAFLIGS  199

Query  736  MVTWRTLALTGIVPCVVLGLGLCII  810
            ++TWR LALTG+VPC+ L +GLC +
Sbjct  200  VITWRGLALTGLVPCIFLLVGLCFV  224



>gb|KHN45387.1| Sugar transporter ERD6-like 7 [Glycine soja]
Length=437

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MVY +TFVAVCGS  FG+CAGYSSPTQ AI +D + S+AEYSLFGSILTFGAM GAITSG
Sbjct  1    MVYFTTFVAVCGSYEFGACAGYSSPTQDAIRKDFSLSLAEYSLFGSILTFGAMVGAITSG  60

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
            PIADF+GRKGAMR+SS FC+AGWL I+FA+G + +DIGRL+TGYGMGVFSYVVPVF+AEI
Sbjct  61   PIADFIGRKGAMRVSSAFCVAGWLVIYFAEGPVYLDIGRLSTGYGMGVFSYVVPVFVAEI  120

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            APKELRG LTTLNQ MI   VSV+F IG + +WR LA+ G++P  VL LGL  I
Sbjct  121  APKELRGTLTTLNQFMITAAVSVSFTIGNVFSWRVLAIIGLIPTAVLLLGLFFI  174



>ref|XP_009352178.1| PREDICTED: sugar transporter ERD6-like 16 [Pyrus x bretschneideri]
Length=496

 Score =   264 bits (674),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 136/226 (60%), Positives = 173/226 (77%), Gaps = 19/226 (8%)
 Frame = +1

Query  184  MAAGQ--DIENGKNEGSTAG---MAAPLIGKED--------DSKTDRW----MVYLSTFV  312
            MA G+  D+E+G  EG+  G   +  PL+ K+D        D  +D+     MV +STFV
Sbjct  1    MAIGECRDVESG--EGNNLGDLDLNQPLVIKKDKIFAHEDGDQGSDKSGSIGMVLVSTFV  58

Query  313  AVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGR  492
            AVCGS  FGSC GYS+PTQS I +DLN S+A++S+FGSILT G M GA+TSG  ADF+GR
Sbjct  59   AVCGSFEFGSCVGYSAPTQSGIREDLNLSLAQFSMFGSILTIGGMLGAVTSGRTADFLGR  118

Query  493  KGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGA  672
            KGAMRMS+ FC+ GWLAI+F+KGAL +D+GR  TG+G+GVFSYVVP+FIAEIAPK LRG 
Sbjct  119  KGAMRMSASFCITGWLAIYFSKGALSLDVGRFFTGFGIGVFSYVVPIFIAEIAPKNLRGG  178

Query  673  LTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            LTTLNQLMIVTG SV+F+IGT+++W TLAL+ I+PC+ L +GLC +
Sbjct  179  LTTLNQLMIVTGSSVSFMIGTIISWETLALSEIIPCIFLLVGLCFV  224



>ref|XP_010649814.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Vitis vinifera]
Length=474

 Score =   263 bits (672),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 165/220 (75%), Gaps = 19/220 (9%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLI-----------GKEDDSKTDR-------WMVYLSTFVAVC  321
            +D+E G   G    +  PL+           G E D  + +       WMV LSTFVAVC
Sbjct  7    EDVEKGGKNG-LEDLKKPLVQGEKIIVSNELGCETDGSSSQNGSDGSIWMVLLSTFVAVC  65

Query  322  GSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGA  501
            GS  FGSC GYS+PTQSAI +DL+ S+AEYS+FGSILT GAM GAITSG + D +GRKGA
Sbjct  66   GSFEFGSCVGYSAPTQSAIREDLDLSLAEYSMFGSILTIGAMLGAITSGLVTDSLGRKGA  125

Query  502  MRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTT  681
            MRMS+ FC+ GWLA++F+ GAL++D+GR  TGYG+G+FSYVVP+FIAEIAPK +RG LTT
Sbjct  126  MRMSASFCITGWLAVYFSMGALLLDMGRFFTGYGIGIFSYVVPIFIAEIAPKSIRGGLTT  185

Query  682  LNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGL  801
            LNQLMIV G SVAF++GT+ TWRTLALTG+VPC+VL +GL
Sbjct  186  LNQLMIVCGSSVAFLLGTVTTWRTLALTGLVPCLVLLIGL  225



>ref|XP_002516838.1| sugar transporter, putative [Ricinus communis]
 gb|EEF45452.1| sugar transporter, putative [Ricinus communis]
Length=516

 Score =   264 bits (675),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 168/219 (77%), Gaps = 11/219 (5%)
 Frame = +1

Query  184  MAAGQ--DIENGKNEGSTAGMAAPLIGKE--------DDSKTDRWMVYLSTFVAVCGSCA  333
            MA GQ  DIE G+       +  PLI +E        ++      MV LSTFVAVCGS  
Sbjct  1    MAIGQCKDIEQGEIN-DLQDLERPLIHEEKAVSFKNDEEENGSMNMVLLSTFVAVCGSFE  59

Query  334  FGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMS  513
            FGSC GYS+PTQSAI +DL+ + A+YS+FGSILT GAM GA+TSG I+D++GRKGAMRMS
Sbjct  60   FGSCVGYSAPTQSAIMEDLSLTTAQYSMFGSILTIGAMIGAVTSGRISDYIGRKGAMRMS  119

Query  514  SVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQL  693
            ++FC+ GWLA+FF++G L +D+GRL TGYG+GVFS+VVP+FIAEIAPK LRG LTTLNQL
Sbjct  120  AIFCITGWLAVFFSRGYLSLDMGRLFTGYGIGVFSFVVPIFIAEIAPKNLRGGLTTLNQL  179

Query  694  MIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            MIVTG S AF+IG++++WR LALTG+VPC+ L +GL  +
Sbjct  180  MIVTGSSTAFLIGSVISWRILALTGLVPCIFLLVGLVFV  218



>ref|XP_002278197.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Vitis vinifera]
Length=492

 Score =   263 bits (672),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 165/220 (75%), Gaps = 19/220 (9%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLI-----------GKEDDSKTDR-------WMVYLSTFVAVC  321
            +D+E G   G    +  PL+           G E D  + +       WMV LSTFVAVC
Sbjct  7    EDVEKGGKNG-LEDLKKPLVQGEKIIVSNELGCETDGSSSQNGSDGSIWMVLLSTFVAVC  65

Query  322  GSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGA  501
            GS  FGSC GYS+PTQSAI +DL+ S+AEYS+FGSILT GAM GAITSG + D +GRKGA
Sbjct  66   GSFEFGSCVGYSAPTQSAIREDLDLSLAEYSMFGSILTIGAMLGAITSGLVTDSLGRKGA  125

Query  502  MRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTT  681
            MRMS+ FC+ GWLA++F+ GAL++D+GR  TGYG+G+FSYVVP+FIAEIAPK +RG LTT
Sbjct  126  MRMSASFCITGWLAVYFSMGALLLDMGRFFTGYGIGIFSYVVPIFIAEIAPKSIRGGLTT  185

Query  682  LNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGL  801
            LNQLMIV G SVAF++GT+ TWRTLALTG+VPC+VL +GL
Sbjct  186  LNQLMIVCGSSVAFLLGTVTTWRTLALTGLVPCLVLLIGL  225



>emb|CAN63855.1| hypothetical protein VITISV_008852 [Vitis vinifera]
Length=561

 Score =   265 bits (677),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 165/220 (75%), Gaps = 19/220 (9%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLI-----------GKEDDSKTDR-------WMVYLSTFVAVC  321
            +D+E G   G    +  PL+           G E D  + +       WMV LSTFVAVC
Sbjct  7    EDVEKGGKNG-LEDLKKPLVQGEKIIVSNELGCETDGSSSQNGSDGSIWMVLLSTFVAVC  65

Query  322  GSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGA  501
            GS  FGSC GYS+PTQSAI +DL+ S+AEYS+FGSILT GAM GAITSG + D +GRKGA
Sbjct  66   GSFEFGSCVGYSAPTQSAIREDLDLSLAEYSMFGSILTIGAMLGAITSGLVTDSLGRKGA  125

Query  502  MRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTT  681
            MRMS+ FC+ GWLA++F+ GAL++D+GR  TGYG+G+FSYVVP+FIAEIAPK +RG LTT
Sbjct  126  MRMSASFCITGWLAVYFSMGALLLDMGRFFTGYGIGIFSYVVPIFIAEIAPKSIRGGLTT  185

Query  682  LNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGL  801
            LNQLMIV G SVAF++GT+ TWRTLALTG+VPC+VL +GL
Sbjct  186  LNQLMIVCGSSVAFLLGTVTTWRTLALTGLVPCLVLLIGL  225



>ref|XP_010546910.1| PREDICTED: sugar transporter ERD6-like 16 [Tarenaya hassleriana]
Length=494

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 164/214 (77%), Gaps = 10/214 (5%)
 Frame = +1

Query  199  DIENGKNE-GSTAGMAAPLIGKEDDSKTDRW---------MVYLSTFVAVCGSCAFGSCA  348
            +I NG  +      MAA  + ++D+S  +           MV LSTFVAVCGS  FGSC 
Sbjct  13   EIANGAEDLEKPLMMAAKKVVEDDESSVEIEEEQRNGSVSMVLLSTFVAVCGSFEFGSCV  72

Query  349  GYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCL  528
            GYS+PTQSAI QDL+ S+AE+S+FGS+LT GAM GA+TSG I+DF GRKGAMR S+ FC+
Sbjct  73   GYSAPTQSAIRQDLHLSLAEFSMFGSVLTIGAMLGAVTSGRISDFSGRKGAMRTSACFCI  132

Query  529  AGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTG  708
             GWLA+FF+K A+++DIGR  TGYG+GVFSY VPV+IAEI+PK LRG LTTLNQLMIV G
Sbjct  133  TGWLAVFFSKEAMLLDIGRFFTGYGIGVFSYAVPVYIAEISPKNLRGGLTTLNQLMIVIG  192

Query  709  VSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             SV+FVIG ++TW+TLALTG+VPC+VL  GLC +
Sbjct  193  SSVSFVIGALITWKTLALTGLVPCLVLLFGLCFV  226



>ref|XP_006419729.1| hypothetical protein CICLE_v10004839mg [Citrus clementina]
 ref|XP_006489198.1| PREDICTED: sugar transporter ERD6-like 16-like [Citrus sinensis]
 gb|ESR32969.1| hypothetical protein CICLE_v10004839mg [Citrus clementina]
Length=490

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 168/225 (75%), Gaps = 16/225 (7%)
 Frame = +1

Query  184  MAAG--QDIENGKNE-GSTAGMAAPLIGKE---------DDSKTDRW----MVYLSTFVA  315
            MA G  +D+ENG+        +  P I KE         DD + +      MV LSTFVA
Sbjct  1    MAIGHCKDVENGEIVINGLEDLEEPFIQKEGKVVSYQDEDDDQENNGGSVGMVLLSTFVA  60

Query  316  VCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRK  495
            VC S  FGSC GYS+PTQSA+  DL+ S+AE+S FGSILT GAM GAITSG IAD VGRK
Sbjct  61   VCASFEFGSCVGYSAPTQSAVRDDLHLSLAEFSTFGSILTIGAMLGAITSGRIADIVGRK  120

Query  496  GAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGAL  675
            GAMR+S+ FC+ GWLA++F+ G+L++DIGR  TGYG+GVFSYVVP+FIAEIAP+ LRG L
Sbjct  121  GAMRISACFCITGWLAVYFSNGSLLLDIGRFFTGYGIGVFSYVVPIFIAEIAPRNLRGLL  180

Query  676  TTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            TTLNQL+IVTG SVA++IG+++ WR LALTG+VPCV+L +GLC +
Sbjct  181  TTLNQLLIVTGSSVAYIIGSIIPWRILALTGLVPCVLLLVGLCFV  225



>ref|XP_011651013.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Cucumis 
sativus]
Length=455

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 165/208 (79%), Gaps = 6/208 (3%)
 Frame = +1

Query  196  QDIENGKNEG---STAGMAAPLIGKEDD---SKTDRWMVYLSTFVAVCGSCAFGSCAGYS  357
            ++IENG ++     T  +     G E+D   S+    M+YLSTFVAVCGS  FGSC GYS
Sbjct  7    REIENGDDDDGNLETQLLMKRKEGLEEDEVCSRRSNDMLYLSTFVAVCGSFQFGSCVGYS  66

Query  358  SPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGW  537
            +P ++AI +DLN S+++YS+FGSILT GAM GAI+SG IAD++GRKGAMRMS+ FC+ GW
Sbjct  67   APAEAAIREDLNLSLSQYSMFGSILTIGAMFGAISSGRIADYIGRKGAMRMSACFCILGW  126

Query  538  LAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSV  717
            +AI+ +K  +++DIGRL TGYG+GVFSYVVP+FIAE+APK LRG LTTLNQL+IV G SV
Sbjct  127  VAIYLSKEPILLDIGRLLTGYGIGVFSYVVPIFIAELAPKNLRGGLTTLNQLLIVMGASV  186

Query  718  AFVIGTMVTWRTLALTGIVPCVVLGLGL  801
            AF++GT+VTWRTLALTG++PC  L +GL
Sbjct  187  AFILGTIVTWRTLALTGLIPCFTLLVGL  214



>gb|KFK26120.1| hypothetical protein AALP_AA8G206400 [Arabis alpina]
Length=485

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 164/213 (77%), Gaps = 8/213 (4%)
 Frame = +1

Query  196  QDIENGKNEGSTA-GMAAPLIGKEDDSK-------TDRWMVYLSTFVAVCGSCAFGSCAG  351
            +D+E G+        +  PL+  +DD +           MV  STFVAVCGS  FGSC G
Sbjct  7    KDVERGEIANKVVEDLEKPLLKNQDDDEEEESEICESYLMVLFSTFVAVCGSFEFGSCVG  66

Query  352  YSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLA  531
            YS+PTQS+I QDL  S+AE+S+FGSILT GAM GA+ SG I+DF GRKGAMR S+ FC+ 
Sbjct  67   YSAPTQSSIRQDLQLSLAEFSMFGSILTIGAMLGAVMSGKISDFSGRKGAMRTSACFCIT  126

Query  532  GWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGV  711
            GWLA+FF+KGAL++D+GR  TGYG+GVFSYVVPV+IAEI+PK LRG LTTLNQLMIV G 
Sbjct  127  GWLAVFFSKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGGLTTLNQLMIVIGS  186

Query  712  SVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            SV+F+IG++++W+TLALTG+VPC+VL LGLC I
Sbjct  187  SVSFMIGSLISWKTLALTGLVPCIVLLLGLCFI  219



>ref|XP_004134178.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Cucumis 
sativus]
 gb|KGN57056.1| hypothetical protein Csa_3G150850 [Cucumis sativus]
Length=482

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 165/208 (79%), Gaps = 6/208 (3%)
 Frame = +1

Query  196  QDIENGKNEG---STAGMAAPLIGKEDD---SKTDRWMVYLSTFVAVCGSCAFGSCAGYS  357
            ++IENG ++     T  +     G E+D   S+    M+YLSTFVAVCGS  FGSC GYS
Sbjct  7    REIENGDDDDGNLETQLLMKRKEGLEEDEVCSRRSNDMLYLSTFVAVCGSFQFGSCVGYS  66

Query  358  SPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGW  537
            +P ++AI +DLN S+++YS+FGSILT GAM GAI+SG IAD++GRKGAMRMS+ FC+ GW
Sbjct  67   APAEAAIREDLNLSLSQYSMFGSILTIGAMFGAISSGRIADYIGRKGAMRMSACFCILGW  126

Query  538  LAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSV  717
            +AI+ +K  +++DIGRL TGYG+GVFSYVVP+FIAE+APK LRG LTTLNQL+IV G SV
Sbjct  127  VAIYLSKEPILLDIGRLLTGYGIGVFSYVVPIFIAELAPKNLRGGLTTLNQLLIVMGASV  186

Query  718  AFVIGTMVTWRTLALTGIVPCVVLGLGL  801
            AF++GT+VTWRTLALTG++PC  L +GL
Sbjct  187  AFILGTIVTWRTLALTGLIPCFTLLVGL  214



>emb|CDO98940.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   261 bits (666),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 168/215 (78%), Gaps = 13/215 (6%)
 Frame = +1

Query  196  QDIENGKNEGST-AGMAAPLI--GK----EDDS-KTDRW-----MVYLSTFVAVCGSCAF  336
            +DIENG +  +    +  P I  GK    ED S + D+      MV LST VAVCGS  F
Sbjct  7    KDIENGISHNNILEDLEKPFIQNGKMVVSEDSSPEADKENGSIAMVLLSTCVAVCGSFEF  66

Query  337  GSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSS  516
            GSC GYS+PTQSAI +DLN S+AE+S+FGSILT GAM G ITSG IADFVGRKGAMR+S+
Sbjct  67   GSCVGYSAPTQSAIREDLNLSLAEFSMFGSILTIGAMIGGITSGRIADFVGRKGAMRISA  126

Query  517  VFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLM  696
            VFC+ GWLA++F+ GAL++D GR  TGYG+G+FSY VPVFIAEIAPK LRG L T+NQLM
Sbjct  127  VFCVIGWLAVYFSTGALILDFGRFCTGYGIGIFSYAVPVFIAEIAPKNLRGGLATINQLM  186

Query  697  IVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGL  801
            IV+G SVA+++GT+V+W+TLALTGI+PC+VL +GL
Sbjct  187  IVSGSSVAYLLGTVVSWQTLALTGILPCIVLFVGL  221



>ref|XP_010105671.1| Sugar transporter ERD6-like 16 [Morus notabilis]
 gb|EXC05702.1| Sugar transporter ERD6-like 16 [Morus notabilis]
Length=439

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 163/216 (75%), Gaps = 22/216 (10%)
 Frame = +1

Query  184  MAAGQ--DIENGK-NEGSTAGMAAPLIGKE-------DDSKTD------------RWMVY  297
            MA GQ  DIENG+    S   +  P I ++       +D ++D             WMV 
Sbjct  1    MAIGQCKDIENGEIRNNSLEDLEQPFIMQDKSSVIAYEDEESDCTSTISADQNGSIWMVL  60

Query  298  LSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIA  477
            LSTFVAVCGS  FGSC G+S+PTQSAI +DLN S+A+YS+FGSILT GAM GA+TSG IA
Sbjct  61   LSTFVAVCGSFEFGSCVGFSAPTQSAIREDLNLSLAQYSMFGSILTIGAMLGAVTSGRIA  120

Query  478  DFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPK  657
            DF+GRKGAMR+S+ FC+ GWLA+FFAKGA  +D+GR  TG+G+G+FSYVVP+F+AEIAPK
Sbjct  121  DFIGRKGAMRLSAGFCITGWLAVFFAKGASSLDMGRFFTGFGIGIFSYVVPIFVAEIAPK  180

Query  658  ELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALT  765
             LRG LTTLNQLMIVTG S+AFVIGT+++WR+LALT
Sbjct  181  NLRGGLTTLNQLMIVTGASLAFVIGTVISWRSLALT  216



>ref|XP_011090877.1| PREDICTED: sugar transporter ERD6-like 16 [Sesamum indicum]
Length=484

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 164/214 (77%), Gaps = 9/214 (4%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGK-----EDDSKTDRW----MVYLSTFVAVCGSCAFGSCA  348
            +D+ENG + G    +  P I +      D+  T++     MV LST VAVCGS  FGSC 
Sbjct  7    RDVENGLDVGHHHELEKPFIQQPKCVDSDEETTNKNGSIGMVLLSTCVAVCGSFEFGSCV  66

Query  349  GYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCL  528
            GYSSPTQSAI QDLN SI+++S+FGSI+T GAM GAITSG IADF+GRKGAMR+S+VFC+
Sbjct  67   GYSSPTQSAIRQDLNLSISQFSMFGSIITIGAMFGAITSGRIADFIGRKGAMRLSAVFCI  126

Query  529  AGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTG  708
             GWLA++F+  A  +D+GR  TG+G+G+FS+VVPVFIAEIAPK LRG L TLNQLMIV G
Sbjct  127  TGWLAVYFSNEAWSLDVGRFCTGFGIGIFSFVVPVFIAEIAPKNLRGGLATLNQLMIVCG  186

Query  709  VSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             S+A+++GT+VTWR LALTG++PC +L +GL  I
Sbjct  187  SSIAYILGTVVTWRALALTGLLPCFLLLVGLFFI  220



>ref|XP_009774897.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Nicotiana 
sylvestris]
Length=488

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 162/214 (76%), Gaps = 12/214 (6%)
 Frame = +1

Query  196  QDIENG---------KNEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCA  348
            +DIENG         +N          LI KE++S     MV LST VAVCGS  FGSC 
Sbjct  7    KDIENGLENLEQPFLENAKIVDSEDEELISKENESIG---MVLLSTCVAVCGSFEFGSCV  63

Query  349  GYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCL  528
            GYS+PTQS I  DLN ++A+YS+FGSI+T GAM GAITSG IADF+GRKGAMRMS++FC+
Sbjct  64   GYSAPTQSEIRNDLNLTLAQYSIFGSIITIGAMIGAITSGRIADFIGRKGAMRMSAIFCI  123

Query  529  AGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTG  708
             GWLA++F+ G L +D+GR  TG+G+G+FSYVVPVFIAEIAPK+LRG LTT+NQLMIV G
Sbjct  124  TGWLAVYFSMGTLTLDVGRFLTGFGIGIFSYVVPVFIAEIAPKDLRGGLTTINQLMIVCG  183

Query  709  VSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             SVA+++GT+++WR LALTGI+PC  L +GL  I
Sbjct  184  ASVAYLLGTVISWRNLALTGILPCTFLLVGLFFI  217



>ref|XP_006356995.1| PREDICTED: sugar transporter ERD6-like 16-like [Solanum tuberosum]
 ref|XP_006358532.1| PREDICTED: sugar transporter ERD6-like 16-like [Solanum tuberosum]
Length=472

 Score =   258 bits (659),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +1

Query  265  DDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGA  444
            ++     WMV LST VAVCGS  FGSC GYS+PTQS I  DLN ++A+YS+FGSI+T GA
Sbjct  27   ENEDGSIWMVLLSTCVAVCGSFEFGSCVGYSAPTQSEIRNDLNLTLAQYSMFGSIITIGA  86

Query  445  MAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYV  624
            M GAITSG IADF+GRKGAMRMS++FC+ GWLA++F+ G LV+D+GR  TGYG+G+FSYV
Sbjct  87   MIGAITSGRIADFIGRKGAMRMSAIFCITGWLAVYFSMGTLVLDMGRFLTGYGIGIFSYV  146

Query  625  VPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLC  804
            VPV+IAEIAPK LRG LTT+NQLMIV G SVA+++GT++TWR LALTGI+PC  L +GL 
Sbjct  147  VPVYIAEIAPKNLRGGLTTINQLMIVCGSSVAYLLGTVITWRNLALTGILPCTFLLVGLL  206

Query  805  II  810
             I
Sbjct  207  FI  208



>ref|XP_004229493.1| PREDICTED: sugar transporter ERD6-like 16 [Solanum lycopersicum]
Length=468

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = +1

Query  265  DDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGA  444
            ++     WMV LST VAVCGS  FGSC GYS+PTQS I  DLN ++AEYS+FGSI+T GA
Sbjct  23   ENEDGSIWMVLLSTCVAVCGSFEFGSCVGYSAPTQSQIRNDLNLTLAEYSMFGSIITIGA  82

Query  445  MAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYV  624
            M GA+TSG IADF+GRKGAMRMS++FC+ GWLA++F+ G LV+D+GR  TGYG+G+FSYV
Sbjct  83   MIGAVTSGRIADFIGRKGAMRMSAIFCITGWLAVYFSMGTLVLDMGRFLTGYGIGIFSYV  142

Query  625  VPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLC  804
            VPV+IAEIAPK LRG LTT+NQLMIV G S A+++GT++TWR LALTGI+PC  L +GL 
Sbjct  143  VPVYIAEIAPKNLRGGLTTINQLMIVCGSSAAYLLGTIITWRNLALTGILPCTFLLVGLL  202

Query  805  II  810
             I
Sbjct  203  FI  204



>emb|CBI26138.3| unnamed protein product [Vitis vinifera]
 gb|ADP37170.1| putative ERD6-like transporter [Vitis vinifera]
Length=438

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MV LSTFVAVCGS  FGSC GYS+PTQSAI +DL+ S+AEYS+FGSILT GAM GAITSG
Sbjct  1    MVLLSTFVAVCGSFEFGSCVGYSAPTQSAIREDLDLSLAEYSMFGSILTIGAMLGAITSG  60

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
             + D +GRKGAMRMS+ FC+ GWLA++F+ GAL++D+GR  TGYG+G+FSYVVP+FIAEI
Sbjct  61   LVTDSLGRKGAMRMSASFCITGWLAVYFSMGALLLDMGRFFTGYGIGIFSYVVPIFIAEI  120

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGL  801
            APK +RG LTTLNQLMIV G SVAF++GT+ TWRTLALTG+VPC+VL +GL
Sbjct  121  APKSIRGGLTTLNQLMIVCGSSVAFLLGTVTTWRTLALTGLVPCLVLLIGL  171



>ref|XP_009603614.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Nicotiana 
tomentosiformis]
Length=481

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 162/211 (77%), Gaps = 6/211 (3%)
 Frame = +1

Query  196  QDIENG-KNEGSTAGMAAPLIGKEDDSKTDRW-----MVYLSTFVAVCGSCAFGSCAGYS  357
            +DIENG +N        A ++  ED+    +      MV LST VAVCGS  FGSC GYS
Sbjct  7    KDIENGLENLEQPFLENAKIVDSEDEELISKENGSIGMVLLSTCVAVCGSFEFGSCVGYS  66

Query  358  SPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGW  537
            +PTQ+ I  DLN ++A+YS+FGSI+T GAM GAITSG IADF+GRKGAMRMS++FC+ GW
Sbjct  67   APTQAEIRNDLNLTLAQYSIFGSIITIGAMIGAITSGRIADFIGRKGAMRMSAIFCITGW  126

Query  538  LAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSV  717
            LA++F+ G L +D+GR  TG+G+G+FSYVVPVFIAEIAPK+LRG LTT+NQLMIV G SV
Sbjct  127  LAVYFSMGTLTLDVGRFLTGFGIGIFSYVVPVFIAEIAPKDLRGGLTTINQLMIVCGASV  186

Query  718  AFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            A+++GT+++WR LALTGI+PC  L +GL  I
Sbjct  187  AYLLGTVISWRNLALTGILPCTFLLVGLFFI  217



>ref|XP_008223079.1| PREDICTED: sugar transporter ERD6-like 16 [Prunus mume]
Length=490

 Score =   256 bits (653),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 158/221 (71%), Gaps = 12/221 (5%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGK------EDDSKTDRW------MVYLSTFVAVCGS  327
            M  G+D+E G+   +   +  P I +      EDD     +      MV LST VAVCGS
Sbjct  1    MEQGKDVERGETSSNQEELEQPFIRRRKVVAHEDDGSGKEFQSESISMVLLSTGVAVCGS  60

Query  328  CAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMR  507
              FG C GYS+PTQSAI +DLN S+AEYS+FGSIL+ GA+ GAITSG IADF+GRKGAMR
Sbjct  61   FQFGICVGYSAPTQSAIRKDLNLSLAEYSMFGSILSIGAVLGAITSGKIADFLGRKGAMR  120

Query  508  MSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLN  687
            +SSV C+  WLAI+F++GAL +D GR  TGYG+  FSYVVPVFIAEIAPK LRG L TLN
Sbjct  121  VSSVICIVAWLAIYFSQGALSLDTGRFLTGYGIAAFSYVVPVFIAEIAPKNLRGGLATLN  180

Query  688  QLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            Q+ IVTG S AF++GT++ WR LAL   VPC++L LG+C +
Sbjct  181  QVFIVTGGSFAFIVGTIINWRALALIATVPCLILLLGVCFV  221



>ref|XP_007226898.1| hypothetical protein PRUPE_ppa016361mg [Prunus persica]
 gb|EMJ28097.1| hypothetical protein PRUPE_ppa016361mg [Prunus persica]
Length=490

 Score =   255 bits (652),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 157/221 (71%), Gaps = 12/221 (5%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGK------EDDSKTDRW------MVYLSTFVAVCGS  327
            M  G+D+E G+   +   +  P I +      EDD            MV LST VAVCGS
Sbjct  1    MEQGKDVERGETSSNQEELEQPFIRRRKVVAHEDDGSGKELQNESIGMVLLSTGVAVCGS  60

Query  328  CAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMR  507
              FG C GYS+PTQSAI +DLN S+AEYS FGSIL+ GA+ GAITSG IADF+GRKGAMR
Sbjct  61   FQFGICVGYSAPTQSAIRKDLNLSLAEYSTFGSILSIGAVLGAITSGKIADFLGRKGAMR  120

Query  508  MSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLN  687
            +SSV C+  WLAI+F++GAL +D GR  TGYG+  FSYVVPVFIAEIAPK LRG L TLN
Sbjct  121  VSSVICIIAWLAIYFSQGALSLDTGRFLTGYGIAAFSYVVPVFIAEIAPKNLRGGLATLN  180

Query  688  QLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            QL IVTG S AF++GT++ WR LAL   VPC++L LG+C++
Sbjct  181  QLFIVTGGSFAFIVGTIINWRALALIATVPCLILLLGVCLV  221



>gb|KJB72535.1| hypothetical protein B456_011G183500 [Gossypium raimondii]
Length=462

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  259  KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  438
            K  D     +MV LSTFVAV G+  FG+C GYS+PTQ+AI +DL  S+AE+++FGSILT 
Sbjct  33   KSSDENGSIFMVLLSTFVAVFGAFEFGTCVGYSAPTQAAIREDLGLSLAEFAMFGSILTI  92

Query  439  GAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFS  618
            GAM GA+TSG IAD +GRKGAMR+S+VFC+AGWLA++F+K  + +D+GR ATGYG+G+FS
Sbjct  93   GAMFGAVTSGRIADTIGRKGAMRLSAVFCIAGWLAVYFSKSGVSLDLGRFATGYGIGIFS  152

Query  619  YVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLG  798
            YVVP+FIAEIAPK LRG LTTLNQL+IV G S AF+IGT+++WR LAL G++PC+VL +G
Sbjct  153  YVVPIFIAEIAPKNLRGGLTTLNQLLIVIGQSTAFLIGTVISWRELALAGLLPCIVLFVG  212

Query  799  LCII  810
            LC I
Sbjct  213  LCFI  216



>ref|XP_007050737.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOX94894.1| Major facilitator superfamily protein [Theobroma cacao]
Length=484

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 164/221 (74%), Gaps = 13/221 (6%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDRW------------MVYLSTFVAVCGS  327
            MA  QD+ENG++    A M  PL+        DR             +V+LSTFVAV GS
Sbjct  1    MAINQDVENGESS-VKAKMKEPLLQHTSIKDGDRKFHNECNRKGLLKVVFLSTFVAVLGS  59

Query  328  CAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMR  507
              FGSC GYS+P QSAI++DL+ S+AE+S+FGSIL  G+M GAITSG IA+F+GRKGAMR
Sbjct  60   YEFGSCMGYSAPVQSAITKDLDLSVAEFSVFGSILNVGSMIGAITSGRIAEFLGRKGAMR  119

Query  508  MSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLN  687
            +SS F + GW+AI+F+KGAL +DIGR  +GYG+G+F+YVVP+++AEIAPK+LRG L TLN
Sbjct  120  ISSAFSITGWIAIYFSKGALSLDIGRFLSGYGIGIFAYVVPIYVAEIAPKDLRGGLATLN  179

Query  688  QLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            QLMIV G SVAF+ GT++ WR LALTGI+PC+V  +GL  I
Sbjct  180  QLMIVIGASVAFLAGTVLKWRLLALTGIIPCLVQLVGLIFI  220



>gb|KJB72537.1| hypothetical protein B456_011G183500 [Gossypium raimondii]
Length=467

 Score =   253 bits (646),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  259  KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  438
            K  D     +MV LSTFVAV G+  FG+C GYS+PTQ+AI +DL  S+AE+++FGSILT 
Sbjct  33   KSSDENGSIFMVLLSTFVAVFGAFEFGTCVGYSAPTQAAIREDLGLSLAEFAMFGSILTI  92

Query  439  GAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFS  618
            GAM GA+TSG IAD +GRKGAMR+S+VFC+AGWLA++F+K  + +D+GR ATGYG+G+FS
Sbjct  93   GAMFGAVTSGRIADTIGRKGAMRLSAVFCIAGWLAVYFSKSGVSLDLGRFATGYGIGIFS  152

Query  619  YVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLG  798
            YVVP+FIAEIAPK LRG LTTLNQL+IV G S AF+IGT+++WR LAL G++PC+VL +G
Sbjct  153  YVVPIFIAEIAPKNLRGGLTTLNQLLIVIGQSTAFLIGTVISWRELALAGLLPCIVLFVG  212

Query  799  LCII  810
            LC I
Sbjct  213  LCFI  216



>gb|KJB72536.1| hypothetical protein B456_011G183500 [Gossypium raimondii]
Length=482

 Score =   253 bits (647),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  259  KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  438
            K  D     +MV LSTFVAV G+  FG+C GYS+PTQ+AI +DL  S+AE+++FGSILT 
Sbjct  33   KSSDENGSIFMVLLSTFVAVFGAFEFGTCVGYSAPTQAAIREDLGLSLAEFAMFGSILTI  92

Query  439  GAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFS  618
            GAM GA+TSG IAD +GRKGAMR+S+VFC+AGWLA++F+K  + +D+GR ATGYG+G+FS
Sbjct  93   GAMFGAVTSGRIADTIGRKGAMRLSAVFCIAGWLAVYFSKSGVSLDLGRFATGYGIGIFS  152

Query  619  YVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLG  798
            YVVP+FIAEIAPK LRG LTTLNQL+IV G S AF+IGT+++WR LAL G++PC+VL +G
Sbjct  153  YVVPIFIAEIAPKNLRGGLTTLNQLLIVIGQSTAFLIGTVISWRELALAGLLPCIVLFVG  212

Query  799  LCII  810
            LC I
Sbjct  213  LCFI  216



>ref|XP_008438775.1| PREDICTED: sugar transporter ERD6-like 16 isoform X3 [Cucumis 
melo]
Length=465

 Score =   252 bits (644),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 164/216 (76%), Gaps = 17/216 (8%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKED--------------DSKTDRWMVYLSTFVAVCGSCA  333
            ++IENG ++G+   +   L+ K +               S+    M+YLST VAVCGS  
Sbjct  7    KEIENGDDDGN---LETQLLMKREEGLEEDEEEEEEEVSSRRCNHMLYLSTSVAVCGSFQ  63

Query  334  FGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMS  513
            FGSC GYS+P ++AI +DLN S+++YS+FGSILT GAM GAITSG IAD++GRK AMRMS
Sbjct  64   FGSCVGYSAPVEAAIREDLNLSLSQYSMFGSILTIGAMFGAITSGRIADYIGRKQAMRMS  123

Query  514  SVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQL  693
            + FC+ GW+AIF +K ++++DIGRL TGYG+GVFSYVVP+FIAEIAPK LRG LTTLNQL
Sbjct  124  ACFCILGWIAIFLSKESVLLDIGRLLTGYGIGVFSYVVPIFIAEIAPKNLRGGLTTLNQL  183

Query  694  MIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGL  801
            +IV G SVAF++GT+VTWRTLALTG++P   L +GL
Sbjct  184  LIVMGASVAFILGTVVTWRTLALTGLIPSFTLLVGL  219



>ref|XP_008438773.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Cucumis 
melo]
Length=496

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 164/216 (76%), Gaps = 17/216 (8%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKED--------------DSKTDRWMVYLSTFVAVCGSCA  333
            ++IENG ++G+   +   L+ K +               S+    M+YLST VAVCGS  
Sbjct  7    KEIENGDDDGN---LETQLLMKREEGLEEDEEEEEEEVSSRRCNHMLYLSTSVAVCGSFQ  63

Query  334  FGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMS  513
            FGSC GYS+P ++AI +DLN S+++YS+FGSILT GAM GAITSG IAD++GRK AMRMS
Sbjct  64   FGSCVGYSAPVEAAIREDLNLSLSQYSMFGSILTIGAMFGAITSGRIADYIGRKQAMRMS  123

Query  514  SVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQL  693
            + FC+ GW+AIF +K ++++DIGRL TGYG+GVFSYVVP+FIAEIAPK LRG LTTLNQL
Sbjct  124  ACFCILGWIAIFLSKESVLLDIGRLLTGYGIGVFSYVVPIFIAEIAPKNLRGGLTTLNQL  183

Query  694  MIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGL  801
            +IV G SVAF++GT+VTWRTLALTG++P   L +GL
Sbjct  184  LIVMGASVAFILGTVVTWRTLALTGLIPSFTLLVGL  219



>gb|KEH32265.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=435

 Score =   250 bits (638),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 159/219 (73%), Gaps = 15/219 (7%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDSKTDRW--------------MVYLSTFVAVCGSCA  333
            +D+E+G +E +   +  P I    D+  D                MV LSTFVAVCGS +
Sbjct  7    KDVESG-HENTHRDLQEPFIQHGKDATVDYHDIESNKRAENGSIGMVLLSTFVAVCGSFS  65

Query  334  FGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMS  513
            FG+C GYSSPTQ+AI  DLN SI+E+S+FGS++T GAM GAITSG I DF+GRKGAMR+S
Sbjct  66   FGTCVGYSSPTQAAIRADLNLSISEFSMFGSLVTIGAMLGAITSGRITDFIGRKGAMRLS  125

Query  514  SVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQL  693
            + FC+ GWLA+FF+K    +DIGR  TGYG+GV SYVVPV+IAEIAPK LRG L T NQL
Sbjct  126  TGFCITGWLAVFFSKDPYSLDIGRFFTGYGIGVISYVVPVYIAEIAPKNLRGGLATTNQL  185

Query  694  MIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            MIV G SV+F++G++++WR LAL G++PC+ L +GLC I
Sbjct  186  MIVIGASVSFLLGSVLSWRKLALAGLLPCLSLLIGLCFI  224



>gb|EYU43869.1| hypothetical protein MIMGU_mgv1a018596mg [Erythranthe guttata]
Length=480

 Score =   250 bits (639),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MV LST VAVCGS  FGSC GYSSPTQSAI +DLN S++++S+FGSI+T GAM GAITSG
Sbjct  43   MVLLSTCVAVCGSFEFGSCVGYSSPTQSAIREDLNLSLSQFSMFGSIITIGAMIGAITSG  102

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
             IADF+GRKGAMR+S++FC+ GWLA++F+  A ++DIGR  TGYG+G+FSYVVPVFIAEI
Sbjct  103  RIADFLGRKGAMRISAIFCIIGWLAVYFSTEAWLLDIGRFCTGYGIGIFSYVVPVFIAEI  162

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            APK LRG L TLNQLMIV G S A+++GT+VTWRTLALTG++PC+++ +GL  I
Sbjct  163  APKNLRGGLATLNQLMIVCGASTAYLLGTVVTWRTLALTGLLPCILILVGLFFI  216



>ref|XP_003609563.1| Sugar transporter ERD6-like protein [Medicago truncatula]
 gb|AES91760.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=490

 Score =   251 bits (640),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 159/219 (73%), Gaps = 15/219 (7%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDSKTDRW--------------MVYLSTFVAVCGSCA  333
            +D+E+G +E +   +  P I    D+  D                MV LSTFVAVCGS +
Sbjct  7    KDVESG-HENTHRDLQEPFIQHGKDATVDYHDIESNKRAENGSIGMVLLSTFVAVCGSFS  65

Query  334  FGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMS  513
            FG+C GYSSPTQ+AI  DLN SI+E+S+FGS++T GAM GAITSG I DF+GRKGAMR+S
Sbjct  66   FGTCVGYSSPTQAAIRADLNLSISEFSMFGSLVTIGAMLGAITSGRITDFIGRKGAMRLS  125

Query  514  SVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQL  693
            + FC+ GWLA+FF+K    +DIGR  TGYG+GV SYVVPV+IAEIAPK LRG L T NQL
Sbjct  126  TGFCITGWLAVFFSKDPYSLDIGRFFTGYGIGVISYVVPVYIAEIAPKNLRGGLATTNQL  185

Query  694  MIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            MIV G SV+F++G++++WR LAL G++PC+ L +GLC I
Sbjct  186  MIVIGASVSFLLGSVLSWRKLALAGLLPCLSLLIGLCFI  224



>gb|KEH36719.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=374

 Score =   247 bits (630),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 160/216 (74%), Gaps = 12/216 (6%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDS----KTDRWM-------VYLSTFVAVCGSCAFGS  342
            +DIENG+  G    +  P I +  D+     +D+ M       V LSTFVAVCGS +FG+
Sbjct  7    KDIENGETNGFQY-LQEPFIQQGKDACKEVGSDKSMENGSIGMVLLSTFVAVCGSFSFGT  65

Query  343  CAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVF  522
            C GYS+PTQ+AI  DLN S+AE+S+FGS++T GAM GAITSG + D +GRKGAMR+S+ F
Sbjct  66   CVGYSAPTQAAIRADLNLSLAEFSMFGSLVTIGAMLGAITSGRVTDIIGRKGAMRISTGF  125

Query  523  CLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  702
            C+ GWLA+FF+K +  +D+GR  TGYG+GV SYVVPV+IAEIAPK LRG L T NQLMIV
Sbjct  126  CIIGWLAVFFSKSSYTLDLGRFFTGYGIGVISYVVPVYIAEIAPKNLRGGLATTNQLMIV  185

Query  703  TGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             G S++F+IG+++ WR LAL G+VPC+ L +GLC I
Sbjct  186  IGSSMSFLIGSIINWRQLALAGLVPCICLLVGLCFI  221



>ref|XP_004508324.1| PREDICTED: sugar transporter ERD6-like 16-like [Cicer arietinum]
Length=488

 Score =   248 bits (634),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 162/219 (74%), Gaps = 15/219 (7%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLI--GKE-----DDSKTDRW-------MVYLSTFVAVCGSCA  333
            ++IE+G+  G    +  P I  GK+      D ++++        MV LSTFVAVCGS +
Sbjct  7    KEIESGEENG-VQNLQEPFIQHGKDGAVKCKDIESNQRVENGSIGMVLLSTFVAVCGSFS  65

Query  334  FGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMS  513
            FG+C GYSSPTQ+AI  DLN SI+E+S+FGS++T GAM GAITSG I DF+GRKGAMRMS
Sbjct  66   FGTCVGYSSPTQAAIRADLNLSISEFSMFGSLVTIGAMIGAITSGRITDFIGRKGAMRMS  125

Query  514  SVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQL  693
            + FC+ GWL IFF+K    +D+GR  TGYG+GV SYVVPV+IAEIAPK LRG L T NQL
Sbjct  126  TGFCITGWLTIFFSKDPYSLDMGRFFTGYGIGVISYVVPVYIAEIAPKNLRGGLATTNQL  185

Query  694  MIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            MIV G SV+F+IG++++WR LAL GIVPC+ L +GLC I
Sbjct  186  MIVIGASVSFLIGSILSWRELALAGIVPCIFLLIGLCFI  224



>ref|XP_010242565.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Nelumbo 
nucifera]
Length=458

 Score =   247 bits (630),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 154/215 (72%), Gaps = 27/215 (13%)
 Frame = +1

Query  184  MAAGQDIENGKNEGS-TAGMAAPLI-----GKEDDSKTDRWMVYLSTFVAVCGSCAFGSC  345
            MA  QD E  +N  S    +  PLI     G+    K   WMVY STFVAVCGS  FGSC
Sbjct  1    MAVDQDAEAAENIISIQQRIREPLIRNIEHGENKGGKEQVWMVYFSTFVAVCGSFEFGSC  60

Query  346  AGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFC  525
                                 YS+FGSILTFGAM GAITSGPIADF+GRKGAM MS+ FC
Sbjct  61   ---------------------YSVFGSILTFGAMIGAITSGPIADFIGRKGAMWMSAAFC  99

Query  526  LAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVT  705
              GWLAI+FA+GAL++DIGRL+TGYGMGVFSYVVPVFIAE+APK+LRG LTT+NQLMI +
Sbjct  100  TGGWLAIYFAEGALLLDIGRLSTGYGMGVFSYVVPVFIAEMAPKDLRGGLTTVNQLMICS  159

Query  706  GVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            GVSVA++IGT++TWR LALTG++PC +L LGL  I
Sbjct  160  GVSVAYIIGTVLTWRALALTGLIPCFILFLGLFFI  194



>gb|KEH36718.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=424

 Score =   246 bits (628),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 160/216 (74%), Gaps = 12/216 (6%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDS----KTDRWM-------VYLSTFVAVCGSCAFGS  342
            +DIENG+  G    +  P I +  D+     +D+ M       V LSTFVAVCGS +FG+
Sbjct  7    KDIENGETNGFQY-LQEPFIQQGKDACKEVGSDKSMENGSIGMVLLSTFVAVCGSFSFGT  65

Query  343  CAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVF  522
            C GYS+PTQ+AI  DLN S+AE+S+FGS++T GAM GAITSG + D +GRKGAMR+S+ F
Sbjct  66   CVGYSAPTQAAIRADLNLSLAEFSMFGSLVTIGAMLGAITSGRVTDIIGRKGAMRISTGF  125

Query  523  CLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  702
            C+ GWLA+FF+K +  +D+GR  TGYG+GV SYVVPV+IAEIAPK LRG L T NQLMIV
Sbjct  126  CIIGWLAVFFSKSSYTLDLGRFFTGYGIGVISYVVPVYIAEIAPKNLRGGLATTNQLMIV  185

Query  703  TGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             G S++F+IG+++ WR LAL G+VPC+ L +GLC I
Sbjct  186  IGSSMSFLIGSIINWRQLALAGLVPCICLLVGLCFI  221



>gb|KDP40049.1| hypothetical protein JCGZ_02047 [Jatropha curcas]
Length=490

 Score =   248 bits (632),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 165/227 (73%), Gaps = 19/227 (8%)
 Frame = +1

Query  184  MAAGQ--DIENGKNEGSTAGMAAPLIGKE--------DDSKTDRW--------MVYLSTF  309
            MA GQ  D+E G+       +  PL+ +E        ++ +TD          MV  STF
Sbjct  1    MAIGQYKDVEQGEIN-VLEDLKRPLVQEEKIISHKIKNNYQTDNEEETTGSIGMVLFSTF  59

Query  310  VAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVG  489
            VAVCGS  FGSC GYS+PTQSAI +DLN + ++YS+FGSILT GAM GAITSG IAD++G
Sbjct  60   VAVCGSFEFGSCVGYSAPTQSAIMEDLNLTASQYSMFGSILTIGAMLGAITSGRIADYIG  119

Query  490  RKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRG  669
            RKGAMRMS  FC+ GW+A+FF+K    +D+GR  TGYG+GVFS+V+P++IAEI+PK LRG
Sbjct  120  RKGAMRMSVGFCITGWVAVFFSKEYFSLDMGRFFTGYGIGVFSFVIPIYIAEISPKNLRG  179

Query  670  ALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             LTTLNQLMIVTG S AF++G++++W+ LALTG+VPC+ L +GL  I
Sbjct  180  GLTTLNQLMIVTGSSTAFLLGSVISWKALALTGLVPCIFLLVGLFFI  226



>gb|KEH36720.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=420

 Score =   246 bits (627),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 160/216 (74%), Gaps = 12/216 (6%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDS----KTDRWM-------VYLSTFVAVCGSCAFGS  342
            +DIENG+  G    +  P I +  D+     +D+ M       V LSTFVAVCGS +FG+
Sbjct  7    KDIENGETNGFQY-LQEPFIQQGKDACKEVGSDKSMENGSIGMVLLSTFVAVCGSFSFGT  65

Query  343  CAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVF  522
            C GYS+PTQ+AI  DLN S+AE+S+FGS++T GAM GAITSG + D +GRKGAMR+S+ F
Sbjct  66   CVGYSAPTQAAIRADLNLSLAEFSMFGSLVTIGAMLGAITSGRVTDIIGRKGAMRISTGF  125

Query  523  CLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  702
            C+ GWLA+FF+K +  +D+GR  TGYG+GV SYVVPV+IAEIAPK LRG L T NQLMIV
Sbjct  126  CIIGWLAVFFSKSSYTLDLGRFFTGYGIGVISYVVPVYIAEIAPKNLRGGLATTNQLMIV  185

Query  703  TGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             G S++F+IG+++ WR LAL G+VPC+ L +GLC I
Sbjct  186  IGSSMSFLIGSIINWRQLALAGLVPCICLLVGLCFI  221



>ref|XP_012069444.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Jatropha 
curcas]
Length=490

 Score =   248 bits (632),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 165/227 (73%), Gaps = 19/227 (8%)
 Frame = +1

Query  184  MAAGQ--DIENGKNEGSTAGMAAPLIGKE--------DDSKTDRW--------MVYLSTF  309
            MA GQ  D+E G+       +  PL+ +E        ++ +TD          MV  STF
Sbjct  1    MAIGQYKDVEQGEIN-VLEDLKRPLVQEEKIISHKIKNNYQTDNEEETTGSIGMVLFSTF  59

Query  310  VAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVG  489
            VAVCGS  FGSC GYS+PTQSAI +DLN + ++YS+FGSILT GAM GAITSG IAD++G
Sbjct  60   VAVCGSFEFGSCVGYSAPTQSAIMEDLNLTASQYSMFGSILTIGAMLGAITSGRIADYIG  119

Query  490  RKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRG  669
            RKGAMRMS  FC+ GW+A+FF+K    +D+GR  TGYG+GVFS+V+P++IAEI+PK LRG
Sbjct  120  RKGAMRMSVGFCITGWVAVFFSKEYFSLDMGRFFTGYGIGVFSFVIPIYIAEISPKNLRG  179

Query  670  ALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             LTTLNQLMIVTG S AF++G++++W+ LALTG+VPC+ L +GL  I
Sbjct  180  GLTTLNQLMIVTGSSTAFLLGSVISWKALALTGLVPCIFLLVGLFFI  226



>ref|XP_009419855.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 152/199 (76%), Gaps = 6/199 (3%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAA--PLIGKEDDSKTDR----WMVYLSTFVAVCGSCAFGSC  345
            MA  +D+ENG       G  A  PL+  + +S  D     WMV LST V VCGS  FGSC
Sbjct  1    MAITKDVENGVGMHDAQGNEARQPLLIHQKESSADSQGSIWMVLLSTAVVVCGSFEFGSC  60

Query  346  AGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFC  525
             GYS+PTQS I++D+  S++EYS+FGSILT GAM GA+TSG +ADF+GRKGAMR+S+V C
Sbjct  61   VGYSAPTQSGITKDIGLSLSEYSVFGSILTIGAMIGAVTSGHLADFIGRKGAMRVSAVIC  120

Query  526  LAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVT  705
            + GWLAI+FAKGA+++  GR+++GYG+GV SYVVPVFIAEIAPK LRG L TLNQL+I  
Sbjct  121  IIGWLAIYFAKGAVLLYFGRISSGYGIGVLSYVVPVFIAEIAPKNLRGGLATLNQLLICG  180

Query  706  GVSVAFVIGTMVTWRTLAL  762
            G SVAFVIGT+VTWRTL L
Sbjct  181  GHSVAFVIGTLVTWRTLVL  199



>ref|XP_009419854.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   246 bits (628),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 152/199 (76%), Gaps = 6/199 (3%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAA--PLIGKEDDSKTDR----WMVYLSTFVAVCGSCAFGSC  345
            MA  +D+ENG       G  A  PL+  + +S  D     WMV LST V VCGS  FGSC
Sbjct  1    MAITKDVENGVGMHDAQGNEARQPLLIHQKESSADSQGSIWMVLLSTAVVVCGSFEFGSC  60

Query  346  AGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFC  525
             GYS+PTQS I++D+  S++EYS+FGSILT GAM GA+TSG +ADF+GRKGAMR+S+V C
Sbjct  61   VGYSAPTQSGITKDIGLSLSEYSVFGSILTIGAMIGAVTSGHLADFIGRKGAMRVSAVIC  120

Query  526  LAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVT  705
            + GWLAI+FAKGA+++  GR+++GYG+GV SYVVPVFIAEIAPK LRG L TLNQL+I  
Sbjct  121  IIGWLAIYFAKGAVLLYFGRISSGYGIGVLSYVVPVFIAEIAPKNLRGGLATLNQLLICG  180

Query  706  GVSVAFVIGTMVTWRTLAL  762
            G SVAFVIGT+VTWRTL L
Sbjct  181  GHSVAFVIGTLVTWRTLVL  199



>ref|XP_006594463.1| PREDICTED: sugar transporter ERD6-like 16-like isoform X3 [Glycine 
max]
Length=564

 Score =   248 bits (633),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 164/227 (72%), Gaps = 12/227 (5%)
 Frame = +1

Query  163  KLIITRKMAAGQDIENGKNEGSTAGMAAPLIGKED----DSKTDRW-------MVYLSTF  309
            K I  R+M      EN K+  S   +  P I  E+    +  +D+        MV LST 
Sbjct  75   KSIAYRRMTCTNAKENHKDVES-GYLQEPFIQPEEVACKEVGSDKSVENGSIGMVLLSTL  133

Query  310  VAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVG  489
            VAVCGS  FG+C GYSSPTQ+AI +DL+ S+AE+S+FGS++T GAM GAITSG I DF+G
Sbjct  134  VAVCGSFTFGNCVGYSSPTQAAIREDLSLSLAEFSMFGSLVTIGAMLGAITSGRITDFIG  193

Query  490  RKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRG  669
            RKGAMR+S+ FC+ GWLA+FF+KG+  +D+GR  TGYG+G+ SYVVPV+IAEIAPK LRG
Sbjct  194  RKGAMRISTGFCITGWLAVFFSKGSYSLDLGRFFTGYGIGLISYVVPVYIAEIAPKNLRG  253

Query  670  ALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             L T NQL+IVTG SV+F++G+++ WR LAL G+VPC+ L +GLC I
Sbjct  254  GLATTNQLLIVTGASVSFLLGSVIHWRKLALAGLVPCICLLIGLCFI  300



>ref|XP_003594043.1| Sugar transporter ERD6-like protein [Medicago truncatula]
 gb|AES64294.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=485

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 160/216 (74%), Gaps = 12/216 (6%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDS----KTDRWM-------VYLSTFVAVCGSCAFGS  342
            +DIENG+  G    +  P I +  D+     +D+ M       V LSTFVAVCGS +FG+
Sbjct  7    KDIENGETNGFQY-LQEPFIQQGKDACKEVGSDKSMENGSIGMVLLSTFVAVCGSFSFGT  65

Query  343  CAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVF  522
            C GYS+PTQ+AI  DLN S+AE+S+FGS++T GAM GAITSG + D +GRKGAMR+S+ F
Sbjct  66   CVGYSAPTQAAIRADLNLSLAEFSMFGSLVTIGAMLGAITSGRVTDIIGRKGAMRISTGF  125

Query  523  CLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  702
            C+ GWLA+FF+K +  +D+GR  TGYG+GV SYVVPV+IAEIAPK LRG L T NQLMIV
Sbjct  126  CIIGWLAVFFSKSSYTLDLGRFFTGYGIGVISYVVPVYIAEIAPKNLRGGLATTNQLMIV  185

Query  703  TGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             G S++F+IG+++ WR LAL G+VPC+ L +GLC I
Sbjct  186  IGSSMSFLIGSIINWRQLALAGLVPCICLLVGLCFI  221



>ref|XP_007147846.1| hypothetical protein PHAVU_006G159600g [Phaseolus vulgaris]
 gb|ESW19840.1| hypothetical protein PHAVU_006G159600g [Phaseolus vulgaris]
Length=523

 Score =   246 bits (629),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 161/219 (74%), Gaps = 10/219 (5%)
 Frame = +1

Query  181  KMAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDRW---------MVYLSTFVAVCGSCA  333
            K  A +D+E+G+       +  P I  E+ +              MV LST VAVCGS  
Sbjct  42   KNMAIEDVESGEAT-KLQCLQEPFIQPEEAATYKEVGCAENGSIGMVLLSTLVAVCGSFT  100

Query  334  FGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMS  513
            FG+C GYS+PTQ+AI +DLN S+AE+S+FGS++T GAM GA+TSG I DF GRKGAMR+S
Sbjct  101  FGTCVGYSAPTQAAIREDLNLSLAEFSMFGSLVTIGAMLGAMTSGRITDFFGRKGAMRIS  160

Query  514  SVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQL  693
            + FC+AGWLA+FF+K +  +D+GR +TGYG+G+ SYVVP++IAEIAPK LRG L T+NQL
Sbjct  161  TGFCIAGWLAVFFSKSSCFLDLGRFSTGYGIGIISYVVPIYIAEIAPKNLRGGLATINQL  220

Query  694  MIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            +IVTG+SV+F IG+++ WR LAL G+VPC+ L +GLC I
Sbjct  221  LIVTGISVSFFIGSVINWRQLALAGLVPCICLVVGLCFI  259



>ref|XP_003547222.2| PREDICTED: sugar transporter ERD6-like 16-like [Glycine max]
Length=482

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MV+LST VAVCGS  FG+C GYS+PTQ+AI  DLN S+AE+S+FGS++T GAM GAITSG
Sbjct  43   MVFLSTLVAVCGSFTFGTCVGYSAPTQAAIRADLNLSLAEFSMFGSLVTIGAMLGAITSG  102

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
             I DF+GRKGAMR+S+ FC+ GWLA+FF+KG+  +D+GR  TGYG+GV SYVVPV+IAEI
Sbjct  103  RITDFIGRKGAMRISTGFCITGWLAVFFSKGSYSLDMGRFFTGYGIGVISYVVPVYIAEI  162

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            APK LRG L T NQL+IVTG SV+F++G+++ WR LAL G+VPC+ L +GLC I
Sbjct  163  APKNLRGGLATTNQLLIVTGGSVSFLLGSVINWRELALAGLVPCICLLVGLCFI  216



>ref|XP_010941736.1| PREDICTED: sugar transporter ERD6-like 16 [Elaeis guineensis]
Length=473

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 156/211 (74%), Gaps = 6/211 (3%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDS--KTDRWMVYLSTFVAVCGSCAFGSCAGYS  357
            M   +D+ + +  G       PL+  E+    K    MV +ST V+VCGS  FG C GYS
Sbjct  1    MGNSKDVVDREENG----FKEPLMHAEETRSCKESLCMVLVSTAVSVCGSFEFGVCVGYS  56

Query  358  SPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGW  537
            +PTQS I QDL  S++EYS+FGSI+T GAM GA+TSG I+DF GRKGAMRMS++ C+ GW
Sbjct  57   APTQSEIRQDLGLSLSEYSVFGSIVTIGAMIGAVTSGRISDFSGRKGAMRMSAIVCIIGW  116

Query  538  LAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSV  717
            L I+FA+GA  +D+GR+ TGYG GVFSYVVPVFIAEIAPK+LRG LTT+NQL+I  G+S+
Sbjct  117  LGIYFAEGAFSLDLGRILTGYGTGVFSYVVPVFIAEIAPKQLRGGLTTINQLLICGGLSL  176

Query  718  AFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             ++IGT+VTWRTL L G+VPC V+ +GL  I
Sbjct  177  CYIIGTLVTWRTLVLVGLVPCFVILVGLYFI  207



>gb|KHN33102.1| Sugar transporter ERD6-like 16 [Glycine soja]
Length=487

 Score =   244 bits (622),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MV+LST VAVCGS  FG+C GYS+PTQ+AI  DLN S+AE+S+FGS++T GAM GAITSG
Sbjct  43   MVFLSTLVAVCGSFTFGTCVGYSAPTQAAIRADLNLSLAEFSMFGSLVTIGAMLGAITSG  102

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
             I DF+GRKGAMR+S+ FC+ GWLA+FF+KG+  +D+GR  TGYG+GV SYVVPV+IAEI
Sbjct  103  RITDFIGRKGAMRISTGFCITGWLAVFFSKGSYSLDMGRFFTGYGIGVISYVVPVYIAEI  162

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            APK LRG L T NQL+IVTG SV+F++G+++ WR LAL G+VPC+ L +GLC I
Sbjct  163  APKNLRGGLATTNQLLIVTGGSVSFLLGSVINWRELALAGLVPCICLLVGLCFI  216



>gb|KHN37528.1| Sugar transporter ERD6-like 16 [Glycine soja]
Length=461

 Score =   243 bits (619),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 159/218 (73%), Gaps = 20/218 (9%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKED------DSKTDRW-------MVYLSTFVAVCGSCAF  336
            +D+E+G        +  P I  ED      ++ +D+        MV LST VAVCGS  F
Sbjct  7    EDVESGY-------LHEPFIQPEDAAAACKENGSDKSVKNGSIGMVLLSTLVAVCGSFTF  59

Query  337  GSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSS  516
            G+C GYS+PTQ+AI  DLN S+AE+S+FGS++T GAM GAITSG I DF+GRKGAMR+S+
Sbjct  60   GTCVGYSAPTQAAIRADLNLSLAEFSMFGSLVTIGAMLGAITSGRITDFIGRKGAMRIST  119

Query  517  VFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLM  696
             FC+ GW+A+FF+KG+  +D GR  TGYG+GV SYVVPV+IAEIAPK LRG L T NQL+
Sbjct  120  GFCITGWIAVFFSKGSYSLDFGRFFTGYGIGVISYVVPVYIAEIAPKNLRGGLATTNQLL  179

Query  697  IVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            IVTG SV+F++G+++ WR LAL G+VPC+ L +GLC I
Sbjct  180  IVTGGSVSFLLGSVINWRELALAGLVPCICLLVGLCFI  217



>ref|XP_011090879.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Sesamum 
indicum]
Length=337

 Score =   239 bits (609),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 157/209 (75%), Gaps = 9/209 (4%)
 Frame = +1

Query  202  IENGKNEGSTAGMAAPLIGKEDDSKTDR------WMVYLSTFVAVCGSCAFGSCAGYSSP  363
            IEN  +E     +  P   K  D + +       +MV LSTFVA+CGS  FG C GYSSP
Sbjct  3    IENASDELEKPFIQQP---KSADPEGESGQNGSIFMVLLSTFVAICGSFEFGICVGYSSP  59

Query  364  TQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLA  543
            TQS+I  DLN S++E+SLFGSI+T GAM G+ITSG IAD++GRKG+MR+++V C+AGW+A
Sbjct  60   TQSSIRHDLNLSLSEFSLFGSIITIGAMFGSITSGRIADYLGRKGSMRLAAVICIAGWVA  119

Query  544  IFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAF  723
            ++F+K A  +D+GR +TGYG+G+ S+VVPVFI EIAPK LRG L TLNQL+IV G S  +
Sbjct  120  VYFSKAAWSLDVGRFSTGYGIGLSSFVVPVFIGEIAPKHLRGGLATLNQLLIVCGSSFVY  179

Query  724  VIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            ++GT+VTWRTLALTG++P +++ +GL  I
Sbjct  180  IVGTIVTWRTLALTGLIPSILVLVGLFFI  208



>ref|XP_006594464.1| PREDICTED: sugar transporter ERD6-like 16-like isoform X4 [Glycine 
max]
 ref|XP_006594465.1| PREDICTED: sugar transporter ERD6-like 16-like isoform X5 [Glycine 
max]
Length=479

 Score =   243 bits (619),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MV LST VAVCGS  FG+C GYSSPTQ+AI +DL+ S+AE+S+FGS++T GAM GAITSG
Sbjct  42   MVLLSTLVAVCGSFTFGNCVGYSSPTQAAIREDLSLSLAEFSMFGSLVTIGAMLGAITSG  101

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
             I DF+GRKGAMR+S+ FC+ GWLA+FF+KG+  +D+GR  TGYG+G+ SYVVPV+IAEI
Sbjct  102  RITDFIGRKGAMRISTGFCITGWLAVFFSKGSYSLDLGRFFTGYGIGLISYVVPVYIAEI  161

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            APK LRG L T NQL+IVTG SV+F++G+++ WR LAL G+VPC+ L +GLC I
Sbjct  162  APKNLRGGLATTNQLLIVTGASVSFLLGSVIHWRKLALAGLVPCICLLIGLCFI  215



>ref|XP_003541648.2| PREDICTED: sugar transporter ERD6-like 16-like isoform X1 [Glycine 
max]
Length=500

 Score =   243 bits (621),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MV LST VAVCGS  FG+C GYSSPTQ+AI +DL+ S+AE+S+FGS++T GAM GAITSG
Sbjct  63   MVLLSTLVAVCGSFTFGNCVGYSSPTQAAIREDLSLSLAEFSMFGSLVTIGAMLGAITSG  122

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
             I DF+GRKGAMR+S+ FC+ GWLA+FF+KG+  +D+GR  TGYG+G+ SYVVPV+IAEI
Sbjct  123  RITDFIGRKGAMRISTGFCITGWLAVFFSKGSYSLDLGRFFTGYGIGLISYVVPVYIAEI  182

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            APK LRG L T NQL+IVTG SV+F++G+++ WR LAL G+VPC+ L +GLC I
Sbjct  183  APKNLRGGLATTNQLLIVTGASVSFLLGSVIHWRKLALAGLVPCICLLIGLCFI  236



>ref|XP_003541649.1| PREDICTED: sugar transporter ERD6-like 16-like [Glycine max]
Length=481

 Score =   242 bits (618),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 159/218 (73%), Gaps = 20/218 (9%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKED------DSKTDRW-------MVYLSTFVAVCGSCAF  336
            +D+E+G        +  P I  ED      ++ +D+        MV LST VAVCGS  F
Sbjct  7    EDVESGY-------LHEPFIQPEDAAAACKENGSDKSVKNGSIGMVLLSTLVAVCGSFTF  59

Query  337  GSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSS  516
            G+C GYS+PTQ+AI  DLN S+AE+S+FGS++T GAM GAITSG I DF+GRKGAMR+S+
Sbjct  60   GTCVGYSAPTQAAIRADLNLSLAEFSMFGSLVTIGAMLGAITSGRITDFIGRKGAMRIST  119

Query  517  VFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLM  696
             FC+ GW+A+FF+KG+  +D GR  TGYG+GV SYVVPV+IAEIAPK LRG L T NQL+
Sbjct  120  GFCITGWIAVFFSKGSYSLDFGRFFTGYGIGVISYVVPVYIAEIAPKNLRGGLATTNQLL  179

Query  697  IVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            IVTG SV+F++G+++ WR LAL G+VPC+ L +GLC I
Sbjct  180  IVTGGSVSFLLGSVINWRELALAGLVPCICLLVGLCFI  217



>ref|XP_010024484.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Eucalyptus 
grandis]
Length=440

 Score =   241 bits (615),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  349  GYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCL  528
            GYS+PTQSAI +DL  S+AEYS+FGSILT GAM GAITSG IADF+GRKGAMRMS++FC+
Sbjct  14   GYSAPTQSAIREDLGLSLAEYSMFGSILTIGAMLGAITSGRIADFIGRKGAMRMSAIFCI  73

Query  529  AGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTG  708
            AGWLA++F+ GA  +D+GR  TGYG+GVFSYVVP+FIAEIAPK LRG LTTLNQLMIV G
Sbjct  74   AGWLAVYFSNGASCLDMGRFFTGYGIGVFSYVVPIFIAEIAPKHLRGGLTTLNQLMIVVG  133

Query  709  VSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             SVAF+IGT+VTWRTLALTG+VPC+VL +GL +I
Sbjct  134  ASVAFLIGTIVTWRTLALTGLVPCIVLFVGLFLI  167



>ref|XP_006594462.1| PREDICTED: sugar transporter ERD6-like 16-like isoform X2 [Glycine 
max]
Length=570

 Score =   244 bits (624),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 163/224 (73%), Gaps = 20/224 (9%)
 Frame = +1

Query  178  RKMAAGQ--DIENGKNEGSTAGMAAPLIGKED----DSKTDRW-------MVYLSTFVAV  318
             KMA  Q  D+E+G        +  P I  E+    +  +D+        MV LST VAV
Sbjct  90   NKMAIEQHKDVESGY-------LQEPFIQPEEVACKEVGSDKSVENGSIGMVLLSTLVAV  142

Query  319  CGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKG  498
            CGS  FG+C GYSSPTQ+AI +DL+ S+AE+S+FGS++T GAM GAITSG I DF+GRKG
Sbjct  143  CGSFTFGNCVGYSSPTQAAIREDLSLSLAEFSMFGSLVTIGAMLGAITSGRITDFIGRKG  202

Query  499  AMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALT  678
            AMR+S+ FC+ GWLA+FF+KG+  +D+GR  TGYG+G+ SYVVPV+IAEIAPK LRG L 
Sbjct  203  AMRISTGFCITGWLAVFFSKGSYSLDLGRFFTGYGIGLISYVVPVYIAEIAPKNLRGGLA  262

Query  679  TLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            T NQL+IVTG SV+F++G+++ WR LAL G+VPC+ L +GLC I
Sbjct  263  TTNQLLIVTGASVSFLLGSVIHWRKLALAGLVPCICLLIGLCFI  306



>ref|XP_004486078.1| PREDICTED: sugar transporter ERD6-like 16-like [Cicer arietinum]
Length=486

 Score =   241 bits (615),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 161/217 (74%), Gaps = 13/217 (6%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDS-----KTDRW-------MVYLSTFVAVCGSCAFG  339
            +D+E+G+       +  PLI + +D+      +D+        MV LSTFVAVCGS +FG
Sbjct  7    KDVESGE-ANVIQYLHEPLIQQGEDACKEVHDSDKSVENGSIGMVLLSTFVAVCGSFSFG  65

Query  340  SCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSV  519
            +C GYS+PTQ+AI  DLN S+AE+S+FGS++T GAM GA+TSG + DF+GRKGAMR+S+ 
Sbjct  66   TCVGYSAPTQAAIRADLNLSLAEFSMFGSLVTIGAMLGAVTSGRVTDFIGRKGAMRVSTG  125

Query  520  FCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMI  699
            FC+ GWLA+FF+K +  +D+GR  TGYG+GV SYVVPV+IAEIAPK LRG L T NQLMI
Sbjct  126  FCIIGWLAVFFSKDSYSLDLGRFCTGYGIGVISYVVPVYIAEIAPKNLRGGLATTNQLMI  185

Query  700  VTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            V G S++F++G+++ WR LAL G+VPC+ L LGL  I
Sbjct  186  VIGSSMSFLVGSVINWRELALAGLVPCICLLLGLFFI  222



>ref|XP_010666329.1| PREDICTED: sugar transporter ERD6-like 16 [Beta vulgaris subsp. 
vulgaris]
Length=495

 Score =   241 bits (614),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 160/219 (73%), Gaps = 15/219 (7%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIG---KEDDSKTDRW-----------MVYLSTFVAVCGSCA  333
            ++ +N ++ G    + +PL+    K+ D + D +           MV  ST VAVCGS  
Sbjct  8    ENTQNIQHNGLQE-LKSPLVKGQCKDVDYEDDEYGSETRDDSSITMVLFSTCVAVCGSFI  66

Query  334  FGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMS  513
            FG+C GYS+PTQSAI  DLN S+A+YS FGSILT GAM GA++SG IADF GRK AMRMS
Sbjct  67   FGTCVGYSAPTQSAIRADLNLSLAQYSTFGSILTIGAMVGAVSSGRIADFSGRKQAMRMS  126

Query  514  SVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQL  693
            + FC+ GWLAI+FA GA  ++IGRL +GYG+GV SYVVP+FIAEI+PK LRG LTTLNQL
Sbjct  127  ACFCIMGWLAIYFATGARSLEIGRLFSGYGIGVLSYVVPIFIAEISPKGLRGGLTTLNQL  186

Query  694  MIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            MIVTG SV+F++G+++ WR  ALTG+VPC+ L  GL ++
Sbjct  187  MIVTGSSVSFLVGSIICWRAFALTGLVPCITLLSGLFLV  225



>ref|XP_008795112.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Phoenix 
dactylifera]
Length=483

 Score =   240 bits (612),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 156/218 (72%), Gaps = 10/218 (5%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDRW---------MVYLSTFVAVCGSCAF  336
            MA  +D+E G N      +  PLI  ++  K +           +V  ST VAVCGS  F
Sbjct  1    MAIMEDVERGLNAKQNE-VREPLIQHKEVPKCEESCNENQGCIGVVLFSTAVAVCGSFEF  59

Query  337  GSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSS  516
            GSC GYS+PTQS I  D+  ++++YS+FGSILT GAM GAITSG IAD +GRKGAMR S+
Sbjct  60   GSCVGYSAPTQSGIINDIGLTLSQYSVFGSILTIGAMIGAITSGRIADLIGRKGAMRTSA  119

Query  517  VFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLM  696
            + C+ GWLAI+FA+ AL++  GR ++GYG+GV SYVVPVFIAEIAPK LRG LTTLNQL+
Sbjct  120  LICIIGWLAIYFAEDALMLYFGRFSSGYGIGVLSYVVPVFIAEIAPKNLRGGLTTLNQLL  179

Query  697  IVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            I +G SVAF++GT VTWRTL L G++PCVVL  GL  I
Sbjct  180  ICSGGSVAFIVGTFVTWRTLVLIGLIPCVVLLAGLFFI  217



>ref|XP_010660047.1| PREDICTED: sugar transporter ERD6-like 8 [Vitis vinifera]
Length=471

 Score =   239 bits (611),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 150/214 (70%), Gaps = 10/214 (5%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCA  348
            MA  QD+E G +      +  PLIG++ + +        W+V LST VAVCGS  FGSC 
Sbjct  1    MATRQDVEKGNDT-----ITKPLIGQKKEVQIQSNNGGLWVVLLSTLVAVCGSFEFGSCV  55

Query  349  GYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCL  528
            GYS+P +  I  DL  S +EYS FGSILT GAM GAITSG IADF+GRKGAM MSS+ C+
Sbjct  56   GYSAPAEYGIMDDLGISYSEYSFFGSILTIGAMIGAITSGQIADFIGRKGAMGMSSMICI  115

Query  529  AGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTG  708
            AGW  ++ + G+  +  GR   GYG+GV SYVVPVFIAEI PK LRGAL T NQL IVTG
Sbjct  116  AGWFTVYLSFGSFSLYSGRFLLGYGIGVLSYVVPVFIAEITPKNLRGALATANQLFIVTG  175

Query  709  VSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            + +A+VIG +VTWR LALTGIVPC+VL +GL  I
Sbjct  176  LFIAYVIGAIVTWRILALTGIVPCMVLLVGLFFI  209



>gb|ADP37168.1| putative ERD6-like transporter [Vitis vinifera]
Length=473

 Score =   239 bits (611),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 150/214 (70%), Gaps = 10/214 (5%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCA  348
            MA  QD+E G +      +  PLIG++ + +        W+V LST VAVCGS  FGSC 
Sbjct  1    MATRQDVEKGNDT-----ITKPLIGQKKEVQIQSNNGGLWVVLLSTLVAVCGSFEFGSCV  55

Query  349  GYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCL  528
            GYS+P +  I  DL  S +EYS FGSILT GAM GAITSG IADF+GRKGAM MSS+ C+
Sbjct  56   GYSAPAEYGIMDDLGISYSEYSFFGSILTIGAMIGAITSGQIADFIGRKGAMGMSSMICI  115

Query  529  AGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTG  708
            AGW  ++ + G+  +  GR   GYG+GV SYVVPVFIAEI PK LRGAL T NQL IVTG
Sbjct  116  AGWFTVYLSFGSFSLYSGRFLLGYGIGVLSYVVPVFIAEITPKNLRGALATANQLFIVTG  175

Query  709  VSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            + +A+VIG +VTWR LALTGIVPC+VL +GL  I
Sbjct  176  LFIAYVIGAIVTWRILALTGIVPCMVLLVGLFFI  209



>ref|XP_010912096.1| PREDICTED: sugar transporter ERD6-like 16 [Elaeis guineensis]
Length=483

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 155/218 (71%), Gaps = 10/218 (5%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDRW---------MVYLSTFVAVCGSCAF  336
            MA  +D+E+G N      +  PLI  + + K             +V  ST VAVCGS  F
Sbjct  1    MAIMEDVESGLNTKQIE-VKKPLIQHKKEPKCQESCNENQGCIGVVLFSTAVAVCGSFEF  59

Query  337  GSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSS  516
            G+C GYS+PTQS I  D+  ++++YS+FGSILT GAM GAITSG IAD +GRKGAMR S+
Sbjct  60   GTCVGYSAPTQSGIINDIGLTLSQYSVFGSILTIGAMIGAITSGRIADLIGRKGAMRTSA  119

Query  517  VFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLM  696
            + C+ GWLAI+FAK AL++  GR ++GYG+GV SYVVPVFIAEIAPK LRG LTTLNQL+
Sbjct  120  LICMVGWLAIYFAKDALMLYFGRFSSGYGIGVLSYVVPVFIAEIAPKNLRGGLTTLNQLL  179

Query  697  IVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            I  G +VAF++GT VTWRTL L G++PC+VL  GL  I
Sbjct  180  ICAGSAVAFIVGTFVTWRTLVLIGLIPCLVLLAGLFFI  217



>gb|KJB22569.1| hypothetical protein B456_004G054600 [Gossypium raimondii]
Length=473

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 152/203 (75%), Gaps = 5/203 (2%)
 Frame = +1

Query  202  IENGKNEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAIS  381
            +ENG+     + M  PL+           +V+L+TFVAV GS  FGSC GYS+P QSAI+
Sbjct  3    LENGE-----SSMKEPLLLHHAKKTRSLEVVFLTTFVAVLGSYEFGSCMGYSAPVQSAIT  57

Query  382  QDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKG  561
            ++L+ SIAE+S+FGSIL  GAM GAITSG IADF+GR GAMR+SS F + GW+AI+F+KG
Sbjct  58   KELHLSIAEFSVFGSILNVGAMIGAITSGRIADFMGRTGAMRISSGFSITGWIAIYFSKG  117

Query  562  ALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMV  741
            AL++DIGR   GYG+G+F+YVVP+++ EIAPK++RG L  LNQLMIV G S  FV+GT +
Sbjct  118  ALLLDIGRFLCGYGIGIFAYVVPIYVGEIAPKDVRGGLAALNQLMIVIGASTTFVVGTAL  177

Query  742  TWRTLALTGIVPCVVLGLGLCII  810
             WR LALTGI+PC++  LGL  I
Sbjct  178  EWRILALTGIIPCLIQLLGLNFI  200



>ref|XP_010242561.1| PREDICTED: sugar transporter ERD6-like 8 isoform X2 [Nelumbo 
nucifera]
Length=429

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 153/215 (71%), Gaps = 10/215 (5%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDR------WMVYLSTFVAVCGSCAFGSC  345
            MA  +++E+G +      M+ PL+G + +            MV L+T VAVCGS  FGSC
Sbjct  1    MARNREVEHGND----VFMSQPLMGTQSEETESHVKHKGLRMVLLTTSVAVCGSFEFGSC  56

Query  346  AGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFC  525
             GYS+PTQ  I +D+  S+ EYS+FGSIL  GA+ GA+TSG +ADF+GRKGAMRMSS  C
Sbjct  57   VGYSAPTQFGIMKDIGLSLTEYSVFGSILNIGAVIGAMTSGHVADFIGRKGAMRMSSTIC  116

Query  526  LAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVT  705
            + GWL I+ ++GA+ +DIGR   GYG+G+ SYVVPVFIAEI PK LRGAL T NQL+IV 
Sbjct  117  ILGWLWIYLSRGAVSLDIGRFLMGYGIGILSYVVPVFIAEITPKNLRGALATANQLLIVI  176

Query  706  GVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            G+SV+F +G  +TWR LAL GIVPC++L +GL  I
Sbjct  177  GISVSFTLGAFLTWRALALIGIVPCILLIVGLQFI  211



>ref|XP_011090878.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Sesamum 
indicum]
Length=485

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 157/209 (75%), Gaps = 9/209 (4%)
 Frame = +1

Query  202  IENGKNEGSTAGMAAPLIGKEDDSKTDR------WMVYLSTFVAVCGSCAFGSCAGYSSP  363
            IEN  +E     +  P   K  D + +       +MV LSTFVA+CGS  FG C GYSSP
Sbjct  3    IENASDELEKPFIQQP---KSADPEGESGQNGSIFMVLLSTFVAICGSFEFGICVGYSSP  59

Query  364  TQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLA  543
            TQS+I  DLN S++E+SLFGSI+T GAM G+ITSG IAD++GRKG+MR+++V C+AGW+A
Sbjct  60   TQSSIRHDLNLSLSEFSLFGSIITIGAMFGSITSGRIADYLGRKGSMRLAAVICIAGWVA  119

Query  544  IFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAF  723
            ++F+K A  +D+GR +TGYG+G+ S+VVPVFI EIAPK LRG L TLNQL+IV G S  +
Sbjct  120  VYFSKAAWSLDVGRFSTGYGIGLSSFVVPVFIGEIAPKHLRGGLATLNQLLIVCGSSFVY  179

Query  724  VIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            ++GT+VTWRTLALTG++P +++ +GL  I
Sbjct  180  IVGTIVTWRTLALTGLIPSILVLVGLFFI  208



>ref|XP_010242560.1| PREDICTED: sugar transporter ERD6-like 8 isoform X1 [Nelumbo 
nucifera]
Length=447

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 153/215 (71%), Gaps = 10/215 (5%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDR------WMVYLSTFVAVCGSCAFGSC  345
            MA  +++E+G +      M+ PL+G + +            MV L+T VAVCGS  FGSC
Sbjct  1    MARNREVEHGND----VFMSQPLMGTQSEETESHVKHKGLRMVLLTTSVAVCGSFEFGSC  56

Query  346  AGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFC  525
             GYS+PTQ  I +D+  S+ EYS+FGSIL  GA+ GA+TSG +ADF+GRKGAMRMSS  C
Sbjct  57   VGYSAPTQFGIMKDIGLSLTEYSVFGSILNIGAVIGAMTSGHVADFIGRKGAMRMSSTIC  116

Query  526  LAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVT  705
            + GWL I+ ++GA+ +DIGR   GYG+G+ SYVVPVFIAEI PK LRGAL T NQL+IV 
Sbjct  117  ILGWLWIYLSRGAVSLDIGRFLMGYGIGILSYVVPVFIAEITPKNLRGALATANQLLIVI  176

Query  706  GVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            G+SV+F +G  +TWR LAL GIVPC++L +GL  I
Sbjct  177  GISVSFTLGAFLTWRALALIGIVPCILLIVGLQFI  211



>gb|ERN07483.1| hypothetical protein AMTR_s00019p00256320 [Amborella trichopoda]
Length=494

 Score =   238 bits (608),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 161/221 (73%), Gaps = 14/221 (6%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLI--GKEDDSKTDR----------WMVYLSTFVAVCGS  327
            M+  +D+E G  +G  + +  PLI  GKE    TD           WMV LSTFVAV GS
Sbjct  1    MSISKDLEVG--QGLQSDLKQPLISKGKEVILSTDSSSNGKDGGSIWMVLLSTFVAVAGS  58

Query  328  CAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMR  507
              FG   G+SSPTQS+I  +L  ++AEYS+FGSILT G+M GA+ SG +AD +GRKGAMR
Sbjct  59   FEFGCAVGFSSPTQSSIRHELGLTLAEYSVFGSILTIGSMVGAVMSGRVADSIGRKGAMR  118

Query  508  MSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLN  687
            +S  FC+ GWLAI+++KG+  +DIGRLA GYG+GVFSYVVPV+IAEI PK LRG  TT+N
Sbjct  119  ISGGFCMIGWLAIYYSKGSWSLDIGRLAVGYGIGVFSYVVPVYIAEITPKSLRGGFTTVN  178

Query  688  QLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            QLMI TGVS A+++GT++TWR L LTG++P +++ +GL ++
Sbjct  179  QLMICTGVSFAYILGTVLTWRVLTLTGLIPMLIMLVGLFVV  219



>ref|XP_011623901.1| PREDICTED: sugar transporter ERD6-like 5 isoform X2 [Amborella 
trichopoda]
Length=472

 Score =   238 bits (606),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 159/222 (72%), Gaps = 14/222 (6%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKE-------------DDSKTDRWMVYLSTFVAVCG  324
            M+A +D+++G     +  +   LI KE             +D K    +V LSTFVAV G
Sbjct  1    MSASKDLDDGSTLRESE-ITEALISKEKSTAVLIASNSSGNDGKGSILVVILSTFVAVSG  59

Query  325  SCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAM  504
            S  FGS  G+SSPTQSAI  DL  S++EYS+FGSILT G+M GAI  G +AD+VGRKGAM
Sbjct  60   SFEFGSAVGFSSPTQSAIRSDLGLSLSEYSVFGSILTIGSMIGAIMCGSLADYVGRKGAM  119

Query  505  RMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTL  684
            R+++VF + GW+AI F++ A  +DIGRL+ GYG+GV SYVVPV+IAEI PK LRG  TT+
Sbjct  120  RIAAVFSILGWIAISFSEAAWTLDIGRLSVGYGIGVLSYVVPVYIAEITPKHLRGGFTTV  179

Query  685  NQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            NQLMIV G SVAF++GT++TWR L +TGIVPC++L LGL I+
Sbjct  180  NQLMIVFGASVAFILGTILTWRVLTVTGIVPCLILLLGLFIV  221



>ref|XP_006845811.2| PREDICTED: sugar transporter ERD6-like 16 [Amborella trichopoda]
Length=495

 Score =   238 bits (607),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 159/221 (72%), Gaps = 14/221 (6%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLI--GKEDDSKTDR----------WMVYLSTFVAVCGS  327
            M+  +D+E G  +G  + +  PLI  GKE    TD           WMV LSTFVAV GS
Sbjct  1    MSISKDLEVG--QGLQSDLKQPLISKGKEVILSTDSSSNGKDGGSIWMVLLSTFVAVAGS  58

Query  328  CAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMR  507
              FG   G+SSPTQS+I  +L  ++AEYS+FGSILT G+M GA+ SG +AD +GRKGAMR
Sbjct  59   FEFGCAVGFSSPTQSSIRHELGLTLAEYSVFGSILTIGSMVGAVMSGRVADSIGRKGAMR  118

Query  508  MSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLN  687
            +S  FC+ GWLAI+++K A  +DIGRL+ GYG+G+ SYVVPV+IAEI PK LRG LTT+N
Sbjct  119  ISGGFCMIGWLAIYYSKAAWSLDIGRLSVGYGIGMLSYVVPVYIAEITPKNLRGGLTTVN  178

Query  688  QLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            QLMI +G S AF++GT++TWR LAL G++PC++L  GL ++
Sbjct  179  QLMICSGASTAFILGTILTWRVLALIGVLPCLILLFGLSLV  219



>ref|XP_010485917.1| PREDICTED: sugar transporter ERD6-like 8 [Camelina sativa]
Length=471

 Score =   238 bits (606),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 152/216 (70%), Gaps = 11/216 (5%)
 Frame = +1

Query  172  ITRKMAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDR---WMVYLSTFVAVCGSCAFGS  342
            +TR+     +  NGK+E        PL+  E +S       WMVYLSTF+AVCGS  FG+
Sbjct  1    MTRRKDDDMEKMNGKSE--------PLLLPEKESDVSEEASWMVYLSTFIAVCGSFEFGT  52

Query  343  CAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVF  522
            C GYS+PTQ  I ++L+ S +++S+FGSIL  GA+ GAITSG I+DF+GRKGAMR++SV 
Sbjct  53   CVGYSAPTQFGIMEELDLSYSQFSVFGSILNVGAVLGAITSGKISDFIGRKGAMRLASVI  112

Query  523  CLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  702
               GWL I+FAKG + +D GR  TGYG G  SYVVPVFIAEI+P+ LRGAL TLNQL +V
Sbjct  113  SAIGWLIIYFAKGDVPLDFGRFLTGYGCGTLSYVVPVFIAEISPRNLRGALATLNQLFLV  172

Query  703  TGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             G++  F+IG +V WRTLALTG+ PCVVL  G   I
Sbjct  173  IGLASMFLIGAVVNWRTLALTGVAPCVVLFFGTWFI  208



>ref|XP_006845806.1| PREDICTED: sugar transporter ERD6-like 5 isoform X1 [Amborella 
trichopoda]
 gb|ERN07481.1| hypothetical protein AMTR_s00019p00256160 [Amborella trichopoda]
Length=493

 Score =   237 bits (605),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 159/222 (72%), Gaps = 14/222 (6%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKE-------------DDSKTDRWMVYLSTFVAVCG  324
            M+A +D+++G     +  +   LI KE             +D K    +V LSTFVAV G
Sbjct  1    MSASKDLDDGSTLRESE-ITEALISKEKSTAVLIASNSSGNDGKGSILVVILSTFVAVSG  59

Query  325  SCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAM  504
            S  FGS  G+SSPTQSAI  DL  S++EYS+FGSILT G+M GAI  G +AD+VGRKGAM
Sbjct  60   SFEFGSAVGFSSPTQSAIRSDLGLSLSEYSVFGSILTIGSMIGAIMCGSLADYVGRKGAM  119

Query  505  RMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTL  684
            R+++VF + GW+AI F++ A  +DIGRL+ GYG+GV SYVVPV+IAEI PK LRG  TT+
Sbjct  120  RIAAVFSILGWIAISFSEAAWTLDIGRLSVGYGIGVLSYVVPVYIAEITPKHLRGGFTTV  179

Query  685  NQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            NQLMIV G SVAF++GT++TWR L +TGIVPC++L LGL I+
Sbjct  180  NQLMIVFGASVAFILGTILTWRVLTVTGIVPCLILLLGLFIV  221



>gb|KDP26380.1| hypothetical protein JCGZ_17538 [Jatropha curcas]
Length=519

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = +1

Query  259  KEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTF  438
             E+++     MV LS FVAVCGS   G C GYSSPTQSAI +DLN S ++YS+FGSIL  
Sbjct  58   NEEETTGSIGMVLLSVFVAVCGSIEMGCCVGYSSPTQSAIMKDLNLSTSQYSVFGSILPI  117

Query  439  GAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFS  618
            GAM GA TSG IAD +GRKGAMRMS+ FC+AGWLA+FF++    +D+GR  TGYG+GVFS
Sbjct  118  GAMFGAFTSGRIADHIGRKGAMRMSAGFCIAGWLAVFFSEQNFSLDMGRFVTGYGIGVFS  177

Query  619  YVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLG  798
            +VVPVFIAEI+PK LRG LT LNQL+ +TG S AF++G++++WR LALTG+VPC+ L +G
Sbjct  178  FVVPVFIAEISPKNLRGGLTALNQLLNITGASTAFLLGSVISWRALALTGLVPCIFLLIG  237

Query  799  LCII  810
            L  +
Sbjct  238  LFFV  241



>ref|XP_009603503.1| PREDICTED: sugar transporter ERD6-like 8 [Nicotiana tomentosiformis]
Length=229

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 150/209 (72%), Gaps = 11/209 (5%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDSKT----DRWMVYLSTFVAVCGSCAFGSCAGYSSP  363
            Q+  NG  E        PLI K D  +T    +  MVYLST VAVCGS AFG+C GYSSP
Sbjct  6    QENGNGDTE-------KPLIVKHDADQTAHKEELVMVYLSTAVAVCGSYAFGTCVGYSSP  58

Query  364  TQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLA  543
            TQ +I  +LN S ++YS+FGSILT GAM GAIT+G IAD +GRKGAMR+SSV C AGWLA
Sbjct  59   TQFSIMDELNLSYSQYSVFGSILTIGAMLGAITAGRIADLLGRKGAMRLSSVICSAGWLA  118

Query  544  IFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAF  723
            I+ AK  +V+ +GR+ +GY +G+ SYVVP+F+ EI+P +LRGAL++ NQL IV G+S  +
Sbjct  119  IYLAKEPMVLYLGRVLSGYSIGIISYVVPMFVGEISPNKLRGALSSTNQLSIVIGLSAVY  178

Query  724  VIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            VIG  V WR LAL G+VPC +L LGL  I
Sbjct  179  VIGAFVGWRILALLGVVPCGLLFLGLFFI  207



>ref|XP_012085835.1| PREDICTED: sugar transporter ERD6-like 16 [Jatropha curcas]
Length=452

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 140/174 (80%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MV LS FVAVCGS   G C GYSSPTQSAI +DLN S ++YS+FGSIL  GAM GA TSG
Sbjct  1    MVLLSVFVAVCGSIEMGCCVGYSSPTQSAIMKDLNLSTSQYSVFGSILPIGAMFGAFTSG  60

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
             IAD +GRKGAMRMS+ FC+AGWLA+FF++    +D+GR  TGYG+GVFS+VVPVFIAEI
Sbjct  61   RIADHIGRKGAMRMSAGFCIAGWLAVFFSEQNFSLDMGRFVTGYGIGVFSFVVPVFIAEI  120

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            +PK LRG LT LNQL+ +TG S AF++G++++WR LALTG+VPC+ L +GL  +
Sbjct  121  SPKNLRGGLTALNQLLNITGASTAFLLGSVISWRALALTGLVPCIFLLIGLFFV  174



>ref|XP_010070295.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Eucalyptus 
grandis]
Length=233

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 137/181 (76%), Gaps = 8/181 (4%)
 Frame = +1

Query  184  MAAGQDIEN---GKNEGSTAGMAAP----LIGKEDDSKTDR-WMVYLSTFVAVCGSCAFG  339
            MA  +DIEN   G  EG    +  P      GK++ +   R WMVY + FVAVCGS  FG
Sbjct  1    MAINEDIENQETGDREGVRERLLVPQEKDRAGKDEGTDKGRPWMVYFTPFVAVCGSYEFG  60

Query  340  SCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSV  519
            +CAGYSSPTQ AI ++L+ S AEYS+FGSILTFGAM GAIT GPIADFVGRK  MR++S 
Sbjct  61   TCAGYSSPTQDAIVEELSLSTAEYSVFGSILTFGAMIGAITGGPIADFVGRKWTMRIASA  120

Query  520  FCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMI  699
             C+AGWLAI+FA+GAL +DIGRLATGYGMGVFSYVVP+FIAEI PK LRGALT +NQ  I
Sbjct  121  LCVAGWLAIYFAEGALALDIGRLATGYGMGVFSYVVPIFIAEITPKNLRGALTAVNQAKI  180

Query  700  V  702
            +
Sbjct  181  L  181



>ref|XP_010546662.1| PREDICTED: sugar transporter ERD6-like 8 [Tarenaya hassleriana]
Length=471

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 150/206 (73%), Gaps = 12/206 (6%)
 Frame = +1

Query  193  GQDIE--NGKNEGSTAGMAAPLIGKEDDSKTDR--WMVYLSTFVAVCGSCAFGSCAGYSS  360
            G D+E  NGK+E        PL+G E  S  D   WMVY+STF+AVCGS  FG   GYS+
Sbjct  5    GDDVEKINGKSE--------PLLGPEKGSDGDEVSWMVYVSTFIAVCGSYEFGCGVGYSA  56

Query  361  PTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWL  540
            PTQ  I +++  S +E+++FGSI+  GAM GAITSG I+DFVGRKGAMR+SS+    GWL
Sbjct  57   PTQFGIMEEIKLSYSEFAVFGSIVNIGAMLGAITSGKISDFVGRKGAMRVSSIIGTVGWL  116

Query  541  AIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  720
             I+ AKGA+ +D+GR  TGYG G  SYVVPVFIAEIAP++LRGAL TL+QL IV G++  
Sbjct  117  IIYLAKGAVPLDLGRFLTGYGCGTLSYVVPVFIAEIAPRKLRGALATLHQLFIVIGLAAM  176

Query  721  FVIGTMVTWRTLALTGIVPCVVLGLG  798
            FVIG +V WR LALTG++PCVVL  G
Sbjct  177  FVIGAVVNWRILALTGVIPCVVLFFG  202



>ref|XP_010464026.1| PREDICTED: sugar transporter ERD6-like 8 [Camelina sativa]
Length=471

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 151/216 (70%), Gaps = 11/216 (5%)
 Frame = +1

Query  172  ITRKMAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDR---WMVYLSTFVAVCGSCAFGS  342
            +TR+     +  NGK+E        PL+  E +S       WMVYLSTF+AVCGS  FG+
Sbjct  1    MTRRKEDDMEKMNGKSE--------PLLLPEKESDVSEEASWMVYLSTFIAVCGSFEFGT  52

Query  343  CAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVF  522
            C GYS+PTQ  I ++L+ S +++S+FGSIL  GA+ GAITSG I+DF+GRKGAMR++SV 
Sbjct  53   CVGYSAPTQFGIMEELDLSYSQFSVFGSILNVGAVLGAITSGKISDFIGRKGAMRLASVI  112

Query  523  CLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  702
               GWL I+ AKG + +D GR  TGYG G  SYVVPVFIAEI+P+ LRGAL TLNQL +V
Sbjct  113  SAIGWLIIYIAKGDVPLDFGRFLTGYGCGTLSYVVPVFIAEISPRNLRGALATLNQLFLV  172

Query  703  TGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             G++  F+IG +V WRTLALTG+ PCVVL  G   I
Sbjct  173  IGLASMFLIGAVVNWRTLALTGVAPCVVLFFGTWFI  208



>ref|XP_006299027.1| hypothetical protein CARUB_v10015164mg [Capsella rubella]
 gb|EOA31925.1| hypothetical protein CARUB_v10015164mg [Capsella rubella]
Length=473

 Score =   234 bits (597),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 152/211 (72%), Gaps = 13/211 (6%)
 Frame = +1

Query  172  ITRKMAAGQDIENGKNEGSTAGMAAPLIGKEDDS-----KTDRWMVYLSTFVAVCGSCAF  336
            +TR+     +  NGK+E        PL+  E +S     +   WMVYLSTF+AVCGS  F
Sbjct  1    MTRRSKDDMEKTNGKSE--------PLLLPEKESNDVSEEEASWMVYLSTFIAVCGSYEF  52

Query  337  GSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSS  516
            G+C GYS+PTQ  I ++L+ S +++S+FGSIL  GA+ GAITSG I+D++GRKGAMR+SS
Sbjct  53   GTCVGYSAPTQFGIMEELSLSYSQFSVFGSILNVGAVIGAITSGKISDYIGRKGAMRLSS  112

Query  517  VFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLM  696
            V    GWL I+FAKG + +D GR  TGYG G  S+VVPVFIAEI+P++LRGAL TLNQL 
Sbjct  113  VISAIGWLIIYFAKGDVSLDFGRFLTGYGCGTLSFVVPVFIAEISPRKLRGALATLNQLF  172

Query  697  IVTGVSVAFVIGTMVTWRTLALTGIVPCVVL  789
            +V G++  F+IG +V WRTLALTG+ PCV+L
Sbjct  173  LVIGLASMFLIGAVVNWRTLALTGVAPCVIL  203



>ref|XP_010660043.1| PREDICTED: sugar transporter ERD6-like 8 isoform X2 [Vitis vinifera]
Length=492

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 152/218 (70%), Gaps = 12/218 (6%)
 Frame = +1

Query  178  RKMAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTD-------RWMVYLSTFVAVCGSCAF  336
             KMAA Q++E G      A +  PLI +E   +           MV LS FVAVCGS  F
Sbjct  22   EKMAAKQEVEKG-----NANITEPLIVQEKQGEAQIKSNNGGLRMVLLSIFVAVCGSFEF  76

Query  337  GSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSS  516
            GSCAGYS+P Q  I  +L  S ++YS+FGSIL+ GAM GAI+SG IAD +GRKGAMRMSS
Sbjct  77   GSCAGYSAPAQYGIMNELGLSYSQYSVFGSILSIGAMIGAISSGWIADSIGRKGAMRMSS  136

Query  517  VFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLM  696
            + C+AGW+ ++ + G++ +D GR   GYG+G+ SYV+PVFIAEI PK  RG L T NQL 
Sbjct  137  MVCIAGWITVYLSFGSVSLDSGRFLLGYGIGILSYVIPVFIAEITPKNHRGTLATANQLF  196

Query  697  IVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            IVTG+ +AFV+G  VTWRTLALTGI+PC+VL +GL  I
Sbjct  197  IVTGLFIAFVVGAFVTWRTLALTGILPCMVLLVGLFFI  234



>emb|CBI34326.3| unnamed protein product [Vitis vinifera]
Length=874

 Score =   241 bits (615),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 152/217 (70%), Gaps = 10/217 (5%)
 Frame = +1

Query  175  TRKMAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFG  339
            + KMA  QD+E G +      +  PLIG++ + +        W+V LST VAVCGS  FG
Sbjct  401  SEKMATRQDVEKGNDT-----ITKPLIGQKKEVQIQSNNGGLWVVLLSTLVAVCGSFEFG  455

Query  340  SCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSV  519
            SC GYS+P +  I  DL  S +EYS FGSILT GAM GAITSG IADF+GRKGAM MSS+
Sbjct  456  SCVGYSAPAEYGIMDDLGISYSEYSFFGSILTIGAMIGAITSGQIADFIGRKGAMGMSSM  515

Query  520  FCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMI  699
             C+AGW  ++ + G+  +  GR   GYG+GV SYVVPVFIAEI PK LRGAL T NQL I
Sbjct  516  ICIAGWFTVYLSFGSFSLYSGRFLLGYGIGVLSYVVPVFIAEITPKNLRGALATANQLFI  575

Query  700  VTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            VTG+ +A+VIG +VTWR LALTGIVPC+VL +GL  I
Sbjct  576  VTGLFIAYVIGAIVTWRILALTGIVPCMVLLVGLFFI  612



>emb|CBI34327.3| unnamed protein product [Vitis vinifera]
Length=602

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 154/220 (70%), Gaps = 12/220 (5%)
 Frame = +1

Query  172  ITRKMAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTD-------RWMVYLSTFVAVCGSC  330
            +T KMAA Q++E G      A +  PLI +E   +           MV LS FVAVCGS 
Sbjct  125  LTEKMAAKQEVEKG-----NANITEPLIVQEKQGEAQIKSNNGGLRMVLLSIFVAVCGSF  179

Query  331  AFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRM  510
             FGSCAGYS+P Q  I  +L  S ++YS+FGSIL+ GAM GAI+SG IAD +GRKGAMRM
Sbjct  180  EFGSCAGYSAPAQYGIMNELGLSYSQYSVFGSILSIGAMIGAISSGWIADSIGRKGAMRM  239

Query  511  SSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQ  690
            SS+ C+AGW+ ++ + G++ +D GR   GYG+G+ SYV+PVFIAEI PK  RG L T NQ
Sbjct  240  SSMVCIAGWITVYLSFGSVSLDSGRFLLGYGIGILSYVIPVFIAEITPKNHRGTLATANQ  299

Query  691  LMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            L IVTG+ +AFV+G  VTWRTLALTGI+PC+VL +GL  I
Sbjct  300  LFIVTGLFIAFVVGAFVTWRTLALTGILPCMVLLVGLFFI  339



>ref|XP_010660042.1| PREDICTED: sugar transporter ERD6-like 8 isoform X1 [Vitis vinifera]
Length=497

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 152/218 (70%), Gaps = 12/218 (6%)
 Frame = +1

Query  178  RKMAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTD-------RWMVYLSTFVAVCGSCAF  336
             KMAA Q++E G      A +  PLI +E   +           MV LS FVAVCGS  F
Sbjct  22   EKMAAKQEVEKG-----NANITEPLIVQEKQGEAQIKSNNGGLRMVLLSIFVAVCGSFEF  76

Query  337  GSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSS  516
            GSCAGYS+P Q  I  +L  S ++YS+FGSIL+ GAM GAI+SG IAD +GRKGAMRMSS
Sbjct  77   GSCAGYSAPAQYGIMNELGLSYSQYSVFGSILSIGAMIGAISSGWIADSIGRKGAMRMSS  136

Query  517  VFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLM  696
            + C+AGW+ ++ + G++ +D GR   GYG+G+ SYV+PVFIAEI PK  RG L T NQL 
Sbjct  137  MVCIAGWITVYLSFGSVSLDSGRFLLGYGIGILSYVIPVFIAEITPKNHRGTLATANQLF  196

Query  697  IVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            IVTG+ +AFV+G  VTWRTLALTGI+PC+VL +GL  I
Sbjct  197  IVTGLFIAFVVGAFVTWRTLALTGILPCMVLLVGLFFI  234



>ref|XP_002882396.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58655.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=470

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 150/212 (71%), Gaps = 8/212 (4%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKE---DDSKTDRWMVYLSTFVAVCGSCAFGSCAGY  354
            MA  +D     N+      A PL+  E   D S+   WMVYLST +AVCGS  FG+C GY
Sbjct  1    MARTKDDMEKMNDK-----AGPLLLPENGSDVSEETSWMVYLSTIIAVCGSYEFGTCVGY  55

Query  355  SSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAG  534
            S+PTQ  I ++LN S +++S+FGSIL  GA+ GAITSG I+DF+GRKGAMR+SSV    G
Sbjct  56   SAPTQFGIMEELNLSYSQFSVFGSILNVGAVLGAITSGKISDFIGRKGAMRLSSVISAIG  115

Query  535  WLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVS  714
            WL I+FAKG + +D GR  TG+G G  S+VVPVFIAEI+P++LRGAL TLNQL IV G++
Sbjct  116  WLIIYFAKGDVPLDFGRFLTGFGCGTLSFVVPVFIAEISPRKLRGALATLNQLFIVIGLA  175

Query  715  VAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
              F+IG +V WRTLALTG+ PCVVL  G   I
Sbjct  176  SMFLIGAVVNWRTLALTGVAPCVVLFFGTWFI  207



>ref|NP_187166.2| sugar transporter ERD6-like 8 [Arabidopsis thaliana]
 sp|Q0WQ63.1|ERDL8_ARATH RecName: Full=Sugar transporter ERD6-like 8 [Arabidopsis thaliana]
 dbj|BAF00736.1| putative sugar transporter [Arabidopsis thaliana]
 gb|AEE74191.1| sugar transporter ERD6-like 8 [Arabidopsis thaliana]
Length=470

 Score =   233 bits (593),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 148/208 (71%), Gaps = 8/208 (4%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKE---DDSKTDRWMVYLSTFVAVCGSCAFGSCAGY  354
            M   +D    +N+ S      PL+  E   D S+   WMVYLST +AVCGS  FG+C GY
Sbjct  1    METRKDDMEKRNDKSE-----PLLLPENGSDVSEEASWMVYLSTIIAVCGSYEFGTCVGY  55

Query  355  SSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAG  534
            S+PTQ  I ++LN S +++S+FGSIL  GA+ GAITSG I+DF+GRKGAMR+SSV    G
Sbjct  56   SAPTQFGIMEELNLSYSQFSVFGSILNMGAVLGAITSGKISDFIGRKGAMRLSSVISAIG  115

Query  535  WLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVS  714
            WL I+ AKG + +D GR  TGYG G  S+VVPVFIAEI+P++LRGAL TLNQL IV G++
Sbjct  116  WLIIYLAKGDVPLDFGRFLTGYGCGTLSFVVPVFIAEISPRKLRGALATLNQLFIVIGLA  175

Query  715  VAFVIGTMVTWRTLALTGIVPCVVLGLG  798
              F+IG +V WRTLALTG+ PCVVL  G
Sbjct  176  SMFLIGAVVNWRTLALTGVAPCVVLFFG  203



>ref|XP_010660044.1| PREDICTED: sugar transporter ERD6-like 8 isoform X3 [Vitis vinifera]
 ref|XP_010660045.1| PREDICTED: sugar transporter ERD6-like 8 isoform X3 [Vitis vinifera]
 gb|ADP37167.1| putative ERD6-like transporter [Vitis vinifera]
Length=474

 Score =   232 bits (591),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 151/216 (70%), Gaps = 12/216 (6%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTD-------RWMVYLSTFVAVCGSCAFGS  342
            MAA Q++E G      A +  PLI +E   +           MV LS FVAVCGS  FGS
Sbjct  1    MAAKQEVEKGN-----ANITEPLIVQEKQGEAQIKSNNGGLRMVLLSIFVAVCGSFEFGS  55

Query  343  CAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVF  522
            CAGYS+P Q  I  +L  S ++YS+FGSIL+ GAM GAI+SG IAD +GRKGAMRMSS+ 
Sbjct  56   CAGYSAPAQYGIMNELGLSYSQYSVFGSILSIGAMIGAISSGWIADSIGRKGAMRMSSMV  115

Query  523  CLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  702
            C+AGW+ ++ + G++ +D GR   GYG+G+ SYV+PVFIAEI PK  RG L T NQL IV
Sbjct  116  CIAGWITVYLSFGSVSLDSGRFLLGYGIGILSYVIPVFIAEITPKNHRGTLATANQLFIV  175

Query  703  TGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            TG+ +AFV+G  VTWRTLALTGI+PC+VL +GL  I
Sbjct  176  TGLFIAFVVGAFVTWRTLALTGILPCMVLLVGLFFI  211



>gb|AAF27021.1|AC009177_11 putative sugar transporter [Arabidopsis thaliana]
Length=463

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 142/189 (75%), Gaps = 3/189 (2%)
 Frame = +1

Query  241  AAPLIGKE---DDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEY  411
            + PL+  E   D S+   WMVYLST +AVCGS  FG+C GYS+PTQ  I ++LN S +++
Sbjct  8    SEPLLLPENGSDVSEEASWMVYLSTIIAVCGSYEFGTCVGYSAPTQFGIMEELNLSYSQF  67

Query  412  SLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLA  591
            S+FGSIL  GA+ GAITSG I+DF+GRKGAMR+SSV    GWL I+ AKG + +D GR  
Sbjct  68   SVFGSILNMGAVLGAITSGKISDFIGRKGAMRLSSVISAIGWLIIYLAKGDVPLDFGRFL  127

Query  592  TGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGI  771
            TGYG G  S+VVPVFIAEI+P++LRGAL TLNQL IV G++  F+IG +V WRTLALTG+
Sbjct  128  TGYGCGTLSFVVPVFIAEISPRKLRGALATLNQLFIVIGLASMFLIGAVVNWRTLALTGV  187

Query  772  VPCVVLGLG  798
             PCVVL  G
Sbjct  188  APCVVLFFG  196



>ref|XP_007030767.1| Sugar transporter, putative [Theobroma cacao]
 gb|EOY11269.1| Sugar transporter, putative [Theobroma cacao]
Length=471

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 149/214 (70%), Gaps = 10/214 (5%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCA  348
            MA  QDIENG     +A +  P   KE++ +        +MV LSTFVAV GS  FGS  
Sbjct  1    MATSQDIENG-----SASLLQPFTQKEENQQNSHGNGSLFMVLLSTFVAVMGSFEFGSSI  55

Query  349  GYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCL  528
            G+SSPTQ A  ++L  S +E+S+FGSILT GAM GAITSG  AD +GR   MRMSS+ C+
Sbjct  56   GFSSPTQQATMEELEMSPSEFSVFGSILTIGAMVGAITSGRAADLIGRIETMRMSSIICI  115

Query  529  AGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTG  708
             GWL I+ A G L ++ GR  TG+G+GV SYVVP+FIAEI P  LRGAL TL+Q+ + TG
Sbjct  116  TGWLIIYLALGTLSLNFGRFLTGFGIGVNSYVVPIFIAEITPTHLRGALLTLHQVSLATG  175

Query  709  VSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            + VA+ +G +VTWRTLALTG++PC V+ +GLC I
Sbjct  176  LLVAYAVGALVTWRTLALTGMIPCAVMIIGLCFI  209



>ref|XP_010244606.1| PREDICTED: sugar transporter ERD6-like 16 [Nelumbo nucifera]
Length=392

 Score =   227 bits (578),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 134/173 (77%), Gaps = 17/173 (10%)
 Frame = +1

Query  262  EDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFG  441
            +  + +DRW+                   GY +PTQSAI  DL+ S+AEYSLFGSILT G
Sbjct  58   QRKTSSDRWL-----------------QVGYLAPTQSAIRDDLDLSLAEYSLFGSILTIG  100

Query  442  AMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSY  621
             MAGAI SG I DF+GRKGAMRMS+ FC+ GWLA++F+KGAL +D+GR+ TGYG+GVFSY
Sbjct  101  GMAGAIMSGRIVDFIGRKGAMRMSAAFCITGWLAVYFSKGALSLDVGRIFTGYGIGVFSY  160

Query  622  VVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPC  780
            VVPV+IAEIAPK+LRG LTT+NQLMIVTG SVAF+IGT+V+WRTL + G++PC
Sbjct  161  VVPVYIAEIAPKDLRGGLTTVNQLMIVTGSSVAFLIGTVVSWRTLVIDGLIPC  213



>emb|CDY30026.1| BnaC01g39820D [Brassica napus]
Length=472

 Score =   229 bits (583),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 148/206 (72%), Gaps = 11/206 (5%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSS  360
             D+E  K++      + PL+  E+ S         WMV LSTF+AVCGS  FG+C GYS+
Sbjct  6    DDMEKVKDK------SEPLLLPENGSDVSEEEGASWMVCLSTFIAVCGSYEFGTCVGYSA  59

Query  361  PTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWL  540
            PTQ  I ++LN S +++S+FGSIL  GA+ GAITSG I+DF+GRKGAMR+SSV    GW+
Sbjct  60   PTQFGIMEELNLSYSQFSVFGSILNVGAVLGAITSGKISDFIGRKGAMRLSSVISAIGWM  119

Query  541  AIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  720
             I+F+KG + +D GR  TGYG G  SYVVPVFIAEI+P++LRGAL TLNQL +V G++  
Sbjct  120  IIYFSKGDIPLDFGRFLTGYGCGTLSYVVPVFIAEISPRKLRGALATLNQLFLVIGLASM  179

Query  721  FVIGTMVTWRTLALTGIVPCVVLGLG  798
            F+IG +V WR LALTG+VPCV+L  G
Sbjct  180  FLIGAVVNWRALALTGVVPCVILFFG  205



>ref|XP_010070291.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Eucalyptus 
grandis]
Length=459

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 144/217 (66%), Gaps = 30/217 (14%)
 Frame = +1

Query  184  MAAGQDIEN---GKNEGSTAGMAAPLIGKE--DDSKTDR---WMVYLSTFVAVCGSCAFG  339
            MA  +DIEN   G  EG    +  P        D  TD+   WMVY +TF+AVCGS  FG
Sbjct  1    MAINEDIENQETGDREGVRERLLVPQEKDRAGKDEGTDKVRPWMVYFTTFIAVCGSYEFG  60

Query  340  SCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSV  519
            +CAGYSSPTQ AI ++L  S AEYS+FGSILTFGAM GAIT GPIADFVGRK  MR++S 
Sbjct  61   TCAGYSSPTQDAIVEELGLSTAEYSVFGSILTFGAMIGAITGGPIADFVGRKWTMRIASA  120

Query  520  FCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMI  699
             C+AGWLAI+FA+G L +DIGRLATGYGMGVFSYV                      LMI
Sbjct  121  LCVAGWLAIYFAEGELALDIGRLATGYGMGVFSYV----------------------LMI  158

Query  700  VTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            V GVSV+F+IGT++ WR LAL G++PC VL  GL  I
Sbjct  159  VAGVSVSFIIGTVLAWRVLALIGLIPCAVLLFGLFFI  195



>ref|XP_009124970.1| PREDICTED: sugar transporter ERD6-like 8 [Brassica rapa]
 emb|CDY21102.1| BnaA01g33330D [Brassica napus]
Length=472

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 148/206 (72%), Gaps = 11/206 (5%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCAGYSS  360
             D+E  K++      + PL+  E+ S         WMV LSTF+AVCGS  FG+C GYS+
Sbjct  6    DDMEKVKDK------SEPLLLPENGSDVSEEEGASWMVCLSTFIAVCGSYEFGTCVGYSA  59

Query  361  PTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWL  540
            PTQ  I ++LN S +++S+FGSIL  GA+ GAITSG I+DF+GRKGAMR+SSV    GW+
Sbjct  60   PTQFGIMEELNLSYSQFSVFGSILNVGAVLGAITSGKISDFIGRKGAMRLSSVISAIGWM  119

Query  541  AIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  720
             I+F+KG + +D GR  TGYG G  SYVVPVFIAEI+P++LRGAL TLNQL +V G++  
Sbjct  120  IIYFSKGDIPLDFGRFLTGYGCGTLSYVVPVFIAEISPRKLRGALATLNQLFLVIGLASM  179

Query  721  FVIGTMVTWRTLALTGIVPCVVLGLG  798
            F+IG ++ WR LALTG+VPCV+L  G
Sbjct  180  FLIGAVINWRALALTGVVPCVILFFG  205



>gb|KJB82599.1| hypothetical protein B456_013G203800 [Gossypium raimondii]
Length=410

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 147/214 (69%), Gaps = 9/214 (4%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDR-----WMVYLSTFVAVCGSCAFGSCA  348
            MA  QDIE    +GS+  +  P   K++  +        +MV L TFVAV GSC FGS  
Sbjct  1    MADSQDIE----KGSSGSLYQPFFHKDEKQQNSHDNGNLFMVILCTFVAVMGSCEFGSSI  56

Query  349  GYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCL  528
            GYSSPTQ  I ++L  S  EYS+FGSILT GAM G+I+ G  AD +GRKG M+MSS+  +
Sbjct  57   GYSSPTQQGIMEELGMSSEEYSMFGSILTIGAMVGSISCGRAADLIGRKGTMKMSSIISI  116

Query  529  AGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTG  708
            AGWL I+ + G L +D+GR  TGYG+GV SYVVPVFIAEI P  LRGAL T++Q+ I TG
Sbjct  117  AGWLIIYLSLGPLSLDVGRFLTGYGIGVNSYVVPVFIAEITPTHLRGALLTVHQVAIATG  176

Query  709  VSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            + VA+ +G  V+WRTLALTG++PC V+ LGL  I
Sbjct  177  LLVAYAVGAFVSWRTLALTGMIPCAVMILGLYFI  210



>ref|XP_010070279.1| PREDICTED: sugar transporter ERD6-like 7 isoform X3 [Eucalyptus 
grandis]
Length=459

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 145/217 (67%), Gaps = 30/217 (14%)
 Frame = +1

Query  184  MAAGQDIEN---GKNEGSTAGMAAP----LIGKEDDSKTDR-WMVYLSTFVAVCGSCAFG  339
            MA  +DIEN   G  EG    +  P      GK++     R WMVY +TFVAVCGS  FG
Sbjct  1    MAINEDIENQETGDREGIRERLLVPQEKDRAGKDEGIDKGRPWMVYFTTFVAVCGSYEFG  60

Query  340  SCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSV  519
            +CAGYSSPTQ AI ++L+ S AEYS+FGSILTFGAM GAIT GPIADFVGRK  MR++S 
Sbjct  61   TCAGYSSPTQDAIVEELSLSTAEYSVFGSILTFGAMIGAITGGPIADFVGRKWTMRIASA  120

Query  520  FCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMI  699
             C+AGWLAI+FA+                      VP+FIAEI PK LRGALT +NQLMI
Sbjct  121  LCVAGWLAIYFAE----------------------VPIFIAEITPKNLRGALTAVNQLMI  158

Query  700  VTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            V GVSV+F+IGT++ WR LAL G++PC VL  GL  I
Sbjct  159  VAGVSVSFIIGTVLAWRVLALIGLIPCAVLLFGLFFI  195



>ref|XP_009414205.1| PREDICTED: sugar transporter ERD6-like 16 [Musa acuminata subsp. 
malaccensis]
Length=481

 Score =   226 bits (577),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 146/194 (75%), Gaps = 9/194 (5%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDSKTDR---------WMVYLSTFVAVCGSCAFGSCA  348
            +D+ENG +    + +  PLI + + +K +          WMV LST VAVCGS  FGSC 
Sbjct  2    EDVENGIHVTHESEVRKPLIQQRELAKAEESSSDGQGSLWMVLLSTGVAVCGSFEFGSCI  61

Query  349  GYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCL  528
            GYS+PTQ+ I++D+  S+++YS+F SILT G M GA+TSG ++D+ GRKGAMR+S+V C+
Sbjct  62   GYSAPTQAGITKDIGLSLSQYSIFASILTTGGMVGAVTSGHLSDYFGRKGAMRISAVVCI  121

Query  529  AGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTG  708
             GWLAI+FAK   ++ +GRL TGYG+GV SYVVPVFIAEIAPK LRG LT+LNQL++V G
Sbjct  122  IGWLAIYFAKETFLLCLGRLFTGYGIGVLSYVVPVFIAEIAPKNLRGGLTSLNQLLLVGG  181

Query  709  VSVAFVIGTMVTWR  750
             SVAF+IGT+V+WR
Sbjct  182  NSVAFIIGTLVSWR  195



>ref|XP_010649823.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Vitis vinifera]
 emb|CBI26145.3| unnamed protein product [Vitis vinifera]
 gb|ADP37171.1| putative ERD6-like transporter [Vitis vinifera]
Length=488

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 147/192 (77%), Gaps = 8/192 (4%)
 Frame = +1

Query  259  KEDDSKTDRW--------MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYS  414
            +EDD  T R         +V+LST VAV GS  FG C  YSSPTQ+AI +DLN S+AEYS
Sbjct  28   EEDDDLTPRNTSQNGSLGVVWLSTTVAVWGSFQFGCCVHYSSPTQTAIRKDLNLSLAEYS  87

Query  415  LFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLAT  594
            +F SIL  GAM G ITSG I++F+GRKG MR++++FC+ GWLAI FA+G L++DIGR+ T
Sbjct  88   VFASILAIGAMIGGITSGHISNFIGRKGTMRVAAIFCIIGWLAIGFAEGVLLLDIGRMCT  147

Query  595  GYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIV  774
            GYG+GVFSYVVPVFIAEIAPK+LRG  T+ N+LMI  G S+ +++GT++TWR LAL G++
Sbjct  148  GYGIGVFSYVVPVFIAEIAPKDLRGGFTSSNELMIQVGGSITYLLGTVLTWRMLALVGLI  207

Query  775  PCVVLGLGLCII  810
            P ++L LG+  +
Sbjct  208  PSLMLILGMFFV  219



>gb|ERN00836.1| hypothetical protein AMTR_s00103p00071860 [Amborella trichopoda]
Length=481

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 152/215 (71%), Gaps = 0/215 (0%)
 Frame = +1

Query  166  LIITRKMAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSC  345
            ++  R +  G  I+  + +      AA       D +    MV LSTFVAVCGS  FG  
Sbjct  1    MLTNRGLEGGYGIQKPEIKQPLISEAASSSCSNGDKEGSVLMVLLSTFVAVCGSFQFGCA  60

Query  346  AGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFC  525
             G+SSPTQSAI  +L  S+ EYS+F SILT GAM GA+  G +AD+ GRKGAMR++++FC
Sbjct  61   LGFSSPTQSAIRNELGLSLYEYSVFASILTIGAMVGALMCGSLADYTGRKGAMRIAAIFC  120

Query  526  LAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVT  705
            L GW+A   +K A ++D+GRL+ GYG+GVFSYVVPV+IAE+APK+LRG L T+NQLM+  
Sbjct  121  LTGWVATGVSKDAWILDLGRLSVGYGIGVFSYVVPVYIAEVAPKDLRGGLGTMNQLMVGF  180

Query  706  GVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            G+S  +++GT++TWRTL LTGI+P ++L LGL +I
Sbjct  181  GISTVYLLGTILTWRTLTLTGIIPSLMLQLGLILI  215



>dbj|BAH01094.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52442.1| hypothetical protein OsJ_34588 [Oryza sativa Japonica Group]
Length=462

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 137/174 (79%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MV  ST VAV GS  FG   GYS+PTQS I +DL  S++EYS+FGSI+T GAM GA+ SG
Sbjct  23   MVIASTGVAVLGSFVFGVSIGYSAPTQSKIREDLQLSLSEYSVFGSIITIGAMIGAVASG  82

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
             +AD  GRKGAMR S++ C+ GWLAIFFA+GA+ +D GR  TG+G+GVFSYVVPVFIAEI
Sbjct  83   HLADISGRKGAMRTSALVCIVGWLAIFFAQGAVSLDFGRFCTGFGVGVFSYVVPVFIAEI  142

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            APK LRG LTTLNQL++ TG+SV +++GTMVTWR L + G+VP ++L +GL  I
Sbjct  143  APKALRGGLTTLNQLLVCTGLSVTYIVGTMVTWRMLVIAGLVPSIILIVGLSFI  196



>gb|KDO44994.1| hypothetical protein CISIN_1g011956mg [Citrus sinensis]
Length=321

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 129/173 (75%), Gaps = 0/173 (0%)
 Frame = +1

Query  292  VYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGP  471
            V LSTFVAVCGS  FGS  GYSSP QS I+ DL  S+AEYSLFGSILT GAM GAI SG 
Sbjct  37   VVLSTFVAVCGSYVFGSAIGYSSPAQSGITNDLGLSVAEYSLFGSILTIGAMIGAIMSGK  96

Query  472  IADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIA  651
            IAD++GR+G M  S + C+ GW+ I F+K A  +D+GRL  GYGMG+ SYVVPV+IAEI 
Sbjct  97   IADYIGRRGTMGFSDIVCIIGWVIIVFSKAAWWLDLGRLLVGYGMGLLSYVVPVYIAEIT  156

Query  652  PKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            PK LRG  TT++QLMI  GVS+ ++IG  + WR LAL G +PC+V  +GLC I
Sbjct  157  PKNLRGGFTTVHQLMICIGVSMTYLIGAFLNWRILALIGTIPCLVQLIGLCFI  209



>ref|XP_006838267.2| PREDICTED: sugar transporter ERD6-like 5 [Amborella trichopoda]
Length=440

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 139/174 (80%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MV LSTFVAVCGS  FG   G+SSPTQSAI  +L  S+ EYS+F SILT GAM GA+  G
Sbjct  1    MVLLSTFVAVCGSFQFGCALGFSSPTQSAIRNELGLSLYEYSVFASILTIGAMVGALMCG  60

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
             +AD+ GRKGAMR++++FCL GW+A   +K A ++D+GRL+ GYG+GVFSYVVPV+IAE+
Sbjct  61   SLADYTGRKGAMRIAAIFCLTGWVATGVSKDAWILDLGRLSVGYGIGVFSYVVPVYIAEV  120

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            APK+LRG L T+NQLM+  G+S  +++GT++TWRTL LTGI+P ++L LGL +I
Sbjct  121  APKDLRGGLGTMNQLMVGFGISTVYLLGTILTWRTLTLTGIIPSLMLQLGLILI  174



>ref|XP_003575758.2| PREDICTED: sugar transporter ERD6-like 16 [Brachypodium distachyon]
Length=440

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 138/174 (79%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MV+ ST VAV GS A+G   GYS+PTQ+ I QDL  +++EYS+FGS++T GAM GA+ SG
Sbjct  1    MVFASTGVAVLGSFAYGVAIGYSAPTQAEIRQDLQLTLSEYSVFGSVITIGAMIGAVASG  60

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
             IAD  GRKGAMR S++ C+ GWLAIFFA+ A  +D GR  TG+G+GVFSYVVPVFIAEI
Sbjct  61   QIADVAGRKGAMRASALVCIVGWLAIFFAQSAASLDFGRFCTGFGVGVFSYVVPVFIAEI  120

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            APK LRG LTTLNQL++ TG+SV +++GT+V+WR L + G+VPC++L +GL  I
Sbjct  121  APKALRGGLTTLNQLLVCTGLSVTYIVGTVVSWRMLVIAGLVPCMILIVGLFFI  174



>ref|XP_011623902.1| PREDICTED: sugar transporter ERD6-like 7 [Amborella trichopoda]
Length=484

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 152/210 (72%), Gaps = 2/210 (1%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDRW-MVYLSTFVAVCGSCAFGSCAGYSS  360
            M+  + +E+G +      +  PLI            MV LSTF+AV GS  FGS  G+SS
Sbjct  1    MSTSKHLEDGHSPREPE-ITEPLISNSSGGDNGSIAMVILSTFIAVSGSFEFGSAVGFSS  59

Query  361  PTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWL  540
            PTQSAI  +L+ S+AE+S+FGSILT GAM GAI SG +AD+VGRK  M  S++ CL GW+
Sbjct  60   PTQSAIRSELDLSLAEFSVFGSILTIGAMIGAIASGRLADYVGRKVTMGTSALCCLLGWI  119

Query  541  AIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVA  720
            AI F++G+  +DIGRLA GYG+GVFSYVVPV+IAEI PK LRG  TT+NQLMI TGVS A
Sbjct  120  AIAFSQGSWSLDIGRLAVGYGIGVFSYVVPVYIAEITPKSLRGGFTTVNQLMICTGVSFA  179

Query  721  FVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            +++GT++TWR L LTG++P +++ +GL ++
Sbjct  180  YILGTVLTWRVLTLTGLIPMLIMLVGLFVV  209



>ref|XP_010649824.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Vitis vinifera]
Length=472

 Score =   221 bits (564),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 147/196 (75%), Gaps = 12/196 (6%)
 Frame = +1

Query  259  KEDDSKTDRW--------MVYLSTFVAVCGSCAFGSC----AGYSSPTQSAISQDLNFSI  402
            +EDD  T R         +V+LST VAV GS  FG C      YSSPTQ+AI +DLN S+
Sbjct  28   EEDDDLTPRNTSQNGSLGVVWLSTTVAVWGSFQFGCCLNLQVHYSSPTQTAIRKDLNLSL  87

Query  403  AEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIG  582
            AEYS+F SIL  GAM G ITSG I++F+GRKG MR++++FC+ GWLAI FA+G L++DIG
Sbjct  88   AEYSVFASILAIGAMIGGITSGHISNFIGRKGTMRVAAIFCIIGWLAIGFAEGVLLLDIG  147

Query  583  RLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLAL  762
            R+ TGYG+GVFSYVVPVFIAEIAPK+LRG  T+ N+LMI  G S+ +++GT++TWR LAL
Sbjct  148  RMCTGYGIGVFSYVVPVFIAEIAPKDLRGGFTSSNELMIQVGGSITYLLGTVLTWRMLAL  207

Query  763  TGIVPCVVLGLGLCII  810
             G++P ++L LG+  +
Sbjct  208  VGLIPSLMLILGMFFV  223



>gb|KCW58929.1| hypothetical protein EUGRSUZ_H015511, partial [Eucalyptus grandis]
Length=277

 Score =   216 bits (549),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 131/180 (73%), Gaps = 6/180 (3%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MVY +TFVAVCGS  FG+CAGYSSPTQ AI ++L  S AEYS+FGSILTFG M GAIT G
Sbjct  1    MVYFTTFVAVCGSHEFGTCAGYSSPTQDAIVEELGLSTAEYSVFGSILTFGVMIGAITGG  60

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
            PIADFVGRK  MR++S  C+AGWLAI+FA+GAL +DIGRLATGYGMGVFSYVVP+FIAEI
Sbjct  61   PIADFVGRKWTMRIASALCVAGWLAIYFAEGALALDIGRLATGYGMGVFSYVVPIFIAEI  120

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLA------LTGIVPCVVLGLGLCII  810
             PK LRGALT + Q  I+   S   +       + LA      L  ++PC VL  GL  I
Sbjct  121  TPKNLRGALTAVKQAKILYEHSWLELQAWSYWQKALACSKFCPLASLIPCAVLLFGLFFI  180



>ref|XP_006433199.1| hypothetical protein CICLE_v10001032mg [Citrus clementina]
 gb|ESR46439.1| hypothetical protein CICLE_v10001032mg [Citrus clementina]
Length=361

 Score =   218 bits (555),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 128/173 (74%), Gaps = 0/173 (0%)
 Frame = +1

Query  292  VYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGP  471
            V LSTFVAVCGS  FGS  GYSSP QS I+ DL  S+AEYSLFGSILT GAM GAI SG 
Sbjct  37   VVLSTFVAVCGSYVFGSAIGYSSPAQSGITNDLGLSVAEYSLFGSILTIGAMIGAIMSGK  96

Query  472  IADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIA  651
            IAD++GR+G M  S + C+ GW  I F+K A  +D+GRL  GYGMG+ SYVVPV+IAEI 
Sbjct  97   IADYIGRRGTMGFSDIVCIIGWAIIVFSKAAWWLDLGRLLVGYGMGLLSYVVPVYIAEIT  156

Query  652  PKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            PK LRG  TT++QLMI  GVS+ ++IG  + WR LAL G +PC+V  +GLC I
Sbjct  157  PKNLRGGFTTVHQLMICIGVSMTYLIGAFLNWRILALIGTIPCLVQLIGLCFI  209



>ref|XP_010649825.1| PREDICTED: sugar transporter ERD6-like 16 isoform X3 [Vitis vinifera]
Length=461

 Score =   221 bits (562),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 147/196 (75%), Gaps = 12/196 (6%)
 Frame = +1

Query  259  KEDDSKTDRW--------MVYLSTFVAVCGSCAFGSC----AGYSSPTQSAISQDLNFSI  402
            +EDD  T R         +V+LST VAV GS  FG C      YSSPTQ+AI +DLN S+
Sbjct  28   EEDDDLTPRNTSQNGSLGVVWLSTTVAVWGSFQFGCCLNLQVHYSSPTQTAIRKDLNLSL  87

Query  403  AEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIG  582
            AEYS+F SIL  GAM G ITSG I++F+GRKG MR++++FC+ GWLAI FA+G L++DIG
Sbjct  88   AEYSVFASILAIGAMIGGITSGHISNFIGRKGTMRVAAIFCIIGWLAIGFAEGVLLLDIG  147

Query  583  RLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLAL  762
            R+ TGYG+GVFSYVVPVFIAEIAPK+LRG  T+ N+LMI  G S+ +++GT++TWR LAL
Sbjct  148  RMCTGYGIGVFSYVVPVFIAEIAPKDLRGGFTSSNELMIQVGGSITYLLGTVLTWRMLAL  207

Query  763  TGIVPCVVLGLGLCII  810
             G++P ++L LG+  +
Sbjct  208  VGLIPSLMLILGMFFV  223



>ref|XP_004248997.1| PREDICTED: sugar transporter ERD6-like 8 [Solanum lycopersicum]
Length=520

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 149/212 (70%), Gaps = 6/212 (3%)
 Frame = +1

Query  175  TRKMAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGY  354
               + +  ++EN   E    G    LI K    + + +MVY ST VAVCGS AFG+C GY
Sbjct  52   NNNIVSSGELENKMEEN---GHKEHLIVKH---REELFMVYFSTVVAVCGSYAFGTCVGY  105

Query  355  SSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAG  534
            SSPTQ +I  +L+ S ++YS+FGSILT GAM GAIT G IADF+GRKGAMR+SSV C AG
Sbjct  106  SSPTQFSIMDELSLSFSQYSIFGSILTTGAMLGAITGGRIADFLGRKGAMRLSSVICGAG  165

Query  535  WLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVS  714
            WLAI+ AK  +V+ +GR   GY +G+ SYVVP+F+ EI+P +LRGAL++ NQL IV G+S
Sbjct  166  WLAIYLAKEPMVLYLGRFLAGYSIGIISYVVPMFVGEISPNKLRGALSSTNQLSIVIGLS  225

Query  715  VAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             A+V+G  V WR LAL G++PC +L LGL  I
Sbjct  226  TAYVMGAFVGWRILALLGVIPCGLLFLGLFFI  257



>ref|XP_002512323.1| sugar transporter, putative [Ricinus communis]
 gb|EEF49775.1| sugar transporter, putative [Ricinus communis]
Length=488

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 134/174 (77%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            +V +ST +AV GS  FGS  GYSSPTQS I QDL+ S+AEYSLFGSILT GAM GAI SG
Sbjct  47   VVVMSTLIAVSGSYVFGSAVGYSSPTQSGIMQDLDLSVAEYSLFGSILTIGAMIGAIMSG  106

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
             IAD++GR+G M  S +FC+ GWLAI F+K +L +D+GRL  GYGMG+ SYVVPV+IAEI
Sbjct  107  RIADYIGRRGTMGFSEIFCIIGWLAIAFSKVSLWLDVGRLLVGYGMGLLSYVVPVYIAEI  166

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             PK LRG  TT++Q MI  GVSV ++IG  ++WRTLAL G +PC++  LGL +I
Sbjct  167  TPKNLRGGFTTVHQFMICCGVSVTYLIGAFISWRTLALIGTIPCLIQLLGLFLI  220



>ref|XP_006663074.1| PREDICTED: sugar transporter ERD6-like 16-like [Oryza brachyantha]
Length=463

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 135/174 (78%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MV  ST VAV GS  FG   GYS+PTQS I +DL  S++EYS+FGSI+T GAM GA+ SG
Sbjct  23   MVIASTGVAVLGSFVFGVSIGYSAPTQSKIREDLQLSLSEYSVFGSIITIGAMIGAVASG  82

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
             +AD  GRKGAMR S++ C+ GWLAIFFA+ A+ +D GR  TG+G+GVFSYVVPVFIAEI
Sbjct  83   HLADVTGRKGAMRASALACIVGWLAIFFAQSAVSLDFGRFCTGFGVGVFSYVVPVFIAEI  142

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            APK LRG LTTLNQL++ TG+SV +++GTMVTWR L + G+VP + L +GL  I
Sbjct  143  APKALRGGLTTLNQLLVCTGLSVTYIVGTMVTWRMLVIAGLVPSIALIIGLFFI  196



>ref|XP_002278654.3| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Vitis vinifera]
 gb|ADP37172.1| putative ERD6-like transporter [Vitis vinifera]
Length=488

 Score =   219 bits (558),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 153/220 (70%), Gaps = 15/220 (7%)
 Frame = +1

Query  175  TRKMAAGQDIENGKNEGSTAGMAAPLIGKEDD--------SKTDRWMVYLSTFVAVCGSC  330
            TR+    + +     +GS       +I +EDD         K    + +LST +AV GS 
Sbjct  7    TRQQDMTEPLIRQDEKGS-------IISEEDDDLKPENPSQKGSPGVEWLSTAIAVWGSF  59

Query  331  AFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRM  510
             FG C  Y+SPTQ+AI +DLN S+AEYS+F S+L  GAM G +TSG I+D +GRKG MR+
Sbjct  60   QFGCCVHYTSPTQTAIRKDLNLSLAEYSVFASVLAIGAMIGGLTSGHISDLIGRKGTMRV  119

Query  511  SSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQ  690
            ++ FC+ GWLAI F +G L++D+GR+ TGYG+G+FSYVVPVFIAEIAPK+LRG  T+LN+
Sbjct  120  AAAFCIVGWLAIGFTEGVLLLDLGRMCTGYGIGIFSYVVPVFIAEIAPKDLRGGFTSLNE  179

Query  691  LMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            LMI  G S+ +++GT++TWR LAL G++P ++L LG+  +
Sbjct  180  LMIQVGGSITYLLGTVLTWRMLALVGLIPSLMLILGMFFV  219



>gb|KDO44991.1| hypothetical protein CISIN_1g011956mg [Citrus sinensis]
Length=456

 Score =   218 bits (556),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 129/173 (75%), Gaps = 0/173 (0%)
 Frame = +1

Query  292  VYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGP  471
            V LSTFVAVCGS  FGS  GYSSP QS I+ DL  S+AEYSLFGSILT GAM GAI SG 
Sbjct  37   VVLSTFVAVCGSYVFGSAIGYSSPAQSGITNDLGLSVAEYSLFGSILTIGAMIGAIMSGK  96

Query  472  IADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIA  651
            IAD++GR+G M  S + C+ GW+ I F+K A  +D+GRL  GYGMG+ SYVVPV+IAEI 
Sbjct  97   IADYIGRRGTMGFSDIVCIIGWVIIVFSKAAWWLDLGRLLVGYGMGLLSYVVPVYIAEIT  156

Query  652  PKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            PK LRG  TT++QLMI  GVS+ ++IG  + WR LAL G +PC+V  +GLC I
Sbjct  157  PKNLRGGFTTVHQLMICIGVSMTYLIGAFLNWRILALIGTIPCLVQLIGLCFI  209



>ref|XP_012089453.1| PREDICTED: sugar transporter ERD6-like 8 [Jatropha curcas]
Length=479

 Score =   219 bits (557),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 147/222 (66%), Gaps = 18/222 (8%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLI--GKEDDSKTDRW-----------MVYLSTFVAVCG  324
            MA   D+E   ++GS   +  P +   KE   K +             MV LST +AV G
Sbjct  1    MAISADVE--YHDGS---LGEPFVVQKKETQHKHEHNEKSGAGVGGLGMVLLSTAIAVSG  55

Query  325  SCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAM  504
            S  FG C GYS+PTQ  I  DL+ S +EYS+FGSIL  GAM GAITSG IAD +GRKGAM
Sbjct  56   SFTFGCCVGYSAPTQLGIMNDLSLSYSEYSVFGSILNIGAMIGAITSGRIADLIGRKGAM  115

Query  505  RMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTL  684
            RMSS+ C+ GW++I  ++G L++D GRL TGY +G+ SYVVPVFIAEI PK+LRGAL + 
Sbjct  116  RMSSIICIVGWISILLSQGYLLLDFGRLLTGYSIGILSYVVPVFIAEITPKDLRGALASA  175

Query  685  NQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            NQ  IV GV   ++IG  V WR LALTG VPC+V+ +GLC I
Sbjct  176  NQFCIVFGVMAIYLIGAFVKWRILALTGNVPCLVMLVGLCFI  217



>gb|KDO44992.1| hypothetical protein CISIN_1g011956mg [Citrus sinensis]
Length=474

 Score =   219 bits (557),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 129/173 (75%), Gaps = 0/173 (0%)
 Frame = +1

Query  292  VYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGP  471
            V LSTFVAVCGS  FGS  GYSSP QS I+ DL  S+AEYSLFGSILT GAM GAI SG 
Sbjct  37   VVLSTFVAVCGSYVFGSAIGYSSPAQSGITNDLGLSVAEYSLFGSILTIGAMIGAIMSGK  96

Query  472  IADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIA  651
            IAD++GR+G M  S + C+ GW+ I F+K A  +D+GRL  GYGMG+ SYVVPV+IAEI 
Sbjct  97   IADYIGRRGTMGFSDIVCIIGWVIIVFSKAAWWLDLGRLLVGYGMGLLSYVVPVYIAEIT  156

Query  652  PKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            PK LRG  TT++QLMI  GVS+ ++IG  + WR LAL G +PC+V  +GLC I
Sbjct  157  PKNLRGGFTTVHQLMICIGVSMTYLIGAFLNWRILALIGTIPCLVQLIGLCFI  209



>ref|XP_006471873.1| PREDICTED: sugar transporter ERD6-like 5-like isoform X2 [Citrus 
sinensis]
Length=456

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 128/173 (74%), Gaps = 0/173 (0%)
 Frame = +1

Query  292  VYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGP  471
            V LSTFVAVCGS  FGS  GYSSP QS I+ DL  S+AEYSLFGSILT GAM GAI SG 
Sbjct  37   VVLSTFVAVCGSYVFGSAIGYSSPAQSGITNDLGLSVAEYSLFGSILTIGAMIGAIMSGK  96

Query  472  IADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIA  651
            IAD++GR+G M  S + C+ GW  I F+K A  +D+GRL  GYGMG+ SYVVPV+IAEI 
Sbjct  97   IADYIGRRGTMGFSDIVCIIGWAIIVFSKAAWWLDLGRLLVGYGMGLLSYVVPVYIAEIT  156

Query  652  PKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            PK LRG  TT++QLMI  GVS+ ++IG  + WR LAL G +PC+V  +GLC I
Sbjct  157  PKNLRGGFTTVHQLMICIGVSMTYLIGAFLNWRILALIGTIPCLVQLIGLCFI  209



>ref|XP_006433198.1| hypothetical protein CICLE_v10001032mg [Citrus clementina]
 ref|XP_006471872.1| PREDICTED: sugar transporter ERD6-like 5-like isoform X1 [Citrus 
sinensis]
 gb|ESR46438.1| hypothetical protein CICLE_v10001032mg [Citrus clementina]
Length=474

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 128/173 (74%), Gaps = 0/173 (0%)
 Frame = +1

Query  292  VYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGP  471
            V LSTFVAVCGS  FGS  GYSSP QS I+ DL  S+AEYSLFGSILT GAM GAI SG 
Sbjct  37   VVLSTFVAVCGSYVFGSAIGYSSPAQSGITNDLGLSVAEYSLFGSILTIGAMIGAIMSGK  96

Query  472  IADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIA  651
            IAD++GR+G M  S + C+ GW  I F+K A  +D+GRL  GYGMG+ SYVVPV+IAEI 
Sbjct  97   IADYIGRRGTMGFSDIVCIIGWAIIVFSKAAWWLDLGRLLVGYGMGLLSYVVPVYIAEIT  156

Query  652  PKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            PK LRG  TT++QLMI  GVS+ ++IG  + WR LAL G +PC+V  +GLC I
Sbjct  157  PKNLRGGFTTVHQLMICIGVSMTYLIGAFLNWRILALIGTIPCLVQLIGLCFI  209



>ref|XP_011023524.1| PREDICTED: sugar transporter ERD6-like 5 isoform X2 [Populus 
euphratica]
Length=381

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 133/186 (72%), Gaps = 1/186 (1%)
 Frame = +1

Query  256  GKEDDS-KTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSIL  432
            GKE     +   MV LST VAV GS  FGS  GYSSPTQS I +DL  S+AEYSLFGSIL
Sbjct  24   GKEQRGGSSATTMVVLSTLVAVSGSYVFGSAIGYSSPTQSGIMEDLGLSVAEYSLFGSIL  83

Query  433  TFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGV  612
            T GAM GAI SG IAD++GR+G M  S + C+ GW+ I F+K +  +D+GRL  GYGMG+
Sbjct  84   TIGAMIGAIMSGRIADYIGRRGTMGFSEIICIIGWMLITFSKASWWLDVGRLLVGYGMGL  143

Query  613  FSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLG  792
             SYV+PV+IAEI PK LRG  TT++QLMI  GVS+ ++IG  V+WR LAL G +PC+V  
Sbjct  144  LSYVIPVYIAEITPKNLRGGFTTVHQLMICCGVSITYLIGAFVSWRILALIGTIPCIVQI  203

Query  793  LGLCII  810
            +GL  I
Sbjct  204  VGLFFI  209



>gb|KJB45167.1| hypothetical protein B456_007G293200 [Gossypium raimondii]
Length=487

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 139/203 (68%), Gaps = 4/203 (2%)
 Frame = +1

Query  214  KNEGSTAGMAAPLIGKEDD----SKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAIS  381
              E    G+     G+E D    + +   MV LST VAVCGS  FG+  GYSSP Q+ I+
Sbjct  17   HKEKPRDGVVHGFSGEEQDGIKTTSSATTMVVLSTSVAVCGSYVFGTAIGYSSPAQTGIT  76

Query  382  QDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKG  561
             DL+ S+AEYS FGSILT GAM GA+ SG +AD++GRK  M  S +FC+ GWL I F+K 
Sbjct  77   DDLDLSVAEYSFFGSILTIGAMIGAVMSGRLADYIGRKRTMGFSEIFCIIGWLLILFSKS  136

Query  562  ALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMV  741
            AL +D GR+  GYGMG+ SYVVPV+IAE+ PK++RG  T+++QLMI  GVS+ ++IG   
Sbjct  137  ALWLDFGRMLVGYGMGLLSYVVPVYIAEVTPKDIRGGFTSVHQLMICCGVSITYLIGAFA  196

Query  742  TWRTLALTGIVPCVVLGLGLCII  810
            TWRTLAL G +PC++  LGL  I
Sbjct  197  TWRTLALIGTIPCLIQLLGLFFI  219



>ref|XP_012089129.1| PREDICTED: sugar transporter ERD6-like 5 [Jatropha curcas]
 gb|KDP23561.1| hypothetical protein JCGZ_23394 [Jatropha curcas]
Length=485

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 129/173 (75%), Gaps = 0/173 (0%)
 Frame = +1

Query  292  VYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGP  471
            V ++T +AV GS  FGS  GYSSPTQS I  DL  S+AEYSLFGSILT GAM GAI SG 
Sbjct  45   VVVTTLIAVSGSYVFGSAIGYSSPTQSGIMDDLGLSVAEYSLFGSILTIGAMVGAIMSGR  104

Query  472  IADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIA  651
            IAD++GR+G M  S +FC+ GWLAI F+K +  +D+GR+  GYGMG+ SYVVPVFIAEI 
Sbjct  105  IADYIGRRGIMGFSEIFCIIGWLAIAFSKASWWLDVGRMLVGYGMGLLSYVVPVFIAEIT  164

Query  652  PKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            PK LRG  TT++QLMI  GVSV ++IG  V+WR LAL G +PC+V  LGL  I
Sbjct  165  PKNLRGGFTTVHQLMICCGVSVTYLIGAFVSWRILALVGTIPCLVQLLGLFFI  217



>ref|XP_006375782.1| hypothetical protein POPTR_0013s02850g [Populus trichocarpa]
 gb|ERP53579.1| hypothetical protein POPTR_0013s02850g [Populus trichocarpa]
Length=409

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 130/174 (75%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MV LST VAV GS  FGS  GYSSPTQS I +DL  S+AEYSLFGSILT GAM GAI SG
Sbjct  36   MVVLSTLVAVSGSYVFGSAIGYSSPTQSGIMEDLGLSVAEYSLFGSILTIGAMIGAIMSG  95

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
             IAD++GR+G M  S + C+ GW+ I F+K +  +D+GRL  GYGMG+ SYV+P++IAEI
Sbjct  96   RIADYIGRRGTMGFSEIICIIGWMLITFSKASWWLDVGRLLVGYGMGLLSYVIPIYIAEI  155

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             PK LRG  TT++QLMI  GVS+ ++IG  ++WR+LAL G +PC+V  +GL  I
Sbjct  156  TPKNLRGGFTTVHQLMICCGVSITYLIGAFMSWRSLALIGTIPCIVQIVGLFFI  209



>gb|AAC64898.1| Similar to Beta integral membrane protein homolog gb|U43629 from 
A. thaliana [Arabidopsis thaliana]
Length=483

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 149/216 (69%), Gaps = 4/216 (2%)
 Frame = +1

Query  175  TRKMAAGQDIENGKNEGSTAGMAAP--LIGKE--DDSKTDRWMVYLSTFVAVCGSCAFGS  342
            T+K    +  E  + E   A +A    LI KE  D S T    + L+TFVAV GS  FGS
Sbjct  52   TKKDRITKRKEKMRGEIDEANLAPETSLINKENQDSSATITTTLLLTTFVAVSGSFVFGS  111

Query  343  CAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVF  522
              GYSSP QS ++++LN S+AEYSLFGSILT GAM GA  SG IAD +GR+  M  S +F
Sbjct  112  AIGYSSPVQSDLTKELNLSVAEYSLFGSILTIGAMIGAAMSGRIADMIGRRATMGFSEMF  171

Query  523  CLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  702
            C+ GWLAI+ +K A+ +D+GR   GYGMGVFS+VVPV+IAEI PK LRG  TT++QL+I 
Sbjct  172  CILGWLAIYLSKVAIWLDVGRFLVGYGMGVFSFVVPVYIAEITPKGLRGGFTTVHQLLIC  231

Query  703  TGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             GVSV +++G+ + WR LAL G++PCVV  +GL +I
Sbjct  232  LGVSVTYLLGSFIGWRILALIGMIPCVVQMMGLFVI  267



>ref|XP_003557831.1| PREDICTED: sugar transporter ERD6-like 16 [Brachypodium distachyon]
Length=502

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 143/208 (69%), Gaps = 5/208 (2%)
 Frame = +1

Query  202  IENGKNEGSTAGMAAPLIGKEDDS-----KTDRWMVYLSTFVAVCGSCAFGSCAGYSSPT  366
            + + K++ +    A   + ++ DS     +   WMV LST VAVCGS  FG+C GYS+PT
Sbjct  30   LRDHKDDAAAVEDAKIQVDEKVDSCGGGPEGSIWMVLLSTAVAVCGSFEFGTCVGYSAPT  89

Query  367  QSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAI  546
            QS I  ++  SI+E+++FGS+LT GAM GA+TSG +ADFVGRK  MR+S+  C+ GWL+I
Sbjct  90   QSGIVDEVGLSISEFAIFGSVLTIGAMIGAVTSGRLADFVGRKMTMRISATICIFGWLSI  149

Query  547  FFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFV  726
            +FAKGA ++  GR   GY  GV SYVVPVFIAEIAPK LRG L T NQL+I +G S  ++
Sbjct  150  YFAKGATMLYFGRTLLGYSTGVLSYVVPVFIAEIAPKNLRGGLATSNQLLICSGSSATYI  209

Query  727  IGTMVTWRTLALTGIVPCVVLGLGLCII  810
             G +V WR L L GI+PCV+L  GL  I
Sbjct  210  TGALVAWRNLVLVGILPCVLLLAGLFFI  237



>emb|CBI26146.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/224 (49%), Positives = 153/224 (68%), Gaps = 19/224 (8%)
 Frame = +1

Query  175  TRKMAAGQDIENGKNEGSTAGMAAPLIGKEDD--------SKTDRWMVYLSTFVAVCGSC  330
            TR+    + +     +GS       +I +EDD         K    + +LST +AV GS 
Sbjct  7    TRQQDMTEPLIRQDEKGS-------IISEEDDDLKPENPSQKGSPGVEWLSTAIAVWGSF  59

Query  331  AFGSC----AGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKG  498
             FG C      Y+SPTQ+AI +DLN S+AEYS+F S+L  GAM G +TSG I+D +GRKG
Sbjct  60   QFGCCLNLQVHYTSPTQTAIRKDLNLSLAEYSVFASVLAIGAMIGGLTSGHISDLIGRKG  119

Query  499  AMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALT  678
             MR+++ FC+ GWLAI F +G L++D+GR+ TGYG+G+FSYVVPVFIAEIAPK+LRG  T
Sbjct  120  TMRVAAAFCIVGWLAIGFTEGVLLLDLGRMCTGYGIGIFSYVVPVFIAEIAPKDLRGGFT  179

Query  679  TLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            +LN+LMI  G S+ +++GT++TWR LAL G++P ++L LG+  +
Sbjct  180  SLNELMIQVGGSITYLLGTVLTWRMLALVGLIPSLMLILGMFFV  223



>ref|XP_011023522.1| PREDICTED: sugar transporter ERD6-like 5 isoform X1 [Populus 
euphratica]
Length=477

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 133/186 (72%), Gaps = 1/186 (1%)
 Frame = +1

Query  256  GKEDDS-KTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSIL  432
            GKE     +   MV LST VAV GS  FGS  GYSSPTQS I +DL  S+AEYSLFGSIL
Sbjct  24   GKEQRGGSSATTMVVLSTLVAVSGSYVFGSAIGYSSPTQSGIMEDLGLSVAEYSLFGSIL  83

Query  433  TFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGV  612
            T GAM GAI SG IAD++GR+G M  S + C+ GW+ I F+K +  +D+GRL  GYGMG+
Sbjct  84   TIGAMIGAIMSGRIADYIGRRGTMGFSEIICIIGWMLITFSKASWWLDVGRLLVGYGMGL  143

Query  613  FSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLG  792
             SYV+PV+IAEI PK LRG  TT++QLMI  GVS+ ++IG  V+WR LAL G +PC+V  
Sbjct  144  LSYVIPVYIAEITPKNLRGGFTTVHQLMICCGVSITYLIGAFVSWRILALIGTIPCIVQI  203

Query  793  LGLCII  810
            +GL  I
Sbjct  204  VGLFFI  209



>ref|XP_002894602.1| hypothetical protein ARALYDRAFT_474748 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70861.1| hypothetical protein ARALYDRAFT_474748 [Arabidopsis lyrata subsp. 
lyrata]
Length=470

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 144/203 (71%), Gaps = 4/203 (2%)
 Frame = +1

Query  214  KNEGSTAGMAAP--LIGKE--DDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAIS  381
            K E   A +A    LI KE  D S T    + L+TFVAV GS  FGS  GYSSP QS ++
Sbjct  2    KGEIDEANLAPETSLIEKENQDSSATTTTTLLLTTFVAVSGSFVFGSAIGYSSPVQSDLT  61

Query  382  QDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKG  561
            +DLN S+AEYSLFGSILT GAM GA  SG IAD +GR+  M  S +FC+ GWL I+ +K 
Sbjct  62   KDLNLSVAEYSLFGSILTIGAMIGAAMSGRIADLIGRRATMGFSEMFCILGWLTIYLSKV  121

Query  562  ALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMV  741
            A+ +D+GR   GYGMGV S+VVPV+IAEI PK+LRG  TT++QLMI  GVSVA+++G+ +
Sbjct  122  AVWLDVGRFLVGYGMGVLSFVVPVYIAEITPKDLRGGFTTVHQLMICLGVSVAYLLGSFI  181

Query  742  TWRTLALTGIVPCVVLGLGLCII  810
             WR LAL G+VPCV+  +GL II
Sbjct  182  GWRILALIGLVPCVIQMMGLFII  204



>emb|CDP17983.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 143/199 (72%), Gaps = 2/199 (1%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSP  363
            MA+  DIE G  +G   G   PL+ K+DDS    +MV+LS+ +AVCGS A+GS  GYSSP
Sbjct  1    MASLPDIEKGGRDGKE-GSEMPLLEKKDDSN-GLYMVFLSSAIAVCGSFAYGSTVGYSSP  58

Query  364  TQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLA  543
             QS I ++L  S ++YS+FGSILT GAM GA+T G IAD +GRKGAMR+SS+ C AG +A
Sbjct  59   AQSPIMEELGLSYSQYSIFGSILTIGAMIGALTCGTIADAIGRKGAMRLSSMICTAGLMA  118

Query  544  IFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAF  723
            I+ AKG  ++ +GR  +GY +G+ SYV+PVF+ EI P +LRGA+ + NQL IV G++ ++
Sbjct  119  IYVAKGPNMLYLGRFLSGYSVGILSYVIPVFVGEITPNKLRGAIGSSNQLFIVAGLAASY  178

Query  724  VIGTMVTWRTLALTGIVPC  780
            V+G    WRTLAL G+ PC
Sbjct  179  VVGAFAGWRTLALFGLAPC  197



>ref|XP_006375783.1| hypothetical protein POPTR_0013s02850g [Populus trichocarpa]
 gb|ERP53580.1| hypothetical protein POPTR_0013s02850g [Populus trichocarpa]
Length=447

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 130/174 (75%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MV LST VAV GS  FGS  GYSSPTQS I +DL  S+AEYSLFGSILT GAM GAI SG
Sbjct  36   MVVLSTLVAVSGSYVFGSAIGYSSPTQSGIMEDLGLSVAEYSLFGSILTIGAMIGAIMSG  95

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
             IAD++GR+G M  S + C+ GW+ I F+K +  +D+GRL  GYGMG+ SYV+P++IAEI
Sbjct  96   RIADYIGRRGTMGFSEIICIIGWMLITFSKASWWLDVGRLLVGYGMGLLSYVIPIYIAEI  155

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             PK LRG  TT++QLMI  GVS+ ++IG  ++WR+LAL G +PC+V  +GL  I
Sbjct  156  TPKNLRGGFTTVHQLMICCGVSITYLIGAFMSWRSLALIGTIPCIVQIVGLFFI  209



>ref|XP_002319570.2| sugar transporter family protein [Populus trichocarpa]
 gb|EEE95493.2| sugar transporter family protein [Populus trichocarpa]
Length=477

 Score =   211 bits (538),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 130/174 (75%), Gaps = 0/174 (0%)
 Frame = +1

Query  289  MVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSG  468
            MV LST VAV GS  FGS  GYSSPTQS I +DL  S+AEYSLFGSILT GAM GAI SG
Sbjct  36   MVVLSTLVAVSGSYVFGSAIGYSSPTQSGIMEDLGLSVAEYSLFGSILTIGAMIGAIMSG  95

Query  469  PIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEI  648
             IAD++GR+G M  S + C+ GW+ I F+K +  +D+GRL  GYGMG+ SYV+P++IAEI
Sbjct  96   RIADYIGRRGTMGFSEIICIIGWMLITFSKASWWLDVGRLLVGYGMGLLSYVIPIYIAEI  155

Query  649  APKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
             PK LRG  TT++QLMI  GVS+ ++IG  ++WR+LAL G +PC+V  +GL  I
Sbjct  156  TPKNLRGGFTTVHQLMICCGVSITYLIGAFMSWRSLALIGTIPCIVQIVGLFFI  209



>ref|XP_007030780.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY11282.1| Major facilitator superfamily protein [Theobroma cacao]
Length=486

 Score =   211 bits (538),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 141/205 (69%), Gaps = 5/205 (2%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSA  375
            +  ++G  + S AG      G+   S +    V LSTFVAVCGS  FG+  GYSSP Q+ 
Sbjct  19   EKPQDGVGDCSGAGQ-----GETRISSSATTTVVLSTFVAVCGSYVFGTAIGYSSPAQTG  73

Query  376  ISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFA  555
            I  DL  S+A+YSLFGSILT GAM GA+ SG IAD++GRK  M  S VFC+ GWLAI F+
Sbjct  74   IVDDLGLSVAQYSLFGSILTIGAMIGAVMSGRIADYIGRKCTMGFSEVFCIVGWLAILFS  133

Query  556  KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGT  735
            K A  +D+GRL  GYGMG+ S+VVPV+IAE+ PK +RG  T+++QLMI  GVS+ ++IG 
Sbjct  134  KAAWWLDLGRLLVGYGMGLLSFVVPVYIAEVTPKNIRGGFTSVHQLMICCGVSITYLIGA  193

Query  736  MVTWRTLALTGIVPCVVLGLGLCII  810
              +WRTLAL G +PC++  LGL  I
Sbjct  194  FASWRTLALIGTIPCLMQLLGLFFI  218



>ref|XP_010684724.1| PREDICTED: sugar transporter ERD6-like 16 isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=398

 Score =   209 bits (531),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 145/209 (69%), Gaps = 1/209 (0%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSP  363
            MA  ++IE      + +    PL+      +    +V LS+F+ V GS AFG+C G+++P
Sbjct  1    MANKKNIEKAPYI-TKSDAKDPLLQLRKVDEGSFKIVVLSSFIIVTGSYAFGTCIGFTAP  59

Query  364  TQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLA  543
             Q AI +DL+ SIA++S FGSIL+ GA  GAITSG ++D+ GRK AMR+S +  L GW A
Sbjct  60   VQEAILRDLDLSIAQFSFFGSILSVGATIGAITSGHVSDYFGRKRAMRISCLITLIGWSA  119

Query  544  IFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAF  723
            I+F+KG+  +D+GRL TG G+GVFSYVVPV+I+EIAP  +RG L  LNQLMIV G+S   
Sbjct  120  IYFSKGSTSLDVGRLLTGLGIGVFSYVVPVYISEIAPTSIRGGLIALNQLMIVLGISCTM  179

Query  724  VIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            ++G + TWR LAL GI+PCVV+  GL II
Sbjct  180  LLGIVATWRQLALHGILPCVVMLFGLLII  208



>gb|KHG12383.1| hypothetical protein F383_10647 [Gossypium arboreum]
Length=476

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 137/203 (67%), Gaps = 4/203 (2%)
 Frame = +1

Query  214  KNEGSTAGMAAPLIGKEDD----SKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAIS  381
              E    G+     G+E D    + +   MV LSTFVAVCGS  FG+  GYSSP Q+ I+
Sbjct  17   HKEKPRDGVVHGFSGEELDGIKTTSSATTMVVLSTFVAVCGSYVFGTAIGYSSPAQTGIT  76

Query  382  QDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKG  561
             DL  S+AEYS FGSILT GAM GA+ SG IAD++GRK  M  S +FC+ GWL I F+K 
Sbjct  77   DDLGLSVAEYSFFGSILTIGAMIGAVMSGRIADYIGRKCTMGFSEIFCIIGWLLILFSKA  136

Query  562  ALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMV  741
            A  +D GR+  G GMG+ SYVVPV+IAE+ PK++RG  T+++QLMI  GVS+ ++IG   
Sbjct  137  AFWLDFGRMLVGCGMGLLSYVVPVYIAEVTPKDIRGGFTSVHQLMICCGVSITYLIGAFA  196

Query  742  TWRTLALTGIVPCVVLGLGLCII  810
            TWRTLAL G +PC++  LGL  I
Sbjct  197  TWRTLALIGTIPCLMQLLGLFFI  219



>ref|XP_010684723.1| PREDICTED: sugar transporter ERD6-like 16 isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=435

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 145/209 (69%), Gaps = 1/209 (0%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSP  363
            MA  ++IE      + +    PL+      +    +V LS+F+ V GS AFG+C G+++P
Sbjct  1    MANKKNIEKAPYI-TKSDAKDPLLQLRKVDEGSFKIVVLSSFIIVTGSYAFGTCIGFTAP  59

Query  364  TQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLA  543
             Q AI +DL+ SIA++S FGSIL+ GA  GAITSG ++D+ GRK AMR+S +  L GW A
Sbjct  60   VQEAILRDLDLSIAQFSFFGSILSVGATIGAITSGHVSDYFGRKRAMRISCLITLIGWSA  119

Query  544  IFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAF  723
            I+F+KG+  +D+GRL TG G+GVFSYVVPV+I+EIAP  +RG L  LNQLMIV G+S   
Sbjct  120  IYFSKGSTSLDVGRLLTGLGIGVFSYVVPVYISEIAPTSIRGGLIALNQLMIVLGISCTM  179

Query  724  VIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            ++G + TWR LAL GI+PCVV+  GL II
Sbjct  180  LLGIVATWRQLALHGILPCVVMLFGLLII  208



>gb|KHG12382.1| hypothetical protein F383_10647 [Gossypium arboreum]
Length=493

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 137/203 (67%), Gaps = 4/203 (2%)
 Frame = +1

Query  214  KNEGSTAGMAAPLIGKEDD----SKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAIS  381
              E    G+     G+E D    + +   MV LSTFVAVCGS  FG+  GYSSP Q+ I+
Sbjct  17   HKEKPRDGVVHGFSGEELDGIKTTSSATTMVVLSTFVAVCGSYVFGTAIGYSSPAQTGIT  76

Query  382  QDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKG  561
             DL  S+AEYS FGSILT GAM GA+ SG IAD++GRK  M  S +FC+ GWL I F+K 
Sbjct  77   DDLGLSVAEYSFFGSILTIGAMIGAVMSGRIADYIGRKCTMGFSEIFCIIGWLLILFSKA  136

Query  562  ALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMV  741
            A  +D GR+  G GMG+ SYVVPV+IAE+ PK++RG  T+++QLMI  GVS+ ++IG   
Sbjct  137  AFWLDFGRMLVGCGMGLLSYVVPVYIAEVTPKDIRGGFTSVHQLMICCGVSITYLIGAFA  196

Query  742  TWRTLALTGIVPCVVLGLGLCII  810
            TWRTLAL G +PC++  LGL  I
Sbjct  197  TWRTLALIGTIPCLMQLLGLFFI  219



>gb|ADW40547.1| vacuolar monosaccharide symporter 1 [Saccharum hybrid cultivar 
Q117]
Length=505

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 145/207 (70%), Gaps = 3/207 (1%)
 Frame = +1

Query  196  QDIENGKNEGSTAGMAAPL--IGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQ  369
            +D +  K +GS    A+     G+ D + + R MV LST VAVCGS  FG+C GYS+PTQ
Sbjct  35   EDHQESKIQGSPEEAASDCGSEGRPDAAGSLR-MVLLSTAVAVCGSFEFGTCVGYSAPTQ  93

Query  370  SAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIF  549
            S I  ++  SI+E+++FGSILT GAM GA+TSG +ADF+GRK  MR+S++ C+ GWL+I 
Sbjct  94   SGIVDEVGLSISEFAIFGSILTIGAMVGAVTSGRLADFLGRKMTMRISAIICIFGWLSIH  153

Query  550  FAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVI  729
             AK A+++  GR+  G+  GV SYVVPVFIAEIAPK LRG L T NQL+I +G S  ++I
Sbjct  154  LAKSAIMLYFGRILLGFSTGVLSYVVPVFIAEIAPKNLRGGLATSNQLLICSGSSATYII  213

Query  730  GTMVTWRTLALTGIVPCVVLGLGLCII  810
            G +V WR L L G++PCV+L  GL  I
Sbjct  214  GALVAWRNLVLVGLLPCVLLLAGLFFI  240



>ref|XP_008674205.1| PREDICTED: LOC100281158 isoform X2 [Zea mays]
Length=416

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 145/216 (67%), Gaps = 5/216 (2%)
 Frame = +1

Query  172  ITRKMAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTD---RWMVYLSTFVAVCGSCAFGS  342
            + R    G+  E+  ++GS    +    G  D  +TD     MV +ST VAVCGS  FG+
Sbjct  32   LLRHCHGGRKEED--DQGSKIRDSPEAEGASDCGRTDGGSLRMVLVSTAVAVCGSFEFGT  89

Query  343  CAGYSSPTQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVF  522
            C GYS+PTQS I +++  SI+E+++FGS+LT GAM GA+TSG +ADF+GRK  MR+S+  
Sbjct  90   CVGYSAPTQSGIVEEVGLSISEFAIFGSVLTVGAMVGAVTSGRLADFLGRKMTMRISATI  149

Query  523  CLAGWLAIFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIV  702
            C+ GWL+I  AK A+++  GR   G+  GV SYVVPVFIAEIAPK LRG L T NQL+I 
Sbjct  150  CIFGWLSIHLAKSAIMLYFGRTLLGFSTGVLSYVVPVFIAEIAPKNLRGGLATSNQLLIC  209

Query  703  TGVSVAFVIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            +G S  ++IG +V WR L L G+VPCV+L  GL  I
Sbjct  210  SGSSATYIIGALVAWRNLVLVGLVPCVLLLAGLFFI  245



>ref|XP_002465229.1| hypothetical protein SORBIDRAFT_01g034610 [Sorghum bicolor]
 gb|EER92227.1| hypothetical protein SORBIDRAFT_01g034610 [Sorghum bicolor]
Length=484

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 141/205 (69%), Gaps = 3/205 (1%)
 Frame = +1

Query  205  ENGKNEGSTAGMAAPLIGKED---DSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSA  375
            ++ K  GS    AA   G E+   D+     MV LST VAVCGS  FG+C GYS+PTQS 
Sbjct  36   DHDKIRGSPEEAAASDCGSEEGRPDAAGSLRMVLLSTAVAVCGSFEFGTCVGYSAPTQSG  95

Query  376  ISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFA  555
            I  ++  SI+E+++FGSILT GAM GA+TSG +ADF+GRK  MR+S+  C+ GWL+I  A
Sbjct  96   IVDEVGLSISEFAIFGSILTVGAMVGAVTSGRLADFLGRKMTMRISATICIFGWLSIHLA  155

Query  556  KGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGT  735
            K A+++  GR+  G+  GV SYVVPVFIAEIAPK LRG L T NQL+I +G S  ++IG 
Sbjct  156  KSAIMLYFGRILLGFSTGVLSYVVPVFIAEIAPKNLRGGLATSNQLLICSGSSATYIIGA  215

Query  736  MVTWRTLALTGIVPCVVLGLGLCII  810
            +V WR L L G++PCV+L  GL  I
Sbjct  216  LVAWRNLVLVGLLPCVLLLAGLYFI  240



>ref|XP_006301882.1| hypothetical protein CARUB_v10022354mg [Capsella rubella]
 gb|EOA34780.1| hypothetical protein CARUB_v10022354mg [Capsella rubella]
Length=464

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 139/201 (69%), Gaps = 2/201 (1%)
 Frame = +1

Query  214  KNEGSTAGMAAP--LIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAISQD  387
            + E   A +A    LI K +        +  +T VAV GS  FGS  GYSSP QS +++D
Sbjct  2    REEIDEADLAPETSLINKGNQESPTTTTLLFTTLVAVSGSFVFGSAIGYSSPVQSDLTKD  61

Query  388  LNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGAL  567
            LN S+AEYSLFGSILT GAM GA  SG IAD +GR+  M  S +FC+ GWLAI+ +K A+
Sbjct  62   LNLSVAEYSLFGSILTIGAMIGAAMSGRIADLIGRRATMGFSEMFCILGWLAIYLSKVAI  121

Query  568  VMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTW  747
             +D+GR   GYGMGV S+VVPV+IAEI PKELRG  TT++QLMI  GVSV +++G+ + W
Sbjct  122  WLDVGRFLVGYGMGVLSFVVPVYIAEITPKELRGGFTTVHQLMICLGVSVTYLLGSFIGW  181

Query  748  RTLALTGIVPCVVLGLGLCII  810
            R LAL G+VPCV+  +GL I+
Sbjct  182  RILALIGMVPCVIQMMGLFIV  202



>gb|KFK35614.1| hypothetical protein AALP_AA4G014000 [Arabis alpina]
Length=469

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 137/206 (67%), Gaps = 4/206 (2%)
 Frame = +1

Query  193  GQDIENGKNEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQS  372
            G++I N      +  +A        DS      + ++T VAV GS  FGS  GYSSP Q 
Sbjct  2    GREIHNTDLAPESLLLAK----YNQDSSAKTITLLITTLVAVSGSFVFGSAIGYSSPVQL  57

Query  373  AISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFF  552
             ++ DL  S+AEYSLFGSILT GAM GA  SG IAD VGR+  M  S +FC+ GWL I+ 
Sbjct  58   DLTNDLKLSVAEYSLFGSILTIGAMIGASMSGRIADLVGRRATMGFSEMFCILGWLTIYL  117

Query  553  AKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIG  732
            +K A  +D+GRL  GYGMGV S+VVPV+IAEI PK+LRG  TT++QLMI  GVSV +++G
Sbjct  118  SKVAFWLDVGRLLVGYGMGVLSFVVPVYIAEITPKDLRGGFTTVHQLMICLGVSVTYLLG  177

Query  733  TMVTWRTLALTGIVPCVVLGLGLCII  810
            + V WR LAL G+VPCVV  +GL II
Sbjct  178  SFVGWRVLALIGMVPCVVQMMGLFII  203



>ref|XP_010684722.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=469

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 145/209 (69%), Gaps = 1/209 (0%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSP  363
            MA  ++IE      + +    PL+      +    +V LS+F+ V GS AFG+C G+++P
Sbjct  1    MANKKNIEKAPYI-TKSDAKDPLLQLRKVDEGSFKIVVLSSFIIVTGSYAFGTCIGFTAP  59

Query  364  TQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLA  543
             Q AI +DL+ SIA++S FGSIL+ GA  GAITSG ++D+ GRK AMR+S +  L GW A
Sbjct  60   VQEAILRDLDLSIAQFSFFGSILSVGATIGAITSGHVSDYFGRKRAMRISCLITLIGWSA  119

Query  544  IFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAF  723
            I+F+KG+  +D+GRL TG G+GVFSYVVPV+I+EIAP  +RG L  LNQLMIV G+S   
Sbjct  120  IYFSKGSTSLDVGRLLTGLGIGVFSYVVPVYISEIAPTSIRGGLIALNQLMIVLGISCTM  179

Query  724  VIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            ++G + TWR LAL GI+PCVV+  GL II
Sbjct  180  LLGIVATWRQLALHGILPCVVMLFGLLII  208



>ref|XP_006361887.1| PREDICTED: sugar transporter ERD6-like 5-like [Solanum tuberosum]
Length=465

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 133/189 (70%), Gaps = 1/189 (1%)
 Frame = +1

Query  247  PLIGKEDDSKTDRWM-VYLSTFVAVCGSCAFGSCAGYSSPTQSAISQDLNFSIAEYSLFG  423
            PL+    D+     + V  ST VAV GS  FGS  G+SSP Q+ I +DL+ S+AEYS+FG
Sbjct  16   PLLSTGGDTPASATLAVVFSTLVAVSGSFVFGSAVGFSSPAQNGIIKDLDLSVAEYSVFG  75

Query  424  SILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKGALVMDIGRLATGYG  603
            SI T GAM GA+ SG +AD   R+GAM  S +FCL GWLAI F K AL +DIGRL  GYG
Sbjct  76   SIWTIGAMIGAVMSGKLADLFARRGAMGFSELFCLLGWLAIIFGKNALWLDIGRLLMGYG  135

Query  604  MGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMVTWRTLALTGIVPCV  783
            +G+ SYVVPV+IAEI PK LRGA TT+NQLMI  GVS+ +V+G ++ WR LA+ G +PC+
Sbjct  136  VGIISYVVPVYIAEITPKNLRGAFTTVNQLMICCGVSLMYVVGVIINWRLLAVIGAIPCI  195

Query  784  VLGLGLCII  810
            +  LGL  I
Sbjct  196  IQLLGLFFI  204



>ref|NP_850964.1| sugar transporter ERD6-like 5 [Arabidopsis thaliana]
 sp|Q3ECP7.2|ERDL5_ARATH RecName: Full=Sugar transporter ERD6-like 5 [Arabidopsis thaliana]
 gb|AEE33139.1| sugar transporter ERD6-like 5 [Arabidopsis thaliana]
Length=470

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 143/203 (70%), Gaps = 2/203 (1%)
 Frame = +1

Query  208  NGKNEGSTAGMAAPLIGKE--DDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSPTQSAIS  381
             G+ + +       LI KE  D S T    + L+TFVAV GS  FGS  GYSSP QS ++
Sbjct  2    RGEIDEANLAPETSLINKENQDSSATITTTLLLTTFVAVSGSFVFGSAIGYSSPVQSDLT  61

Query  382  QDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLAIFFAKG  561
            ++LN S+AEYSLFGSILT GAM GA  SG IAD +GR+  M  S +FC+ GWLAI+ +K 
Sbjct  62   KELNLSVAEYSLFGSILTIGAMIGAAMSGRIADMIGRRATMGFSEMFCILGWLAIYLSKV  121

Query  562  ALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAFVIGTMV  741
            A+ +D+GR   GYGMGVFS+VVPV+IAEI PK LRG  TT++QL+I  GVSV +++G+ +
Sbjct  122  AIWLDVGRFLVGYGMGVFSFVVPVYIAEITPKGLRGGFTTVHQLLICLGVSVTYLLGSFI  181

Query  742  TWRTLALTGIVPCVVLGLGLCII  810
             WR LAL G++PCVV  +GL +I
Sbjct  182  GWRILALIGMIPCVVQMMGLFVI  204



>ref|XP_010684721.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=473

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 145/209 (69%), Gaps = 1/209 (0%)
 Frame = +1

Query  184  MAAGQDIENGKNEGSTAGMAAPLIGKEDDSKTDRWMVYLSTFVAVCGSCAFGSCAGYSSP  363
            MA  ++IE      + +    PL+      +    +V LS+F+ V GS AFG+C G+++P
Sbjct  1    MANKKNIEKAPYI-TKSDAKDPLLQLRKVDEGSFKIVVLSSFIIVTGSYAFGTCIGFTAP  59

Query  364  TQSAISQDLNFSIAEYSLFGSILTFGAMAGAITSGPIADFVGRKGAMRMSSVFCLAGWLA  543
             Q AI +DL+ SIA++S FGSIL+ GA  GAITSG ++D+ GRK AMR+S +  L GW A
Sbjct  60   VQEAILRDLDLSIAQFSFFGSILSVGATIGAITSGHVSDYFGRKRAMRISCLITLIGWSA  119

Query  544  IFFAKGALVMDIGRLATGYGMGVFSYVVPVFIAEIAPKELRGALTTLNQLMIVTGVSVAF  723
            I+F+KG+  +D+GRL TG G+GVFSYVVPV+I+EIAP  +RG L  LNQLMIV G+S   
Sbjct  120  IYFSKGSTSLDVGRLLTGLGIGVFSYVVPVYISEIAPTSIRGGLIALNQLMIVLGISCTM  179

Query  724  VIGTMVTWRTLALTGIVPCVVLGLGLCII  810
            ++G + TWR LAL GI+PCVV+  GL II
Sbjct  180  LLGIVATWRQLALHGILPCVVMLFGLLII  208



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1697011271292