BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10876

Length=871
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009799724.1|  PREDICTED: vacuolar protein sorting-associat...    454   4e-155   Nicotiana sylvestris
ref|XP_009608526.1|  PREDICTED: vacuolar protein sorting-associat...    452   2e-154   Nicotiana tomentosiformis
ref|XP_010277681.1|  PREDICTED: vacuolar protein sorting-associat...    449   2e-153   Nelumbo nucifera [Indian lotus]
ref|XP_011074892.1|  PREDICTED: vacuolar protein sorting-associat...    449   3e-153   Sesamum indicum [beniseed]
ref|XP_006347715.1|  PREDICTED: vacuolar protein sorting-associat...    450   4e-153   Solanum tuberosum [potatoes]
ref|XP_004230072.1|  PREDICTED: vacuolar protein sorting-associat...    446   6e-152   Solanum lycopersicum
ref|XP_011074891.1|  PREDICTED: vacuolar protein sorting-associat...    440   6e-150   
gb|EYU22898.1|  hypothetical protein MIMGU_mgv1a005391mg                440   2e-149   Erythranthe guttata [common monkey flower]
emb|CBI19087.3|  unnamed protein product                                433   2e-149   Vitis vinifera
ref|XP_009413636.1|  PREDICTED: vacuolar protein sorting-associat...    438   6e-149   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002285827.1|  PREDICTED: vacuolar protein sorting-associat...    437   1e-148   Vitis vinifera
ref|XP_006472696.1|  PREDICTED: vacuolar protein sorting-associat...    432   2e-146   Citrus sinensis [apfelsine]
ref|XP_006434098.1|  hypothetical protein CICLE_v10001011mg             432   3e-146   Citrus clementina [clementine]
gb|KHG03201.1|  Vacuolar sorting-associated protein 9A -like protein    429   2e-145   Gossypium arboreum [tree cotton]
ref|XP_012078144.1|  PREDICTED: vacuolar protein sorting-associat...    428   6e-145   Jatropha curcas
gb|KJB64382.1|  hypothetical protein B456_010G046700                    427   2e-144   Gossypium raimondii
ref|XP_008782345.1|  PREDICTED: vacuolar protein sorting-associat...    436   2e-144   
ref|XP_007018921.1|  Vacuolar sorting protein 9 domain isoform 1        425   6e-144   
ref|XP_009394050.1|  PREDICTED: vacuolar protein sorting-associat...    424   1e-143   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010672212.1|  PREDICTED: vacuolar protein sorting-associat...    425   3e-143   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW70546.1|  hypothetical protein EUGRSUZ_F03739                     424   8e-143   Eucalyptus grandis [rose gum]
ref|XP_003526606.1|  PREDICTED: vacuolar protein sorting-associat...    422   9e-143   Glycine max [soybeans]
ref|XP_010063331.1|  PREDICTED: vacuolar protein sorting-associat...    422   1e-142   Eucalyptus grandis [rose gum]
ref|XP_011074893.1|  PREDICTED: vacuolar protein sorting-associat...    421   1e-142   
ref|NP_001141062.1|  uncharacterized protein LOC100273143               422   3e-142   Zea mays [maize]
ref|XP_010095511.1|  hypothetical protein L484_014940                   420   9e-142   Morus notabilis
ref|XP_007222254.1|  hypothetical protein PRUPE_ppa004752mg             421   1e-141   Prunus persica
gb|ABF95105.1|  Vacuolar sorting protein 9 domain containing prot...    420   1e-141   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004984708.1|  PREDICTED: vacuolar protein sorting-associat...    420   1e-141   Setaria italica
ref|XP_004515662.1|  PREDICTED: vacuolar protein sorting-associat...    420   2e-141   Cicer arietinum [garbanzo]
ref|XP_002468141.1|  hypothetical protein SORBIDRAFT_01g040290          419   3e-141   
ref|XP_002513841.1|  Vacuolar protein sorting-associated protein ...    419   4e-141   Ricinus communis
ref|XP_003522593.1|  PREDICTED: vacuolar protein sorting-associat...    418   4e-141   Glycine max [soybeans]
gb|EEC74907.1|  hypothetical protein OsI_10843                          418   5e-141   Oryza sativa Indica Group [Indian rice]
ref|XP_007136193.1|  hypothetical protein PHAVU_009G026000g             418   6e-141   Phaseolus vulgaris [French bean]
gb|KHN47064.1|  Vacuolar protein sorting-associated protein 9A          417   9e-141   Glycine soja [wild soybean]
ref|XP_006846608.1|  PREDICTED: vacuolar protein sorting-associat...    415   3e-140   Amborella trichopoda
ref|XP_010228835.1|  PREDICTED: vacuolar protein sorting-associat...    417   4e-140   Brachypodium distachyon [annual false brome]
ref|XP_008233931.1|  PREDICTED: vacuolar protein sorting-associat...    416   5e-140   Prunus mume [ume]
ref|XP_008378527.1|  PREDICTED: vacuolar protein sorting-associat...    414   3e-139   
ref|XP_008441683.1|  PREDICTED: vacuolar protein sorting-associat...    412   9e-139   
ref|XP_003601131.1|  Rab5 GDP/GTP exchange factor                       412   2e-138   Medicago truncatula
ref|XP_004138949.2|  PREDICTED: vacuolar protein sorting-associat...    411   2e-138   Cucumis sativus [cucumbers]
ref|XP_009367322.1|  PREDICTED: vacuolar protein sorting-associat...    411   3e-138   Pyrus x bretschneideri [bai li]
ref|XP_010530179.1|  PREDICTED: vacuolar protein sorting-associat...    410   1e-137   Tarenaya hassleriana [spider flower]
ref|XP_002306602.2|  hypothetical protein POPTR_0005s16300g             411   2e-137   Populus trichocarpa [western balsam poplar]
ref|XP_011006325.1|  PREDICTED: vacuolar protein sorting-associat...    410   3e-137   Populus euphratica
ref|XP_008658255.1|  PREDICTED: uncharacterized protein LOC100273...    404   1e-135   Zea mays [maize]
pdb|2EFC|A  Chain A, Ara7-GdpATVPS9A                                    395   4e-135   Arabidopsis thaliana [mouse-ear cress]
pdb|2EFH|A  Chain A, Ara7-GdpATVPS9A(D185N)                             393   2e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009367011.1|  PREDICTED: vacuolar protein sorting-associat...    400   4e-134   Pyrus x bretschneideri [bai li]
gb|EPS71524.1|  hypothetical protein M569_03234                         396   6e-134   Genlisea aurea
ref|XP_004300426.1|  PREDICTED: vacuolar protein sorting-associat...    399   7e-134   Fragaria vesca subsp. vesca
ref|XP_002883202.1|  vacuolar sorting protein 9 domain-containing...    401   1e-133   
ref|NP_566645.1|  guanine nucleotide exchange factor VPS9a              400   2e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466135.1|  PREDICTED: vacuolar protein sorting-associat...    398   2e-132   Camelina sativa [gold-of-pleasure]
ref|XP_010507992.1|  PREDICTED: vacuolar protein sorting-associat...    397   6e-132   Camelina sativa [gold-of-pleasure]
ref|XP_010487918.1|  PREDICTED: vacuolar protein sorting-associat...    396   1e-131   Camelina sativa [gold-of-pleasure]
ref|XP_009145754.1|  PREDICTED: vacuolar protein sorting-associat...    389   9e-130   Brassica rapa
emb|CDY51691.1|  BnaA05g36780D                                          387   1e-129   Brassica napus [oilseed rape]
ref|XP_006649789.1|  PREDICTED: vacuolar protein sorting-associat...    387   3e-129   
emb|CDY24616.1|  BnaC05g33000D                                          387   3e-129   Brassica napus [oilseed rape]
ref|XP_006399406.1|  hypothetical protein EUTSA_v10012815mg             394   9e-129   
ref|XP_006406463.1|  hypothetical protein EUTSA_v10020497mg             389   1e-128   Eutrema salsugineum [saltwater cress]
emb|CDX69912.1|  BnaA10g22610D                                          390   3e-127   
emb|CDY21574.1|  BnaC09g47180D                                          388   4e-127   Brassica napus [oilseed rape]
ref|XP_009122506.1|  PREDICTED: vacuolar protein sorting-associat...    390   4e-127   
gb|KFK39302.1|  hypothetical protein AALP_AA3G227000                    384   7e-127   Arabis alpina [alpine rockcress]
ref|XP_010228834.1|  PREDICTED: vacuolar protein sorting-associat...    358   2e-116   
ref|NP_196494.1|  vacuolar sorting protein 9 (VPS9) domain protein      359   5e-115   
gb|EMS67780.1|  hypothetical protein TRIUR3_13259                       351   4e-114   Triticum urartu
ref|XP_002873394.1|  hypothetical protein ARALYDRAFT_487743             357   7e-114   
emb|CDP21117.1|  unnamed protein product                                338   2e-113   Coffea canephora [robusta coffee]
ref|XP_006286460.1|  hypothetical protein CARUB_v10000364mg             352   1e-112   
ref|XP_001761544.1|  predicted protein                                  340   7e-110   
ref|XP_009145755.1|  PREDICTED: vacuolar protein sorting-associat...    336   3e-109   
ref|XP_011074894.1|  PREDICTED: vacuolar protein sorting-associat...    334   3e-109   Sesamum indicum [beniseed]
ref|XP_002265083.1|  PREDICTED: vacuolar protein sorting-associat...    329   2e-107   Vitis vinifera
ref|XP_010665494.1|  PREDICTED: vacuolar protein sorting-associat...    330   2e-107   Vitis vinifera
ref|XP_010926433.1|  PREDICTED: vacuolar protein sorting-associat...    328   9e-107   
ref|XP_011621043.1|  PREDICTED: vacuolar protein sorting-associat...    327   3e-106   
ref|XP_010530180.1|  PREDICTED: vacuolar protein sorting-associat...    326   2e-105   Tarenaya hassleriana [spider flower]
gb|EMT30391.1|  hypothetical protein F775_07589                         328   4e-105   
ref|XP_006371359.1|  hypothetical protein POPTR_0019s09420g             320   6e-104   
ref|XP_012073501.1|  PREDICTED: vacuolar protein sorting-associat...    317   1e-103   
ref|XP_002989534.1|  hypothetical protein SELMODRAFT_130016             322   2e-103   
ref|XP_008237814.1|  PREDICTED: vacuolar protein sorting-associat...    319   2e-103   Prunus mume [ume]
ref|XP_007199889.1|  hypothetical protein PRUPE_ppa007191mg             318   2e-103   Prunus persica
ref|XP_002964275.1|  hypothetical protein SELMODRAFT_81029              321   3e-103   
ref|XP_007019727.1|  Vacuolar sorting protein 9 domain isoform 3        315   4e-103   
ref|XP_012073500.1|  PREDICTED: vacuolar protein sorting-associat...    318   8e-103   Jatropha curcas
gb|KDO51372.1|  hypothetical protein CISIN_1g014956mg                   318   1e-102   Citrus sinensis [apfelsine]
ref|XP_008391861.1|  PREDICTED: vacuolar protein sorting-associat...    317   1e-102   
ref|XP_007019725.1|  Vacuolar sorting protein 9 domain isoform 1        317   1e-102   
ref|XP_006441804.1|  hypothetical protein CICLE_v10020271mg             318   2e-102   
ref|XP_006478314.1|  PREDICTED: vacuolar protein sorting-associat...    317   2e-102   Citrus sinensis [apfelsine]
gb|KDP36696.1|  hypothetical protein JCGZ_07987                         315   2e-102   Jatropha curcas
ref|XP_009347394.1|  PREDICTED: vacuolar protein sorting-associat...    316   3e-102   Pyrus x bretschneideri [bai li]
ref|XP_009347395.1|  PREDICTED: vacuolar protein sorting-associat...    315   4e-102   Pyrus x bretschneideri [bai li]
gb|AAP06853.1|  unknown protein                                         321   6e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010999499.1|  PREDICTED: vacuolar protein sorting-associat...    314   2e-101   Populus euphratica
ref|XP_010999498.1|  PREDICTED: vacuolar protein sorting-associat...    314   2e-101   Populus euphratica
ref|XP_010252346.1|  PREDICTED: vacuolar protein sorting-associat...    313   3e-101   Nelumbo nucifera [Indian lotus]
ref|XP_010063729.1|  PREDICTED: vacuolar protein sorting-associat...    313   5e-101   Eucalyptus grandis [rose gum]
ref|XP_010228836.1|  PREDICTED: vacuolar protein sorting-associat...    313   1e-100   
ref|XP_008803797.1|  PREDICTED: vacuolar protein sorting-associat...    310   7e-100   Phoenix dactylifera
ref|XP_010665496.1|  PREDICTED: vacuolar protein sorting-associat...    308   2e-99    Vitis vinifera
ref|XP_004290268.1|  PREDICTED: vacuolar protein sorting-associat...    307   6e-99    Fragaria vesca subsp. vesca
gb|KJB26934.1|  hypothetical protein B456_004G268000                    305   5e-98    Gossypium raimondii
gb|KJB26935.1|  hypothetical protein B456_004G268000                    305   5e-98    Gossypium raimondii
ref|XP_004499674.1|  PREDICTED: vacuolar protein sorting-associat...    302   6e-97    Cicer arietinum [garbanzo]
ref|XP_009404953.1|  PREDICTED: vacuolar protein sorting-associat...    299   8e-96    Musa acuminata subsp. malaccensis [pisang utan]
gb|AES68516.2|  vacuolar protein sorting-associated protein VPS9        299   1e-95    Medicago truncatula
ref|XP_007148693.1|  hypothetical protein PHAVU_005G006600g             298   4e-95    Phaseolus vulgaris [French bean]
ref|XP_004981098.1|  PREDICTED: vacuolar protein sorting-associat...    295   1e-94    
ref|XP_010927812.1|  PREDICTED: vacuolar protein sorting-associat...    295   3e-94    
ref|XP_010927811.1|  PREDICTED: vacuolar protein sorting-associat...    295   3e-94    
gb|ERN18990.1|  hypothetical protein AMTR_s00194p00047120               294   9e-94    Amborella trichopoda
ref|NP_001136555.1|  hypothetical protein                               293   1e-93    Zea mays [maize]
ref|XP_003523864.2|  PREDICTED: vacuolar protein sorting-associat...    294   2e-93    Glycine max [soybeans]
ref|XP_003598265.1|  Rab5 GDP/GTP exchange factor                       294   2e-93    
ref|XP_006652011.1|  PREDICTED: vacuolar protein sorting-associat...    285   4e-91    Oryza brachyantha
gb|EEC76506.1|  hypothetical protein OsI_14274                          281   1e-89    Oryza sativa Indica Group [Indian rice]
gb|EEE60276.1|  hypothetical protein OsJ_13323                          281   4e-89    Oryza sativa Japonica Group [Japonica rice]
gb|KHN44773.1|  Vacuolar protein sorting-associated protein 9A          273   2e-85    Glycine soja [wild soybean]
ref|XP_003559162.1|  PREDICTED: vacuolar protein sorting-associat...    270   9e-85    Brachypodium distachyon [annual false brome]
ref|XP_010252347.1|  PREDICTED: vacuolar protein sorting-associat...    269   2e-84    Nelumbo nucifera [Indian lotus]
ref|XP_011649084.1|  PREDICTED: vacuolar protein sorting-associat...    258   6e-80    Cucumis sativus [cucumbers]
ref|XP_003060633.1|  predicted protein                                  258   2e-78    Micromonas pusilla CCMP1545
ref|NP_001049631.1|  Os03g0262900                                       254   2e-78    
gb|KJB26932.1|  hypothetical protein B456_004G268000                    252   3e-78    Gossypium raimondii
emb|CBI16976.3|  unnamed protein product                                249   5e-78    Vitis vinifera
ref|XP_011628200.1|  PREDICTED: vacuolar protein sorting-associat...    251   2e-77    
ref|XP_009347396.1|  PREDICTED: vacuolar protein sorting-associat...    251   2e-77    
ref|XP_002504979.1|  predicted protein                                  250   3e-75    Micromonas commoda
gb|KJB26933.1|  hypothetical protein B456_004G268000                    236   2e-73    Gossypium raimondii
ref|XP_004295727.2|  PREDICTED: vacuolar protein sorting-associat...    236   3e-72    Fragaria vesca subsp. vesca
gb|KJB26931.1|  hypothetical protein B456_004G268000                    234   2e-71    Gossypium raimondii
ref|NP_001051858.1|  Os03g0842700                                       221   1e-67    
gb|KDO80822.1|  hypothetical protein CISIN_1g0118121mg                  213   1e-65    Citrus sinensis [apfelsine]
gb|KDO80820.1|  hypothetical protein CISIN_1g0118122mg                  219   3e-65    Citrus sinensis [apfelsine]
ref|XP_008661165.1|  PREDICTED: vacuolar protein sorting-associat...    212   7e-64    
gb|AFW88574.1|  hypothetical protein ZEAMMB73_536018                    212   9e-64    
gb|EMT32991.1|  hypothetical protein F775_07723                         211   9e-64    
ref|NP_001030728.1|  guanine nucleotide exchange factor VPS9a           211   9e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003083380.1|  Vacuolar assembly/sorting protein VPS9 (ISS)       213   2e-61    Ostreococcus tauri
ref|XP_005651348.1|  hypothetical protein COCSUDRAFT_59312              218   4e-61    Coccomyxa subellipsoidea C-169
ref|XP_010664267.1|  PREDICTED: vacuolar protein sorting-associat...    209   1e-60    Vitis vinifera
ref|XP_001693976.1|  guanine nucleotide exchange factor                 208   2e-59    Chlamydomonas reinhardtii
ref|XP_008338875.1|  PREDICTED: vacuolar protein sorting-associat...    205   2e-59    
ref|XP_001421331.1|  predicted protein                                  202   9e-58    Ostreococcus lucimarinus CCE9901
ref|XP_006297950.1|  hypothetical protein CARUB_v10013991mg             192   2e-54    
gb|ERM99753.1|  hypothetical protein AMTR_s00099p00124940               186   3e-54    Amborella trichopoda
ref|XP_008338874.1|  PREDICTED: vacuolar protein sorting-associat...    176   2e-50    
ref|XP_010252348.1|  PREDICTED: vacuolar protein sorting-associat...    179   5e-50    Nelumbo nucifera [Indian lotus]
ref|XP_004347671.2|  hypothetical protein CAOG_04920                    183   1e-49    Capsaspora owczarzaki ATCC 30864
gb|KJE94251.1|  hypothetical protein CAOG_004920                        183   1e-49    Capsaspora owczarzaki ATCC 30864
gb|AAS07379.1|  putative vacuolar sorting protein , 5'-partial          173   1e-49    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002956401.1|  hypothetical protein VOLCADRAFT_119357             185   3e-49    Volvox carteri f. nagariensis
ref|XP_006441803.1|  hypothetical protein CICLE_v10020271mg             176   7e-49    
emb|CEI94724.1|  hypothetical protein RMCBS344292_08929                 174   1e-48    Rhizopus microsporus
emb|CEG65654.1|  Putative Guanine nucleotide exchange factor Vps9       174   1e-48    Rhizopus microsporus
emb|CEG62775.1|  hypothetical protein RMATCC62417_00051                 176   2e-47    Rhizopus microsporus
emb|CDH48555.1|  related to vps9 (involved in vacuoletrafficking)       175   4e-46    Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS03506.1|  hypothetical protein LRAMOSA00908                      174   4e-46    Lichtheimia ramosa
gb|EPB92767.1|  hypothetical protein HMPREF1544_00496                   172   8e-46    Mucor circinelloides f. circinelloides 1006PhL
gb|EPB91334.1|  hypothetical protein HMPREF1544_01851                   170   2e-45    Mucor circinelloides f. circinelloides 1006PhL
gb|ESA06419.1|  hypothetical protein GLOINDRAFT_82458                   160   1e-43    
ref|XP_003286704.1|  hypothetical protein DICPUDRAFT_150717             166   6e-43    Dictyostelium purpureum
ref|XP_002674145.1|  predicted protein                                  164   2e-42    Naegleria gruberi strain NEG-M
gb|KFH69955.1|  hypothetical protein MVEG_04758                         165   5e-42    Mortierella verticillata NRRL 6337
gb|EXX51022.1|  Vps9p                                                   160   2e-41    Rhizophagus irregularis DAOM 197198w
emb|CEP07299.1|  hypothetical protein                                   160   3e-41    Parasitella parasitica
dbj|GAN10056.1|  guanine nucleotide exchange factor                     159   5e-41    Mucor ambiguus
ref|XP_002174022.1|  guanyl-nucleotide exchange factor Vps901           159   6e-41    Schizosaccharomyces japonicus yFS275
gb|EXX51021.1|  Vps9p                                                   159   8e-41    Rhizophagus irregularis DAOM 197198w
gb|ERS95192.1|  hypothetical protein HMPREF1624_08403                   160   2e-40    Sporothrix schenckii ATCC 58251
gb|KIH87120.1|  guanine nucleotide exchange factor                      160   2e-40    Sporothrix brasiliensis 5110
ref|XP_003652940.1|  hypothetical protein THITE_2114800                 159   3e-40    Thielavia terrestris NRRL 8126
gb|KJR89981.1|  hypothetical protein SPSK_05911                         160   3e-40    Sporothrix schenckii 1099-18
ref|XP_008869177.1|  hypothetical protein H310_06051                    157   4e-40    Aphanomyces invadans
gb|KIW67139.1|  hypothetical protein PV04_06411                         158   5e-40    Phialophora americana
gb|EEH17796.1|  hypothetical protein PABG_00359                         158   8e-40    Paracoccidioides brasiliensis Pb03
gb|EEH37209.2|  hypothetical protein PAAG_07765                         158   9e-40    Paracoccidioides lutzii Pb01
ref|XP_010758125.1|  hypothetical protein PADG_02772                    157   1e-39    Paracoccidioides brasiliensis Pb18
tpe|CBF75630.1|  TPA: guanine nucleotide exchange factor Vps9, pu...    157   1e-39    Aspergillus nidulans FGSC A4
gb|KIZ01817.1|  hypothetical protein MNEG_6145                          155   2e-39    Monoraphidium neglectum
gb|EQB49461.1|  hypothetical protein CGLO_11199                         155   2e-39    Colletotrichum gloeosporioides Cg-14
ref|XP_001243139.1|  hypothetical protein CIMG_07035                    157   2e-39    Coccidioides immitis RS
ref|XP_005850796.1|  hypothetical protein CHLNCDRAFT_140312             155   2e-39    Chlorella variabilis
gb|KJE96549.1|  hypothetical protein, variant                           154   3e-39    Capsaspora owczarzaki ATCC 30864
ref|XP_009522430.1|  hypothetical protein PHYSODRAFT_327908             157   3e-39    Phytophthora sojae
gb|EGD91802.2|  hypothetical protein TERG_08020                         155   3e-39    Trichophyton rubrum CBS 118892
ref|XP_007758222.1|  hypothetical protein A1O7_06026                    156   3e-39    Cladophialophora yegresii CBS 114405
ref|XP_003070197.1|  Vacuolar sorting protein 9 domain containing...    156   3e-39    Coccidioides posadasii C735 delta SOWgp
gb|EFW23197.1|  guanine nucleotide exchange factor Vps9                 156   3e-39    Coccidioides posadasii str. Silveira
ref|XP_008729052.1|  hypothetical protein G647_06510                    155   3e-39    Cladophialophora carrionii CBS 160.54
emb|CEP17622.1|  hypothetical protein                                   154   4e-39    Parasitella parasitica
ref|XP_639976.1|  vacuolar sorting protein 9 domain-containing pr...    155   4e-39    Dictyostelium discoideum AX4
gb|EEH06551.1|  vacuolar sorting-associated protein                     155   4e-39    Histoplasma capsulatum G186AR
gb|ELR07775.1|  hypothetical protein GMDG_00398                         156   4e-39    Pseudogymnoascus destructans 20631-21
ref|XP_004344475.1|  hypothetical protein CAOG_06854                    154   5e-39    Capsaspora owczarzaki ATCC 30864
emb|CAK43884.1|  unnamed protein product                                154   5e-39    Aspergillus niger
gb|EGC47352.1|  vacuolar sorting-associated protein                     155   6e-39    Histoplasma capsulatum H88
gb|KIV79896.1|  hypothetical protein PV11_07437                         155   7e-39    Exophiala sideris
ref|XP_003660286.1|  hypothetical protein MYCTH_2298407                 155   7e-39    Thermothelomyces thermophila ATCC 42464
ref|XP_003437304.1|  unnamed protein product                            155   8e-39    Podospora anserina S mat+
ref|XP_002628058.1|  guanine nucleotide exchange factor Vps9            155   8e-39    
gb|KFY04368.1|  hypothetical protein O988_00821                         154   8e-39    Pseudogymnoascus sp. VKM F-3808
ref|XP_006962723.1|  guanine nucleotide exchange factor                 154   8e-39    Trichoderma reesei QM6a
ref|XP_007747659.1|  hypothetical protein A1O5_08888                    154   9e-39    Cladophialophora psammophila CBS 110553
emb|CDO73317.1|  hypothetical protein BN946_scf185008.g79               154   9e-39    Trametes cinnabarina
ref|XP_007738290.1|  hypothetical protein A1O3_10009                    154   1e-38    Capronia epimyces CBS 606.96
gb|KIW85768.1|  hypothetical protein Z517_01160                         154   1e-38    Fonsecaea pedrosoi CBS 271.37
ref|XP_004361013.1|  vacuolar sorting protein 9 domain-containing...    156   1e-38    Cavenderia fasciculata
gb|KIW95181.1|  hypothetical protein Z519_03765                         154   1e-38    Cladophialophora bantiana CBS 173.52
gb|EFQ36027.1|  hypothetical protein GLRG_11171                         154   1e-38    Colletotrichum graminicola M1.001
gb|KIX94401.1|  hypothetical protein Z520_09787                         154   1e-38    Fonsecaea multimorphosa CBS 102226
ref|XP_007725461.1|  hypothetical protein A1O1_06392                    154   1e-38    Capronia coronata CBS 617.96
gb|EPQ64616.1|  guanine nucleotide exchange factor                      154   2e-38    Blumeria graminis f. sp. tritici 96224
gb|KDN65593.1|  hypothetical protein CSUB01_03125                       154   2e-38    Colletotrichum sublineola
emb|CCU75364.1|  vacuolar protein sorting-associated protein 9          154   2e-38    Blumeria graminis f. sp. hordei DH14
ref|XP_003174431.1|  hypothetical protein MGYG_04604                    154   2e-38    Nannizzia gypsea CBS 118893
gb|KIL95104.1|  hypothetical protein FAVG1_02036                        154   2e-38    Fusarium avenaceum
ref|XP_008711274.1|  hypothetical protein HMPREF1541_00747              154   2e-38    Cyphellophora europaea CBS 101466
gb|ETL50097.1|  hypothetical protein, variant 2                         152   2e-38    Phytophthora parasitica
gb|EPS33524.1|  hypothetical protein PDE_08486                          154   2e-38    Penicillium oxalicum 114-2
gb|ETI56956.1|  hypothetical protein, variant 2                         152   2e-38    Phytophthora parasitica P1569
gb|KIN01912.1|  hypothetical protein OIDMADRAFT_103171                  154   2e-38    Oidiodendron maius Zn
ref|XP_003710228.1|  vacuolar protein sorting-associated protein 9      153   2e-38    Magnaporthe oryzae 70-15
ref|XP_008890206.1|  hypothetical protein, variant 2                    152   2e-38    Phytophthora parasitica INRA-310
gb|KFY12804.1|  hypothetical protein V492_03654                         154   2e-38    Pseudogymnoascus sp. VKM F-4246
gb|EFA77417.1|  vacuolar sorting protein 9 domain-containing protein    152   3e-38    Heterostelium album PN500
gb|KIW46837.1|  hypothetical protein PV06_02469                         153   3e-38    Exophiala oligosperma
gb|KFY37167.1|  hypothetical protein V494_04868                         154   3e-38    Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|KIV88709.1|  hypothetical protein PV10_08367                         153   3e-38    Exophiala mesophila
gb|EGE08560.1|  guanine nucleotide exchange factor Vps9                 153   3e-38    Trichophyton equinum CBS 127.97
gb|KIW31945.1|  hypothetical protein PV07_03531                         153   3e-38    Cladophialophora immunda
ref|XP_002151505.1|  guanine nucleotide exchange factor Vps9, put...    152   3e-38    Talaromyces marneffei ATCC 18224
gb|EGD99859.1|  guanine nucleotide exchange factor Vps9                 153   4e-38    Trichophyton tonsurans CBS 112818
gb|EZF27115.1|  hypothetical protein H100_00911                         153   4e-38    Trichophyton rubrum MR850
gb|ETK96743.1|  hypothetical protein L915_00612                         152   4e-38    Phytophthora parasitica
ref|XP_003349944.1|  hypothetical protein SMAC_00836                    153   4e-38    Sordaria macrospora k-hell
gb|ETK96744.1|  hypothetical protein, variant 1                         152   4e-38    Phytophthora parasitica
gb|KDB21467.1|  hypothetical protein H109_06635                         153   4e-38    Trichophyton interdigitale MR816
ref|XP_003231721.1|  guanine nucleotide exchange factor Vps9            153   4e-38    Trichophyton rubrum CBS 118892
gb|EPX74057.1|  guanyl-nucleotide exchange factor Vps901                151   4e-38    Schizosaccharomyces octosporus yFS286
gb|EZF29427.1|  hypothetical protein H101_06898                         153   4e-38    Trichophyton interdigitale H6
ref|XP_002151507.1|  guanine nucleotide exchange factor Vps9, put...    152   4e-38    Talaromyces marneffei ATCC 18224
gb|ETI56954.1|  hypothetical protein F443_00670                         152   4e-38    Phytophthora parasitica P1569
ref|XP_008890204.1|  hypothetical protein PPTG_00552                    152   4e-38    Phytophthora parasitica INRA-310
gb|EXL74981.1|  hypothetical protein FOPG_09941                         153   4e-38    Fusarium oxysporum f. sp. conglutinans race 2 54008
ref|XP_002151504.1|  guanine nucleotide exchange factor Vps9, put...    152   4e-38    Talaromyces marneffei ATCC 18224
gb|ETL50095.1|  hypothetical protein L916_00614                         152   4e-38    Phytophthora parasitica
gb|KFY59455.1|  hypothetical protein V497_04265                         153   5e-38    Pseudogymnoascus sp. VKM F-4516 (FW-969)
gb|EXK88141.1|  hypothetical protein FOQG_08535                         153   5e-38    Fusarium oxysporum f. sp. raphani 54005
gb|EWZ50777.1|  hypothetical protein FOZG_01163                         153   5e-38    Fusarium oxysporum Fo47
ref|XP_011126163.1|  hypothetical protein AOL_s00173g119                153   5e-38    Arthrobotrys oligospora ATCC 24927
gb|EXA53019.1|  hypothetical protein FOVG_01029                         153   5e-38    Fusarium oxysporum f. sp. pisi HDV247
gb|EXM11175.1|  hypothetical protein FOIG_00974                         153   5e-38    Fusarium oxysporum f. sp. cubense tropical race 4 54006
gb|EWY93928.1|  hypothetical protein FOYG_06878                         153   5e-38    Fusarium oxysporum FOSC 3-a
ref|XP_007277574.1|  guanine nucleotide exchange factor vps9            153   5e-38    
gb|EXK48021.1|  hypothetical protein FOMG_01169                         153   5e-38    Fusarium oxysporum f. sp. melonis 26406
gb|EWZ91761.1|  hypothetical protein FOWG_07169                         153   5e-38    Fusarium oxysporum f. sp. lycopersici MN25
gb|EPY53885.1|  guanyl-nucleotide exchange factor Vps901                151   5e-38    Schizosaccharomyces cryophilus OY26
ref|XP_009156232.1|  hypothetical protein HMPREF1120_03895              152   5e-38    Exophiala dermatitidis NIH/UT8656
gb|KFX92725.1|  hypothetical protein V490_05209                         153   6e-38    Pseudogymnoascus sp. VKM F-3557
gb|EPT03040.1|  hypothetical protein FOMPIDRAFT_159853                  153   6e-38    Fomitopsis pinicola FP-58527 SS1
ref|XP_009256016.1|  hypothetical protein FPSE_04623                    153   6e-38    Fusarium pseudograminearum CS3096
ref|XP_007672411.1|  hypothetical protein BAUCODRAFT_46571              150   6e-38    Baudoinia panamericana UAMH 10762
gb|EWG37407.1|  hypothetical protein FVEG_01027                         152   6e-38    Fusarium verticillioides 7600
gb|KFY28523.1|  hypothetical protein V493_02885                         153   6e-38    Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|ELQ34182.1|  vacuolar protein sorting-associated protein 9           153   7e-38    Magnaporthe oryzae Y34
gb|KFZ09277.1|  hypothetical protein V502_08838                         152   7e-38    Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|ENH84210.1|  guanine nucleotide exchange factor vps9                 152   7e-38    
gb|KFY45677.1|  hypothetical protein V495_02857                         152   8e-38    Pseudogymnoascus sp. VKM F-4514 (FW-929)
dbj|GAM25876.1|  hypothetical protein SAMD00019534_090510               151   8e-38    Acytostelium subglobosum LB1
gb|KFY96609.1|  hypothetical protein V500_02400                         152   8e-38    Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|KIK01464.1|  hypothetical protein K443DRAFT_678328                   152   8e-38    Laccaria amethystina LaAM-08-1
ref|XP_007799630.1|  putative guanine nucleotide exchange factor ...    152   9e-38    
gb|KIW52856.1|  hypothetical protein PV05_08469                         152   9e-38    
gb|EHK50131.1|  hypothetical protein TRIATDRAFT_51127                   151   1e-37    
gb|KIW18347.1|  hypothetical protein PV08_02635                         151   1e-37    
gb|KIX04507.1|  hypothetical protein Z518_05377                         151   1e-37    
gb|EMR81772.1|  putative vacuolar protein sorting-associated prot...    152   1e-37    
gb|KGQ05533.1|  Vacuolar protein sorting-associated protein 9a          152   1e-37    
emb|CCD52288.1|  hypothetical protein BofuT4_P080830.1                  152   1e-37    
gb|KFY17319.1|  hypothetical protein V491_05036                         152   1e-37    
gb|KFY72315.1|  hypothetical protein V499_07540                         152   1e-37    
gb|KFZ16969.1|  hypothetical protein V501_01973                         152   1e-37    
ref|XP_008599866.1|  vacuolar protein sorting-associated protein        152   1e-37    
emb|CCT62370.1|  related to VPS9                                        151   1e-37    
gb|KFY51092.1|  hypothetical protein V496_08953                         152   2e-37    
gb|KFY99737.1|  hypothetical protein V498_00538                         152   2e-37    
dbj|BAE54917.1|  unnamed protein product                                149   2e-37    
ref|XP_011394233.1|  hypothetical protein NCU07301                      151   2e-37    
ref|XP_001874525.1|  predicted protein                                  151   2e-37    
gb|EHA26662.1|  hypothetical protein ASPNIDRAFT_172651                  151   2e-37    
ref|XP_001212311.1|  conserved hypothetical protein                     150   2e-37    
ref|XP_001389217.2|  guanine nucleotide exchange factor Vps9            150   3e-37    
gb|KIV99214.1|  hypothetical protein PV09_09078                         151   3e-37    
gb|EFX01654.1|  guanine nucleotide exchange factor                      151   3e-37    
gb|ESZ92227.1|  hypothetical protein SBOR_7392                          151   3e-37    
ref|XP_001592364.1|  hypothetical protein SS1G_06605                    150   3e-37    
ref|XP_007865032.1|  hypothetical protein GLOTRDRAFT_74843              150   4e-37    
gb|EHK17421.1|  hypothetical protein TRIVIDRAFT_42827                   149   5e-37    
ref|XP_008025409.1|  hypothetical protein SETTUDRAFT_178785             150   5e-37    
gb|EXL49699.1|  hypothetical protein FOCG_09956                         150   5e-37    
ref|XP_008038801.1|  hypothetical protein TRAVEDRAFT_58773              150   5e-37    
ref|XP_008081335.1|  VPS9                                               150   5e-37    
ref|XP_007598050.1|  hypothetical protein CFIO01_00248                  150   5e-37    
gb|EUN33074.1|  hypothetical protein COCVIDRAFT_83762                   149   6e-37    
ref|XP_007826991.1|  hypothetical protein PFICI_00219                   150   6e-37    
ref|XP_003295267.1|  hypothetical protein PTT_00152                     150   6e-37    
ref|XP_002341694.1|  guanine nucleotide exchange factor Vps9, put...    149   7e-37    
gb|KEF56424.1|  hypothetical protein A1O9_08005                         149   7e-37    
ref|XP_007682879.1|  hypothetical protein COCMIDRAFT_81389              149   7e-37    
gb|KKA23202.1|  Guanine nucleotide exchange factor Vps9                 149   8e-37    
ref|XP_003054273.1|  predicted protein                                  149   8e-37    
ref|NP_596110.2|  guanyl-nucleotide exchange factor Vps901 (predi...    147   8e-37    
gb|KIM34491.1|  hypothetical protein M408DRAFT_303717                   149   9e-37    
sp|O74396.3|VPS91_SCHPO  RecName: Full=Vacuolar protein sorting-a...    147   9e-37    
dbj|GAA81894.1|  guanine nucleotide exchange factor Vps9                149   1e-36    
gb|KHJ30718.1|  putative guanine nucleotide exchange factor             149   1e-36    
ref|XP_003856820.1|  vacuolar sorting protein 9-like protein            149   2e-36    
ref|XP_011115829.1|  hypothetical protein H072_10351                    149   2e-36    
gb|EMD95818.1|  hypothetical protein COCHEDRAFT_1200788                 148   2e-36    
ref|XP_007694864.1|  hypothetical protein COCSADRAFT_131503             149   2e-36    
ref|XP_001933477.1|  vacuolar protein sorting-associated protein 9      149   2e-36    
ref|XP_007715645.1|  hypothetical protein COCCADRAFT_39661              148   2e-36    
gb|KJX96685.1|  hypothetical protein TI39_contig606g00014               148   2e-36    
ref|XP_008617578.1|  hypothetical protein SDRG_13278                    146   2e-36    
emb|CCA22037.1|  conserved hypothetical protein                         146   3e-36    
gb|KEY76698.1|  guanine nucleotide exchange factor Vps9                 148   3e-36    
ref|XP_001266788.1|  guanine nucleotide exchange factor Vps9, put...    147   3e-36    
gb|EMD39246.1|  hypothetical protein CERSUDRAFT_112905                  147   3e-36    
ref|XP_001272101.1|  guanine nucleotide exchange factor Vps9, put...    147   3e-36    
ref|XP_751582.1|  guanine nucleotide exchange factor Vps9               147   3e-36    
gb|EDP50607.1|  guanine nucleotide exchange factor Vps9, putative       147   3e-36    
gb|KFA50824.1|  hypothetical protein S40293_05842                       148   4e-36    
gb|KFA63176.1|  hypothetical protein S40285_03253                       148   4e-36    
gb|KFA72589.1|  hypothetical protein S40288_10101                       148   4e-36    
gb|ETS64335.1|  hypothetical protein PaG_01181                          149   4e-36    
gb|KEQ72241.1|  hypothetical protein M436DRAFT_16856                    145   4e-36    
ref|XP_007919649.1|  hypothetical protein MYCFIDRAFT_13044              144   4e-36    
gb|KFH47236.1|  Vacuolar protein sorting-associated protein 9a-li...    147   4e-36    
dbj|GAD95680.1|  guanine nucleotide exchange factor Vps9, putative      147   4e-36    
ref|XP_007304427.1|  hypothetical protein STEHIDRAFT_121647             147   5e-36    
gb|KEY66165.1|  hypothetical protein S7711_05334                        147   6e-36    
gb|KJK62321.1|  Vacuolar sorting protein 9 VPS9 domain protein          147   6e-36    
emb|CEJ90448.1|  Putative Guanine nucleotide exchange factor            147   6e-36    
ref|XP_001799199.1|  hypothetical protein SNOG_08895                    147   7e-36    
gb|EJU03773.1|  hypothetical protein DACRYDRAFT_21223                   146   7e-36    
dbj|GAK67237.1|  conserved hypothetical protein                         148   7e-36    
ref|XP_007370072.1|  hypothetical protein DICSQDRAFT_112065             146   7e-36    
gb|KEQ83017.1|  hypothetical protein M438DRAFT_299250                   146   8e-36    
gb|KID77090.1|  guanine nucleotide exchange factor Vps9                 147   8e-36    
emb|CCA77889.1|  related to VPS9 (involved in vacuole trafficking)      145   8e-36    
ref|XP_002383150.1|  guanine nucleotide exchange factor Vps9, put...    146   9e-36    
gb|KJJ36738.1|  Vacuolar sorting protein 9 VPS9 domain protein          146   9e-36    
gb|KIP01499.1|  hypothetical protein PHLGIDRAFT_131242                  146   9e-36    
gb|KEQ58094.1|  hypothetical protein M437DRAFT_16978                    145   1e-35    
dbj|GAA98435.1|  hypothetical protein E5Q_05121                         145   1e-35    
ref|XP_007262519.1|  hypothetical protein FOMMEDRAFT_144395             146   1e-35    
emb|CCF43069.1|  hypothetical protein CH063_02984                       146   1e-35    
gb|EMF18009.1|  hypothetical protein SEPMUDRAFT_146890                  146   2e-35    
dbj|GAC75352.1|  vacuolar assembly/sorting protein VPS9                 147   2e-35    
ref|XP_009826725.1|  hypothetical protein H257_04052                    144   2e-35    
gb|EME50362.1|  hypothetical protein DOTSEDRAFT_69029                   145   2e-35    
gb|KDO24171.1|  hypothetical protein SPRG_10599                         143   2e-35    
dbj|GAC97871.1|  hypothetical protein PHSY_005459                       146   2e-35    
ref|XP_003837516.1|  hypothetical protein LEMA_P037500.1                145   3e-35    
ref|XP_002902158.1|  conserved hypothetical protein                     143   3e-35    
gb|EWC48970.1|  hypothetical protein DRE_00275                          145   3e-35    
ref|XP_002151506.1|  guanine nucleotide exchange factor Vps9, put...    143   3e-35    
gb|KEQ99349.1|  hypothetical protein AUEXF2481DRAFT_35251               144   3e-35    
emb|CCX16176.1|  Similar to Vacuolar protein sorting-associated p...    145   3e-35    
ref|XP_009221445.1|  vacuolar protein sorting-associated protein 9      145   4e-35    
emb|CCI45176.1|  unnamed protein product                                143   4e-35    
ref|XP_007293710.1|  guanine nucleotide exchange factor                 145   4e-35    
emb|CCI45175.1|  unnamed protein product                                143   5e-35    
emb|CCI45177.1|  unnamed protein product                                142   5e-35    
gb|KIE03185.1|  guanine nucleotide exchange factor Vps9                 144   5e-35    
gb|EXV02834.1|  vacuolar sorting protein 9 (VPS9) and CUE domain ...    144   5e-35    
dbj|GAM83529.1|  hypothetical protein ANO11243_015170                   142   5e-35    
gb|KJA23564.1|  hypothetical protein HYPSUDRAFT_39753                   144   6e-35    
gb|EKV04659.1|  Guanine nucleotide exchange factor Vps9, putative       144   6e-35    
emb|CCI45174.1|  unnamed protein product                                142   6e-35    
ref|XP_002367935.1|  vacuolar sorting protein 9 domain-containing...    145   6e-35    
gb|KFG63557.1|  vacuolar sorting protein 9 (vps9) domain-containi...    145   6e-35    
gb|KFH17556.1|  vacuolar sorting protein 9 (vps9) domain-containi...    145   7e-35    
gb|KJK79125.1|  hypothetical protein H634G_05940                        144   7e-35    
gb|EZF27116.1|  hypothetical protein H100_00911                         142   7e-35    
gb|KFG50815.1|  vacuolar sorting protein 9 (vps9) domain-containi...    145   7e-35    
ref|XP_011392133.1|  hypothetical protein UMAG_10209                    145   7e-35    
gb|EPR64172.1|  vacuolar sorting protein 9 (vps9) domain-containi...    145   7e-35    
ref|XP_006674729.1|  guanine nucleotide exchange factor Vps9            144   7e-35    
gb|KID66707.1|  guanine nucleotide exchange factor Vps9                 144   7e-35    
gb|KFH03126.1|  vacuolar sorting protein 9 (vps9) domain-containi...    145   8e-35    
gb|KKA26291.1|  hypothetical protein TD95_001756                        144   8e-35    
gb|KHN99969.1|  guanine nucleotide exchange factor Vps9                 144   8e-35    
gb|KIK23846.1|  hypothetical protein PISMIDRAFT_431115                  144   1e-34    
ref|XP_011413684.1|  PREDICTED: rab5 GDP/GTP exchange factor-like...    140   1e-34    
ref|XP_011027631.1|  PREDICTED: vacuolar protein sorting-associat...    133   1e-34    
gb|EKC23954.1|  Rab5 GDP/GTP exchange factor                            140   1e-34    
ref|XP_009548733.1|  hypothetical protein HETIRDRAFT_35794              141   1e-34    
ref|XP_011441797.1|  PREDICTED: rab5 GDP/GTP exchange factor-like...    140   1e-34    
gb|KII85928.1|  hypothetical protein PLICRDRAFT_115563                  142   1e-34    
ref|XP_011413683.1|  PREDICTED: rab5 GDP/GTP exchange factor-like...    140   1e-34    
gb|KDQ61512.1|  hypothetical protein JAAARDRAFT_30960                   143   2e-34    
emb|CDM36756.1|  Vacuolar sorting protein 9                             142   2e-34    
ref|XP_011441795.1|  PREDICTED: rab5 GDP/GTP exchange factor-like...    140   2e-34    
emb|CDI56173.1|  related to VPS9 (involved in vacuole trafficking)      144   2e-34    
ref|XP_009655634.1|  vacuolar protein sorting-associated protein        142   2e-34    
ref|XP_002466119.1|  hypothetical protein SORBIDRAFT_01g001730          134   3e-34    
gb|KIM44474.1|  hypothetical protein M413DRAFT_442446                   142   3e-34    
emb|CBQ70150.1|  related to VPS9 (involved in vacuole trafficking)      143   3e-34    
ref|XP_011316266.1|  hypothetical protein FGSG_00581                    142   3e-34    
gb|KIO34142.1|  hypothetical protein M407DRAFT_13574                    142   3e-34    
ref|XP_007776389.1|  hypothetical protein W97_00283                     142   3e-34    
tpg|DAA38362.1|  TPA: hypothetical protein ZEAMMB73_654747              133   3e-34    
ref|XP_007787498.1|  hypothetical protein EPUS_06191                    142   3e-34    
gb|EYE92745.1|  hypothetical protein EURHEDRAFT_461723                  141   3e-34    
gb|EKC27624.1|  Rab5 GDP/GTP exchange factor                            140   3e-34    
gb|EYB25638.1|  hypothetical protein FG05_00581                         142   4e-34    
ref|XP_003033439.1|  hypothetical protein SCHCODRAFT_67546              140   4e-34    
ref|XP_008889578.1|  vacuolar sorting protein 9 (vps9) domain-con...    143   4e-34    
ref|XP_004337173.1|  Vacuolar sorting protein 9 (VPS9) domain con...    139   4e-34    
gb|KJJ23831.1|  Ubiquitin system component Cue                          141   5e-34    
ref|XP_002910841.1|  guanine nucleotide exchange factor Vps9            142   5e-34    
ref|XP_002341695.1|  guanine nucleotide exchange factor Vps9, put...    139   5e-34    
ref|XP_007881103.1|  hypothetical protein PFL1_05380                    142   5e-34    
ref|XP_002564598.1|  Pc22g05650                                         141   5e-34    
ref|XP_002739424.1|  PREDICTED: rab5 GDP/GTP exchange factor-like       139   7e-34    
emb|CCE30603.1|  related to VPS9 (involved in vacuole trafficking)      142   8e-34    
gb|KIO10723.1|  hypothetical protein M404DRAFT_13500                    141   9e-34    
gb|EPE09104.1|  guanine nucleotide exchange factor                      141   1e-33    
gb|EMT61988.1|  Vacuolar protein sorting-associated protein 9a          140   1e-33    
gb|ENH60957.1|  Vacuolar protein sorting-associated protein 9a          140   1e-33    
gb|KIK56317.1|  hypothetical protein GYMLUDRAFT_47084                   140   1e-33    
ref|XP_003883325.1|  ADL349Wp, related                                  141   1e-33    
gb|KGO78515.1|  Vacuolar sorting protein 9, subgroup                    140   2e-33    
emb|CCF49846.1|  related to VPS9 (involved in vacuole trafficking)      140   2e-33    
gb|KDQ06115.1|  hypothetical protein BOTBODRAFT_39806                   140   2e-33    
gb|KGO37985.1|  Vacuolar sorting protein 9, subgroup                    140   2e-33    
ref|XP_011027632.1|  PREDICTED: vacuolar protein sorting-associat...    129   2e-33    
ref|XP_002848533.1|  vacuolar protein sorting-associated protein 9      139   2e-33    
gb|KIY63586.1|  hypothetical protein CYLTODRAFT_493795                  140   2e-33    
dbj|BAC40915.1|  unnamed protein product                                137   2e-33    
ref|XP_006386385.1|  hypothetical protein POPTR_0002s09030g             134   2e-33    
gb|KDB14524.1|  guanine nucleotide exchange factor Vps9                 140   3e-33    
gb|KIK38445.1|  hypothetical protein CY34DRAFT_809337                   139   4e-33    
ref|XP_006461916.1|  hypothetical protein AGABI2DRAFT_178887            139   4e-33    
gb|KIR68108.1|  vacuolar protein sorting-associated protein 9           138   5e-33    
ref|XP_001635384.1|  predicted protein                                  136   5e-33    
gb|KIM68312.1|  hypothetical protein SCLCIDRAFT_106533                  139   5e-33    
gb|KIR88741.1|  vacuolar protein sorting-associated protein 9           137   6e-33    
ref|XP_007844230.1|  guanine nucleotide exchange factor vps9            138   7e-33    
gb|KIR49239.1|  vacuolar protein sorting-associated protein 9           137   7e-33    
gb|KDR80762.1|  hypothetical protein GALMADRAFT_241195                  138   7e-33    
ref|XP_007327199.1|  hypothetical protein AGABI1DRAFT_54776             138   7e-33    
gb|EST07188.1|  hypothetical protein PSEUBRA_SCAF21g03421               139   8e-33    
gb|EGN96863.1|  hypothetical protein SERLA73DRAFT_170228                137   1e-32    
gb|KJZ78359.1|  hypothetical protein HIM_02397                          137   2e-32    
ref|XP_003195268.1|  hypothetical protein CGB_G3250C                    135   3e-32    
gb|KIY35842.1|  vacuolar protein sorting-associated protein 9           135   3e-32    
emb|CCV00363.1|  unnamed protein product                                134   4e-32    
gb|KJE01132.1|  vacuolar protein sorting-associated protein 9           135   4e-32    
gb|KIJ20973.1|  hypothetical protein PAXINDRAFT_165782                  136   4e-32    
gb|KGB76441.1|  hypothetical protein CNBG_2279                          135   4e-32    
ref|XP_001729850.1|  hypothetical protein MGL_2836                      135   5e-32    
gb|KIR98989.1|  vacuolar protein sorting-associated protein 9           135   5e-32    
gb|KIR27600.1|  vacuolar protein sorting-associated protein 9           135   5e-32    
gb|KIR41942.1|  vacuolar protein sorting-associated protein 9           135   6e-32    
gb|KIR33314.1|  vacuolar protein sorting-associated protein 9           135   6e-32    
ref|XP_005839401.1|  hypothetical protein GUITHDRAFT_101593             133   7e-32    
ref|XP_007873026.1|  hypothetical protein PNEG_01111                    133   8e-32    
ref|XP_787397.3|  PREDICTED: rab5 GDP/GTP exchange factor isoform X6    133   9e-32    
ref|XP_011679348.1|  PREDICTED: rab5 GDP/GTP exchange factor isof...    133   1e-31    
gb|KIK94524.1|  hypothetical protein PAXRUDRAFT_782707                  135   1e-31    
ref|XP_007343850.1|  hypothetical protein AURDEDRAFT_113204             134   1e-31    
ref|XP_007005668.1|  hypothetical protein TREMEDRAFT_32532              132   2e-31    
ref|XP_012050914.1|  vacuolar protein sorting-associated protein 9      134   2e-31    
gb|KIJ65541.1|  hypothetical protein HYDPIDRAFT_27542                   134   2e-31    
ref|XP_005828015.1|  hypothetical protein GUITHDRAFT_40600              126   3e-31    
gb|KIM90409.1|  hypothetical protein PILCRDRAFT_84427                   133   5e-31    
gb|AAT77029.1|  putative Vacuolar sorting protein (with alternati...    124   6e-31    
ref|XP_007894803.1|  PREDICTED: rab5 GDP/GTP exchange factor            130   9e-31    
ref|XP_008872377.1|  hypothetical protein H310_08430                    130   9e-31    
gb|KID90081.1|  guanine nucleotide exchange factor Vps9                 132   1e-30    
ref|XP_002840628.1|  hypothetical protein                               130   2e-30    
ref|XP_572005.1|  hypothetical protein CNG02570                         130   2e-30    
emb|CDM85288.1|  unnamed protein product                                124   2e-30    
ref|XP_007403030.1|  hypothetical protein PHACADRAFT_214810             128   2e-30    
ref|XP_774239.1|  hypothetical protein CNBG2200                         130   3e-30    
gb|KIL69228.1|  hypothetical protein M378DRAFT_157476                   129   3e-30    
gb|KDO80823.1|  hypothetical protein CISIN_1g0118121mg                  120   3e-30    
gb|EKC98355.1|  hypothetical protein A1Q2_07369                         131   4e-30    
ref|XP_504692.1|  YALI0E32593p                                          128   4e-30    
ref|XP_007809384.1|  guanine nucleotide exchange factor Vps9            130   4e-30    



>ref|XP_009799724.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Nicotiana sylvestris]
Length=481

 Score =   454 bits (1168),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 229/258 (89%), Positives = 241/258 (93%), Gaps = 2/258 (1%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN DV GSSTAPLTWHDFL+RMR PSA DFVK IKSFIVSF NNAPD ERDS AVQEFL
Sbjct  1    MENNDVLGSSTAPLTWHDFLQRMRDPSATDFVKGIKSFIVSFLNNAPDAERDSAAVQEFL  60

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
            GNME AFRAHSLWAGCSEEELESAGEGLEKYVMTKLF+  FAS PEDVKVD+QL+EKIAL
Sbjct  61   GNMETAFRAHSLWAGCSEEELESAGEGLEKYVMTKLFTRTFASFPEDVKVDEQLHEKIAL  120

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQFVRPENLDIKPVF+NE+SWLLAQKEL KINMY+APRDKL+CILNCCKVINNLL   S
Sbjct  121  IQQFVRPENLDIKPVFENESSWLLAQKELQKINMYRAPRDKLVCILNCCKVINNLL--TS  178

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +SANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR QTRLVSEAAYFFTN+LSAE
Sbjct  179  VSANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRRQTRLVSEAAYFFTNILSAE  238

Query  816  SFIMNIDAKALSMDETEF  869
            SFI+NIDAKALSMD+TEF
Sbjct  239  SFILNIDAKALSMDDTEF  256



>ref|XP_009608526.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Nicotiana tomentosiformis]
Length=482

 Score =   452 bits (1164),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 228/258 (88%), Positives = 242/258 (94%), Gaps = 2/258 (1%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN DV GSSTAPLTWHDFL+RMR PSAADFVK IKSFIVSF NNAPD E+DS AVQEFL
Sbjct  1    MENNDVLGSSTAPLTWHDFLQRMRDPSAADFVKGIKSFIVSFLNNAPDAEKDSAAVQEFL  60

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
            GNME AFRAHSLWAGCSEEELESAGEGLEKYVMTKLF+  FAS PEDVKVD+QL+EKIAL
Sbjct  61   GNMETAFRAHSLWAGCSEEELESAGEGLEKYVMTKLFTRTFASFPEDVKVDEQLHEKIAL  120

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQFVRPENLDIKP+F+NE+SWLLAQKEL KINMY+APRDKL+CILNCCKVINNLL   S
Sbjct  121  IQQFVRPENLDIKPLFENESSWLLAQKELQKINMYRAPRDKLVCILNCCKVINNLL--TS  178

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +SANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR QTRLVSEAAYFFTN+LSAE
Sbjct  179  VSANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRRQTRLVSEAAYFFTNILSAE  238

Query  816  SFIMNIDAKALSMDETEF  869
            SFI+NIDAKALSMD+TEF
Sbjct  239  SFILNIDAKALSMDDTEF  256



>ref|XP_010277681.1| PREDICTED: vacuolar protein sorting-associated protein 9A [Nelumbo 
nucifera]
Length=465

 Score =   449 bits (1156),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 225/258 (87%), Positives = 243/258 (94%), Gaps = 0/258 (0%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENADVFGSSTAPLTWHDFLERMRQPSA +FVK+IKSFIVSFSNNAPDPE+DS AVQEFL
Sbjct  1    MENADVFGSSTAPLTWHDFLERMRQPSATEFVKSIKSFIVSFSNNAPDPEKDSAAVQEFL  60

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
             NME AFRAHSLWAGCSEEELESAGEGLEKYVMTKL++ VFAS PEDVK D+QL EK+AL
Sbjct  61   ANMEMAFRAHSLWAGCSEEELESAGEGLEKYVMTKLYTRVFASLPEDVKHDEQLSEKMAL  120

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQF+ PENLDIK  FQNE SWLLAQKEL KINMYKAPRDKL+CIL+CCKVINNLL+NAS
Sbjct  121  IQQFIHPENLDIKSTFQNEASWLLAQKELQKINMYKAPRDKLVCILSCCKVINNLLLNAS  180

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++NENPPGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R Q+RLVSEAAYFFTN+LSAE
Sbjct  181  IASNENPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRQSRLVSEAAYFFTNMLSAE  240

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAK+LSMDETEF
Sbjct  241  SFIYNIDAKSLSMDETEF  258



>ref|XP_011074892.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X2 [Sesamum indicum]
Length=459

 Score =   449 bits (1154),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 228/258 (88%), Positives = 241/258 (93%), Gaps = 0/258 (0%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            M+N+DVFGSSTAPLTWHDFLERMR PSAADFVKAIKSFIVSF NNAPD ERDS AVQEFL
Sbjct  1    MDNSDVFGSSTAPLTWHDFLERMRHPSAADFVKAIKSFIVSFLNNAPDAERDSVAVQEFL  60

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
            GNMEAAFRAH LWAG SEEELESAGEGLEKYVMTKLF+ VFAS PEDVK D+QLYEK+AL
Sbjct  61   GNMEAAFRAHPLWAGSSEEELESAGEGLEKYVMTKLFTRVFASIPEDVKADEQLYEKMAL  120

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQFVRPENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NAS
Sbjct  121  IQQFVRPENLDIKPTFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNAS  180

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            ++ANE+ PGAD+FLPVLIYVTIKANPPQLHSNL YIQRFR QTRLV+EAAYFFTN+LS E
Sbjct  181  LAANEDHPGADEFLPVLIYVTIKANPPQLHSNLSYIQRFRRQTRLVAEAAYFFTNMLSVE  240

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAKALSMDE EF
Sbjct  241  SFISNIDAKALSMDEVEF  258



>ref|XP_006347715.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Solanum tuberosum]
Length=503

 Score =   450 bits (1157),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 226/258 (88%), Positives = 242/258 (94%), Gaps = 2/258 (1%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN+DV GSSTAPLTWHDFL+RMR P+AADFVK+IKSFIVSF NNAPD ERDS AVQEFL
Sbjct  1    MENSDVLGSSTAPLTWHDFLQRMRDPTAADFVKSIKSFIVSFLNNAPDAERDSAAVQEFL  60

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
            GNME AFRAHSLWAGCSEEELESAGEGLEKYVMTKLF+  FAS PEDVKVD+QL+EKIAL
Sbjct  61   GNMETAFRAHSLWAGCSEEELESAGEGLEKYVMTKLFTRTFASLPEDVKVDEQLHEKIAL  120

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQFVRPENLDIKP+FQNE+SWLLAQKEL KINMY+APRDKL+CILNCCKVINNLL   S
Sbjct  121  IQQFVRPENLDIKPIFQNESSWLLAQKELQKINMYRAPRDKLVCILNCCKVINNLL--TS  178

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +SA +NPPGADDFLPVLIYVT+KANPPQLHSNLLYIQRFR QTRLVSEAAYFFTN+LSAE
Sbjct  179  VSAKDNPPGADDFLPVLIYVTVKANPPQLHSNLLYIQRFRRQTRLVSEAAYFFTNILSAE  238

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDA+ALSMDETEF
Sbjct  239  SFISNIDAQALSMDETEF  256



>ref|XP_004230072.1| PREDICTED: vacuolar protein sorting-associated protein 9A [Solanum 
lycopersicum]
Length=485

 Score =   446 bits (1148),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 225/258 (87%), Positives = 240/258 (93%), Gaps = 2/258 (1%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN+DV GSSTAPLTWHDFL+RMR PSAA+FVK+IKSFIVSF NN PD ERDS AVQEFL
Sbjct  1    MENSDVLGSSTAPLTWHDFLQRMRDPSAAEFVKSIKSFIVSFLNNVPDAERDSAAVQEFL  60

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
            GNME AFRAHSLWAGCSEEELESAGEGLEKYVMTKLF+  FAS PEDVKVD+QL+EKIAL
Sbjct  61   GNMETAFRAHSLWAGCSEEELESAGEGLEKYVMTKLFTRTFASLPEDVKVDEQLHEKIAL  120

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQFVRPENLDIKP FQNE+SWLLAQKEL KINMY+APRDKL+CILNCCKVINN+L   S
Sbjct  121  IQQFVRPENLDIKPTFQNESSWLLAQKELQKINMYRAPRDKLVCILNCCKVINNIL--TS  178

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +SA +NPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR QTRLVSEAAYFFTN+LSAE
Sbjct  179  VSAKDNPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRRQTRLVSEAAYFFTNILSAE  238

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDA+ALSMDETEF
Sbjct  239  SFISNIDARALSMDETEF  256



>ref|XP_011074891.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X1 [Sesamum indicum]
Length=463

 Score =   440 bits (1132),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 227/262 (87%), Positives = 240/262 (92%), Gaps = 4/262 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKS----FIVSFSNNAPDPERDSKAV  263
            M+N+DVFGSSTAPLTWHDFLERMR PSAADFVKAIK     FIVSF NNAPD ERDS AV
Sbjct  1    MDNSDVFGSSTAPLTWHDFLERMRHPSAADFVKAIKRYSCIFIVSFLNNAPDAERDSVAV  60

Query  264  QEFLGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYE  443
            QEFLGNMEAAFRAH LWAG SEEELESAGEGLEKYVMTKLF+ VFAS PEDVK D+QLYE
Sbjct  61   QEFLGNMEAAFRAHPLWAGSSEEELESAGEGLEKYVMTKLFTRVFASIPEDVKADEQLYE  120

Query  444  KIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLL  623
            K+ALIQQFVRPENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL
Sbjct  121  KMALIQQFVRPENLDIKPTFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLL  180

Query  624  INASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNL  803
            +NAS++ANE+ PGAD+FLPVLIYVTIKANPPQLHSNL YIQRFR QTRLV+EAAYFFTN+
Sbjct  181  LNASLAANEDHPGADEFLPVLIYVTIKANPPQLHSNLSYIQRFRRQTRLVAEAAYFFTNM  240

Query  804  LSAESFIMNIDAKALSMDETEF  869
            LS ESFI NIDAKALSMDE EF
Sbjct  241  LSVESFISNIDAKALSMDEVEF  262



>gb|EYU22898.1| hypothetical protein MIMGU_mgv1a005391mg [Erythranthe guttata]
Length=485

 Score =   440 bits (1132),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 220/258 (85%), Positives = 239/258 (93%), Gaps = 0/258 (0%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN+DVF SSTAPLTWHDFLERMR PSAA+FVK IKSFIVSF NNAPD ERDS AVQEFL
Sbjct  1    MENSDVFSSSTAPLTWHDFLERMRHPSAAEFVKGIKSFIVSFLNNAPDAERDSAAVQEFL  60

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
            GNME AFRAHSLWAG SEEELESAGEGLEKYVMTKLF+ VF S PEDVK D+QL+EK++L
Sbjct  61   GNMETAFRAHSLWAGSSEEELESAGEGLEKYVMTKLFTRVFTSIPEDVKADEQLHEKMSL  120

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQF+RPENLDIKP +QNETSWLLAQKEL KINMYKAPRDKLLCILNCCKVINNLL+NAS
Sbjct  121  IQQFIRPENLDIKPTYQNETSWLLAQKELQKINMYKAPRDKLLCILNCCKVINNLLLNAS  180

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +++NE+ PGAD+FLPVLIYVTIKANPPQLHSNL YIQRFR QTRLVSE+AY+FTN+LS E
Sbjct  181  LASNEDHPGADEFLPVLIYVTIKANPPQLHSNLSYIQRFRRQTRLVSESAYYFTNMLSVE  240

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAKALSM+ETEF
Sbjct  241  SFIANIDAKALSMEETEF  258



>emb|CBI19087.3| unnamed protein product [Vitis vinifera]
Length=301

 Score =   433 bits (1113),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 217/258 (84%), Positives = 240/258 (93%), Gaps = 0/258 (0%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENAD F SSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDS AVQEFL
Sbjct  1    MENADPFASSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSAAVQEFL  60

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
             NME AFRAH LWAGCSEEELESAGEGLEKYVMTKL++ VFAS P+D K+D+QL+EKI L
Sbjct  61   ANMEMAFRAHPLWAGCSEEELESAGEGLEKYVMTKLYTRVFASVPDDSKLDEQLFEKIGL  120

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+RPE LDIK  FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NAS
Sbjct  121  VQQFIRPEQLDIKTTFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNAS  180

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++NE+PPGAD+FLPVLIYVT+KANPPQLHSNLLYI R+R Q+R+V+EAAYFFTN+LSAE
Sbjct  181  IASNEDPPGADEFLPVLIYVTLKANPPQLHSNLLYILRYRRQSRMVAEAAYFFTNMLSAE  240

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NI+A++LSMDE EF
Sbjct  241  SFISNINAESLSMDEREF  258



>ref|XP_009413636.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Musa acuminata subsp. malaccensis]
Length=468

 Score =   438 bits (1126),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 219/256 (86%), Positives = 235/256 (92%), Gaps = 0/256 (0%)
 Frame = +3

Query  102  NADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGN  281
              D FGSSTAPLTWHDFLERMR PSAADFVK+IKSFIVSFSN APDPE DS AVQ+FL N
Sbjct  5    GGDAFGSSTAPLTWHDFLERMRHPSAADFVKSIKSFIVSFSNKAPDPENDSAAVQDFLTN  64

Query  282  MEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQ  461
            ME AFRAH+LWAG SEEELESAGEGLEKYVMTKLFS VFAS PED   D +LYEK+AL+Q
Sbjct  65   MEGAFRAHTLWAGSSEEELESAGEGLEKYVMTKLFSRVFASVPEDANSDGELYEKMALLQ  124

Query  462  QFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASIS  641
            QFVRPENLDI+P FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NASI+
Sbjct  125  QFVRPENLDIQPAFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASIA  184

Query  642  ANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESF  821
            +NENPPGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R Q+RLVSEAAYFFTN+LSAESF
Sbjct  185  SNENPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRQSRLVSEAAYFFTNILSAESF  244

Query  822  IMNIDAKALSMDETEF  869
            I NIDA+ALSMDE EF
Sbjct  245  IWNIDAQALSMDEIEF  260



>ref|XP_002285827.1| PREDICTED: vacuolar protein sorting-associated protein 9A isoform 
X1 [Vitis vinifera]
Length=463

 Score =   437 bits (1123),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 217/258 (84%), Positives = 240/258 (93%), Gaps = 0/258 (0%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENAD F SSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDS AVQEFL
Sbjct  1    MENADPFASSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSAAVQEFL  60

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
             NME AFRAH LWAGCSEEELESAGEGLEKYVMTKL++ VFAS P+D K+D+QL+EKI L
Sbjct  61   ANMEMAFRAHPLWAGCSEEELESAGEGLEKYVMTKLYTRVFASVPDDSKLDEQLFEKIGL  120

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+RPE LDIK  FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NAS
Sbjct  121  VQQFIRPEQLDIKTTFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNAS  180

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++NE+PPGAD+FLPVLIYVT+KANPPQLHSNLLYI R+R Q+R+V+EAAYFFTN+LSAE
Sbjct  181  IASNEDPPGADEFLPVLIYVTLKANPPQLHSNLLYILRYRRQSRMVAEAAYFFTNMLSAE  240

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NI+A++LSMDE EF
Sbjct  241  SFISNINAESLSMDEREF  258



>ref|XP_006472696.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Citrus sinensis]
Length=477

 Score =   432 bits (1111),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 219/258 (85%), Positives = 235/258 (91%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENADVF      L  HDFLERMRQPSAADFVK+IKSFIVSFSNNAPDPERDS AVQ FL
Sbjct  1    MENADVF------LGLHDFLERMRQPSAADFVKSIKSFIVSFSNNAPDPERDSAAVQSFL  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
             NMEAAFRAH LWAGCSEEEL+SAGEGLEKYVMTKLF+ VFAS P+DVK D+QL EKIAL
Sbjct  55   ANMEAAFRAHPLWAGCSEEELDSAGEGLEKYVMTKLFTRVFASIPDDVKTDEQLSEKIAL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQFVRPENLDIK  FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NAS
Sbjct  115  VQQFVRPENLDIKASFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I+ NENPPGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R Q+RLV EAAYFFTN+LSAE
Sbjct  175  IALNENPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRQSRLVGEAAYFFTNMLSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDA+ALSM+E+EF
Sbjct  235  SFISNIDAQALSMEESEF  252



>ref|XP_006434098.1| hypothetical protein CICLE_v10001011mg [Citrus clementina]
 gb|ESR47338.1| hypothetical protein CICLE_v10001011mg [Citrus clementina]
Length=477

 Score =   432 bits (1110),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 218/258 (84%), Positives = 234/258 (91%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENADVF      L  HDFLERMRQPSAADFVK+IKSFIVSFSNNAPDPERDS AVQ FL
Sbjct  1    MENADVF------LGLHDFLERMRQPSAADFVKSIKSFIVSFSNNAPDPERDSAAVQSFL  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
             NMEAAFRAH LWAGCSEEEL+SA EGLEKYVMTKLF+ VFAS P+DVK D+QL EKIAL
Sbjct  55   ANMEAAFRAHPLWAGCSEEELDSALEGLEKYVMTKLFTRVFASIPDDVKTDEQLSEKIAL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQFVRPENLDIK  FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NAS
Sbjct  115  VQQFVRPENLDIKASFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I+ NENPPGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R Q+RLV EAAYFFTN+LSAE
Sbjct  175  IALNENPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRQSRLVGEAAYFFTNMLSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDA+ALSM+E+EF
Sbjct  235  SFISNIDAQALSMEESEF  252



>gb|KHG03201.1| Vacuolar sorting-associated protein 9A -like protein [Gossypium 
arboreum]
Length=466

 Score =   429 bits (1103),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 218/258 (84%), Positives = 237/258 (92%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENADVF      L   DFLERMRQPSAADFVK+IKSFIVSFSNNAP+PERDS AVQ F 
Sbjct  1    MENADVF------LGLQDFLERMRQPSAADFVKSIKSFIVSFSNNAPEPERDSAAVQAFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
             NMEAAFRAH LWAGCSEEEL+SAGEGLEKYVMTKLF+ VFAS P+DVK+D+QL EK+AL
Sbjct  55   ANMEAAFRAHPLWAGCSEEELDSAGEGLEKYVMTKLFTRVFASLPDDVKLDEQLSEKMAL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQFVRPENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NAS
Sbjct  115  VQQFVRPENLDIKPAFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++NENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQR+R Q+RLVSEAAYFFTN+LSAE
Sbjct  175  IASNENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRYRRQSRLVSEAAYFFTNMLSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            +FI NIDAKALS++ETEF
Sbjct  235  AFISNIDAKALSLEETEF  252



>ref|XP_012078144.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Jatropha curcas]
 gb|KDP32736.1| hypothetical protein JCGZ_12028 [Jatropha curcas]
Length=468

 Score =   428 bits (1100),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 215/258 (83%), Positives = 238/258 (92%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            ME+ADVF      L  HDFLERMRQPSAADFVK+IKSFIVSFSNNAPDPERDS  VQ+FL
Sbjct  1    MESADVF------LGLHDFLERMRQPSAADFVKSIKSFIVSFSNNAPDPERDSALVQDFL  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              MEAAFRAH LWAGCS+EELESAGEGLEKYVMTKLF+ VFAS P+DVKVD+QL EK++L
Sbjct  55   AKMEAAFRAHPLWAGCSDEELESAGEGLEKYVMTKLFTRVFASIPDDVKVDEQLSEKMSL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQF+RPENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NAS
Sbjct  115  IQQFIRPENLDIKPTFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++NENPPGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R Q+RLV+EAAYFFTN+LSAE
Sbjct  175  IASNENPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRQSRLVAEAAYFFTNMLSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SF+ NIDAK++SM+ETEF
Sbjct  235  SFVSNIDAKSISMEETEF  252



>gb|KJB64382.1| hypothetical protein B456_010G046700 [Gossypium raimondii]
 gb|KJB64383.1| hypothetical protein B456_010G046700 [Gossypium raimondii]
Length=466

 Score =   427 bits (1097),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 217/258 (84%), Positives = 236/258 (91%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENADVF      L   DFLERMRQPSAADFVK+IKSFIVSFSNNAPDPERDS AVQ F 
Sbjct  1    MENADVF------LGLQDFLERMRQPSAADFVKSIKSFIVSFSNNAPDPERDSAAVQAFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
             NMEAAFRAH LWAGCSEEEL+SAGEGLEKYVMTKLF+ VFAS P+DVK+D+QL +K+AL
Sbjct  55   ANMEAAFRAHPLWAGCSEEELDSAGEGLEKYVMTKLFTRVFASLPDDVKLDEQLSQKMAL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQFVRPENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NAS
Sbjct  115  VQQFVRPENLDIKPAFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++NENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQR+R Q+RLVSEAAYFFTN+LSA 
Sbjct  175  IASNENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRYRRQSRLVSEAAYFFTNMLSAA  234

Query  816  SFIMNIDAKALSMDETEF  869
            +FI NIDAKALS++ETEF
Sbjct  235  AFISNIDAKALSLEETEF  252



>ref|XP_008782345.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Phoenix dactylifera]
Length=765

 Score =   436 bits (1122),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 219/256 (86%), Positives = 241/256 (94%), Gaps = 0/256 (0%)
 Frame = +3

Query  102  NADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGN  281
            ++D FGSSTAPLTWHDFLERMR PSAADFVK+IKSFIVSFSN APDPE+DS AVQEFL N
Sbjct  5    SSDAFGSSTAPLTWHDFLERMRHPSAADFVKSIKSFIVSFSNKAPDPEKDSFAVQEFLAN  64

Query  282  MEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQ  461
            ME AFRAH+LWAG SEEELESAGEGLEKYVMTKLF+ VFAS PEDVK DD+L+EK+AL+Q
Sbjct  65   MEGAFRAHTLWAGSSEEELESAGEGLEKYVMTKLFNRVFASLPEDVKHDDELFEKMALLQ  124

Query  462  QFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASIS  641
            QFVRPENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NASIS
Sbjct  125  QFVRPENLDIKPNFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASIS  184

Query  642  ANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESF  821
            +N+NPPGAD+FLPVLIYVTIKANPPQL+SNLLYIQR+R Q+RLV+EAAYFFTN+LSAESF
Sbjct  185  SNDNPPGADEFLPVLIYVTIKANPPQLYSNLLYIQRYRRQSRLVAEAAYFFTNILSAESF  244

Query  822  IMNIDAKALSMDETEF  869
            I NIDA++LSMDE EF
Sbjct  245  IWNIDAQSLSMDEVEF  260



>ref|XP_007018921.1| Vacuolar sorting protein 9 domain isoform 1 [Theobroma cacao]
 ref|XP_007018922.1| Vacuolar sorting protein 9 domain isoform 1 [Theobroma cacao]
 gb|EOY16146.1| Vacuolar sorting protein 9 domain isoform 1 [Theobroma cacao]
 gb|EOY16147.1| Vacuolar sorting protein 9 domain isoform 1 [Theobroma cacao]
Length=466

 Score =   425 bits (1093),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 219/258 (85%), Positives = 236/258 (91%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENADVF      L   DFLERMRQPSAADFVK+IKSFIVSFSNNAPDPERDS AVQ FL
Sbjct  1    MENADVF------LGLQDFLERMRQPSAADFVKSIKSFIVSFSNNAPDPERDSAAVQSFL  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
             NMEA FRAH LWAGCSEEEL+SAGEGLEKYVMTKLF+ VFAS P+DVK D+QL EK+AL
Sbjct  55   ANMEADFRAHPLWAGCSEEELDSAGEGLEKYVMTKLFTRVFASLPDDVKHDEQLSEKMAL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQFVRPENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NAS
Sbjct  115  IQQFVRPENLDIKPNFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++NENPPGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R Q+RLV+EAAYFFTN+LSAE
Sbjct  175  IASNENPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRQSRLVAEAAYFFTNMLSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI +IDAKALSM+ETEF
Sbjct  235  SFISSIDAKALSMEETEF  252



>ref|XP_009394050.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Musa acuminata subsp. malaccensis]
Length=461

 Score =   424 bits (1091),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 215/261 (82%), Positives = 237/261 (91%), Gaps = 3/261 (1%)
 Frame = +3

Query  96   MENA---DVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQ  266
            MEN    D FGSSTAPLTWHDFLERMR PSA+DFVK+IKSFI SFSN APDPE+DS AVQ
Sbjct  1    MENGGGGDAFGSSTAPLTWHDFLERMRHPSASDFVKSIKSFITSFSNKAPDPEKDSAAVQ  60

Query  267  EFLGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEK  446
            EFL NME AFRAH+LWAG SEEELES+GEGLEKY+MTKLF+HVFAS  ED   D++L EK
Sbjct  61   EFLANMEGAFRAHTLWAGSSEEELESSGEGLEKYIMTKLFNHVFASVQEDANSDEELTEK  120

Query  447  IALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLI  626
            +AL+QQFVRPENLD+K  FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+
Sbjct  121  MALLQQFVRPENLDVKKAFQNETSWLLAQKELQKINMYKAPRDKLICILNCCKVINNLLL  180

Query  627  NASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLL  806
            NASI++NENPPGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R Q+RLVSEAAYFFTN+L
Sbjct  181  NASITSNENPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRQSRLVSEAAYFFTNIL  240

Query  807  SAESFIMNIDAKALSMDETEF  869
            SAESFI NIDA+ALSM+E EF
Sbjct  241  SAESFIWNIDAQALSMEEAEF  261



>ref|XP_010672212.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Beta vulgaris subsp. vulgaris]
Length=508

 Score =   425 bits (1093),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 212/258 (82%), Positives = 237/258 (92%), Gaps = 0/258 (0%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN ++F SST  LTW+DFLERMRQPSAA+FVKAIKSFIVSFSNN PDPE+DS AVQ+F 
Sbjct  1    MENNEMFSSSTVRLTWNDFLERMRQPSAAEFVKAIKSFIVSFSNNMPDPEKDSAAVQQFF  60

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
             NMEAAFRAHSLW+GCSEEELESAGEGLEKYVMTKLF+ VFA +P+DVK D+Q+ EKIAL
Sbjct  61   ANMEAAFRAHSLWSGCSEEELESAGEGLEKYVMTKLFTRVFALYPDDVKDDEQISEKIAL  120

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+RPENLDIKP FQNE+SWLLAQKEL KINMYKAPR+KL CILNCCKVI NLL NA+
Sbjct  121  VQQFIRPENLDIKPTFQNESSWLLAQKELQKINMYKAPREKLACILNCCKVITNLLHNAA  180

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            ++ANENPPGAD+FLPVLIYVTIKANPPQLH NLLYIQR+RHQ+RLVSEAAY+FTN+LSA 
Sbjct  181  VTANENPPGADEFLPVLIYVTIKANPPQLHLNLLYIQRYRHQSRLVSEAAYYFTNILSAV  240

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDA+ALSMDE EF
Sbjct  241  SFISNIDAQALSMDENEF  258



>gb|KCW70546.1| hypothetical protein EUGRSUZ_F03739 [Eucalyptus grandis]
Length=509

 Score =   424 bits (1090),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 215/259 (83%), Positives = 233/259 (90%), Gaps = 6/259 (2%)
 Frame = +3

Query  93   AMENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEF  272
            AMENADV       L  HDFLERMRQPSA+D VK+IKSFIVSF+NNAPDPERDS  VQEF
Sbjct  95   AMENADVI------LGLHDFLERMRQPSASDIVKSIKSFIVSFTNNAPDPERDSVIVQEF  148

Query  273  LGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIA  452
            L NME  FR H LWAGCSEEELESAGEGLEKYVMTKLFS VFASHP+DVK+D+ L EK+A
Sbjct  149  LNNMEGVFRKHPLWAGCSEEELESAGEGLEKYVMTKLFSRVFASHPDDVKLDEDLSEKMA  208

Query  453  LIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINA  632
            L+QQF+RPENLDI P FQNETSWLLAQKEL KINM KAPRDKL+CILNCCKVINNLLINA
Sbjct  209  LVQQFIRPENLDITPTFQNETSWLLAQKELQKINMCKAPRDKLVCILNCCKVINNLLINA  268

Query  633  SISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSA  812
            SI++NENPPGAD+FLPVLIYVTIKA+PPQLHSNLLYIQR+R Q+RLV+EAAYFFTN+LSA
Sbjct  269  SIASNENPPGADEFLPVLIYVTIKASPPQLHSNLLYIQRYRRQSRLVAEAAYFFTNMLSA  328

Query  813  ESFIMNIDAKALSMDETEF  869
            ESFI NIDAKALSMDETEF
Sbjct  329  ESFISNIDAKALSMDETEF  347



>ref|XP_003526606.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Glycine max]
 gb|KHN09161.1| Vacuolar protein sorting-associated protein 9A [Glycine soja]
Length=467

 Score =   422 bits (1085),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 215/258 (83%), Positives = 236/258 (91%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENADVF      L  HDFLERMRQPSAA+FVKAIKSFIVSFSNNAPDP+RDS AVQ FL
Sbjct  1    MENADVF------LGLHDFLERMRQPSAAEFVKAIKSFIVSFSNNAPDPDRDSAAVQAFL  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              MEA FRAH LWAGCSEEELESAGEGLEKYVMTKLF+ VFAS P+DVK DDQL EK+AL
Sbjct  55   AKMEADFRAHPLWAGCSEEELESAGEGLEKYVMTKLFARVFASLPDDVKFDDQLSEKMAL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQF+RPENLDIKPVFQNE+SWLLAQKEL KINMYKAPRDKL+CILNCC+VI+NLL+NAS
Sbjct  115  IQQFIRPENLDIKPVFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCRVISNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +++ ENPPGAD+FLPVLIYVTIKANPPQLHSNLLYIQRFRHQ+RLV+EAAY+FTN+LSAE
Sbjct  175  VASRENPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRFRHQSRLVAEAAYYFTNMLSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAKA+SM+E EF
Sbjct  235  SFISNIDAKAISMEEAEF  252



>ref|XP_010063331.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Eucalyptus grandis]
Length=464

 Score =   422 bits (1084),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 214/258 (83%), Positives = 232/258 (90%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENADV       L  HDFLERMRQPSA+D VK+IKSFIVSF+NNAPDPERDS  VQEFL
Sbjct  1    MENADVI------LGLHDFLERMRQPSASDIVKSIKSFIVSFTNNAPDPERDSVIVQEFL  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
             NME  FR H LWAGCSEEELESAGEGLEKYVMTKLFS VFASHP+DVK+D+ L EK+AL
Sbjct  55   NNMEGVFRKHPLWAGCSEEELESAGEGLEKYVMTKLFSRVFASHPDDVKLDEDLSEKMAL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+RPENLDI P FQNETSWLLAQKEL KINM KAPRDKL+CILNCCKVINNLLINAS
Sbjct  115  VQQFIRPENLDITPTFQNETSWLLAQKELQKINMCKAPRDKLVCILNCCKVINNLLINAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++NENPPGAD+FLPVLIYVTIKA+PPQLHSNLLYIQR+R Q+RLV+EAAYFFTN+LSAE
Sbjct  175  IASNENPPGADEFLPVLIYVTIKASPPQLHSNLLYIQRYRRQSRLVAEAAYFFTNMLSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAKALSMDETEF
Sbjct  235  SFISNIDAKALSMDETEF  252



>ref|XP_011074893.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X3 [Sesamum indicum]
Length=451

 Score =   421 bits (1083),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 217/258 (84%), Positives = 232/258 (90%), Gaps = 8/258 (3%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            M+N+DVFGSSTAPLTWHDFLERMR PSAADFVKAIK +  +        ERDS AVQEFL
Sbjct  1    MDNSDVFGSSTAPLTWHDFLERMRHPSAADFVKAIKRYSYA--------ERDSVAVQEFL  52

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
            GNMEAAFRAH LWAG SEEELESAGEGLEKYVMTKLF+ VFAS PEDVK D+QLYEK+AL
Sbjct  53   GNMEAAFRAHPLWAGSSEEELESAGEGLEKYVMTKLFTRVFASIPEDVKADEQLYEKMAL  112

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQFVRPENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NAS
Sbjct  113  IQQFVRPENLDIKPTFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNAS  172

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            ++ANE+ PGAD+FLPVLIYVTIKANPPQLHSNL YIQRFR QTRLV+EAAYFFTN+LS E
Sbjct  173  LAANEDHPGADEFLPVLIYVTIKANPPQLHSNLSYIQRFRRQTRLVAEAAYFFTNMLSVE  232

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAKALSMDE EF
Sbjct  233  SFISNIDAKALSMDEVEF  250



>ref|NP_001141062.1| uncharacterized protein LOC100273143 [Zea mays]
 gb|ACF85312.1| unknown [Zea mays]
 gb|AFW88898.1| hypothetical protein ZEAMMB73_627333 [Zea mays]
Length=483

 Score =   422 bits (1084),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/256 (82%), Positives = 234/256 (91%), Gaps = 0/256 (0%)
 Frame = +3

Query  102  NADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGN  281
            +AD FGS TAPL WHDFLERMRQPSAA+FVK+IKSFIV+FSN APDPE+DS A+QEFL N
Sbjct  4    SADSFGSLTAPLAWHDFLERMRQPSAAEFVKSIKSFIVTFSNRAPDPEKDSTAIQEFLEN  63

Query  282  MEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQ  461
            ME AFRAH+ WAG SEEELESAGEGLEKYVMTKLF+ VFAS PEDVK D++L+EK++L+Q
Sbjct  64   MEGAFRAHTPWAGSSEEELESAGEGLEKYVMTKLFNRVFASVPEDVKSDEELFEKMSLLQ  123

Query  462  QFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASIS  641
            QFVRPENLDIKP +QNETSWLLAQKEL KINMYKAPRDKL CILNCCKVINNLL+NASI 
Sbjct  124  QFVRPENLDIKPEYQNETSWLLAQKELQKINMYKAPRDKLACILNCCKVINNLLLNASIV  183

Query  642  ANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESF  821
            +NE PPGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R QTRLVSEA YFFTN+LSAESF
Sbjct  184  SNETPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRQTRLVSEAQYFFTNILSAESF  243

Query  822  IMNIDAKALSMDETEF  869
            I NID ++LSM+E +F
Sbjct  244  IWNIDGESLSMNELDF  259



>ref|XP_010095511.1| hypothetical protein L484_014940 [Morus notabilis]
 gb|EXB60485.1| hypothetical protein L484_014940 [Morus notabilis]
Length=466

 Score =   420 bits (1079),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 214/258 (83%), Positives = 233/258 (90%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN DVF      L  HDFLERMRQPSAADFVK+IKSFIVSFSNNAPDPERDS AVQEFL
Sbjct  1    MENTDVF------LGLHDFLERMRQPSAADFVKSIKSFIVSFSNNAPDPERDSNAVQEFL  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              MEA FRAH LWAGCSEEEL+SAGEGLEKYVMTKLF+ VFAS P+DVK D++L EK+AL
Sbjct  55   AKMEADFRAHPLWAGCSEEELDSAGEGLEKYVMTKLFTRVFASLPDDVKHDEELSEKMAL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQF+RPENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVI+NLL+NAS
Sbjct  115  IQQFIRPENLDIKPNFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVISNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++NENPPGAD+FLPVLIYVTIKANPPQLHSNLLYI+R+R Q+RLVSEAAYFFTN+ S E
Sbjct  175  IASNENPPGADEFLPVLIYVTIKANPPQLHSNLLYIERYRRQSRLVSEAAYFFTNMQSVE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAKALS+DE EF
Sbjct  235  SFISNIDAKALSVDEAEF  252



>ref|XP_007222254.1| hypothetical protein PRUPE_ppa004752mg [Prunus persica]
 gb|EMJ23453.1| hypothetical protein PRUPE_ppa004752mg [Prunus persica]
Length=493

 Score =   421 bits (1081),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 211/258 (82%), Positives = 232/258 (90%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENADVF      L   DFLERMRQP+AADFVK+IKSFIVSFSNNAPDPERDS AVQ+F 
Sbjct  1    MENADVF------LGLQDFLERMRQPTAADFVKSIKSFIVSFSNNAPDPERDSAAVQDFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              ME  FRAH LWAGCSEEEL+SAGEGLEKYVMTKLF  VFAS P+DVK+DDQLYEK+AL
Sbjct  55   AQMEMDFRAHPLWAGCSEEELDSAGEGLEKYVMTKLFPRVFASVPDDVKLDDQLYEKMAL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+RPENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NAS
Sbjct  115  VQQFIRPENLDIKPTFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +++NENPPGAD+FLPVLIYVT+KANPPQLHSNLLYIQR+R Q+RLV E AYFFTN+LS E
Sbjct  175  VASNENPPGADEFLPVLIYVTLKANPPQLHSNLLYIQRYRRQSRLVGETAYFFTNMLSVE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAK++SMDETEF
Sbjct  235  SFISNIDAKSISMDETEF  252



>gb|ABF95105.1| Vacuolar sorting protein 9 domain containing protein, expressed 
[Oryza sativa Japonica Group]
 gb|EEE58741.1| hypothetical protein OsJ_10226 [Oryza sativa Japonica Group]
Length=480

 Score =   420 bits (1079),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/253 (82%), Positives = 231/253 (91%), Gaps = 0/253 (0%)
 Frame = +3

Query  111  VFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEA  290
             FGS+TAPL WHDFLERMRQPSAADFVK+IK FIV+FSN APDPE DS AVQEFL NME 
Sbjct  9    AFGSATAPLAWHDFLERMRQPSAADFVKSIKGFIVTFSNRAPDPEHDSAAVQEFLENMEG  68

Query  291  AFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFV  470
            AFRAH+ WAG SEEELESAGEGLEKYVMTKLF+ VFAS PEDVK D++L+EK++L+QQF+
Sbjct  69   AFRAHTPWAGSSEEELESAGEGLEKYVMTKLFNRVFASVPEDVKSDEELFEKMSLLQQFI  128

Query  471  RPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANE  650
            RPENLDIKP +Q+ETSWLLAQKEL KINMYKAPRDKL CILNCCKVINNLL+NASI +NE
Sbjct  129  RPENLDIKPEYQSETSWLLAQKELQKINMYKAPRDKLACILNCCKVINNLLLNASIVSNE  188

Query  651  NPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMN  830
            NPPGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R Q+RLVSEA YFFTN+LSAESFI N
Sbjct  189  NPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRQSRLVSEAQYFFTNILSAESFIWN  248

Query  831  IDAKALSMDETEF  869
            ID ++LSMDE +F
Sbjct  249  IDGESLSMDERDF  261



>ref|XP_004984708.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Setaria italica]
Length=489

 Score =   420 bits (1079),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 207/256 (81%), Positives = 234/256 (91%), Gaps = 0/256 (0%)
 Frame = +3

Query  102  NADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGN  281
              D FGSSTAPL WHDFLERMRQPSAA+FVK+IKSFIV+FSN APDPE+DS +VQEFL N
Sbjct  4    GGDAFGSSTAPLAWHDFLERMRQPSAAEFVKSIKSFIVTFSNRAPDPEKDSASVQEFLEN  63

Query  282  MEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQ  461
            ME AFRAH+ WAG SEEELESAGEGLEKYVMTKL++ VFAS PEDVK D++L+EK++L+Q
Sbjct  64   MEGAFRAHTPWAGSSEEELESAGEGLEKYVMTKLYNRVFASVPEDVKSDEELFEKMSLLQ  123

Query  462  QFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASIS  641
            QF+RPENLDIKP +QNETSWLLAQKEL KINM+KAPRDKL CILNCCKVINNLL+NASI 
Sbjct  124  QFIRPENLDIKPEYQNETSWLLAQKELQKINMFKAPRDKLSCILNCCKVINNLLLNASIV  183

Query  642  ANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESF  821
            +N+NPPGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R QTRLVSEA YFFTN+LSAESF
Sbjct  184  SNDNPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRQTRLVSEAQYFFTNILSAESF  243

Query  822  IMNIDAKALSMDETEF  869
            I NID ++LSM+E +F
Sbjct  244  IWNIDGESLSMNELDF  259



>ref|XP_004515662.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Cicer arietinum]
Length=495

 Score =   420 bits (1079),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/258 (81%), Positives = 235/258 (91%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENADVF      L  HDFLERMRQP+AADFVKAIKSFIVSFSNN PDP+RDS AVQ+FL
Sbjct  1    MENADVF------LGLHDFLERMRQPAAADFVKAIKSFIVSFSNNGPDPDRDSSAVQDFL  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
             NMEAAF+AH LW+GCSE+ELESAGEGLEKYVMTKLF+ VFAS P+DVK+DDQL EK++L
Sbjct  55   ANMEAAFKAHPLWSGCSEDELESAGEGLEKYVMTKLFARVFASVPDDVKLDDQLSEKMSL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQF+RPENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVI NLL+NAS
Sbjct  115  IQQFIRPENLDIKPTFQNETSWLLAQKELQKINMYKAPRDKLICILNCCKVIGNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +++ ++PPGAD+FLPVLIYVTIKANPPQLHSNLLYIQRFR  +RLV EA+Y+FTN+LSAE
Sbjct  175  VASKDSPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRFRRDSRLVGEASYYFTNMLSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAKA+SMDETEF
Sbjct  235  SFISNIDAKAISMDETEF  252



>ref|XP_002468141.1| hypothetical protein SORBIDRAFT_01g040290 [Sorghum bicolor]
 gb|EER95139.1| hypothetical protein SORBIDRAFT_01g040290 [Sorghum bicolor]
Length=470

 Score =   419 bits (1076),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/256 (82%), Positives = 234/256 (91%), Gaps = 2/256 (1%)
 Frame = +3

Query  102  NADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGN  281
            NAD   SSTAPL WHDFLERMRQPSAA+FVK+IKSFIV+FSN APDPE+DS AVQEFL N
Sbjct  4    NAD--ASSTAPLAWHDFLERMRQPSAAEFVKSIKSFIVTFSNRAPDPEKDSAAVQEFLEN  61

Query  282  MEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQ  461
            ME AFRAH+ WAG SEEEL+SAGEGLEKYVMTKLF+ VFAS PEDVK D++L+EK++L+Q
Sbjct  62   MEGAFRAHTPWAGSSEEELKSAGEGLEKYVMTKLFNRVFASVPEDVKSDEELFEKMSLLQ  121

Query  462  QFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASIS  641
            QF+RPENLDIKP +QNETSWLLAQKEL KINMYKAPRDKL CILNCCKVINNLL+NASI 
Sbjct  122  QFIRPENLDIKPEYQNETSWLLAQKELQKINMYKAPRDKLACILNCCKVINNLLLNASIV  181

Query  642  ANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESF  821
            +NENPPGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R QTRLVSEA YFFTN+LSAESF
Sbjct  182  SNENPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRQTRLVSEAQYFFTNILSAESF  241

Query  822  IMNIDAKALSMDETEF  869
            I NID ++LSM+E +F
Sbjct  242  IWNIDGESLSMNELDF  257



>ref|XP_002513841.1| Vacuolar protein sorting-associated protein VPS9, putative [Ricinus 
communis]
 gb|EEF48424.1| Vacuolar protein sorting-associated protein VPS9, putative [Ricinus 
communis]
Length=477

 Score =   419 bits (1076),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 211/258 (82%), Positives = 234/258 (91%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENADVF      L  HDFLERMRQPSA+DFVK+IKSFIVSFSNNAPDPERDS  VQEFL
Sbjct  1    MENADVF------LGLHDFLERMRQPSASDFVKSIKSFIVSFSNNAPDPERDSALVQEFL  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
             NMEAAFRAH LWAGCS++ELESAGEGLEKYVMTKLF+ VFAS P+DVK D+QL EK++L
Sbjct  55   ANMEAAFRAHPLWAGCSDDELESAGEGLEKYVMTKLFTRVFASLPDDVKADEQLSEKMSL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQF+RPENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NAS
Sbjct  115  IQQFIRPENLDIKPPFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++NENPPGAD+FLPV+IYVT+KANPPQL+SNLLYIQR+R Q+RLV EAAYFFTN+LSA 
Sbjct  175  IASNENPPGADEFLPVVIYVTLKANPPQLNSNLLYIQRYRSQSRLVGEAAYFFTNMLSAV  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDA +LSM+E EF
Sbjct  235  SFISNIDANSLSMEEAEF  252



>ref|XP_003522593.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Glycine max]
Length=465

 Score =   418 bits (1074),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 212/258 (82%), Positives = 232/258 (90%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENADVF      L  HDFLERMRQPSAA+FVKAIKSFIVSFSNNAPDP+RDS  VQ FL
Sbjct  1    MENADVF------LGLHDFLERMRQPSAAEFVKAIKSFIVSFSNNAPDPDRDSATVQAFL  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              MEA F AH LWAGCSEEEL SAGEGLEKYVMTKLF+ VFAS P+DVK DDQL EK+AL
Sbjct  55   AKMEADFSAHPLWAGCSEEELASAGEGLEKYVMTKLFARVFASLPDDVKFDDQLSEKMAL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQF+RPENLDIKP FQNE+SWLLAQKEL KINMYKAPRDKL+CILNCC+VI+NLL+NAS
Sbjct  115  IQQFIRPENLDIKPAFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCRVISNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +++ ENPPGAD+FLPVLIYVTIKANPPQLHSNLLYIQRFRHQ+RLV+EAAY+FTN+LSAE
Sbjct  175  VASRENPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRFRHQSRLVAEAAYYFTNMLSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAKA+SMDE EF
Sbjct  235  SFISNIDAKAISMDEAEF  252



>gb|EEC74907.1| hypothetical protein OsI_10843 [Oryza sativa Indica Group]
Length=470

 Score =   418 bits (1074),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 208/253 (82%), Positives = 231/253 (91%), Gaps = 0/253 (0%)
 Frame = +3

Query  111  VFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEA  290
             FGS+TAPL WHDFLERMRQPSAADFVK+IK FIV+FSN APDPE DS AVQEFL NME 
Sbjct  9    AFGSATAPLAWHDFLERMRQPSAADFVKSIKGFIVTFSNRAPDPEHDSAAVQEFLENMEG  68

Query  291  AFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFV  470
            AFRAH+ WAG SEEELESAGEGLEKYVMTKLF+ VFAS PEDVK D++L+EK++L+QQF+
Sbjct  69   AFRAHTPWAGSSEEELESAGEGLEKYVMTKLFNRVFASVPEDVKSDEELFEKMSLLQQFI  128

Query  471  RPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANE  650
            RPENLDIKP +Q+ETSWLLAQKEL KINMYKAPRDKL CILNCCKVINNLL+NASI +NE
Sbjct  129  RPENLDIKPEYQSETSWLLAQKELQKINMYKAPRDKLACILNCCKVINNLLLNASIVSNE  188

Query  651  NPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMN  830
            NPPGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R Q+RLVSEA YFFTN+LSAESFI N
Sbjct  189  NPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRPQSRLVSEAQYFFTNILSAESFIWN  248

Query  831  IDAKALSMDETEF  869
            ID ++LSMDE +F
Sbjct  249  IDGESLSMDERDF  261



>ref|XP_007136193.1| hypothetical protein PHAVU_009G026000g [Phaseolus vulgaris]
 gb|ESW08187.1| hypothetical protein PHAVU_009G026000g [Phaseolus vulgaris]
Length=471

 Score =   418 bits (1074),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 213/258 (83%), Positives = 234/258 (91%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENADVF      L   DFLERMRQPSAA+FVKAIKSFIVSFSNNAPDPERDS  VQ FL
Sbjct  1    MENADVF------LGLQDFLERMRQPSAAEFVKAIKSFIVSFSNNAPDPERDSALVQAFL  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              MEA FRAH LWAGCSEEELESAGEGLEKYVMTKLF+ VFAS P+DVK+DDQL EK+AL
Sbjct  55   AKMEADFRAHPLWAGCSEEELESAGEGLEKYVMTKLFARVFASVPDDVKLDDQLSEKMAL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQFVRPENLDIKP FQNE+SWLLAQKEL KINMYKAPRDKL+CILNCC+VI+NLL+NAS
Sbjct  115  VQQFVRPENLDIKPPFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCRVISNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +++ ENPPGAD+FLPVLIYVT+KANPPQLHSNLLYIQRFRHQ+RLV+EAAY+FTN+LSAE
Sbjct  175  LASKENPPGADEFLPVLIYVTLKANPPQLHSNLLYIQRFRHQSRLVAEAAYYFTNMLSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAKA+SMDE EF
Sbjct  235  SFISNIDAKAISMDEAEF  252



>gb|KHN47064.1| Vacuolar protein sorting-associated protein 9A [Glycine soja]
Length=465

 Score =   417 bits (1072),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 212/258 (82%), Positives = 231/258 (90%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENADVF      L  HDFLERMRQPSAA+FVKAIKSFIVSFSNNAPDP RDS  VQ FL
Sbjct  1    MENADVF------LGLHDFLERMRQPSAAEFVKAIKSFIVSFSNNAPDPGRDSATVQAFL  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              MEA F AH LWAGCSEEEL SAGEGLEKYVMTKLF+ VFAS P+DVK DDQL EK+AL
Sbjct  55   AKMEADFSAHPLWAGCSEEELASAGEGLEKYVMTKLFARVFASLPDDVKFDDQLSEKMAL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQF+RPENLDIKP FQNE+SWLLAQKEL KINMYKAPRDKL+CILNCC+VI+NLL+NAS
Sbjct  115  IQQFIRPENLDIKPAFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCRVISNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +++ ENPPGAD+FLPVLIYVTIKANPPQLHSNLLYIQRFRHQ+RLV+EAAY+FTN+LSAE
Sbjct  175  VASRENPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRFRHQSRLVAEAAYYFTNMLSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAKA+SMDE EF
Sbjct  235  SFISNIDAKAISMDEAEF  252



>ref|XP_006846608.1| PREDICTED: vacuolar protein sorting-associated protein 9A [Amborella 
trichopoda]
 gb|ERN08283.1| hypothetical protein AMTR_s00156p00017490 [Amborella trichopoda]
Length=451

 Score =   415 bits (1067),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 209/258 (81%), Positives = 235/258 (91%), Gaps = 0/258 (0%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN+D   ++TAPLT HDFL+RMR PSAAD VK+IKSFIVSF NN PDP +DS AVQEFL
Sbjct  1    MENSDFLSAATAPLTCHDFLDRMRHPSAADLVKSIKSFIVSFLNNTPDPVKDSVAVQEFL  60

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
             NME AFRAH+LWAG SEEELESAGEGLEKYVMTKLF+  FAS PE+VK D++L EK+AL
Sbjct  61   NNMEGAFRAHTLWAGASEEELESAGEGLEKYVMTKLFTRAFASIPEEVKKDEELSEKMAL  120

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+RP+NLDIKP FQNETSWLLAQKEL KINMYKAPRDKLLCIL+CCKVINNLL+NAS
Sbjct  121  VQQFIRPDNLDIKPNFQNETSWLLAQKELQKINMYKAPRDKLLCILHCCKVINNLLLNAS  180

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++N+NPPGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R Q+RLVSE+AYFFTNLLSAE
Sbjct  181  IASNDNPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRQSRLVSESAYFFTNLLSAE  240

Query  816  SFIMNIDAKALSMDETEF  869
            SFI N+DA +LSMDETEF
Sbjct  241  SFIANLDAGSLSMDETEF  258



>ref|XP_010228835.1| PREDICTED: vacuolar protein sorting-associated protein 9A isoform 
X2 [Brachypodium distachyon]
Length=494

 Score =   417 bits (1071),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 208/254 (82%), Positives = 232/254 (91%), Gaps = 0/254 (0%)
 Frame = +3

Query  108  DVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNME  287
            D FGSSTAPL WHDFLERMRQPSA++FVK+IK FIV+FSN APDPERDS AVQEFL NME
Sbjct  8    DAFGSSTAPLAWHDFLERMRQPSASEFVKSIKGFIVTFSNRAPDPERDSAAVQEFLENME  67

Query  288  AAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQF  467
             AFRAH+ WAG SEEELESAGEGLEKYVMTKLF+ VFAS PEDVK D++L+EK++L+QQF
Sbjct  68   GAFRAHTPWAGSSEEELESAGEGLEKYVMTKLFNRVFASVPEDVKSDEELFEKMSLLQQF  127

Query  468  VRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISAN  647
            VRPENLDIKP +QNETSWLLAQKEL KINMYKAPRDKL CILNCCKVINNLL+NAS  +N
Sbjct  128  VRPENLDIKPEYQNETSWLLAQKELQKINMYKAPRDKLACILNCCKVINNLLMNASHMSN  187

Query  648  ENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIM  827
            +N PGAD+FLPVLIYVT+KANPPQLHSNLLYIQR+R Q+RLVSEA YFFTN+LSAESFI 
Sbjct  188  DNAPGADEFLPVLIYVTLKANPPQLHSNLLYIQRYRSQSRLVSEAQYFFTNILSAESFIW  247

Query  828  NIDAKALSMDETEF  869
            NIDA++LSMDE +F
Sbjct  248  NIDAESLSMDERDF  261



>ref|XP_008233931.1| PREDICTED: vacuolar protein sorting-associated protein 9A [Prunus 
mume]
Length=492

 Score =   416 bits (1070),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 210/258 (81%), Positives = 230/258 (89%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENADVF      L   DFLERMRQP+AADFVK+IKSFIVSFSNNAPDPERDS AVQ+F 
Sbjct  1    MENADVF------LGLQDFLERMRQPTAADFVKSIKSFIVSFSNNAPDPERDSAAVQDFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
               E  FRAH LWAGCSEEEL+SAGEGLEKYV TKLF  VFAS P+DVK+DDQLYEK+AL
Sbjct  55   AQTEMDFRAHPLWAGCSEEELDSAGEGLEKYVTTKLFPRVFASVPDDVKLDDQLYEKMAL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQF+RPENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NAS
Sbjct  115  IQQFIRPENLDIKPTFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +++NENPPGAD+FLPVLIYVT+KANPPQLHSNLLYIQR+R Q+RLV E AYFFTN+LS E
Sbjct  175  VASNENPPGADEFLPVLIYVTLKANPPQLHSNLLYIQRYRRQSRLVGETAYFFTNMLSVE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAK++SMDETEF
Sbjct  235  SFISNIDAKSISMDETEF  252



>ref|XP_008378527.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Malus domestica]
Length=474

 Score =   414 bits (1063),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 207/258 (80%), Positives = 232/258 (90%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENADVF      L  HDFLERMRQPSAADFVK+IKSFIVSF+NNAPDPE DS AVQ+F 
Sbjct  1    MENADVF------LGLHDFLERMRQPSAADFVKSIKSFIVSFTNNAPDPEGDSAAVQDFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              ME  FRAH LWAGCSEEEL+SAGEGLEKYVMTKLF  VFAS P+DVK+D+QLYEK+AL
Sbjct  55   ARMEIDFRAHPLWAGCSEEELDSAGEGLEKYVMTKLFPRVFASLPDDVKLDEQLYEKMAL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+RPENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NAS
Sbjct  115  VQQFIRPENLDIKPTFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLMNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +++NENPPGAD+FLPVLIYVT+KANPPQLHSNLLYIQR+R Q+RLV EA+YFFTN+LS E
Sbjct  175  VASNENPPGADEFLPVLIYVTLKANPPQLHSNLLYIQRYRRQSRLVGEASYFFTNMLSVE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDA A+S+DE+E+
Sbjct  235  SFISNIDANAISLDESEY  252



>ref|XP_008441683.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Cucumis melo]
Length=472

 Score =   412 bits (1060),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 209/258 (81%), Positives = 231/258 (90%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN DVF      L  HDFLERMRQPSA+DFVK+IKSFIVSFSNNAPDPERDS +VQEF 
Sbjct  1    MENTDVF------LGLHDFLERMRQPSASDFVKSIKSFIVSFSNNAPDPERDSASVQEFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              ME AFRAH LW+GCSEEELESAGEGLEKYVMTKLFS V+AS  +DVK+D+QL EK+AL
Sbjct  55   AKMEGAFRAHPLWSGCSEEELESAGEGLEKYVMTKLFSRVYASLADDVKIDEQLSEKMAL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQF+RPENLDIKP FQNETSWLLAQKELLKINM+KAPRDKL+C+L+CCKVI+NLL NAS
Sbjct  115  IQQFIRPENLDIKPNFQNETSWLLAQKELLKINMHKAPRDKLVCLLSCCKVISNLLFNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++NENPPGAD+FLPVLIYV IKANPPQLHSNLLYIQR+R Q+RL  EAAYFFTN+LSAE
Sbjct  175  IASNENPPGADEFLPVLIYVIIKANPPQLHSNLLYIQRYRGQSRLTGEAAYFFTNILSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAKALSM+E EF
Sbjct  235  SFISNIDAKALSMEEIEF  252



>ref|XP_003601131.1| Rab5 GDP/GTP exchange factor [Medicago truncatula]
 gb|AES71382.1| vacuolar protein sorting-associated protein VPS9 [Medicago truncatula]
Length=478

 Score =   412 bits (1058),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 208/258 (81%), Positives = 231/258 (90%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENAD      A    HDFLERMRQP+AADFVKAIKSFIVSFSN+ PDPERDS AVQ+FL
Sbjct  1    MENAD------ASSGLHDFLERMRQPAAADFVKAIKSFIVSFSNHGPDPERDSDAVQDFL  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
             NMEAAF+AH LWAGCS++ELESAGEGLEKYVMTKLF  VFAS P+DVK+D+QL EK+AL
Sbjct  55   ANMEAAFKAHPLWAGCSDDELESAGEGLEKYVMTKLFPRVFASVPDDVKLDEQLSEKMAL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQF+RPENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL CILNCCKVI NLL+NAS
Sbjct  115  IQQFIRPENLDIKPPFQNETSWLLAQKELQKINMYKAPRDKLTCILNCCKVIGNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +++ +NPPGAD+FLPVLIYVT+KANPPQLHSNLLYIQRFR Q+RLV EA+Y+FTN+LSAE
Sbjct  175  LASKDNPPGADEFLPVLIYVTLKANPPQLHSNLLYIQRFRRQSRLVGEASYYFTNMLSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDA A+SMDETEF
Sbjct  235  SFISNIDANAISMDETEF  252



>ref|XP_004138949.2| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X1 [Cucumis sativus]
 gb|KGN61453.1| hypothetical protein Csa_2G128630 [Cucumis sativus]
Length=474

 Score =   411 bits (1057),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 208/258 (81%), Positives = 231/258 (90%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN DVF      L  HDFLERMRQPSA+DFVK+IKSFIVSFSNNAPDPERDS +VQEF 
Sbjct  1    MENTDVF------LGLHDFLERMRQPSASDFVKSIKSFIVSFSNNAPDPERDSASVQEFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              ME AFRAH LW+GCSEEELESAGEGLEKYVMTKLFS V+AS  +DVK+D+Q+ EK+AL
Sbjct  55   AKMEGAFRAHPLWSGCSEEELESAGEGLEKYVMTKLFSRVYASLADDVKIDEQISEKMAL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQF+RPENLDIKP FQNETSWLLAQKELLKINM+KAPRDKL+C+L+CCKVI+NLL NAS
Sbjct  115  IQQFIRPENLDIKPNFQNETSWLLAQKELLKINMHKAPRDKLVCLLSCCKVISNLLFNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++NENPPGAD+FLPVLIYV IKANPPQLHSNLLYIQR+R Q+RL  EAAYFFTN+LSAE
Sbjct  175  IASNENPPGADEFLPVLIYVIIKANPPQLHSNLLYIQRYRGQSRLTGEAAYFFTNVLSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAKALSM+E EF
Sbjct  235  SFISNIDAKALSMEEIEF  252



>ref|XP_009367322.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Pyrus x bretschneideri]
Length=474

 Score =   411 bits (1056),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 206/258 (80%), Positives = 232/258 (90%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENADVF      L  HDFLERMRQPSAADFVK+IKSFIVSF+NNAPDPERDS AVQ+F 
Sbjct  1    MENADVF------LGLHDFLERMRQPSAADFVKSIKSFIVSFTNNAPDPERDSAAVQDFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              ME  FRAH LWAGCSEEEL+SAGEGLEKYVMTKLF  VFAS P+D+K+D+QLYEK+AL
Sbjct  55   SRMEIDFRAHPLWAGCSEEELDSAGEGLEKYVMTKLFPRVFASLPDDLKLDEQLYEKMAL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+RPENLDIKP FQNETSWLLAQKEL KINM KAPRDKL+CILNCCKVINNLL+NAS
Sbjct  115  VQQFIRPENLDIKPTFQNETSWLLAQKELQKINMCKAPRDKLVCILNCCKVINNLLMNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +++NENPPGAD+FLPVLIYVT+KANPPQLHSNLLYIQR+R Q+RLV EA+YFFTN+LS E
Sbjct  175  VASNENPPGADEFLPVLIYVTLKANPPQLHSNLLYIQRYRRQSRLVGEASYFFTNMLSVE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDA A+S+DE+E+
Sbjct  235  SFISNIDANAISLDESEY  252



>ref|XP_010530179.1| PREDICTED: vacuolar protein sorting-associated protein 9A isoform 
X1 [Tarenaya hassleriana]
Length=510

 Score =   410 bits (1055),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/258 (79%), Positives = 232/258 (90%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            ME+AD+F      L  HDFLERMR+PSAADFVK+IKSFIVSFSNNAPDPE+D  AVQEF 
Sbjct  1    MESADMF------LGLHDFLERMRKPSAADFVKSIKSFIVSFSNNAPDPEKDCAAVQEFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              MEAAFRAH LW+GCSEEEL+SAGEGLEKYVMTKLF+ VFAS+PE+ K D+QL++K+AL
Sbjct  55   SKMEAAFRAHPLWSGCSEEELDSAGEGLEKYVMTKLFTRVFASNPEEAKFDEQLFQKMAL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+ PENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL NAS
Sbjct  115  VQQFISPENLDIKPTFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLFNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +++NEN PGAD+FLPVLIYVTIKANPPQLHSNLLYIQRFR Q++LV EAAYFFTN+LSAE
Sbjct  175  VASNENAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRFRRQSKLVGEAAYFFTNMLSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAKA+SM+E +F
Sbjct  235  SFISNIDAKAISMEEADF  252



>ref|XP_002306602.2| hypothetical protein POPTR_0005s16300g [Populus trichocarpa]
 gb|EEE93598.2| hypothetical protein POPTR_0005s16300g [Populus trichocarpa]
Length=532

 Score =   411 bits (1056),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 208/258 (81%), Positives = 231/258 (90%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN+D+       L  HDFLERMR PSAADFVK+IKSFIVSFSN+APDPERDS  VQEFL
Sbjct  1    MENSDI------SLGLHDFLERMRHPSAADFVKSIKSFIVSFSNHAPDPERDSALVQEFL  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
             NME AF+AH LWAGCSEEELESAGEGLEKYVMTKL S VFAS P+DV+VD QL EKI+L
Sbjct  55   ANMETAFKAHPLWAGCSEEELESAGEGLEKYVMTKLSSRVFASVPDDVEVDKQLSEKISL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQF+RPENLDIKP FQNETSWLLAQKEL K+N+Y+APRDKL+CILNCCKVINNLL NAS
Sbjct  115  IQQFIRPENLDIKPAFQNETSWLLAQKELQKVNLYRAPRDKLVCILNCCKVINNLLFNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +++NENPPGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R Q+RLV EAAYF TN+LSAE
Sbjct  175  MASNENPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRCQSRLVGEAAYFLTNILSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAK+LSM+E+EF
Sbjct  235  SFISNIDAKSLSMEESEF  252



>ref|XP_011006325.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Populus euphratica]
Length=516

 Score =   410 bits (1053),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 207/258 (80%), Positives = 230/258 (89%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN+D+       L  HDFLERMR PSAADFVK+IKSFIVSFSN+APDPERDS  VQEFL
Sbjct  1    MENSDI------SLGLHDFLERMRHPSAADFVKSIKSFIVSFSNHAPDPERDSALVQEFL  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              ME AF+AH LWAGCSEEELESAGEGLEKYVMTKL S VFAS PED++VD QL EKI+L
Sbjct  55   AKMETAFKAHPLWAGCSEEELESAGEGLEKYVMTKLSSRVFASVPEDMEVDKQLSEKISL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            IQQF+RPENLDIKP FQNETSWLLAQKEL K+N+Y+APRDKL+CILNCCKVINNLL NAS
Sbjct  115  IQQFIRPENLDIKPTFQNETSWLLAQKELQKVNLYRAPRDKLVCILNCCKVINNLLFNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +++NENPPGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R Q+RLV EAAYF TN+LSAE
Sbjct  175  MASNENPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRCQSRLVGEAAYFLTNILSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAK+LSM+E+EF
Sbjct  235  SFISNIDAKSLSMEESEF  252



>ref|XP_008658255.1| PREDICTED: uncharacterized protein LOC100273143 isoform X1 [Zea 
mays]
Length=478

 Score =   404 bits (1039),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 205/256 (80%), Positives = 229/256 (89%), Gaps = 5/256 (2%)
 Frame = +3

Query  102  NADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGN  281
            +AD FGS TAPL WHDFLERMRQPSAA+FVK+IKSFIV+FSN APDPE+DS A+QEFL N
Sbjct  4    SADSFGSLTAPLAWHDFLERMRQPSAAEFVKSIKSFIVTFSNRAPDPEKDSTAIQEFLEN  63

Query  282  MEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQ  461
            ME AFRAH+ WAG SEEELESAGEGLEKYVMTKLF+ VFAS PEDVK D++L+EK++L+Q
Sbjct  64   MEGAFRAHTPWAGSSEEELESAGEGLEKYVMTKLFNRVFASVPEDVKSDEELFEKMSLLQ  123

Query  462  QFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASIS  641
            QFVRPENLDIKP +QNETSWLLAQKEL KINMYKAPRDKL CILNCCKVINNLL+NASI 
Sbjct  124  QFVRPENLDIKPEYQNETSWLLAQKELQKINMYKAPRDKLACILNCCKVINNLLLNASIV  183

Query  642  ANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESF  821
            +NE PPGAD+FLPVLIYVTIK     LHSNLLYIQR+R QTRLVSEA YFFTN+LSAESF
Sbjct  184  SNETPPGADEFLPVLIYVTIK-----LHSNLLYIQRYRRQTRLVSEAQYFFTNILSAESF  238

Query  822  IMNIDAKALSMDETEF  869
            I NID ++LSM+E +F
Sbjct  239  IWNIDGESLSMNELDF  254



>pdb|2EFC|A Chain A, Ara7-GdpATVPS9A
 pdb|2EFC|C Chain C, Ara7-GdpATVPS9A
 pdb|2EFD|A Chain A, Ara7ATVPS9A
 pdb|2EFD|C Chain C, Ara7ATVPS9A
 pdb|2EFE|A Chain A, Ara7-Gdpnh2ATVPS9A
 pdb|2EFE|C Chain C, Ara7-Gdpnh2ATVPS9A
 pdb|4G01|A Chain A, Ara7-gdp-ca2+/vps9a
Length=267

 Score =   395 bits (1015),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 197/259 (76%), Positives = 230/259 (89%), Gaps = 6/259 (2%)
 Frame = +3

Query  93   AMENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEF  272
            +MEN DVF      L  HDFLERMR+PSA DFVK+IKSFIVSFSNNAPDPE+D   VQEF
Sbjct  2    SMENTDVF------LGLHDFLERMRKPSAGDFVKSIKSFIVSFSNNAPDPEKDCAMVQEF  55

Query  273  LGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIA  452
               MEAAFRAH LW+GCSEEEL+SAG+GLEKYVMTKLF+ VFAS+ E+V  D++L++K++
Sbjct  56   FSKMEAAFRAHPLWSGCSEEELDSAGDGLEKYVMTKLFTRVFASNTEEVIADEKLFQKMS  115

Query  453  LIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINA  632
            L+QQF+ PENLDI+P FQNE+SWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NA
Sbjct  116  LVQQFISPENLDIQPTFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNA  175

Query  633  SISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSA  812
            SI++NEN PGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R +++LV EAAYFFTN+LSA
Sbjct  176  SIASNENAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSA  235

Query  813  ESFIMNIDAKALSMDETEF  869
            ESFI NIDAK++S+DE EF
Sbjct  236  ESFISNIDAKSISLDEAEF  254



>pdb|2EFH|A Chain A, Ara7-GdpATVPS9A(D185N)
 pdb|2EFH|C Chain C, Ara7-GdpATVPS9A(D185N)
Length=267

 Score =   393 bits (1010),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 196/259 (76%), Positives = 230/259 (89%), Gaps = 6/259 (2%)
 Frame = +3

Query  93   AMENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEF  272
            +MEN DVF      L  HDFLERMR+PSA DFVK+IKSFIVSFSNNAPDPE+D   VQEF
Sbjct  2    SMENTDVF------LGLHDFLERMRKPSAGDFVKSIKSFIVSFSNNAPDPEKDCAMVQEF  55

Query  273  LGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIA  452
               MEAAFRAH LW+GCSEEEL+SAG+GLEKYVMTKLF+ VFAS+ E+V  D++L++K++
Sbjct  56   FSKMEAAFRAHPLWSGCSEEELDSAGDGLEKYVMTKLFTRVFASNTEEVIADEKLFQKMS  115

Query  453  LIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINA  632
            L+QQF+ PENLDI+P FQNE+SWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NA
Sbjct  116  LVQQFISPENLDIQPTFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNA  175

Query  633  SISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSA  812
            SI++NEN PGA++FLPVLIYVTIKANPPQLHSNLLYIQR+R +++LV EAAYFFTN+LSA
Sbjct  176  SIASNENAPGANEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSA  235

Query  813  ESFIMNIDAKALSMDETEF  869
            ESFI NIDAK++S+DE EF
Sbjct  236  ESFISNIDAKSISLDEAEF  254



>ref|XP_009367011.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Pyrus x bretschneideri]
Length=476

 Score =   400 bits (1029),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 203/258 (79%), Positives = 225/258 (87%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN DVF      L   DFLERMRQPSAADFVK+IKSFIVSFSNNAPDPERDS AVQ+F 
Sbjct  1    MENTDVF------LGLQDFLERMRQPSAADFVKSIKSFIVSFSNNAPDPERDSAAVQDFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              ME  FRAH LWAG SEEEL+SAGEGLEKYVMTKLF  VF S P+DVK+D+QLYEK+ L
Sbjct  55   ARMEIDFRAHPLWAGYSEEELDSAGEGLEKYVMTKLFPRVFPSLPDDVKLDEQLYEKMTL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+RPENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLLI AS
Sbjct  115  VQQFIRPENLDIKPTFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLIKAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +++NENPPGAD+FLPVLIYVT+KANPPQLH NLLYIQR+R Q+RL  EA+YFFTN+LS E
Sbjct  175  VASNENPPGADEFLPVLIYVTLKANPPQLHLNLLYIQRYRRQSRLFGEASYFFTNMLSVE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDA A+SMDE+E+
Sbjct  235  SFISNIDANAISMDESEY  252



>gb|EPS71524.1| hypothetical protein M569_03234, partial [Genlisea aurea]
Length=363

 Score =   396 bits (1017),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 201/258 (78%), Positives = 225/258 (87%), Gaps = 0/258 (0%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN D  GSS A  T  +FLERMRQPSA+DFVK+IKSFIVSF NN PD ERDS AVQEFL
Sbjct  1    MENPDASGSSAAVSTLQEFLERMRQPSASDFVKSIKSFIVSFLNNTPDAERDSTAVQEFL  60

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
             NMEAAFR+HSLWAG SEEELESA EGLEKYVMTKLF+  FAS PEDV+ D+ LY KI+L
Sbjct  61   ANMEAAFRSHSLWAGSSEEELESACEGLEKYVMTKLFTRSFASTPEDVEADENLYRKISL  120

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+RPE+LDI P +QNE SWLLAQKEL KINM K PRDKL CILNCC+VINNLL+NAS
Sbjct  121  VQQFLRPEHLDISPTYQNEASWLLAQKELQKINMSKPPRDKLQCILNCCRVINNLLLNAS  180

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +S+N + PGAD+FLPVLIYVTIKANPPQLHSNL+YIQRFR QTRLVSEAAYFFTN++SAE
Sbjct  181  MSSNGDHPGADEFLPVLIYVTIKANPPQLHSNLVYIQRFRRQTRLVSEAAYFFTNMVSAE  240

Query  816  SFIMNIDAKALSMDETEF  869
            SFI N+DA++LSMDE EF
Sbjct  241  SFITNLDARSLSMDEVEF  258



>ref|XP_004300426.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Fragaria vesca subsp. vesca]
Length=453

 Score =   399 bits (1025),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 204/261 (78%), Positives = 227/261 (87%), Gaps = 6/261 (2%)
 Frame = +3

Query  87   RLAMENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQ  266
            R  +ENADVF         HDFLERMRQPSA DFVK+IKSFIVSFSN+A DPERDS AVQ
Sbjct  6    RTLIENADVFTG------LHDFLERMRQPSAGDFVKSIKSFIVSFSNDARDPERDSAAVQ  59

Query  267  EFLGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEK  446
             F   ME  FR H LWAGCSEEEL+SAGEGLEKYVMTKLF+ VFAS P+DV++D+ L+EK
Sbjct  60   SFFAQMEVDFRVHPLWAGCSEEELDSAGEGLEKYVMTKLFTRVFASLPDDVRLDNVLHEK  119

Query  447  IALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLI  626
            +AL+QQF+RPENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL 
Sbjct  120  MALVQQFIRPENLDIKPAFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLH  179

Query  627  NASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLL  806
            NASI++NEN  GAD+FLPVLIYVT+KANPPQLHSNLLYIQR+R Q+RLV+EAAYFFTN+L
Sbjct  180  NASIASNENTHGADEFLPVLIYVTLKANPPQLHSNLLYIQRYRRQSRLVAEAAYFFTNML  239

Query  807  SAESFIMNIDAKALSMDETEF  869
            S ESFI N+DA ALSMDETEF
Sbjct  240  SVESFISNMDANALSMDETEF  260



>ref|XP_002883202.1| vacuolar sorting protein 9 domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59461.1| vacuolar sorting protein 9 domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=520

 Score =   401 bits (1030),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 198/258 (77%), Positives = 229/258 (89%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN DVF      L  HDFLERMR+PSA DFVK+IKSFIVSFSNNAPDPE+D   VQEF 
Sbjct  1    MENTDVF------LGLHDFLERMRKPSAGDFVKSIKSFIVSFSNNAPDPEKDCATVQEFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              MEAAFRAH LW+GCSEEEL+SAG+GLEKYVMTKLF+ VFAS+ E+V  D++L++K++L
Sbjct  55   SKMEAAFRAHPLWSGCSEEELDSAGDGLEKYVMTKLFTRVFASNTEEVIADEKLFQKMSL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+ PENLDI+P FQNE+SWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NAS
Sbjct  115  VQQFISPENLDIQPTFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++NEN PGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R +++LV EAAYFFTN+LSAE
Sbjct  175  IASNENAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAK+LS+DE EF
Sbjct  235  SFISNIDAKSLSLDEAEF  252



>ref|NP_566645.1| guanine nucleotide exchange factor VPS9a [Arabidopsis thaliana]
 sp|Q9LT31.1|VPS9A_ARATH RecName: Full=Vacuolar protein sorting-associated protein 9A; 
Short=AtVSP9a [Arabidopsis thaliana]
 dbj|BAB01291.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK76484.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85069.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76284.1| guanine nucleotide exchange factor VPS9a [Arabidopsis thaliana]
Length=520

 Score =   400 bits (1028),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 197/258 (76%), Positives = 229/258 (89%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN DVF      L  HDFLERMR+PSA DFVK+IKSFIVSFSNNAPDPE+D   VQEF 
Sbjct  1    MENTDVF------LGLHDFLERMRKPSAGDFVKSIKSFIVSFSNNAPDPEKDCAMVQEFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              MEAAFRAH LW+GCSEEEL+SAG+GLEKYVMTKLF+ VFAS+ E+V  D++L++K++L
Sbjct  55   SKMEAAFRAHPLWSGCSEEELDSAGDGLEKYVMTKLFTRVFASNTEEVIADEKLFQKMSL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+ PENLDI+P FQNE+SWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NAS
Sbjct  115  VQQFISPENLDIQPTFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++NEN PGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R +++LV EAAYFFTN+LSAE
Sbjct  175  IASNENAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAK++S+DE EF
Sbjct  235  SFISNIDAKSISLDEAEF  252



>ref|XP_010466135.1| PREDICTED: vacuolar protein sorting-associated protein 9A [Camelina 
sativa]
Length=520

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/258 (76%), Positives = 227/258 (88%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN D F      L  HDFLERMR+PSA DFVK+IKSFIVSFSNNAPDPE+D   VQEF 
Sbjct  1    MENTDAF------LGLHDFLERMRKPSAGDFVKSIKSFIVSFSNNAPDPEKDCAMVQEFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              MEAAFRAH LW+GCSEEEL+SAG+GLEKYVMTKLF+ VFAS+ EDV  D++L++K++L
Sbjct  55   SKMEAAFRAHPLWSGCSEEELDSAGDGLEKYVMTKLFTRVFASNTEDVIADEKLFQKMSL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+ PE+LDI+P FQNE+SWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NAS
Sbjct  115  VQQFISPESLDIQPTFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++N N PGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R +++LV EAAYFFTN+LSAE
Sbjct  175  IASNGNAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAK+LSMDE EF
Sbjct  235  SFISNIDAKSLSMDEAEF  252



>ref|XP_010507992.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Camelina sativa]
Length=520

 Score =   397 bits (1019),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 196/258 (76%), Positives = 227/258 (88%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN D F      L  HDFLERMR+PSA DFVK+IKSFIVSFSNNAPDPE+D   VQEF 
Sbjct  1    MENTDAF------LGLHDFLERMRKPSAGDFVKSIKSFIVSFSNNAPDPEKDCAMVQEFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              MEAAFRAH LW+GCSEEEL+SAG+GLEKYVMTKLF+ VFAS+ EDV  D++L++K++L
Sbjct  55   SKMEAAFRAHPLWSGCSEEELDSAGDGLEKYVMTKLFTRVFASNTEDVIADEKLFQKMSL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+ PE+LDI+P FQNE+SWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NAS
Sbjct  115  VQQFISPESLDIQPTFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++N N PGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R +++LV EAAYFFTN+LSAE
Sbjct  175  IASNGNAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAK+LSMDE +F
Sbjct  235  SFISNIDAKSLSMDEADF  252



>ref|XP_010487918.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Camelina sativa]
Length=520

 Score =   396 bits (1017),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 196/258 (76%), Positives = 226/258 (88%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN D F      L  HDFLERMR+PSA DFVK+IKSFIVSFSNNAPDPE D   VQEF 
Sbjct  1    MENTDAF------LGLHDFLERMRKPSAGDFVKSIKSFIVSFSNNAPDPEMDCAMVQEFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              MEAAFRAH LW+GCSEEEL+SAG+GLEKYVMTKLF+ VFAS+ EDV  D++L++K++L
Sbjct  55   SKMEAAFRAHPLWSGCSEEELDSAGDGLEKYVMTKLFTRVFASNTEDVIADEKLFQKMSL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+ PE+LDI+P FQNE+SWLLAQKEL KINMYKAPRDKL+C+LNCCKVINNLL+NAS
Sbjct  115  VQQFISPESLDIQPTFQNESSWLLAQKELQKINMYKAPRDKLVCVLNCCKVINNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++N N PGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R +++LV EAAYFFTN+LSAE
Sbjct  175  IASNGNAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAK+LSMDE EF
Sbjct  235  SFISNIDAKSLSMDEAEF  252



>ref|XP_009145754.1| PREDICTED: vacuolar protein sorting-associated protein 9A isoform 
X1 [Brassica rapa]
Length=465

 Score =   389 bits (999),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 190/245 (78%), Positives = 222/245 (91%), Gaps = 0/245 (0%)
 Frame = +3

Query  135  LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLW  314
            ++ HDFLERMR+PSA D VK+IKSFIVSF NN PDPE+DS AVQ+F   MEAAFRAH LW
Sbjct  7    VSIHDFLERMRKPSAGDLVKSIKSFIVSFLNNEPDPEKDSAAVQDFFSKMEAAFRAHPLW  66

Query  315  AGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIK  494
            +GCSE+EL+SAG+GLEKYVMTKLF  VFAS+ EDV  D++L++K++L+QQF+ PE LDIK
Sbjct  67   SGCSEDELDSAGDGLEKYVMTKLFPRVFASNTEDVISDEKLFQKMSLVQQFISPEYLDIK  126

Query  495  PVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDF  674
            P FQNETSWLLAQKEL KINMYKAPRDKL+C+LNCCKVINNLL+NASI++NEN PGAD+F
Sbjct  127  PTFQNETSWLLAQKELQKINMYKAPRDKLVCVLNCCKVINNLLLNASIASNENTPGADEF  186

Query  675  LPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSM  854
            LPVLIYVTIKANPPQLHSNLLYIQR+R +++LVSEAAYFFTN+LSAESFI NIDAK+LSM
Sbjct  187  LPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVSEAAYFFTNILSAESFISNIDAKSLSM  246

Query  855  DETEF  869
            +E EF
Sbjct  247  EEAEF  251



>emb|CDY51691.1| BnaA05g36780D [Brassica napus]
Length=399

 Score =   387 bits (993),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 190/245 (78%), Positives = 221/245 (90%), Gaps = 0/245 (0%)
 Frame = +3

Query  135  LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLW  314
            ++ HDFLERMR+PSA D VK+IKSFIVSF NN PDPE+DS AVQ+F   MEAAFRAH LW
Sbjct  7    VSIHDFLERMRKPSAGDLVKSIKSFIVSFLNNEPDPEKDSAAVQDFFSKMEAAFRAHPLW  66

Query  315  AGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIK  494
            +GCSE+EL+SAG+GLEKYVMTKLF  VFAS+ EDV  D++L++K++L+QQF+ PE LDIK
Sbjct  67   SGCSEDELDSAGDGLEKYVMTKLFPRVFASNTEDVISDEKLFQKMSLVQQFISPEYLDIK  126

Query  495  PVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDF  674
            P FQNETSWLLAQKEL KINMYKAPRDKL+C+LNCCKVINNLL+NASI++NEN PGAD+F
Sbjct  127  PTFQNETSWLLAQKELQKINMYKAPRDKLVCVLNCCKVINNLLLNASIASNENTPGADEF  186

Query  675  LPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSM  854
            LPVLIYVTIKANPPQLHSNLLYIQR+R +++LV EAAYFFTN+LSAESFI NIDAK+LSM
Sbjct  187  LPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSAESFISNIDAKSLSM  246

Query  855  DETEF  869
            DE EF
Sbjct  247  DEAEF  251



>ref|XP_006649789.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Oryza brachyantha]
Length=454

 Score =   387 bits (995),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 195/236 (83%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +3

Query  162  MRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAGCseeele  341
            MRQPSAA+FVK+IK FIV+FSN APDPE DS AVQEFL NME AFRAH+ WAG SEEELE
Sbjct  1    MRQPSAAEFVKSIKGFIVTFSNRAPDPEHDSVAVQEFLENMEGAFRAHTPWAGSSEEELE  60

Query  342  sagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSW  521
            SAGEGLEKYVMTKLF+ VFAS PEDVK D++L+EK++L+QQF+RPENLDIKP +QNETSW
Sbjct  61   SAGEGLEKYVMTKLFNRVFASVPEDVKSDEELFEKMSLLQQFIRPENLDIKPEYQNETSW  120

Query  522  LLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTI  701
            LLAQKEL KINMYKAPRDKL CILNCCKVINNLL+NASI +NENPPGAD+FLPVLIYVTI
Sbjct  121  LLAQKELQKINMYKAPRDKLACILNCCKVINNLLLNASIVSNENPPGADEFLPVLIYVTI  180

Query  702  KANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            KANPPQLHSNLLYIQR+R Q+RLVSEA YFFTN+LSAESFI NIDA++LSMDE +F
Sbjct  181  KANPPQLHSNLLYIQRYRRQSRLVSEAQYFFTNILSAESFIWNIDAESLSMDERDF  236



>emb|CDY24616.1| BnaC05g33000D [Brassica napus]
Length=466

 Score =   387 bits (995),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 188/245 (77%), Positives = 221/245 (90%), Gaps = 0/245 (0%)
 Frame = +3

Query  135  LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLW  314
            ++ HDFLERMR+PSA D VK+IKSFIVSF NN PDPE+DS AVQ+F   MEAAFRAH LW
Sbjct  7    VSIHDFLERMRKPSAGDLVKSIKSFIVSFLNNEPDPEKDSSAVQDFFSKMEAAFRAHPLW  66

Query  315  AGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIK  494
            +GCSE+EL+SAG+GLEKYVMTKLF  VFAS+ EDV  D++L++K++L+QQF+ PE LDIK
Sbjct  67   SGCSEDELDSAGDGLEKYVMTKLFPRVFASNTEDVISDEKLFQKMSLVQQFISPEYLDIK  126

Query  495  PVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDF  674
            P FQNETSWLLAQKEL KINMYKAPRDKL+C+LNCCKVINNLL+NASI++NEN PGAD+F
Sbjct  127  PTFQNETSWLLAQKELQKINMYKAPRDKLVCVLNCCKVINNLLLNASIASNENTPGADEF  186

Query  675  LPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSM  854
            LPVLIYVTIKANPPQLHSNLLY+QR+R +++LV EAAYFFTN+LSAESFI NIDAK+LSM
Sbjct  187  LPVLIYVTIKANPPQLHSNLLYVQRYRRESKLVGEAAYFFTNILSAESFISNIDAKSLSM  246

Query  855  DETEF  869
            D+ EF
Sbjct  247  DQAEF  251



>ref|XP_006399406.1| hypothetical protein EUTSA_v10012815mg [Eutrema salsugineum]
 gb|ESQ40859.1| hypothetical protein EUTSA_v10012815mg [Eutrema salsugineum]
Length=709

 Score =   394 bits (1013),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 195/258 (76%), Positives = 227/258 (88%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN DVF         HDFLERMR+PSA DFVK+IKSFIVSFSNNAPDPE+D  AVQEF 
Sbjct  1    MENTDVFPG------LHDFLERMRKPSAGDFVKSIKSFIVSFSNNAPDPEKDCDAVQEFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              MEAAFRAH +W+GCSEEEL+SAG+GLEKYVMTKLF+ VFAS+ +DV  D++L++K++L
Sbjct  55   SKMEAAFRAHPIWSGCSEEELDSAGDGLEKYVMTKLFTRVFASNTDDVISDEKLFQKMSL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+ PENLDI+P FQNETSWLLAQKEL KINM+KAPRDKL+CIL+CCKVINNLL+NAS
Sbjct  115  VQQFISPENLDIQPTFQNETSWLLAQKELQKINMFKAPRDKLMCILSCCKVINNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++ EN PGAD+FLPVLIYVTIKANPPQ HSNL+YIQR+R Q++LV EAAYFFTNLLSAE
Sbjct  175  IASKENAPGADEFLPVLIYVTIKANPPQFHSNLMYIQRYRRQSKLVGEAAYFFTNLLSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAK+LSMDE +F
Sbjct  235  SFISNIDAKSLSMDEADF  252



>ref|XP_006406463.1| hypothetical protein EUTSA_v10020497mg [Eutrema salsugineum]
 gb|ESQ47916.1| hypothetical protein EUTSA_v10020497mg [Eutrema salsugineum]
Length=528

 Score =   389 bits (998),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 188/245 (77%), Positives = 220/245 (90%), Gaps = 0/245 (0%)
 Frame = +3

Query  135  LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLW  314
            +++HDFLERMR+PS+ DFVK+IKSFIVSFSNNAPDPE+D   VQ F   ME AFRAH LW
Sbjct  7    VSFHDFLERMRKPSSGDFVKSIKSFIVSFSNNAPDPEKDCATVQAFFAKMETAFRAHPLW  66

Query  315  AGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIK  494
            +GCSEEEL+SAG+GLEKYVMTKLF  VFAS  +DV  D++L++K++L+QQF+ PENLDI+
Sbjct  67   SGCSEEELDSAGDGLEKYVMTKLFPRVFASSIDDVISDEKLFQKMSLVQQFISPENLDIQ  126

Query  495  PVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDF  674
            P FQNE+SWLLAQKEL KINMYK PRDKL+CILNCCKVINNLL+NASI++NEN PGAD+F
Sbjct  127  PTFQNESSWLLAQKELQKINMYKTPRDKLVCILNCCKVINNLLLNASIASNENAPGADEF  186

Query  675  LPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSM  854
            LPVLIYVTIKANPPQLHSNLLYIQR+R +++LV EAAYFFTN+LSAESFI NIDAK+LSM
Sbjct  187  LPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSAESFISNIDAKSLSM  246

Query  855  DETEF  869
            DE EF
Sbjct  247  DEAEF  251



>emb|CDX69912.1| BnaA10g22610D [Brassica napus]
Length=713

 Score =   390 bits (1003),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 194/258 (75%), Positives = 227/258 (88%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN DVF         HDFLERMR+PSA DFVK+IKSFIVSFSN+APDPE+DS+AVQEF 
Sbjct  1    MENIDVFPG------LHDFLERMRKPSAGDFVKSIKSFIVSFSNHAPDPEKDSEAVQEFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              MEAAFRAH LW+G SEEEL+SA +GLEKYVMTKLF+ VFAS+ EDV  D++L++K++L
Sbjct  55   TKMEAAFRAHPLWSGSSEEELDSAADGLEKYVMTKLFTRVFASNTEDVISDEKLFQKMSL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+ PE+LDI+P FQNETSWLLAQKEL K+NMYKAPRDKL+CIL+CCKVINNLL+NAS
Sbjct  115  VQQFISPESLDIQPTFQNETSWLLAQKELQKMNMYKAPRDKLMCILSCCKVINNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++ EN PGAD+FLPVLIYVTIKANPPQ HSNLLYIQR+R Q++LV EA+YFFTNLLSAE
Sbjct  175  IASKENAPGADEFLPVLIYVTIKANPPQFHSNLLYIQRYRRQSKLVGEASYFFTNLLSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAK+LSMDE +F
Sbjct  235  SFISNIDAKSLSMDEADF  252



>emb|CDY21574.1| BnaC09g47180D [Brassica napus]
Length=638

 Score =   388 bits (997),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 191/258 (74%), Positives = 227/258 (88%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN DVF         HDF ERMR+PSA DFVK+IKSFIVSFSNNAP+PE+DS+AVQEF 
Sbjct  1    MENIDVFPG------LHDFFERMRKPSAGDFVKSIKSFIVSFSNNAPNPEKDSEAVQEFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              MEAAFRAH LW+G SEE+L+SA +GLEKYVMTKLF+ VFAS+ EDV  D++L++K++L
Sbjct  55   TKMEAAFRAHPLWSGSSEEDLDSAADGLEKYVMTKLFTRVFASNTEDVISDEKLFQKMSL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+ PE+LDI+P FQNETSWLLAQKEL K+NMYKAPRDKL+CIL+CCKVINNLL+NAS
Sbjct  115  VQQFISPESLDIQPTFQNETSWLLAQKELQKMNMYKAPRDKLMCILSCCKVINNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            +++ EN PGAD+FLPVLIYVTIKANPPQ HSNLLYIQR+R Q++LV EA+YFFTNLLSAE
Sbjct  175  VASKENAPGADEFLPVLIYVTIKANPPQFHSNLLYIQRYRRQSKLVGEASYFFTNLLSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAK+LSMDE++F
Sbjct  235  SFISNIDAKSLSMDESDF  252



>ref|XP_009122506.1| PREDICTED: vacuolar protein sorting-associated protein 9A [Brassica 
rapa]
Length=716

 Score =   390 bits (1003),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 194/258 (75%), Positives = 227/258 (88%), Gaps = 6/258 (2%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN DVF         HDFLERMR+PSA DFVK+IKSFIVSFSN+APDPE+DS+AVQEF 
Sbjct  1    MENIDVFPG------LHDFLERMRKPSAGDFVKSIKSFIVSFSNHAPDPEKDSEAVQEFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              MEAAFRAH LW+G SEEEL+SA +GLEKYVMTKLF+ VFAS+ EDV  D++L++K++L
Sbjct  55   TKMEAAFRAHPLWSGSSEEELDSAADGLEKYVMTKLFTRVFASNTEDVISDEKLFQKMSL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+ PE+LDI+P FQNETSWLLAQKEL K+NMYKAPRDKL+CIL+CCKVINNLL+NAS
Sbjct  115  VQQFISPESLDIQPTFQNETSWLLAQKELQKMNMYKAPRDKLMCILSCCKVINNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++ EN PGAD+FLPVLIYVTIKANPPQ HSNLLYIQR+R Q++LV EA+YFFTNLLSAE
Sbjct  175  IASKENAPGADEFLPVLIYVTIKANPPQFHSNLLYIQRYRRQSKLVGEASYFFTNLLSAE  234

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAK+LSMDE +F
Sbjct  235  SFISNIDAKSLSMDEADF  252



>gb|KFK39302.1| hypothetical protein AALP_AA3G227000 [Arabis alpina]
Length=522

 Score =   384 bits (985),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 197/258 (76%), Positives = 222/258 (86%), Gaps = 9/258 (3%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN  VF      L  HDFLERMR PSA DFVK+IKSFIVSFSNNAPDPE+D  AVQ F 
Sbjct  1    MENTTVF------LGPHDFLERMRNPSAGDFVKSIKSFIVSFSNNAPDPEKDCAAVQHFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              MEAAF AH LW+GCSEEEL+SAG+GLEKYVMTKLF+ VFAS+ EDV  D++L++K++L
Sbjct  55   SKMEAAFMAHPLWSGCSEEELDSAGDGLEKYVMTKLFTRVFASNTEDVISDEKLFQKMSL  114

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+ PENLDI+P FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NAS
Sbjct  115  VQQFISPENLDIQPTFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNAS  174

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
               N+N  GAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R +++LV EAAYFFTNLLSAE
Sbjct  175  ---NKNAHGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNLLSAE  231

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAK+LSMDE EF
Sbjct  232  SFISNIDAKSLSMDEAEF  249



>ref|XP_010228834.1| PREDICTED: vacuolar protein sorting-associated protein 9A isoform 
X1 [Brachypodium distachyon]
Length=540

 Score =   358 bits (918),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 182/222 (82%), Positives = 203/222 (91%), Gaps = 0/222 (0%)
 Frame = +3

Query  204  SFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAGCseeelesagegleKYVMTKL  383
            SFIV+FSN APDPERDS AVQEFL NME AFRAH+ WAG SEEELESAGEGLEKYVMTKL
Sbjct  86   SFIVTFSNRAPDPERDSAAVQEFLENMEGAFRAHTPWAGSSEEELESAGEGLEKYVMTKL  145

Query  384  FSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYK  563
            F+ VFAS PEDVK D++L+EK++L+QQFVRPENLDIKP +QNETSWLLAQKEL KINMYK
Sbjct  146  FNRVFASVPEDVKSDEELFEKMSLLQQFVRPENLDIKPEYQNETSWLLAQKELQKINMYK  205

Query  564  APRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYI  743
            APRDKL CILNCCKVINNLL+NAS  +N+N PGAD+FLPVLIYVT+KANPPQLHSNLLYI
Sbjct  206  APRDKLACILNCCKVINNLLMNASHMSNDNAPGADEFLPVLIYVTLKANPPQLHSNLLYI  265

Query  744  QRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            QR+R Q+RLVSEA YFFTN+LSAESFI NIDA++LSMDE +F
Sbjct  266  QRYRSQSRLVSEAQYFFTNILSAESFIWNIDAESLSMDERDF  307



>ref|NP_196494.1| vacuolar sorting protein 9 (VPS9) domain protein [Arabidopsis 
thaliana]
 emb|CAC05458.1| putative protein [Arabidopsis thaliana]
 gb|AED91374.1| vacuolar sorting protein 9 (VPS9) domain protein [Arabidopsis 
thaliana]
Length=712

 Score =   359 bits (921),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 180/258 (70%), Positives = 214/258 (83%), Gaps = 9/258 (3%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN DV          H+FL +   PSA DF+K+IKSFIVS  N APDPE+D  AVQ+F 
Sbjct  1    MENTDVVSG------LHNFLSK---PSAKDFIKSIKSFIVSILNTAPDPEKDCDAVQDFF  51

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              ME+AFRAH LW+GCS++EL++AG+GLEKYVMTKLF  VFAS+ EDV  D++L++KI+L
Sbjct  52   YKMESAFRAHPLWSGCSDDELDNAGDGLEKYVMTKLFPRVFASNTEDVISDEKLFQKISL  111

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+ PENLDI+P FQN+TSWLLAQKEL KINMY APRDKL+CIL CCKVINNLL+NAS
Sbjct  112  VQQFISPENLDIQPTFQNQTSWLLAQKELQKINMYNAPRDKLMCILRCCKVINNLLLNAS  171

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++N+N PGAD FLPVLIYVTIKANPPQ HSNLLYIQR+R Q++LV EA Y FTN+LSAE
Sbjct  172  IASNQNEPGADQFLPVLIYVTIKANPPQFHSNLLYIQRYRRQSKLVGEAGYLFTNILSAE  231

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDAK+LSMDE +F
Sbjct  232  SFISNIDAKSLSMDEADF  249



>gb|EMS67780.1| hypothetical protein TRIUR3_13259 [Triticum urartu]
Length=535

 Score =   351 bits (901),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 180/222 (81%), Positives = 203/222 (91%), Gaps = 0/222 (0%)
 Frame = +3

Query  204  SFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAGCseeelesagegleKYVMTKL  383
            SFI++FSN APDPE DS AVQEFL NME AFRAH+ WAG SEEELESAGEGLEKYVMTKL
Sbjct  101  SFIMTFSNRAPDPEGDSTAVQEFLENMEGAFRAHTPWAGSSEEELESAGEGLEKYVMTKL  160

Query  384  FSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYK  563
            ++ VFAS PEDVK D++L+EKI+L+QQF+RPENLDIKP +QNETSWLLAQKEL KINMYK
Sbjct  161  YNRVFASVPEDVKSDEELFEKISLLQQFIRPENLDIKPEYQNETSWLLAQKELQKINMYK  220

Query  564  APRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYI  743
            APRDKL CILNCCKVINNLL+NAS  +++NPPGAD+FLPVLIYVTIKANPPQLHSNLLYI
Sbjct  221  APRDKLACILNCCKVINNLLMNASHMSHDNPPGADEFLPVLIYVTIKANPPQLHSNLLYI  280

Query  744  QRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            QR+R Q+RLVSEA YFFTNLLSAESFI NI+A++LSMDE +F
Sbjct  281  QRYRCQSRLVSEAQYFFTNLLSAESFIWNIEAESLSMDERDF  322



>ref|XP_002873394.1| hypothetical protein ARALYDRAFT_487743 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49653.1| hypothetical protein ARALYDRAFT_487743 [Arabidopsis lyrata subsp. 
lyrata]
Length=745

 Score =   357 bits (916),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 180/258 (70%), Positives = 210/258 (81%), Gaps = 9/258 (3%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN DV          H+FL +   PSA DF+K+IKSFIVS  N APDPE+D  AVQEF 
Sbjct  1    MENTDVVSG------LHNFLSK---PSAKDFIKSIKSFIVSILNTAPDPEKDCDAVQEFF  51

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              ME+AFRAH LW+GCS +EL +AG+GLEKYVMTKLF  VFAS+ EDV  D++L+ K++L
Sbjct  52   SKMESAFRAHPLWSGCSADELHNAGDGLEKYVMTKLFPRVFASNTEDVISDEKLFHKMSL  111

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
             Q F+ PENLDI+P FQN+TSWLLAQKEL KINMY APRDKL+CIL CCKVINNLL+NAS
Sbjct  112  FQLFISPENLDIQPTFQNQTSWLLAQKELQKINMYNAPRDKLMCILRCCKVINNLLLNAS  171

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++NEN PGAD FLPVLIYVTIKANPPQ HSNLLYIQR+R Q++LV EAAY FTN+LSAE
Sbjct  172  IASNENAPGADQFLPVLIYVTIKANPPQFHSNLLYIQRYRRQSKLVGEAAYLFTNILSAE  231

Query  816  SFIMNIDAKALSMDETEF  869
            SFI NIDA++LSMDE +F
Sbjct  232  SFISNIDAESLSMDEADF  249



>emb|CDP21117.1| unnamed protein product [Coffea canephora]
Length=218

 Score =   338 bits (867),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/207 (86%), Positives = 187/207 (90%), Gaps = 2/207 (1%)
 Frame = +3

Query  96   MENA--DVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQE  269
            ME A  D FGSSTAPLTWHDFLERMR PSAA FVK IKSFIVSF NNAPD ERDS AVQE
Sbjct  1    METATSDAFGSSTAPLTWHDFLERMRHPSAAPFVKDIKSFIVSFMNNAPDGERDSAAVQE  60

Query  270  FLGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKI  449
            FLGNME AFRAH+LWAG SEEELESAGEGLEKYVMTKLF  VFAS PEDV+ DDQLYEKI
Sbjct  61   FLGNMETAFRAHTLWAGSSEEELESAGEGLEKYVMTKLFPRVFASLPEDVQADDQLYEKI  120

Query  450  ALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLIN  629
            AL+QQF++PENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVI+NLL+N
Sbjct  121  ALVQQFIQPENLDIKPTFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVISNLLLN  180

Query  630  ASISANENPPGADDFLPVLIYVTIKAN  710
            ASI+A ENPPGAD+FLPVLIYVTIK N
Sbjct  181  ASIAAKENPPGADEFLPVLIYVTIKVN  207



>ref|XP_006286460.1| hypothetical protein CARUB_v10000364mg [Capsella rubella]
 gb|EOA19358.1| hypothetical protein CARUB_v10000364mg [Capsella rubella]
Length=690

 Score =   352 bits (904),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 176/258 (68%), Positives = 215/258 (83%), Gaps = 9/258 (3%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN DVF         H+FL +   PSA DF+K+IKSFIVS  N APDP++D  AVQ+F 
Sbjct  1    MENTDVFSG------LHNFLSK---PSAKDFIKSIKSFIVSILNTAPDPDKDCDAVQDFF  51

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              M++AFRAH+L +GCS++ELE+AG+GLEKYVMTKLF  VFAS+ EDV  D++L+ K++L
Sbjct  52   SKMDSAFRAHTLRSGCSDDELENAGDGLEKYVMTKLFPRVFASNTEDVISDEKLFHKMSL  111

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+ PENLD++P FQN+TSWLLAQKEL KINMYK PRDKL+CIL CC+VINNLL+NAS
Sbjct  112  LQQFISPENLDVQPNFQNQTSWLLAQKELQKINMYKGPRDKLMCILRCCRVINNLLLNAS  171

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I++NEN PGAD FLPVLIYVTIKANPPQ HSNLLYIQR+R Q++LV +AAY FTN+LSAE
Sbjct  172  IASNENAPGADQFLPVLIYVTIKANPPQFHSNLLYIQRYRRQSKLVGDAAYLFTNILSAE  231

Query  816  SFIMNIDAKALSMDETEF  869
            SFI +IDAK+LSMDE +F
Sbjct  232  SFISSIDAKSLSMDEADF  249



>ref|XP_001761544.1| predicted protein [Physcomitrella patens]
 gb|EDQ73612.1| predicted protein [Physcomitrella patens]
Length=536

 Score =   340 bits (873),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 171/258 (66%), Positives = 212/258 (82%), Gaps = 1/258 (0%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN D+F ++TA LT+HDFL+RMR P A D VK+IKSFIV F +  PDP++DS++VQ FL
Sbjct  1    MENVDMFNAATATLTFHDFLDRMRHPQAVDLVKSIKSFIVEFMSRTPDPDKDSESVQSFL  60

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
               E AF AH L+   ++EEL+SAGEGLEKY+MTKLFS  FA   E+ + D +L EK+A+
Sbjct  61   TTTEGAFGAHPLFVNATDEELDSAGEGLEKYLMTKLFSRAFAPVSEEKEHDKKLSEKMAI  120

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +QQF+RPE+LDI P F +E+S L AQKELLKIN YKAPRDKL+CILNCC+VINNLL+N S
Sbjct  121  LQQFIRPEHLDIPPKF-DESSLLFAQKELLKINTYKAPRDKLVCILNCCRVINNLLLNVS  179

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            I + +NPPGADDFLPVLIYV IKANPPQL+SNLLYI R+RH +RLVSEAAYF+TN++SAE
Sbjct  180  IGSKDNPPGADDFLPVLIYVVIKANPPQLNSNLLYINRYRHHSRLVSEAAYFYTNIVSAE  239

Query  816  SFIMNIDAKALSMDETEF  869
             FI N++A +LSMD +EF
Sbjct  240  HFIDNLEATSLSMDSSEF  257



>ref|XP_009145755.1| PREDICTED: vacuolar protein sorting-associated protein 9A isoform 
X2 [Brassica rapa]
Length=445

 Score =   336 bits (862),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = +3

Query  225  NNAPDPERDSKAVQEFLGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFAS  404
            N + DPE+DS AVQ+F   MEAAFRAH LW+GCSE+EL+SAG+GLEKYVMTKLF  VFAS
Sbjct  17   NPSKDPEKDSAAVQDFFSKMEAAFRAHPLWSGCSEDELDSAGDGLEKYVMTKLFPRVFAS  76

Query  405  HPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLL  584
            + EDV  D++L++K++L+QQF+ PE LDIKP FQNETSWLLAQKEL KINMYKAPRDKL+
Sbjct  77   NTEDVISDEKLFQKMSLVQQFISPEYLDIKPTFQNETSWLLAQKELQKINMYKAPRDKLV  136

Query  585  CILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQT  764
            C+LNCCKVINNLL+NASI++NEN PGAD+FLPVLIYVTIKANPPQLHSNLLYIQR+R ++
Sbjct  137  CVLNCCKVINNLLLNASIASNENTPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRES  196

Query  765  RLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +LVSEAAYFFTN+LSAESFI NIDAK+LSM+E EF
Sbjct  197  KLVSEAAYFFTNILSAESFISNIDAKSLSMEEAEF  231



>ref|XP_011074894.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X4 [Sesamum indicum]
Length=397

 Score =   334 bits (856),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  282  MEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQ  461
            MEAAFRAH LWAG SEEELESAGEGLEKYVMTKLF+ VFAS PEDVK D+QLYEK+ALIQ
Sbjct  1    MEAAFRAHPLWAGSSEEELESAGEGLEKYVMTKLFTRVFASIPEDVKADEQLYEKMALIQ  60

Query  462  QFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASIS  641
            QFVRPENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NAS++
Sbjct  61   QFVRPENLDIKPTFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASLA  120

Query  642  ANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESF  821
            ANE+ PGAD+FLPVLIYVTIKANPPQLHSNL YIQRFR QTRLV+EAAYFFTN+LS ESF
Sbjct  121  ANEDHPGADEFLPVLIYVTIKANPPQLHSNLSYIQRFRRQTRLVAEAAYFFTNMLSVESF  180

Query  822  IMNIDAKALSMDETEF  869
            I NIDAKALSMDE EF
Sbjct  181  ISNIDAKALSMDEVEF  196



>ref|XP_002265083.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X2 [Vitis vinifera]
Length=382

 Score =   329 bits (844),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/251 (66%), Positives = 205/251 (82%), Gaps = 0/251 (0%)
 Frame = +3

Query  117  GSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAF  296
             SS+ PLT++DFL+RMR P++ D V++IKSFIVSFS  AP PE D K +Q+FL  ME + 
Sbjct  3    ASSSQPLTFYDFLDRMRNPASLDLVRSIKSFIVSFSFYAPSPENDGKRLQDFLLTMEDSI  62

Query  297  RAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRP  476
            R H LW G +EEE++SA EGLEKYVMTKLFS  FA+ PED K D ++ EKI+L+Q F+RP
Sbjct  63   RDHPLWVGATEEEIDSAIEGLEKYVMTKLFSRTFAASPEDAKADQEISEKISLLQNFLRP  122

Query  477  ENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENP  656
            E+LDI  V QNE SWLLA+KEL K+N +KAPR+KLLCILNCC+VINNLL+NA++S N   
Sbjct  123  EHLDIPAVLQNEASWLLAEKELQKVNAFKAPREKLLCILNCCRVINNLLLNAAMSENHIL  182

Query  657  PGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNID  836
             GADDFLPVLIYVTIKANPPQLHSNL +IQ +R Q +LVSE AY+FTNL+SA+SFI+++D
Sbjct  183  AGADDFLPVLIYVTIKANPPQLHSNLKFIQLYRRQEKLVSEVAYYFTNLVSAKSFIVDLD  242

Query  837  AKALSMDETEF  869
            AK+LSMD  EF
Sbjct  243  AKSLSMDAVEF  253



>ref|XP_010665494.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X1 [Vitis vinifera]
 ref|XP_010665495.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X1 [Vitis vinifera]
Length=392

 Score =   330 bits (845),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/251 (66%), Positives = 205/251 (82%), Gaps = 0/251 (0%)
 Frame = +3

Query  117  GSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAF  296
             SS+ PLT++DFL+RMR P++ D V++IKSFIVSFS  AP PE D K +Q+FL  ME + 
Sbjct  3    ASSSQPLTFYDFLDRMRNPASLDLVRSIKSFIVSFSFYAPSPENDGKRLQDFLLTMEDSI  62

Query  297  RAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRP  476
            R H LW G +EEE++SA EGLEKYVMTKLFS  FA+ PED K D ++ EKI+L+Q F+RP
Sbjct  63   RDHPLWVGATEEEIDSAIEGLEKYVMTKLFSRTFAASPEDAKADQEISEKISLLQNFLRP  122

Query  477  ENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENP  656
            E+LDI  V QNE SWLLA+KEL K+N +KAPR+KLLCILNCC+VINNLL+NA++S N   
Sbjct  123  EHLDIPAVLQNEASWLLAEKELQKVNAFKAPREKLLCILNCCRVINNLLLNAAMSENHIL  182

Query  657  PGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNID  836
             GADDFLPVLIYVTIKANPPQLHSNL +IQ +R Q +LVSE AY+FTNL+SA+SFI+++D
Sbjct  183  AGADDFLPVLIYVTIKANPPQLHSNLKFIQLYRRQEKLVSEVAYYFTNLVSAKSFIVDLD  242

Query  837  AKALSMDETEF  869
            AK+LSMD  EF
Sbjct  243  AKSLSMDAVEF  253



>ref|XP_010926433.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Elaeis guineensis]
Length=414

 Score =   328 bits (842),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  282  MEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQ  461
            ME AFRAH+LWAG SEEELESAGEGLEKYVMTKLF+ VFAS PEDVK D++L+EK+AL+Q
Sbjct  1    MEGAFRAHTLWAGSSEEELESAGEGLEKYVMTKLFNRVFASLPEDVKHDEELFEKMALLQ  60

Query  462  QFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASIS  641
            QFVRPENLDI P FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NASI+
Sbjct  61   QFVRPENLDITPSFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASIA  120

Query  642  ANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESF  821
            +N+NPPGAD+FLPVLIYVTIKANPPQL+SNLLYIQR+R Q+RLVSEAAYFFTN+LSAESF
Sbjct  121  SNDNPPGADEFLPVLIYVTIKANPPQLYSNLLYIQRYRRQSRLVSEAAYFFTNILSAESF  180

Query  822  IMNIDAKALSMDETEF  869
            I NIDA++LSMDE EF
Sbjct  181  IWNIDAQSLSMDEVEF  196



>ref|XP_011621043.1| PREDICTED: vacuolar protein sorting-associated protein 9A [Amborella 
trichopoda]
Length=420

 Score =   327 bits (839),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 203/249 (82%), Gaps = 0/249 (0%)
 Frame = +3

Query  123  STAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRA  302
            S++P  ++DFL+RM+ P++ D V++IKSFIVSFS +A D ERD K +Q+FL  MEAA + 
Sbjct  3    SSSPANFYDFLDRMKHPASVDLVRSIKSFIVSFSFHAADAERDGKKLQDFLLTMEAAIKD  62

Query  303  HSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPEN  482
            H LW G +EEE++SA EGLEKY+MTKLFS  FAS   DVK D ++ EKI L+Q FVRPE+
Sbjct  63   HPLWYGATEEEIDSAIEGLEKYLMTKLFSRTFASSLADVKRDKEISEKICLLQNFVRPEH  122

Query  483  LDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPG  662
            LDI    QNETSWLLA+KEL KIN +KAPR+KLLCILNCC+VINNLL+N S+S +  P G
Sbjct  123  LDISREIQNETSWLLAEKELQKINAFKAPREKLLCILNCCRVINNLLLNVSMSTDRRPAG  182

Query  663  ADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAK  842
            ADDFLPVLIYVTIKANPPQ HSNL YIQ +R Q+RL+SEAAY+FTN++S ESFI+ +DAK
Sbjct  183  ADDFLPVLIYVTIKANPPQFHSNLKYIQLYRRQSRLISEAAYYFTNMVSVESFILELDAK  242

Query  843  ALSMDETEF  869
            +LSMDE EF
Sbjct  243  SLSMDENEF  251



>ref|XP_010530180.1| PREDICTED: vacuolar protein sorting-associated protein 9A isoform 
X2 [Tarenaya hassleriana]
Length=454

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  282  MEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQ  461
            MEAAFRAH LW+GCSEEEL+SAGEGLEKYVMTKLF+ VFAS+PE+ K D+QL++K+AL+Q
Sbjct  1    MEAAFRAHPLWSGCSEEELDSAGEGLEKYVMTKLFTRVFASNPEEAKFDEQLFQKMALVQ  60

Query  462  QFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASIS  641
            QF+ PENLDIKP FQNETSWLLAQKEL KINMYKAPRDKL+CILNCCKVINNLL NAS++
Sbjct  61   QFISPENLDIKPTFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLFNASVA  120

Query  642  ANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESF  821
            +NEN PGAD+FLPVLIYVTIKANPPQLHSNLLYIQRFR Q++LV EAAYFFTN+LSAESF
Sbjct  121  SNENAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRFRRQSKLVGEAAYFFTNMLSAESF  180

Query  822  IMNIDAKALSMDETEF  869
            I NIDAKA+SM+E +F
Sbjct  181  ISNIDAKAISMEEADF  196



>gb|EMT30391.1| hypothetical protein F775_07589 [Aegilops tauschii]
Length=530

 Score =   328 bits (841),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 178/260 (68%), Positives = 201/260 (77%), Gaps = 39/260 (15%)
 Frame = +3

Query  207  FIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLF  386
            FI++FSN  PDPERDS AVQEFL NME AFRAH+ WAG SEEELESAGEGLEKYVMTKL+
Sbjct  48   FIMTFSNREPDPERDSAAVQEFLENMEGAFRAHTPWAGSSEEELESAGEGLEKYVMTKLY  107

Query  387  SHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKA  566
            + VFAS PEDVK D++L+EKI+L+QQF+ PENLDIKP +QNETSWLLAQKEL KINMYKA
Sbjct  108  NRVFASVPEDVKSDEELFEKISLLQQFIHPENLDIKPEYQNETSWLLAQKELQKINMYKA  167

Query  567  PRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIK--------------  704
            PRDKL CILNCCKVINNLL+NAS  +++NPPGAD+FLPVLIYVTIK              
Sbjct  168  PRDKLACILNCCKVINNLLMNASHMSHDNPPGADEFLPVLIYVTIKQACGVMYLTIVACI  227

Query  705  -------------------------ANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLS  809
                                     ANPPQLHSNLLYIQR+R Q+RLVSEA YFFTNLLS
Sbjct  228  EPTRLPYICTLLAQPVKVSFGNFKTANPPQLHSNLLYIQRYRCQSRLVSEAQYFFTNLLS  287

Query  810  AESFIMNIDAKALSMDETEF  869
            AESFI NI+A++LSMDE +F
Sbjct  288  AESFIWNIEAESLSMDERDF  307



>ref|XP_006371359.1| hypothetical protein POPTR_0019s09420g, partial [Populus trichocarpa]
 gb|ERP49156.1| hypothetical protein POPTR_0019s09420g, partial [Populus trichocarpa]
Length=377

 Score =   320 bits (820),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 156/245 (64%), Positives = 198/245 (81%), Gaps = 0/245 (0%)
 Frame = +3

Query  135  LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLW  314
            + ++DFL++MR P++ + VK+IKSFIVSF  ++ +PE DSK VQEF   MEAA   H LW
Sbjct  15   IMFYDFLDKMRNPASLNLVKSIKSFIVSFQFSSANPENDSKRVQEFFSTMEAAIMEHPLW  74

Query  315  AGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIK  494
            AG +++E + + EGLEKY+MTKLFS  FA  PEDVK+D ++ EKI L+Q F+RPE+LDI 
Sbjct  75   AGATDDEFDCSMEGLEKYIMTKLFSRTFAISPEDVKIDQEISEKIHLLQSFLRPEHLDIP  134

Query  495  PVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDF  674
            P  QNE SWLLA+KEL KIN ++APR+KL CI++CC++INNLL+NAS+S N  P GADDF
Sbjct  135  PFLQNEASWLLAEKELQKINAFRAPREKLHCIMSCCRIINNLLLNASMSENHVPGGADDF  194

Query  675  LPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSM  854
            LPVLIYVTIKANPPQLHSNL YIQ +R Q ++VSE AY+FTNL+SA+SFI  +DAK+LSM
Sbjct  195  LPVLIYVTIKANPPQLHSNLKYIQLYRRQEKMVSEPAYYFTNLVSAKSFIGQLDAKSLSM  254

Query  855  DETEF  869
            DE EF
Sbjct  255  DEIEF  259



>ref|XP_012073501.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X2 [Jatropha curcas]
Length=326

 Score =   317 bits (813),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/247 (64%), Positives = 197/247 (80%), Gaps = 0/247 (0%)
 Frame = +3

Query  129  APLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHS  308
            + +T++DFL++MR P++ D V++IKSFIVSFS    +PE D K VQEF   ME A   H 
Sbjct  17   SSITFYDFLDKMRNPASLDLVRSIKSFIVSFSFYTANPENDGKRVQEFFSTMEGAIMDHP  76

Query  309  LWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLD  488
            LWAG + EE++ A EG+EKYVMTKLFS  FA+ PEDVK+D  + EKI L+Q F+RPE+LD
Sbjct  77   LWAGATNEEVDCAMEGMEKYVMTKLFSRTFAASPEDVKIDRNISEKIQLLQTFLRPEHLD  136

Query  489  IKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGAD  668
            I  V QNE SWLLA+KEL KIN  KAPR+KLLCI++CC+VINNLL+NASIS N    GAD
Sbjct  137  IPAVLQNEASWLLAEKELQKINASKAPREKLLCIMSCCRVINNLLLNASISENHVLGGAD  196

Query  669  DFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKAL  848
            DFLPVLIYV IKANPP LHSNL +IQ +R Q +LVSEAAY+FTN++SA+SFI++++AK+L
Sbjct  197  DFLPVLIYVMIKANPPLLHSNLKFIQLYRRQAKLVSEAAYYFTNIVSAKSFIVDLNAKSL  256

Query  849  SMDETEF  869
            SMDE EF
Sbjct  257  SMDEIEF  263



>ref|XP_002989534.1| hypothetical protein SELMODRAFT_130016 [Selaginella moellendorffii]
 gb|EFJ09410.1| hypothetical protein SELMODRAFT_130016 [Selaginella moellendorffii]
Length=463

 Score =   322 bits (824),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/258 (62%), Positives = 207/258 (80%), Gaps = 3/258 (1%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN+D+F ++T   T+HDFLERM+ PSAAD V++IKSFIV+F ++  DP  DS + Q+FL
Sbjct  1    MENSDMFNAATKQQTFHDFLERMKHPSAADLVRSIKSFIVNFMSSPIDPAMDSASAQDFL  60

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
               E AFRAH LWAG +EEELE+A EGLEKYVMTK+F+  ++  P D   D +L +KI+L
Sbjct  61   STTEVAFRAHPLWAGATEEELENAAEGLEKYVMTKIFTRAYSPLPSDSLKDQELSDKISL  120

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +Q F++PE+LD+   FQNE SWL+A+KEL KIN YKAPRDKL+CILNCC+VINNLL+   
Sbjct  121  LQHFIKPEHLDLPQSFQNEASWLIAEKELQKINSYKAPRDKLVCILNCCRVINNLLL---  177

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            ++ +  PPGA++FLP LIYV IKANPPQLHSNL +I+R+RH +RLV+EA+YF+T+L+S E
Sbjct  178  MAKSGTPPGAEEFLPALIYVVIKANPPQLHSNLQFIERYRHSSRLVAEASYFYTSLVSVE  237

Query  816  SFIMNIDAKALSMDETEF  869
            SFI  +DAK+LSMDE EF
Sbjct  238  SFIEKLDAKSLSMDEAEF  255



>ref|XP_008237814.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Prunus mume]
Length=378

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/251 (63%), Positives = 201/251 (80%), Gaps = 0/251 (0%)
 Frame = +3

Query  117  GSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAF  296
            GSS++   ++DFL+RMR P++ D V++IKSFIVSFS  A +PE D K VQEF   ME   
Sbjct  3    GSSSSSAIFYDFLDRMRNPASLDLVRSIKSFIVSFSFYAANPENDGKKVQEFYTTMEDTI  62

Query  297  RAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRP  476
            R H LWAG +++E++ A EGLEKYVMTKLFS  F+S PEDVK+D +  +KI L+Q F++P
Sbjct  63   RDHPLWAGATDQEVDCAMEGLEKYVMTKLFSRTFSSTPEDVKIDLETSQKIHLLQTFLKP  122

Query  477  ENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENP  656
            E+LDI  V +NE SWLLA+KEL KIN +KAPR+KLLC++NCCKVINNLL+NAS+S N   
Sbjct  123  EHLDIPTVLRNEASWLLAEKELQKINAFKAPREKLLCVMNCCKVINNLLLNASMSENHVL  182

Query  657  PGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNID  836
             GADDFLPVLIYV IKANPPQLHSNL +IQ +R QT+LVSEAAY+ TNL+SA++FI  ++
Sbjct  183  AGADDFLPVLIYVMIKANPPQLHSNLKFIQLYRRQTKLVSEAAYYLTNLVSAKTFIFELN  242

Query  837  AKALSMDETEF  869
            AK+LS+DE EF
Sbjct  243  AKSLSIDEIEF  253



>ref|XP_007199889.1| hypothetical protein PRUPE_ppa007191mg [Prunus persica]
 gb|EMJ01088.1| hypothetical protein PRUPE_ppa007191mg [Prunus persica]
Length=378

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/251 (63%), Positives = 202/251 (80%), Gaps = 0/251 (0%)
 Frame = +3

Query  117  GSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAF  296
            GSS++   ++DFL+RMR P++ D V++IKSFIVSFS  A +PE D K VQ+F   ME A 
Sbjct  3    GSSSSSAIFYDFLDRMRNPASLDLVRSIKSFIVSFSFYAANPENDGKKVQDFYTTMEDAI  62

Query  297  RAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRP  476
            R H LWAG +++E++ A EGLEKYVMTKLFS  F+S PEDVK+D +  +KI L+Q F++P
Sbjct  63   RDHPLWAGATDQEVDCAMEGLEKYVMTKLFSRTFSSTPEDVKIDLETSQKIHLLQTFLKP  122

Query  477  ENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENP  656
            E+LDI  V +NE SWLLA+KEL KIN +KAPR+KLLC++NCCKVINNLL+NAS+S N   
Sbjct  123  EHLDIPAVLRNEASWLLAEKELQKINAFKAPREKLLCVMNCCKVINNLLLNASMSENHVL  182

Query  657  PGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNID  836
             GADDFLPVLIYV IKANPPQLHSNL +IQ +R QT+LVSEAAY+ TNL+SA++FI  ++
Sbjct  183  AGADDFLPVLIYVMIKANPPQLHSNLKFIQLYRRQTKLVSEAAYYLTNLVSAKTFIFELN  242

Query  837  AKALSMDETEF  869
            AK+LS+DE EF
Sbjct  243  AKSLSIDEIEF  253



>ref|XP_002964275.1| hypothetical protein SELMODRAFT_81029 [Selaginella moellendorffii]
 gb|EFJ34608.1| hypothetical protein SELMODRAFT_81029 [Selaginella moellendorffii]
Length=469

 Score =   321 bits (823),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/258 (62%), Positives = 207/258 (80%), Gaps = 3/258 (1%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN+D+F ++T   T+HDFLERM+ PSAAD V++IKSFIV+F ++  DP  DS + Q+FL
Sbjct  1    MENSDMFNAATKQQTFHDFLERMKHPSAADLVRSIKSFIVNFMSSPIDPAMDSASAQDFL  60

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
               E AFRAH LWAG +EEELE+A EGLEKYVMTK+F+  ++  P D   D +L +KI+L
Sbjct  61   STTEVAFRAHPLWAGATEEELENAAEGLEKYVMTKIFTRAYSPLPSDSLKDQELSDKISL  120

Query  456  IQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINAS  635
            +Q F++PE+LD+   FQNE SWL+A+KEL KIN YKAPRDKL+CILNCC+VINNLL+   
Sbjct  121  LQHFIKPEHLDLPQSFQNEASWLIAEKELQKINSYKAPRDKLVCILNCCRVINNLLL---  177

Query  636  ISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAE  815
            ++ +  PPGA++FLP LIYV IKANPPQLHSNL +I+R+RH +RLV+EA+YF+T+L+S E
Sbjct  178  MAKSGTPPGAEEFLPALIYVVIKANPPQLHSNLQFIERYRHSSRLVAEASYFYTSLVSVE  237

Query  816  SFIMNIDAKALSMDETEF  869
            SFI  +DAK+LSMDE EF
Sbjct  238  SFIEKLDAKSLSMDEAEF  255



>ref|XP_007019727.1| Vacuolar sorting protein 9 domain isoform 3 [Theobroma cacao]
 gb|EOY16952.1| Vacuolar sorting protein 9 domain isoform 3 [Theobroma cacao]
Length=300

 Score =   315 bits (807),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 204/249 (82%), Gaps = 0/249 (0%)
 Frame = +3

Query  123  STAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRA  302
            +T  L +  FL++MR P++ D V++IKSFIVSFS NA +PE D K +Q+F    EAA R 
Sbjct  3    TTHSLPFDSFLDKMRNPASLDLVRSIKSFIVSFSFNAGNPENDGKRIQDFFLTTEAAIRD  62

Query  303  HSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPEN  482
            H LWAG ++EE+++A EGLEKYVMTKL S  FAS  ED+K+D ++ EKI L+Q F+RPE+
Sbjct  63   HPLWAGSTDEEIDNALEGLEKYVMTKLHSRTFASSAEDIKMDREISEKICLLQTFLRPEH  122

Query  483  LDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPG  662
            LDI  V QNE SWLLA+KEL KIN +KAPR+KLLCI+NCC+VINNLL+NASIS +  P G
Sbjct  123  LDIPVVLQNEASWLLAEKELKKINAFKAPREKLLCIMNCCRVINNLLLNASISEDHVPGG  182

Query  663  ADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAK  842
            ADDFLPVLIYVTIKANPPQLHSNL +IQ +R Q++L+SEAAY+ TNL+SA+SFI++++AK
Sbjct  183  ADDFLPVLIYVTIKANPPQLHSNLKFIQLYRRQSKLISEAAYYHTNLVSAKSFIVDLNAK  242

Query  843  ALSMDETEF  869
            +LS++ETEF
Sbjct  243  SLSIEETEF  251



>ref|XP_012073500.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X1 [Jatropha curcas]
Length=404

 Score =   318 bits (815),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 158/247 (64%), Positives = 197/247 (80%), Gaps = 0/247 (0%)
 Frame = +3

Query  129  APLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHS  308
            + +T++DFL++MR P++ D V++IKSFIVSFS    +PE D K VQEF   ME A   H 
Sbjct  17   SSITFYDFLDKMRNPASLDLVRSIKSFIVSFSFYTANPENDGKRVQEFFSTMEGAIMDHP  76

Query  309  LWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLD  488
            LWAG + EE++ A EG+EKYVMTKLFS  FA+ PEDVK+D  + EKI L+Q F+RPE+LD
Sbjct  77   LWAGATNEEVDCAMEGMEKYVMTKLFSRTFAASPEDVKIDRNISEKIQLLQTFLRPEHLD  136

Query  489  IKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGAD  668
            I  V QNE SWLLA+KEL KIN  KAPR+KLLCI++CC+VINNLL+NASIS N    GAD
Sbjct  137  IPAVLQNEASWLLAEKELQKINASKAPREKLLCIMSCCRVINNLLLNASISENHVLGGAD  196

Query  669  DFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKAL  848
            DFLPVLIYV IKANPP LHSNL +IQ +R Q +LVSEAAY+FTN++SA+SFI++++AK+L
Sbjct  197  DFLPVLIYVMIKANPPLLHSNLKFIQLYRRQAKLVSEAAYYFTNIVSAKSFIVDLNAKSL  256

Query  849  SMDETEF  869
            SMDE EF
Sbjct  257  SMDEIEF  263



>gb|KDO51372.1| hypothetical protein CISIN_1g014956mg [Citrus sinensis]
Length=415

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/245 (64%), Positives = 198/245 (81%), Gaps = 0/245 (0%)
 Frame = +3

Query  135  LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLW  314
            +T++DFL+RMR P++ D V++IKSFIVSFS N  +PE D K VQEF   ME+A + H LW
Sbjct  17   VTFYDFLDRMRNPASLDLVRSIKSFIVSFSFNNANPENDGKRVQEFFTTMESAIKDHPLW  76

Query  315  AGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIK  494
            A  + E +ESA EGLEKYVMTKLFS  FAS  EDVK+D ++ EKI L+Q F+RPE+LDI 
Sbjct  77   ANATIEAIESAMEGLEKYVMTKLFSRTFASTSEDVKIDQEISEKICLLQTFLRPEHLDIP  136

Query  495  PVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDF  674
               QNE SWLLA+KEL KIN  KAPR+K+LCI+NCC++INNLL+NASIS N    GADDF
Sbjct  137  TFLQNEASWLLAEKELQKINALKAPREKVLCIMNCCRIINNLLLNASISENVELGGADDF  196

Query  675  LPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSM  854
            LPVLIY+ IKANPPQLHSN+ +IQ +R Q  LVSEAAY+FTNL+SA++FI++++AK+LSM
Sbjct  197  LPVLIYIIIKANPPQLHSNIKFIQLYRRQAMLVSEAAYYFTNLVSAKTFILDLNAKSLSM  256

Query  855  DETEF  869
            +ETEF
Sbjct  257  EETEF  261



>ref|XP_008391861.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Malus domestica]
Length=377

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/251 (63%), Positives = 200/251 (80%), Gaps = 0/251 (0%)
 Frame = +3

Query  117  GSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAF  296
            G S++   ++DFL+RMR P++ D V++IKSFIVSFS  A +PE D K VQEF   ME   
Sbjct  3    GLSSSSAIFYDFLDRMRNPASLDLVRSIKSFIVSFSFYAANPESDGKKVQEFYATMEDNI  62

Query  297  RAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRP  476
            R H LWAG +++E++ A EGLEKYVMTKLFS  FAS PED K+D +   KI L++ F++P
Sbjct  63   RDHPLWAGATDQEVDCAMEGLEKYVMTKLFSRTFASSPEDAKIDLETSHKIHLLETFLKP  122

Query  477  ENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENP  656
            E+LDI  V +NE SWLLA+KEL KIN +KAPR+KLLCI+NCCKVINNLL+NAS+S N   
Sbjct  123  EHLDIPVVLRNEASWLLAEKELQKINAFKAPREKLLCIMNCCKVINNLLLNASMSENHVL  182

Query  657  PGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNID  836
             GADDFLPVLIYV IKANPPQLHSNL +IQ +R QT+LVSEAAY+FTNL+SA++FI+ ++
Sbjct  183  AGADDFLPVLIYVMIKANPPQLHSNLRFIQLYRRQTKLVSEAAYYFTNLVSAKTFILELN  242

Query  837  AKALSMDETEF  869
            AK+LS+DE EF
Sbjct  243  AKSLSIDEIEF  253



>ref|XP_007019725.1| Vacuolar sorting protein 9 domain isoform 1 [Theobroma cacao]
 ref|XP_007019726.1| Vacuolar sorting protein 9 domain isoform 1 [Theobroma cacao]
 gb|EOY16950.1| Vacuolar sorting protein 9 domain isoform 1 [Theobroma cacao]
 gb|EOY16951.1| Vacuolar sorting protein 9 domain isoform 1 [Theobroma cacao]
Length=384

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 204/249 (82%), Gaps = 0/249 (0%)
 Frame = +3

Query  123  STAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRA  302
            +T  L +  FL++MR P++ D V++IKSFIVSFS NA +PE D K +Q+F    EAA R 
Sbjct  3    TTHSLPFDSFLDKMRNPASLDLVRSIKSFIVSFSFNAGNPENDGKRIQDFFLTTEAAIRD  62

Query  303  HSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPEN  482
            H LWAG ++EE+++A EGLEKYVMTKL S  FAS  ED+K+D ++ EKI L+Q F+RPE+
Sbjct  63   HPLWAGSTDEEIDNALEGLEKYVMTKLHSRTFASSAEDIKMDREISEKICLLQTFLRPEH  122

Query  483  LDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPG  662
            LDI  V QNE SWLLA+KEL KIN +KAPR+KLLCI+NCC+VINNLL+NASIS +  P G
Sbjct  123  LDIPVVLQNEASWLLAEKELKKINAFKAPREKLLCIMNCCRVINNLLLNASISEDHVPGG  182

Query  663  ADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAK  842
            ADDFLPVLIYVTIKANPPQLHSNL +IQ +R Q++L+SEAAY+ TNL+SA+SFI++++AK
Sbjct  183  ADDFLPVLIYVTIKANPPQLHSNLKFIQLYRRQSKLISEAAYYHTNLVSAKSFIVDLNAK  242

Query  843  ALSMDETEF  869
            +LS++ETEF
Sbjct  243  SLSIEETEF  251



>ref|XP_006441804.1| hypothetical protein CICLE_v10020271mg [Citrus clementina]
 gb|ESR55044.1| hypothetical protein CICLE_v10020271mg [Citrus clementina]
Length=425

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/245 (64%), Positives = 198/245 (81%), Gaps = 0/245 (0%)
 Frame = +3

Query  135  LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLW  314
            +T++DFL+RMR P++ D V++IKSFIVSFS N  +PE D K VQEF   ME+A + H LW
Sbjct  17   VTFYDFLDRMRNPASLDLVRSIKSFIVSFSFNNANPENDGKRVQEFFTTMESAIKDHPLW  76

Query  315  AGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIK  494
            A  + E +ESA EGLEKYVMTKLFS  FAS  EDVK+D ++ EKI L+Q F+RPE+LDI 
Sbjct  77   ANATIEAIESAMEGLEKYVMTKLFSRTFASTSEDVKIDQEISEKICLLQTFLRPEHLDIP  136

Query  495  PVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDF  674
               QNE SWLLA+KEL KIN  KAPR+K+LCI+NCC++INNLL+NASIS N    GADDF
Sbjct  137  TFLQNEASWLLAEKELQKINALKAPREKVLCIMNCCRIINNLLLNASISENVELGGADDF  196

Query  675  LPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSM  854
            LPVLIY+ IKANPPQLHSN+ +IQ +R Q  LVSEAAY+FTNL+SA++FI++++AK+LSM
Sbjct  197  LPVLIYIIIKANPPQLHSNIKFIQLYRRQAMLVSEAAYYFTNLVSAKTFILDLNAKSLSM  256

Query  855  DETEF  869
            +ETEF
Sbjct  257  EETEF  261



>ref|XP_006478314.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Citrus sinensis]
Length=415

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/245 (64%), Positives = 199/245 (81%), Gaps = 0/245 (0%)
 Frame = +3

Query  135  LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLW  314
            +T++DFL+RMR P++ D V++IKSFIVSFS N  +PE D K VQEF   ME+A + H LW
Sbjct  17   VTFYDFLDRMRNPASLDLVRSIKSFIVSFSFNNANPENDGKRVQEFFTTMESAIKDHPLW  76

Query  315  AGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIK  494
            A  + E++ESA EGLEKYVMTKLFS  FAS  EDVK+D ++ EKI L+Q F+RPE+LDI 
Sbjct  77   ANATIEDIESAMEGLEKYVMTKLFSRTFASTSEDVKIDQEISEKICLLQTFLRPEHLDIP  136

Query  495  PVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDF  674
               QNE SWLLA+KEL KIN  KAPR+K+LCI+NCC++INNLL+NASIS N    GADDF
Sbjct  137  TFLQNEASWLLAEKELQKINALKAPREKVLCIMNCCRIINNLLLNASISENVELGGADDF  196

Query  675  LPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSM  854
            LPVLIY+ IKANPPQLHSN+ +IQ +R Q  LVSEAAY+FTNL+SA++FI++++AK+LSM
Sbjct  197  LPVLIYIIIKANPPQLHSNIKFIQLYRRQAMLVSEAAYYFTNLVSAKTFILDLNAKSLSM  256

Query  855  DETEF  869
            +ETEF
Sbjct  257  EETEF  261



>gb|KDP36696.1| hypothetical protein JCGZ_07987 [Jatropha curcas]
Length=353

 Score =   315 bits (807),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/247 (64%), Positives = 197/247 (80%), Gaps = 0/247 (0%)
 Frame = +3

Query  129  APLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHS  308
            + +T++DFL++MR P++ D V++IKSFIVSFS    +PE D K VQEF   ME A   H 
Sbjct  17   SSITFYDFLDKMRNPASLDLVRSIKSFIVSFSFYTANPENDGKRVQEFFSTMEGAIMDHP  76

Query  309  LWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLD  488
            LWAG + EE++ A EG+EKYVMTKLFS  FA+ PEDVK+D  + EKI L+Q F+RPE+LD
Sbjct  77   LWAGATNEEVDCAMEGMEKYVMTKLFSRTFAASPEDVKIDRNISEKIQLLQTFLRPEHLD  136

Query  489  IKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGAD  668
            I  V QNE SWLLA+KEL KIN  KAPR+KLLCI++CC+VINNLL+NASIS N    GAD
Sbjct  137  IPAVLQNEASWLLAEKELQKINASKAPREKLLCIMSCCRVINNLLLNASISENHVLGGAD  196

Query  669  DFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKAL  848
            DFLPVLIYV IKANPP LHSNL +IQ +R Q +LVSEAAY+FTN++SA+SFI++++AK+L
Sbjct  197  DFLPVLIYVMIKANPPLLHSNLKFIQLYRRQAKLVSEAAYYFTNIVSAKSFIVDLNAKSL  256

Query  849  SMDETEF  869
            SMDE EF
Sbjct  257  SMDEIEF  263



>ref|XP_009347394.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X1 [Pyrus x bretschneideri]
Length=382

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/243 (65%), Positives = 196/243 (81%), Gaps = 0/243 (0%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            ++DFL+RMR P++ D V++IKSFIVSFS  A +PE D K VQEF   ME   R H LWAG
Sbjct  14   FYDFLDRMRNPASLDLVRSIKSFIVSFSFYAANPESDGKKVQEFYATMEDNIRDHPLWAG  73

Query  321  CseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPV  500
             +++E++ A EGLEKYVMTKLFS  FAS PED K+D +   KI L+Q F++PE+LDI  V
Sbjct  74   ATDQEVDCAMEGLEKYVMTKLFSRTFASSPEDAKIDLETSHKIHLLQTFLKPEHLDIPVV  133

Query  501  FQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLP  680
             +NE SWLLA+KEL KIN +KAPR+KLLCI+NCCKVINNLL+NAS+S N    GADDFLP
Sbjct  134  LRNEASWLLAEKELQKINAFKAPREKLLCIMNCCKVINNLLLNASMSENHVLAGADDFLP  193

Query  681  VLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDE  860
            VLIYV IKANPPQLHSNL +IQ +R QT+LVSEAAY+FTNL+SA++FI+ ++AK+LS+DE
Sbjct  194  VLIYVMIKANPPQLHSNLRFIQLYRRQTKLVSEAAYYFTNLVSAKTFILELNAKSLSIDE  253

Query  861  TEF  869
             EF
Sbjct  254  IEF  256



>ref|XP_009347395.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X2 [Pyrus x bretschneideri]
Length=380

 Score =   315 bits (808),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 158/243 (65%), Positives = 196/243 (81%), Gaps = 0/243 (0%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            ++DFL+RMR P++ D V++IKSFIVSFS  A +PE D K VQEF   ME   R H LWAG
Sbjct  14   FYDFLDRMRNPASLDLVRSIKSFIVSFSFYAANPESDGKKVQEFYATMEDNIRDHPLWAG  73

Query  321  CseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPV  500
             +++E++ A EGLEKYVMTKLFS  FAS PED K+D +   KI L+Q F++PE+LDI  V
Sbjct  74   ATDQEVDCAMEGLEKYVMTKLFSRTFASSPEDAKIDLETSHKIHLLQTFLKPEHLDIPVV  133

Query  501  FQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLP  680
             +NE SWLLA+KEL KIN +KAPR+KLLCI+NCCKVINNLL+NAS+S N    GADDFLP
Sbjct  134  LRNEASWLLAEKELQKINAFKAPREKLLCIMNCCKVINNLLLNASMSENHVLAGADDFLP  193

Query  681  VLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDE  860
            VLIYV IKANPPQLHSNL +IQ +R QT+LVSEAAY+FTNL+SA++FI+ ++AK+LS+DE
Sbjct  194  VLIYVMIKANPPQLHSNLRFIQLYRRQTKLVSEAAYYFTNLVSAKTFILELNAKSLSIDE  253

Query  861  TEF  869
             EF
Sbjct  254  IEF  256



>gb|AAP06853.1| unknown protein [Oryza sativa Japonica Group]
Length=559

 Score =   321 bits (822),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 192/221 (87%), Gaps = 4/221 (2%)
 Frame = +3

Query  207  FIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLF  386
            FIV+FSN APDPE DS AVQEFL NME AFRAH+ WAG SEEELESAGEGLEKYVMTKLF
Sbjct  124  FIVTFSNRAPDPEHDSAAVQEFLENMEGAFRAHTPWAGSSEEELESAGEGLEKYVMTKLF  183

Query  387  SHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKA  566
            + VFAS PEDVK D++L+EK++L+QQF+RPENLDIKP +Q+ETSWLLAQKEL KINMYKA
Sbjct  184  NRVFASVPEDVKSDEELFEKMSLLQQFIRPENLDIKPEYQSETSWLLAQKELQKINMYKA  243

Query  567  PRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQ  746
            PRDKL CILNCCKVINNLL+NASI +NENPPGAD+FLPVLIYVTIK    + +  ++   
Sbjct  244  PRDKLACILNCCKVINNLLLNASIVSNENPPGADEFLPVLIYVTIK----KKYKPIIGAV  299

Query  747  RFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            R+R Q+RLVSEA YFFTN+LSAESFI NID ++LSMDE +F
Sbjct  300  RYRRQSRLVSEAQYFFTNILSAESFIWNIDGESLSMDERDF  340


 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 48/81 (59%), Gaps = 14/81 (17%)
 Frame = +3

Query  111  VFGSSTAPLTWHDFLERMRQPSAADFVKAIKSF----------IVSFSNNAPDPERDSKA  260
             FGS+TAPL WHDFLERMRQPSAADFVK+IK            ++  S+ + DP R + A
Sbjct  9    AFGSATAPLAWHDFLERMRQPSAADFVKSIKGLAPPQIFGARHMLDLSSWSRDPRRKACA  68

Query  261  VQEFLGNMEAAFRAHSLWAGC  323
                +G+  AA R  S+  G 
Sbjct  69   A---IGSCYAA-RVGSIVCGA  85



>ref|XP_010999499.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X2 [Populus euphratica]
Length=385

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/245 (62%), Positives = 198/245 (81%), Gaps = 0/245 (0%)
 Frame = +3

Query  135  LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLW  314
            + ++DFL++MR P++ + VK+IKSFIVSF  ++ +PE DSK VQEF   MEAA   H LW
Sbjct  15   VMFYDFLDKMRNPASLNLVKSIKSFIVSFQFSSANPENDSKRVQEFFSTMEAAIMEHPLW  74

Query  315  AGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIK  494
            AG +++E + + EGLEKY+MTKLFS  FA  PEDV++D ++ EKI ++Q F+RPE+LDI 
Sbjct  75   AGATDDEFDCSMEGLEKYIMTKLFSRTFAISPEDVQIDQEISEKIHMLQSFLRPEHLDIP  134

Query  495  PVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDF  674
            P  QNE SWLLA+KEL KIN ++APR+KL CI++CC++INNLL+NAS+S N    GADDF
Sbjct  135  PFLQNEASWLLAEKELQKINAFRAPREKLHCIMSCCRIINNLLLNASMSENHVVGGADDF  194

Query  675  LPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSM  854
            LPVLIYVTIKANPPQLHSNL YIQ +R Q ++VSE AY+FTNL+SA+SFI+ +DAK+LSM
Sbjct  195  LPVLIYVTIKANPPQLHSNLKYIQLYRRQEKMVSEPAYYFTNLVSAKSFIVQLDAKSLSM  254

Query  855  DETEF  869
            DE EF
Sbjct  255  DEIEF  259



>ref|XP_010999498.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X1 [Populus euphratica]
Length=385

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/245 (62%), Positives = 198/245 (81%), Gaps = 0/245 (0%)
 Frame = +3

Query  135  LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLW  314
            + ++DFL++MR P++ + VK+IKSFIVSF  ++ +PE DSK VQEF   MEAA   H LW
Sbjct  15   VMFYDFLDKMRNPASLNLVKSIKSFIVSFQFSSANPENDSKRVQEFFSTMEAAIMEHPLW  74

Query  315  AGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIK  494
            AG +++E + + EGLEKY+MTKLFS  FA  PEDV++D ++ EKI ++Q F+RPE+LDI 
Sbjct  75   AGATDDEFDCSMEGLEKYIMTKLFSRTFAISPEDVQIDQEISEKIHMLQSFLRPEHLDIP  134

Query  495  PVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDF  674
            P  QNE SWLLA+KEL KIN ++APR+KL CI++CC++INNLL+NAS+S N    GADDF
Sbjct  135  PFLQNEASWLLAEKELQKINAFRAPREKLHCIMSCCRIINNLLLNASMSENHVVGGADDF  194

Query  675  LPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSM  854
            LPVLIYVTIKANPPQLHSNL YIQ +R Q ++VSE AY+FTNL+SA+SFI+ +DAK+LSM
Sbjct  195  LPVLIYVTIKANPPQLHSNLKYIQLYRRQEKMVSEPAYYFTNLVSAKSFIVQLDAKSLSM  254

Query  855  DETEF  869
            DE EF
Sbjct  255  DEIEF  259



>ref|XP_010252346.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X1 [Nelumbo nucifera]
Length=383

 Score =   313 bits (803),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 206/249 (83%), Gaps = 1/249 (0%)
 Frame = +3

Query  123  STAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRA  302
            S+  LT++DFL+RMR P++ D V++IKSFIVSFS    + E DSK +Q+FL  ME++ R 
Sbjct  4    SSNSLTFYDFLDRMRHPASLDLVRSIKSFIVSFSFCTANSESDSKKLQDFLLTMESSIRD  63

Query  303  HSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPEN  482
            H LWAG +EEE++ A EGLEKYVMTKLF+  FAS  ED KVD ++ EKI L+Q F++PE+
Sbjct  64   HPLWAGATEEEIDCAVEGLEKYVMTKLFTRTFASS-EDTKVDQEISEKICLLQHFIKPEH  122

Query  483  LDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPG  662
            LDI   + NETSWL AQKEL K+N +KAPR+KLLCILNCC+VINNLL+N ++S++  P G
Sbjct  123  LDIPGPYHNETSWLFAQKELQKMNAFKAPREKLLCILNCCRVINNLLLNVAMSSDNVPAG  182

Query  663  ADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAK  842
            ADDFLP+LIYVTIKANPPQLHSNL +IQ +R Q++L+SEAAY+FTNL+SA+SFI+++DAK
Sbjct  183  ADDFLPILIYVTIKANPPQLHSNLKFIQLYRRQSKLISEAAYYFTNLMSAKSFIIDLDAK  242

Query  843  ALSMDETEF  869
            +LS++E+EF
Sbjct  243  SLSINESEF  251



>ref|XP_010063729.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Eucalyptus grandis]
 gb|KCW70987.1| hypothetical protein EUGRSUZ_F04096 [Eucalyptus grandis]
Length=395

 Score =   313 bits (802),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/245 (64%), Positives = 198/245 (81%), Gaps = 0/245 (0%)
 Frame = +3

Query  135  LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLW  314
            + ++DFL+RMR P++ D V++IKSFIVSFS   P+PE D K VQ+F   ME A R H LW
Sbjct  22   MEFYDFLDRMRNPASLDLVRSIKSFIVSFSFYPPNPENDGKKVQDFFMTMEGALRDHPLW  81

Query  315  AGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIK  494
            AG S+ E++ A EGLEKYVMTKLFS  FA  PED KVD ++ EKI+L+Q F+RPE+LDI 
Sbjct  82   AGASDNEIDCAMEGLEKYVMTKLFSRTFACSPEDTKVDREIAEKISLLQTFLRPEHLDIP  141

Query  495  PVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDF  674
             V +NE SWLLA+KEL K+N +KAPR+KLLCI+NCC+VINNLL+NAS+S N    GADDF
Sbjct  142  AVLRNEASWLLAEKELQKMNSFKAPREKLLCIMNCCRVINNLLLNASMSENHVLAGADDF  201

Query  675  LPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSM  854
            LPVLIYVTIKANPP+LHSNL +IQ +R Q +LVSEAAY+ TNL+SA+SFI +++A++LS+
Sbjct  202  LPVLIYVTIKANPPELHSNLKFIQLYRRQAKLVSEAAYYLTNLISAKSFIADLNARSLSI  261

Query  855  DETEF  869
            +E EF
Sbjct  262  NEIEF  266



>ref|XP_010228836.1| PREDICTED: vacuolar protein sorting-associated protein 9A isoform 
X3 [Brachypodium distachyon]
Length=429

 Score =   313 bits (803),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  282  MEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQ  461
            ME AFRAH+ WAG SEEELESAGEGLEKYVMTKLF+ VFAS PEDVK D++L+EK++L+Q
Sbjct  1    MEGAFRAHTPWAGSSEEELESAGEGLEKYVMTKLFNRVFASVPEDVKSDEELFEKMSLLQ  60

Query  462  QFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASIS  641
            QFVRPENLDIKP +QNETSWLLAQKEL KINMYKAPRDKL CILNCCKVINNLL+NAS  
Sbjct  61   QFVRPENLDIKPEYQNETSWLLAQKELQKINMYKAPRDKLACILNCCKVINNLLMNASHM  120

Query  642  ANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESF  821
            +N+N PGAD+FLPVLIYVT+KANPPQLHSNLLYIQR+R Q+RLVSEA YFFTN+LSAESF
Sbjct  121  SNDNAPGADEFLPVLIYVTLKANPPQLHSNLLYIQRYRSQSRLVSEAQYFFTNILSAESF  180

Query  822  IMNIDAKALSMDETEF  869
            I NIDA++LSMDE +F
Sbjct  181  IWNIDAESLSMDERDF  196



>ref|XP_008803797.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Phoenix dactylifera]
Length=374

 Score =   310 bits (793),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 156/243 (64%), Positives = 193/243 (79%), Gaps = 0/243 (0%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            ++DFL RMR P++AD V+AIKSFIVSFS +  D E DS+ +Q+FL  ME+  + H LWA 
Sbjct  12   FYDFLNRMRHPASADLVRAIKSFIVSFSFHTTDAENDSRKLQDFLVTMESTIKEHPLWAH  71

Query  321  CseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPV  500
             S EE++SA EGLEKYVMTKLF+  FAS PEDVK D  + EKI L+Q FVRP++LD+  V
Sbjct  72   ASHEEIDSAVEGLEKYVMTKLFNRTFASSPEDVKADLYISEKIRLLQHFVRPDHLDVPRV  131

Query  501  FQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLP  680
             +NE SWL A KEL KIN +K PR+KLLCI+NCC++INNLL+N S+S N  P GADDFLP
Sbjct  132  LRNEASWLFAAKELQKINSFKVPREKLLCIMNCCRIINNLLLNISMSTNYVPAGADDFLP  191

Query  681  VLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDE  860
            VLIYVTIKANPPQLHSNL +IQ FR Q++LVSE  Y+ TNL+SAE+FI NI+A +LSM+E
Sbjct  192  VLIYVTIKANPPQLHSNLKFIQLFRRQSKLVSEVEYYLTNLISAETFITNINASSLSMEE  251

Query  861  TEF  869
            +EF
Sbjct  252  SEF  254



>ref|XP_010665496.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X3 [Vitis vinifera]
Length=381

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/251 (63%), Positives = 197/251 (78%), Gaps = 11/251 (4%)
 Frame = +3

Query  117  GSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAF  296
             SS+ PLT++DFL+RMR P++ D V++IKS           PE D K +Q+FL  ME + 
Sbjct  3    ASSSQPLTFYDFLDRMRNPASLDLVRSIKS-----------PENDGKRLQDFLLTMEDSI  51

Query  297  RAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRP  476
            R H LW G +EEE++SA EGLEKYVMTKLFS  FA+ PED K D ++ EKI+L+Q F+RP
Sbjct  52   RDHPLWVGATEEEIDSAIEGLEKYVMTKLFSRTFAASPEDAKADQEISEKISLLQNFLRP  111

Query  477  ENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENP  656
            E+LDI  V QNE SWLLA+KEL K+N +KAPR+KLLCILNCC+VINNLL+NA++S N   
Sbjct  112  EHLDIPAVLQNEASWLLAEKELQKVNAFKAPREKLLCILNCCRVINNLLLNAAMSENHIL  171

Query  657  PGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNID  836
             GADDFLPVLIYVTIKANPPQLHSNL +IQ +R Q +LVSE AY+FTNL+SA+SFI+++D
Sbjct  172  AGADDFLPVLIYVTIKANPPQLHSNLKFIQLYRRQEKLVSEVAYYFTNLVSAKSFIVDLD  231

Query  837  AKALSMDETEF  869
            AK+LSMD  EF
Sbjct  232  AKSLSMDAVEF  242



>ref|XP_004290268.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Fragaria vesca subsp. vesca]
Length=380

 Score =   307 bits (787),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 155/243 (64%), Positives = 194/243 (80%), Gaps = 0/243 (0%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            ++DFL+RMR P++ D V++IKSFIVSFS    +PE D K VQEF   ME + R H LW+G
Sbjct  13   FYDFLDRMRNPASLDLVRSIKSFIVSFSFYPANPENDGKRVQEFFATMEDSIRDHPLWSG  72

Query  321  CseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPV  500
             +E+E++SA EGLEKYVMTKLFS  F+S PED K D ++  KI L+Q F++PE+LDI PV
Sbjct  73   ATEDEVQSAMEGLEKYVMTKLFSRTFSSCPEDAKTDLEVSHKIQLLQTFLKPEHLDIPPV  132

Query  501  FQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLP  680
             +NE SWLLA+KEL KIN +KAPR+KLLCI+NCCKVINNLL+NAS+S      GADDFLP
Sbjct  133  LRNEASWLLAEKELQKINAFKAPREKLLCIMNCCKVINNLLLNASMSEKHVLAGADDFLP  192

Query  681  VLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDE  860
            VLIYV IKANPPQLHSNL +IQ +R Q +LVSEAAY+ TNL+SA++FI  ++AK+LS+DE
Sbjct  193  VLIYVMIKANPPQLHSNLKFIQLYRRQAKLVSEAAYYLTNLVSAKTFISELNAKSLSIDE  252

Query  861  TEF  869
             EF
Sbjct  253  IEF  255



>gb|KJB26934.1| hypothetical protein B456_004G268000 [Gossypium raimondii]
Length=374

 Score =   305 bits (780),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 192/235 (82%), Gaps = 0/235 (0%)
 Frame = +3

Query  150  FLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAGCse  329
            FL+RMR P++ D V++IKSFIVSFS  A +PE D K +QEF   ME A R H LWA  S+
Sbjct  13   FLDRMRNPASLDLVRSIKSFIVSFSYTASNPETDGKRIQEFFQTMEDAIRDHPLWASSSD  72

Query  330  eelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQN  509
            +E ++A EGLEKYVMTKL S  FAS PEDVK+D ++ EKI+L+Q F+RP++LDI    QN
Sbjct  73   DETDNALEGLEKYVMTKLHSRTFASTPEDVKIDAEISEKISLLQTFLRPQHLDIPSALQN  132

Query  510  ETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLI  689
            E +WLLA+KEL KIN +KAPR+KLLCI+NC +VINNLL+NASIS +  P GADDFLPVLI
Sbjct  133  EAAWLLAEKELKKINAFKAPREKLLCIINCSRVINNLLLNASISEDHVPGGADDFLPVLI  192

Query  690  YVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSM  854
            YVTIKANPPQLHSNL +IQ +R Q++LVSEAAY+ TNL+SA+SFI++++AK+LS+
Sbjct  193  YVTIKANPPQLHSNLKFIQLYRRQSKLVSEAAYYLTNLVSAKSFIVDLNAKSLSI  247



>gb|KJB26935.1| hypothetical protein B456_004G268000 [Gossypium raimondii]
 gb|KJB26936.1| hypothetical protein B456_004G268000 [Gossypium raimondii]
Length=375

 Score =   305 bits (780),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 192/235 (82%), Gaps = 0/235 (0%)
 Frame = +3

Query  150  FLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAGCse  329
            FL+RMR P++ D V++IKSFIVSFS  A +PE D K +QEF   ME A R H LWA  S+
Sbjct  13   FLDRMRNPASLDLVRSIKSFIVSFSYTASNPETDGKRIQEFFQTMEDAIRDHPLWASSSD  72

Query  330  eelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQN  509
            +E ++A EGLEKYVMTKL S  FAS PEDVK+D ++ EKI+L+Q F+RP++LDI    QN
Sbjct  73   DETDNALEGLEKYVMTKLHSRTFASTPEDVKIDAEISEKISLLQTFLRPQHLDIPSALQN  132

Query  510  ETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLI  689
            E +WLLA+KEL KIN +KAPR+KLLCI+NC +VINNLL+NASIS +  P GADDFLPVLI
Sbjct  133  EAAWLLAEKELKKINAFKAPREKLLCIINCSRVINNLLLNASISEDHVPGGADDFLPVLI  192

Query  690  YVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSM  854
            YVTIKANPPQLHSNL +IQ +R Q++LVSEAAY+ TNL+SA+SFI++++AK+LS+
Sbjct  193  YVTIKANPPQLHSNLKFIQLYRRQSKLVSEAAYYLTNLVSAKSFIVDLNAKSLSI  247



>ref|XP_004499674.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Cicer arietinum]
Length=379

 Score =   302 bits (774),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/251 (60%), Positives = 199/251 (79%), Gaps = 1/251 (0%)
 Frame = +3

Query  117  GSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAF  296
            GS++   ++H FL RMR PS+ D V+AIKSFIVSFS   P PE D K VQ+F  +ME A 
Sbjct  3    GSTSRSTSFHGFLHRMRHPSSIDLVRAIKSFIVSFSFYQPKPENDGKRVQDFFLSMEVAI  62

Query  297  RAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRP  476
            R H LW   +EE+++ A EGLEKY+MTKLFS  F +  ED K+D ++ EKI+L+Q F++P
Sbjct  63   RNHPLWETATEEDIDCAMEGLEKYIMTKLFSRTFTTSLEDSKIDQEISEKISLLQTFLKP  122

Query  477  ENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENP  656
            E+LDI+PV  NE SWLLA+KEL K+N +KAP++KL  I+NCC+VINNLL+NA++S +  P
Sbjct  123  EHLDIQPVLHNEASWLLAEKELQKMNAFKAPQEKLSSIMNCCRVINNLLLNAAMSEHV-P  181

Query  657  PGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNID  836
             GADDFLPVLIYVTIKANPP LHSNL +I+ +R QT+L+SEA Y+FTNL+S+++FI +++
Sbjct  182  AGADDFLPVLIYVTIKANPPNLHSNLKFIKLYRRQTKLISEAEYYFTNLVSSKTFITDLN  241

Query  837  AKALSMDETEF  869
            AK+LSMDET+F
Sbjct  242  AKSLSMDETKF  252



>ref|XP_009404953.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Musa acuminata subsp. malaccensis]
Length=370

 Score =   299 bits (765),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 144/243 (59%), Positives = 190/243 (78%), Gaps = 0/243 (0%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            ++DFL RMR+P+AAD V++IKSF++SF     + E D   VQ+FL  ME   + H LWA 
Sbjct  11   FYDFLNRMRRPAAADLVRSIKSFVISFPFQTSNAEHDGNKVQDFLAMMETTIKEHPLWAH  70

Query  321  CseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPV  500
             + EE++SA EGLEKY+MTKLF+H FAS  ED K+D ++ EK  L+Q F++P++LD+  V
Sbjct  71   ATYEEIDSAIEGLEKYIMTKLFTHTFASSSEDAKLDLEISEKNCLLQHFIKPDHLDVPRV  130

Query  501  FQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLP  680
            FQNE SWL A KEL KIN +KAPRDKLLCI+NCC++INNLL++ S++ N  P GADDFLP
Sbjct  131  FQNEASWLFAAKELQKINFFKAPRDKLLCIMNCCRIINNLLLDISMTTNHTPAGADDFLP  190

Query  681  VLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDE  860
            +LIYVTIKANPPQLHSNL ++Q +R  ++LVSE  Y+ TNL+SA++FI NI+A +LSMDE
Sbjct  191  ILIYVTIKANPPQLHSNLKFVQLYRKHSKLVSEVEYYLTNLISAKTFITNINASSLSMDE  250

Query  861  TEF  869
            +EF
Sbjct  251  SEF  253



>gb|AES68516.2| vacuolar protein sorting-associated protein VPS9 [Medicago truncatula]
Length=391

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/243 (61%), Positives = 195/243 (80%), Gaps = 1/243 (0%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +HDFL RMR PS+ D V+AIKSFIVSFS   P PE D + VQ+F  +ME A R H LWA 
Sbjct  13   FHDFLHRMRHPSSLDLVRAIKSFIVSFSFYQPKPENDGRRVQDFFLSMEVAIRNHPLWAT  72

Query  321  CseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPV  500
             +EE+++ A EGLEKY+MTKLFS  FA+ PED K+D ++ EKI+L+Q F++PE+LDI PV
Sbjct  73   ATEEDIDCAMEGLEKYIMTKLFSRTFAASPEDAKIDHEISEKISLLQTFLKPEHLDIPPV  132

Query  501  FQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLP  680
              NE SWLLA+KEL KIN +KAP++KL  I+NCC+VINNLL+NA++S    P GADDF+P
Sbjct  133  LHNEASWLLAEKELQKINAFKAPQEKLSTIMNCCRVINNLLLNAAMSEYV-PAGADDFIP  191

Query  681  VLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDE  860
            VLIYVTIKANPP LHSNL +I+ +R QT+L+SEA Y+FTNL+SA++FI+ +++K+LS+DE
Sbjct  192  VLIYVTIKANPPMLHSNLKFIKLYRRQTKLISEAEYYFTNLVSAKTFIIELNSKSLSIDE  251

Query  861  TEF  869
             +F
Sbjct  252  IKF  254



>ref|XP_007148693.1| hypothetical protein PHAVU_005G006600g [Phaseolus vulgaris]
 gb|ESW20687.1| hypothetical protein PHAVU_005G006600g [Phaseolus vulgaris]
Length=387

 Score =   298 bits (762),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 197/256 (77%), Gaps = 1/256 (0%)
 Frame = +3

Query  102  NADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGN  281
            N D    S +  ++ DFL RM  P++ D V++IKSFIVSFS   P PE D K VQ+F  +
Sbjct  2    NTDTLADSRSKTSFTDFLNRMHHPASLDLVRSIKSFIVSFSFYQPKPENDGKRVQDFFLS  61

Query  282  MEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQ  461
            MEAA R H LW   SEE+++ A EGLEKY+M KLFS  F++ PED K+D+++ EKI L+Q
Sbjct  62   MEAAMRDHPLWTTASEEDIDCAMEGLEKYIMIKLFSRTFSATPEDAKIDNEISEKICLLQ  121

Query  462  QFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASIS  641
             F++PE+LDI P+ QNE SWLLA+KELLKIN +KAP +KLL ILNCC+VIN +L+N ++S
Sbjct  122  TFLKPEHLDIPPILQNEASWLLAEKELLKINAFKAPHEKLLSILNCCRVINKVLLNVAVS  181

Query  642  ANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESF  821
             +  P GADDFLPVLIYVTIKANP +LHSNL +I+ FR Q +L+SEA Y+FTNL+SA +F
Sbjct  182  EHV-PAGADDFLPVLIYVTIKANPQKLHSNLKFIKLFRRQAKLISEAEYYFTNLVSAAAF  240

Query  822  IMNIDAKALSMDETEF  869
            I++++AK+LSMDE +F
Sbjct  241  IVDLNAKSLSMDEIKF  256



>ref|XP_004981098.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X1 [Setaria italica]
Length=350

 Score =   295 bits (756),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/243 (58%), Positives = 189/243 (78%), Gaps = 0/243 (0%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            ++DFL+RMR+P+AAD  ++IKSF+VSFS + P+ E D   VQ FL  ME A R H LWA 
Sbjct  13   FYDFLDRMRRPAAADLFRSIKSFLVSFSFHEPNAEEDGGKVQAFLTEMEGAIRGHPLWAN  72

Query  321  CseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPV  500
             + +E++ A EGLEKY+MTKLF   F +  ED   D ++ +KI L+QQFV+P +LDI  V
Sbjct  73   ATNQEIDHALEGLEKYIMTKLFDRTFGTSAEDAITDMEISQKIGLLQQFVKPHHLDIPKV  132

Query  501  FQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLP  680
             QNE SWLLA KEL KIN +KAPR+KLLCI++CC+VINNLL+N S+S +    GAD+FLP
Sbjct  133  LQNEASWLLAVKELQKINSFKAPREKLLCIMSCCQVINNLLLNISMSNDRTLSGADEFLP  192

Query  681  VLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDE  860
            +LIY+TIKANPPQLHSNL ++Q FR +T+LVSE  Y+ TNL+SA+ FI++++A++LSM+E
Sbjct  193  ILIYITIKANPPQLHSNLKFVQLFRRETKLVSEVEYYLTNLISAKMFILDVNARSLSMEE  252

Query  861  TEF  869
            TEF
Sbjct  253  TEF  255



>ref|XP_010927812.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X2 [Elaeis guineensis]
Length=379

 Score =   295 bits (755),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 151/248 (61%), Positives = 189/248 (76%), Gaps = 5/248 (2%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            ++DFL RMR P++AD V+AIKSFIVSFS +A D + DS+ +Q+FL  ME   + H LW  
Sbjct  12   FYDFLNRMRHPASADLVRAIKSFIVSFSFHATDADNDSRKLQDFLVTMETTIKEHPLWVH  71

Query  321  Cseeeles-----agegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENL  485
             S EEL+S       +GLEKYVMTKLF+  FAS  EDVK D  + EKI L+Q F+RP++L
Sbjct  72   ASHEELDSAIELCTVQGLEKYVMTKLFNRTFASSSEDVKADLDVSEKIRLLQHFIRPDHL  131

Query  486  DIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGA  665
            D+  V  NE SWL A KEL KIN + APR+KLLCI+NCC++INNLL+N S+S+N  P GA
Sbjct  132  DVPRVLHNEASWLFAAKELQKINTFNAPREKLLCIMNCCRIINNLLLNISMSSNYVPAGA  191

Query  666  DDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKA  845
            DDFLPVLIYVTIKANPPQLHSNL +IQ FR  ++LVSE  Y+ TNL+SAE+FI NI+A +
Sbjct  192  DDFLPVLIYVTIKANPPQLHSNLKFIQLFRRNSKLVSEVEYYLTNLISAETFITNINASS  251

Query  846  LSMDETEF  869
            LSM+E+EF
Sbjct  252  LSMEESEF  259



>ref|XP_010927811.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X1 [Elaeis guineensis]
Length=380

 Score =   295 bits (755),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 151/248 (61%), Positives = 189/248 (76%), Gaps = 5/248 (2%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            ++DFL RMR P++AD V+AIKSFIVSFS +A D + DS+ +Q+FL  ME   + H LW  
Sbjct  12   FYDFLNRMRHPASADLVRAIKSFIVSFSFHATDADNDSRKLQDFLVTMETTIKEHPLWVH  71

Query  321  Cseeeles-----agegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENL  485
             S EEL+S       +GLEKYVMTKLF+  FAS  EDVK D  + EKI L+Q F+RP++L
Sbjct  72   ASHEELDSAIELCTVQGLEKYVMTKLFNRTFASSSEDVKADLDVSEKIRLLQHFIRPDHL  131

Query  486  DIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGA  665
            D+  V  NE SWL A KEL KIN + APR+KLLCI+NCC++INNLL+N S+S+N  P GA
Sbjct  132  DVPRVLHNEASWLFAAKELQKINTFNAPREKLLCIMNCCRIINNLLLNISMSSNYVPAGA  191

Query  666  DDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKA  845
            DDFLPVLIYVTIKANPPQLHSNL +IQ FR  ++LVSE  Y+ TNL+SAE+FI NI+A +
Sbjct  192  DDFLPVLIYVTIKANPPQLHSNLKFIQLFRRNSKLVSEVEYYLTNLISAETFITNINASS  251

Query  846  LSMDETEF  869
            LSM+E+EF
Sbjct  252  LSMEESEF  259



>gb|ERN18990.1| hypothetical protein AMTR_s00194p00047120 [Amborella trichopoda]
Length=387

 Score =   294 bits (753),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  363  KYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWLLAQKEL  542
            KY+MTKLF+  FAS PE+VK D++L EK+AL+QQF RP+NLDIKP FQNET WLLAQKEL
Sbjct  26   KYIMTKLFTRAFASIPEEVKKDEELSEKMALVQQFNRPDNLDIKPNFQNETPWLLAQKEL  85

Query  543  LKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQL  722
             KINMYKAPRDKLLCIL+CCKVINNLL+NASI++N+NPPGAD+FLPVLIYVTIKANPPQL
Sbjct  86   QKINMYKAPRDKLLCILHCCKVINNLLLNASIASNDNPPGADEFLPVLIYVTIKANPPQL  145

Query  723  HSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            HSNLLYIQR+R Q+RLVSE+AYFFTNLLSAESFI N+DA +LSMDETEF
Sbjct  146  HSNLLYIQRYRRQSRLVSESAYFFTNLLSAESFIANLDAGSLSMDETEF  194



>ref|NP_001136555.1| hypothetical protein [Zea mays]
 gb|ACF82163.1| unknown [Zea mays]
 tpg|DAA52412.1| TPA: hypothetical protein ZEAMMB73_530565 [Zea mays]
Length=350

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/243 (59%), Positives = 188/243 (77%), Gaps = 0/243 (0%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            ++DFL+RMR+P+AAD  ++IKSF+VSFS +AP+ E D   VQ FL  ME+A R H LWA 
Sbjct  13   FYDFLDRMRRPAAADLFRSIKSFLVSFSFHAPNAEEDGSKVQAFLAEMESAIRDHPLWAN  72

Query  321  CseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPV  500
             +++E++ A EGLEKYV+TKLF   F +  ED   D  + EKI L+QQFV+P +LDI  V
Sbjct  73   ATDQEIDHALEGLEKYVITKLFDRTFGTSTEDAVTDMDISEKIGLLQQFVKPHHLDIPKV  132

Query  501  FQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLP  680
              NE SWLLA KEL KIN +KAPR+KLLCI+NCC+VINNLL+N S+S +    GAD+FLP
Sbjct  133  LHNEASWLLAVKELQKINSFKAPREKLLCIMNCCQVINNLLLNISMSNDRTLSGADEFLP  192

Query  681  VLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDE  860
            +LIYVTIKANPPQLHSNL +IQ FR +T+L+SE  Y+ TNL+SA+ FI+++ A +LSM+E
Sbjct  193  ILIYVTIKANPPQLHSNLKFIQLFRRETKLISEVEYYLTNLISAKMFIIDVSAHSLSMEE  252

Query  861  TEF  869
            +EF
Sbjct  253  SEF  255



>ref|XP_003523864.2| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Glycine max]
Length=400

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/244 (59%), Positives = 196/244 (80%), Gaps = 1/244 (0%)
 Frame = +3

Query  138  TWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWA  317
            ++HDFL RMR P++ D V++IKSFIVSFS + P PE D K VQ+F  +MEAA R HSLW 
Sbjct  33   SFHDFLYRMRHPASLDLVRSIKSFIVSFSFHQPKPENDGKRVQDFFVSMEAAIRDHSLWT  92

Query  318  GCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKP  497
              SEE+++ A +GLEKY+MTKLFS  F++  ED K+D+++  KI L+Q F++PE+LDI P
Sbjct  93   TASEEDIDCAMQGLEKYIMTKLFSRTFSASAEDAKIDNEISSKICLLQTFLKPEHLDIPP  152

Query  498  VFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFL  677
            + QNE  WLLA+KELLKIN +KAP +KLL I+NCC++INNLL+NA++S    P GAD FL
Sbjct  153  ILQNEALWLLAEKELLKINAFKAPHEKLLSIMNCCRIINNLLLNAAMS-EYVPAGADGFL  211

Query  678  PVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMD  857
            PVLIYVTIKANPP+LHSNL +I+ +  Q +L+SEA Y+FTNL+SA++FI++++AK+LSMD
Sbjct  212  PVLIYVTIKANPPKLHSNLKFIKLYTRQAKLISEAEYYFTNLVSAKTFIVDLNAKSLSMD  271

Query  858  ETEF  869
            E ++
Sbjct  272  EIKY  275



>ref|XP_003598265.1| Rab5 GDP/GTP exchange factor [Medicago truncatula]
Length=394

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 195/246 (79%), Gaps = 4/246 (2%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +HDFL RMR PS+ D V+AIKSFIVSFS   P PE D + VQ+F  +ME A R H LWA 
Sbjct  13   FHDFLHRMRHPSSLDLVRAIKSFIVSFSFYQPKPENDGRRVQDFFLSMEVAIRNHPLWAT  72

Query  321  CseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPV  500
             +EE+++ A EGLEKY+MTKLFS  FA+ PED K+D ++ EKI+L+Q F++PE+LDI PV
Sbjct  73   ATEEDIDCAMEGLEKYIMTKLFSRTFAASPEDAKIDHEISEKISLLQTFLKPEHLDIPPV  132

Query  501  FQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLP  680
              NE SWLLA+KEL KIN +KAP++KL  I+NCC+VINNLL+NA++S    P GADDF+P
Sbjct  133  LHNEASWLLAEKELQKINAFKAPQEKLSTIMNCCRVINNLLLNAAMSEYV-PAGADDFIP  191

Query  681  VLIYVTIK---ANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALS  851
            VLIYVTIK   ANPP LHSNL +I+ +R QT+L+SEA Y+FTNL+SA++FI+ +++K+LS
Sbjct  192  VLIYVTIKARLANPPMLHSNLKFIKLYRRQTKLISEAEYYFTNLVSAKTFIIELNSKSLS  251

Query  852  MDETEF  869
            +DE +F
Sbjct  252  IDEIKF  257



>ref|XP_006652011.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Oryza brachyantha]
Length=298

 Score =   285 bits (728),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/251 (55%), Positives = 187/251 (75%), Gaps = 0/251 (0%)
 Frame = +3

Query  117  GSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAF  296
             S  + L ++DF+ RMR+P+AA    +I++F+ S S   P+ E     VQ F   MEAA 
Sbjct  5    ASPASRLDFYDFIARMRRPAAAGLFHSIRNFLASLSQGEPNAEEGGARVQAFFAEMEAAI  64

Query  297  RAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRP  476
            R H LWA  S +E+++A EGLEK++MTKLF   FAS  EDVK D ++ EKI L+Q+FVRP
Sbjct  65   RDHPLWANASNQEIDNALEGLEKFIMTKLFDRTFASSAEDVKADMEITEKIGLLQRFVRP  124

Query  477  ENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENP  656
             +LDI  V  NET+WLLA KEL KIN +K+PR+KL+C+L+CC++INNLL+N S+S +   
Sbjct  125  HHLDIPKVLHNETAWLLAVKELQKINSFKSPREKLICVLSCCQIINNLLLNVSMSNDRTL  184

Query  657  PGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNID  836
             GADDFLP+LIY+TIKANPPQLHSNL +IQ FR +T+L+SE  Y+ TNL+SA+ FI+N+D
Sbjct  185  SGADDFLPILIYITIKANPPQLHSNLKFIQLFRRETKLISEVEYYLTNLISAKMFIINVD  244

Query  837  AKALSMDETEF  869
             ++LSM+E+ F
Sbjct  245  GRSLSMEESVF  255



>gb|EEC76506.1| hypothetical protein OsI_14274 [Oryza sativa Indica Group]
Length=308

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/254 (56%), Positives = 186/254 (73%), Gaps = 4/254 (2%)
 Frame = +3

Query  120  SSTAP---LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNA-PDPERDSKAVQEFLGNME  287
            S T+P   L ++DF+ RMR+P+AAD   +I+SF+ S S    P+ E D   VQ F   ME
Sbjct  3    SPTSPASRLDFYDFIGRMRRPAAADLFHSIRSFLASLSQGGEPNAEVDGGRVQTFFAEME  62

Query  288  AAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQF  467
             A R H LWA  + +E+++A EGLEKY+MTKLF   FAS  EDVK D ++ EKI L+Q F
Sbjct  63   TAIRDHPLWANATNQEIDNALEGLEKYIMTKLFDRAFASSAEDVKSDMEISEKIGLLQHF  122

Query  468  VRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISAN  647
            VRP +LDI  +  NE +WLLA KEL KIN +K+PR+KL CI++CC+VINNLL+N S+S +
Sbjct  123  VRPHHLDIPKLLHNEAAWLLAVKELQKINSFKSPREKLSCIMSCCQVINNLLLNVSMSND  182

Query  648  ENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIM  827
                GADDFLP+LIY+TIKANPPQLHSNL +IQ FR +TRL+SE  Y+ TNL+SA+ FIM
Sbjct  183  RTLSGADDFLPILIYITIKANPPQLHSNLKFIQLFRRETRLISEVEYYLTNLISAKMFIM  242

Query  828  NIDAKALSMDETEF  869
            N++  +LSM+E+ F
Sbjct  243  NVNGHSLSMEESVF  256



>gb|EEE60276.1| hypothetical protein OsJ_13323 [Oryza sativa Japonica Group]
Length=351

 Score =   281 bits (719),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/254 (56%), Positives = 186/254 (73%), Gaps = 4/254 (2%)
 Frame = +3

Query  120  SSTAP---LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNA-PDPERDSKAVQEFLGNME  287
            S T+P   L ++DF+ RMR+P+AAD   +I+SF+ S S    P+ E D   VQ F   ME
Sbjct  3    SPTSPASRLDFYDFIGRMRRPAAADLFHSIRSFLASLSQGGEPNAEVDGGRVQTFFAEME  62

Query  288  AAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQF  467
             A R H LWA  + +E+++A EGLEKY+MTKLF   FAS  EDVK D ++ EKI L+Q F
Sbjct  63   TAIRDHPLWANATNQEIDNALEGLEKYIMTKLFDRAFASSAEDVKSDMEISEKIGLLQHF  122

Query  468  VRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISAN  647
            VRP +LDI  +  NE +WLLA KEL KIN +K+PR+KL CI++CC+VINNLL+N S+S +
Sbjct  123  VRPHHLDIPKLLHNEAAWLLAVKELQKINSFKSPREKLSCIMSCCQVINNLLLNVSMSND  182

Query  648  ENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIM  827
                GADDFLP+LIY+TIKANPPQLHSNL +IQ FR +TRL+SE  Y+ TNL+SA+ FIM
Sbjct  183  RTLSGADDFLPILIYITIKANPPQLHSNLKFIQLFRRETRLISEVEYYLTNLISAKMFIM  242

Query  828  NIDAKALSMDETEF  869
            N++  +LSM+E+ F
Sbjct  243  NVNGHSLSMEESVF  256



>gb|KHN44773.1| Vacuolar protein sorting-associated protein 9A [Glycine soja]
Length=399

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 195/270 (72%), Gaps = 27/270 (10%)
 Frame = +3

Query  138  TWHDFLERMRQPSAADFVKAIKS----------FIVSFSNNAPDPERDSKAVQEFLGNME  287
            ++HDFL RMR P++ D V++IK           FIVSFS + P PE D K VQ+F  +ME
Sbjct  6    SFHDFLYRMRHPASLDLVRSIKRHIFTHFSQFFFIVSFSFHQPKPENDGKRVQDFFVSME  65

Query  288  AAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQF  467
            AA R HSLW   SEE+++ A +GLEKY+MTKLFS  F++  ED K+D+++  KI L+Q F
Sbjct  66   AAIRDHSLWTTASEEDIDCAMQGLEKYIMTKLFSRTFSASAEDAKIDNEISSKICLLQTF  125

Query  468  VRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISAN  647
            ++PE+LDI P+ QNE  WLLA+KELLKIN +KAP +KLL I+NCC++INNLL+NA++S  
Sbjct  126  LKPEHLDIPPILQNEALWLLAEKELLKINAFKAPHEKLLSIMNCCRIINNLLLNAAMS-E  184

Query  648  ENPPGADDFLPVLIYVTIK----------------ANPPQLHSNLLYIQRFRHQTRLVSE  779
              P GAD FLPVLIYVTIK                ANPP+LHSNL +I+ +  Q +L+SE
Sbjct  185  YVPAGADGFLPVLIYVTIKASPPWGDLFLLVCHFQANPPKLHSNLKFIKLYTRQAKLISE  244

Query  780  AAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            A Y+FTNL+SA++FI++++AK+LSMDE ++
Sbjct  245  AEYYFTNLVSAKTFIVDLNAKSLSMDEIKY  274



>ref|XP_003559162.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Brachypodium distachyon]
Length=351

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 184/250 (74%), Gaps = 0/250 (0%)
 Frame = +3

Query  120  SSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFR  299
            S  + + ++ FL+RMR+P+AAD  ++IKSF+ S S + P  E D   VQ F   ME   R
Sbjct  7    SPASRVDFYGFLDRMRRPAAADLFRSIKSFLASLSLDEPSAEEDGARVQAFFTAMETTIR  66

Query  300  AHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPE  479
             H LWA  + +E++ A EGLEKY+MTKLF   F S  ED   D ++ EKI L+QQF+RP 
Sbjct  67   EHPLWANATHQEIDHALEGLEKYIMTKLFDRTFVSSAEDAAADAEVSEKIGLLQQFLRPC  126

Query  480  NLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPP  659
            +LDI  +  NE SWLLA KEL KIN +++PRDKLLCI++CC+VINNLL+N S+S + +P 
Sbjct  127  HLDIPKILHNEASWLLAVKELQKINSFRSPRDKLLCIMSCCQVINNLLLNVSMSNDRSPS  186

Query  660  GADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDA  839
            GAD+FLP+LIY+TIKANPPQLHSNL ++Q FR + +LVSE  Y+ TNL+SA+ FI+N++ 
Sbjct  187  GADEFLPILIYITIKANPPQLHSNLKFVQLFRREAKLVSEVEYYLTNLISAKMFIVNVNG  246

Query  840  KALSMDETEF  869
             +LSM+E+EF
Sbjct  247  HSLSMEESEF  256



>ref|XP_010252347.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X2 [Nelumbo nucifera]
Length=352

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/249 (57%), Positives = 185/249 (74%), Gaps = 32/249 (13%)
 Frame = +3

Query  123  STAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRA  302
            S+  LT++DFL+RMR P++ D V++IK                               R 
Sbjct  4    SSNSLTFYDFLDRMRHPASLDLVRSIK-------------------------------RD  32

Query  303  HSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPEN  482
            H LWAG +EEE++ A EGLEKYVMTKLF+  FAS  ED KVD ++ EKI L+Q F++PE+
Sbjct  33   HPLWAGATEEEIDCAVEGLEKYVMTKLFTRTFASS-EDTKVDQEISEKICLLQHFIKPEH  91

Query  483  LDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPG  662
            LDI   + NETSWL AQKEL K+N +KAPR+KLLCILNCC+VINNLL+N ++S++  P G
Sbjct  92   LDIPGPYHNETSWLFAQKELQKMNAFKAPREKLLCILNCCRVINNLLLNVAMSSDNVPAG  151

Query  663  ADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAK  842
            ADDFLP+LIYVTIKANPPQLHSNL +IQ +R Q++L+SEAAY+FTNL+SA+SFI+++DAK
Sbjct  152  ADDFLPILIYVTIKANPPQLHSNLKFIQLYRRQSKLISEAAYYFTNLMSAKSFIIDLDAK  211

Query  843  ALSMDETEF  869
            +LS++E+EF
Sbjct  212  SLSINESEF  220



>ref|XP_011649084.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X2 [Cucumis sativus]
 ref|XP_011649085.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X2 [Cucumis sativus]
Length=363

 Score =   258 bits (659),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = +3

Query  447  IALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLI  626
            +ALIQQF+RPENLDIKP FQNETSWLLAQKELLKINM+KAPRDKL+C+L+CCKVI+NLL 
Sbjct  1    MALIQQFIRPENLDIKPNFQNETSWLLAQKELLKINMHKAPRDKLVCLLSCCKVISNLLF  60

Query  627  NASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLL  806
            NASI++NENPPGAD+FLPVLIYV IKANPPQLHSNLLYIQR+R Q+RL  EAAYFFTN+L
Sbjct  61   NASIASNENPPGADEFLPVLIYVIIKANPPQLHSNLLYIQRYRGQSRLTGEAAYFFTNVL  120

Query  807  SAESFIMNIDAKALSMDETEF  869
            SAESFI NIDAKALSM+E EF
Sbjct  121  SAESFISNIDAKALSMEEIEF  141



>ref|XP_003060633.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55402.1| predicted protein [Micromonas pusilla CCMP1545]
Length=502

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 181/260 (70%), Gaps = 5/260 (2%)
 Frame = +3

Query  96   MENADV-FGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNA--PDPERDSKAVQ  266
            M N D  F +STAPLT+  FLE+MR PSA++ VK+IK FI SF + A   D + D   VQ
Sbjct  1    MANGDAAFAASTAPLTFQSFLEKMRHPSASELVKSIKGFIASFDDAAVARDSDADGARVQ  60

Query  267  EFLGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEK  446
            EFL   E AFR H  W G S+EEL+++GEGLEKY+MTKL+   FA  P+DV  DD L  +
Sbjct  61   EFLRETERAFRGHPAWRGASQEELDASGEGLEKYLMTKLYPKTFAVAPDDVAADDFLGAR  120

Query  447  IALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLI  626
            +A +  FVRPE+LDI   F ++ SW LA+ EL K+N +KAPRDKL+C+LN C+++NNLL 
Sbjct  121  VAALASFVRPEHLDIPTRFHSDASWSLARNELCKMNNFKAPRDKLVCVLNTCRIVNNLL-  179

Query  627  NASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLL  806
            NA+     +PPGADDFLP LIYV +++NP  L SN  +I RFR ++RL SEAAYFFTNL 
Sbjct  180  NATHGPT-SPPGADDFLPALIYVVLRSNPAALESNARFISRFRLESRLASEAAYFFTNLQ  238

Query  807  SAESFIMNIDAKALSMDETE  866
            SA  F+ + DA A +  E E
Sbjct  239  SATRFLSSCDASAFTGLEKE  258



>ref|NP_001049631.1| Os03g0262900 [Oryza sativa Japonica Group]
 dbj|BAF11545.1| Os03g0262900 [Oryza sativa Japonica Group]
Length=371

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 140/166 (84%), Gaps = 14/166 (8%)
 Frame = +3

Query  372  MTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKI  551
            MTKLF+ VFAS PEDVK D++L+EK++L+QQF+RPENLDIKP +Q+ETSWLLAQKEL KI
Sbjct  1    MTKLFNRVFASVPEDVKSDEELFEKMSLLQQFIRPENLDIKPEYQSETSWLLAQKELQKI  60

Query  552  NMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSN  731
            NMYKAPRDKL CILNCCKVINNLL+NASI +NENPPGAD+FLPVLIYVTIK         
Sbjct  61   NMYKAPRDKLACILNCCKVINNLLLNASIVSNENPPGADEFLPVLIYVTIK---------  111

Query  732  LLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
                 R+R Q+RLVSEA YFFTN+LSAESFI NID ++LSMDE +F
Sbjct  112  -----RYRRQSRLVSEAQYFFTNILSAESFIWNIDGESLSMDERDF  152



>gb|KJB26932.1| hypothetical protein B456_004G268000 [Gossypium raimondii]
Length=318

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +3

Query  282  MEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQ  461
            ME A R H LWA  S++E ++A EGLEKYVMTKL S  FAS PEDVK+D ++ EKI+L+Q
Sbjct  1    MEDAIRDHPLWASSSDDETDNALEGLEKYVMTKLHSRTFASTPEDVKIDAEISEKISLLQ  60

Query  462  QFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASIS  641
             F+RP++LDI    QNE +WLLA+KEL KIN +KAPR+KLLCI+NC +VINNLL+NASIS
Sbjct  61   TFLRPQHLDIPSALQNEAAWLLAEKELKKINAFKAPREKLLCIINCSRVINNLLLNASIS  120

Query  642  ANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESF  821
             +  P GADDFLPVLIYVTIKANPPQLHSNL +IQ +R Q++LVSEAAY+ TNL+SA+SF
Sbjct  121  EDHVPGGADDFLPVLIYVTIKANPPQLHSNLKFIQLYRRQSKLVSEAAYYLTNLVSAKSF  180

Query  822  IMNIDAKALSM  854
            I++++AK+LS+
Sbjct  181  IVDLNAKSLSI  191



>emb|CBI16976.3| unnamed protein product [Vitis vinifera]
Length=245

 Score =   249 bits (636),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = +3

Query  117  GSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAF  296
             SS+ PLT++DFL+RMR P++ D V++IKSFIVSFS  AP PE D K +Q+FL  ME + 
Sbjct  3    ASSSQPLTFYDFLDRMRNPASLDLVRSIKSFIVSFSFYAPSPENDGKRLQDFLLTMEDSI  62

Query  297  RAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRP  476
            R H LW G +EEE++SA EGLEKYVMTKLFS  FA+ PED K D ++ EKI+L+Q F+RP
Sbjct  63   RDHPLWVGATEEEIDSAIEGLEKYVMTKLFSRTFAASPEDAKADQEISEKISLLQNFLRP  122

Query  477  ENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENP  656
            E+LDI  V QNE SWLLA+KEL K+N +KAPR+KLLCILNCC+VINNLL+NA++S N   
Sbjct  123  EHLDIPAVLQNEASWLLAEKELQKVNAFKAPREKLLCILNCCRVINNLLLNAAMSENHIL  182

Query  657  PGADDFLPVLIYVTIKAN  710
             GADDFLPVLIYVTIKA+
Sbjct  183  AGADDFLPVLIYVTIKAS  200



>ref|XP_011628200.1| PREDICTED: vacuolar protein sorting-associated protein 9A [Amborella 
trichopoda]
Length=345

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 140/166 (84%), Gaps = 14/166 (8%)
 Frame = +3

Query  372  MTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKI  551
            MTKLF+  FAS PE+VK D++L EK+AL+QQF RP+NLDIKP FQNET WLLAQKEL KI
Sbjct  1    MTKLFTRAFASIPEEVKKDEELSEKMALVQQFNRPDNLDIKPNFQNETPWLLAQKELQKI  60

Query  552  NMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSN  731
            NMYKAPRDKLLCIL+CCKVINNLL+NASI++N+NPPGAD+FLPVLIYVTIK         
Sbjct  61   NMYKAPRDKLLCILHCCKVINNLLLNASIASNDNPPGADEFLPVLIYVTIK---------  111

Query  732  LLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
                 R+R Q+RLVSE+AYFFTNLLSAESFI N+DA +LSMDETEF
Sbjct  112  -----RYRRQSRLVSESAYFFTNLLSAESFIANLDAGSLSMDETEF  152



>ref|XP_009347396.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X3 [Pyrus x bretschneideri]
Length=349

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/243 (55%), Positives = 169/243 (70%), Gaps = 33/243 (14%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            ++DFL+RMR P++ D V++IKSFIVSFS  A +PE D K VQEF   ME   R H LWAG
Sbjct  14   FYDFLDRMRNPASLDLVRSIKSFIVSFSFYAANPESDGKKVQEFYATMEDNIRDHPLWAG  73

Query  321  CseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPV  500
             +++E++ A EGLEKYVMTKLFS  FAS PED K+D +   KI L+Q F++PE+LDI  V
Sbjct  74   ATDQEVDCAMEGLEKYVMTKLFSRTFASSPEDAKIDLETSHKIHLLQTFLKPEHLDIPVV  133

Query  501  FQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLP  680
             +NE SWLLA+KEL KIN +KAPR+KLLCI+NCC                          
Sbjct  134  LRNEASWLLAEKELQKINAFKAPREKLLCIMNCC--------------------------  167

Query  681  VLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDE  860
                   KANPPQLHSNL +IQ +R QT+LVSEAAY+FTNL+SA++FI+ ++AK+LS+DE
Sbjct  168  -------KANPPQLHSNLRFIQLYRRQTKLVSEAAYYFTNLVSAKTFILELNAKSLSIDE  220

Query  861  TEF  869
             EF
Sbjct  221  IEF  223



>ref|XP_002504979.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66237.1| predicted protein [Micromonas sp. RCC299]
Length=504

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 137/258 (53%), Positives = 183/258 (71%), Gaps = 10/258 (4%)
 Frame = +3

Query  117  GSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSF------SNNAPDPERDSKAVQEFLG  278
            G    PLT+ +FLE+MR PSA++ VK++++FI SF      +N   D + D + +Q FL 
Sbjct  4    GDQGMPLTFQNFLEKMRHPSASELVKSMQAFISSFGDAQMPANAQRDSDEDGRRIQAFLR  63

Query  279  NMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALI  458
            + EAAFR H  W G SEEELE++GEGLEKY+ TKL+ ++FA   E+  +DD L  +IA +
Sbjct  64   DTEAAFRGHPAWRGASEEELEASGEGLEKYLTTKLYPNIFAVVNEERTLDDVLGRRIAAL  123

Query  459  QQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASI  638
            + F+RPE+LDI   F+ E S  LA+ EL+K+N +KAPRDKL+C+LN C+VINNLL   ++
Sbjct  124  RTFIRPEHLDIPECFRVEASLALARNELVKVNNFKAPRDKLVCVLNTCRVINNLL---NV  180

Query  639  SANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAES  818
            SA   P GADDFLPVLIYV + ANPP+L SNL YI RFR ++RLVSEAAYF+TNL+SA  
Sbjct  181  SAGNRPAGADDFLPVLIYVVMLANPPRLESNLRYIARFRLESRLVSEAAYFYTNLVSATH  240

Query  819  FIMNIDAKALS-MDETEF  869
            F+   D  A + +DE  F
Sbjct  241  FLTTCDHSAFTNLDEDVF  258



>gb|KJB26933.1| hypothetical protein B456_004G268000 [Gossypium raimondii]
Length=202

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = +3

Query  150  FLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAGCse  329
            FL+RMR P++ D V++IKSFIVSFS  A +PE D K +QEF   ME A R H LWA  S+
Sbjct  13   FLDRMRNPASLDLVRSIKSFIVSFSYTASNPETDGKRIQEFFQTMEDAIRDHPLWASSSD  72

Query  330  eelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQN  509
            +E ++A EGLEKYVMTKL S  FAS PEDVK+D ++ EKI+L+Q F+RP++LDI    QN
Sbjct  73   DETDNALEGLEKYVMTKLHSRTFASTPEDVKIDAEISEKISLLQTFLRPQHLDIPSALQN  132

Query  510  ETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLI  689
            E +WLLA+KEL KIN +KAPR+KLLCI+NC +VINNLL+NASIS +  P GADDFLPVLI
Sbjct  133  EAAWLLAEKELKKINAFKAPREKLLCIINCSRVINNLLLNASISEDHVPGGADDFLPVLI  192

Query  690  YVTIKANPP  716
            YVTIKA+ P
Sbjct  193  YVTIKASSP  201



>ref|XP_004295727.2| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Fragaria vesca subsp. vesca]
Length=314

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 178/243 (73%), Gaps = 8/243 (3%)
 Frame = +3

Query  147  DFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAGCs  326
            DF  RMR P++ + +K+IK+FI SFS N  +P+ D+K VQEF  N E + R+H LWA   
Sbjct  34   DF-RRMRNPASVELIKSIKNFIESFSLNTSNPQEDAKTVQEFYKNAENSIRSHKLWAD--  90

Query  327  eeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQ  506
             ++++SA EGLEKYVMTKLFS  F+S PED K+D ++ +K+ L+  F++PE+LDI  V  
Sbjct  91   -QDVDSAMEGLEKYVMTKLFSQTFSS-PEDAKIDREISQKMRLLLTFLKPEHLDISEVLW  148

Query  507  NETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPP--GADDFLP  680
            NE S   A KEL +I  +KAPR KLLC++N CKVI NLL+ +S S ++ P   GAD+FLP
Sbjct  149  NEASLYHAIKELQRIKAFKAPRSKLLCVMNSCKVIYNLLL-SSASKSQAPVILGADEFLP  207

Query  681  VLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDE  860
            VLIYV I ANPPQLHSNL +I+ +R + +LVSEAA   T+L+SA++FI  +DAK+LS+DE
Sbjct  208  VLIYVVIMANPPQLHSNLKFIELYRREAKLVSEAACCLTHLVSAKTFISELDAKSLSIDE  267

Query  861  TEF  869
             EF
Sbjct  268  AEF  270



>gb|KJB26931.1| hypothetical protein B456_004G268000 [Gossypium raimondii]
Length=288

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +3

Query  372  MTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKI  551
            MTKL S  FAS PEDVK+D ++ EKI+L+Q F+RP++LDI    QNE +WLLA+KEL KI
Sbjct  1    MTKLHSRTFASTPEDVKIDAEISEKISLLQTFLRPQHLDIPSALQNEAAWLLAEKELKKI  60

Query  552  NMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSN  731
            N +KAPR+KLLCI+NC +VINNLL+NASIS +  P GADDFLPVLIYVTIKANPPQLHSN
Sbjct  61   NAFKAPREKLLCIINCSRVINNLLLNASISEDHVPGGADDFLPVLIYVTIKANPPQLHSN  120

Query  732  LLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSM  854
            L +IQ +R Q++LVSEAAY+ TNL+SA+SFI++++AK+LS+
Sbjct  121  LKFIQLYRRQSKLVSEAAYYLTNLVSAKSFIVDLNAKSLSI  161



>ref|NP_001051858.1| Os03g0842700 [Oryza sativa Japonica Group]
 gb|AAT77027.1| putative Vacuolar sorting protein (with alternative splicing) 
[Oryza sativa Japonica Group]
 gb|ABF99826.1| Vacuolar sorting protein 9 domain containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13772.1| Os03g0842700 [Oryza sativa Japonica Group]
 dbj|BAG92157.1| unnamed protein product [Oryza sativa Japonica Group]
Length=218

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = +3

Query  372  MTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKI  551
            MTKLF   FAS  EDVK D ++ EKI L+Q FVRP +LDI  +  NE +WLLA KEL KI
Sbjct  1    MTKLFDRAFASSAEDVKSDMEISEKIGLLQHFVRPHHLDIPKLLHNEAAWLLAVKELQKI  60

Query  552  NMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSN  731
            N +K+PR+KL CI++CC+VINNLL+N S+S +    GADDFLP+LIY+TIKANPPQLHSN
Sbjct  61   NSFKSPREKLSCIMSCCQVINNLLLNVSMSNDRTLSGADDFLPILIYITIKANPPQLHSN  120

Query  732  LLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            L +IQ FR +TRL+SE  Y+ TNL+SA+ FIMN++  +LSM+E+ F
Sbjct  121  LKFIQLFRRETRLISEVEYYLTNLISAKMFIMNVNGHSLSMEESVF  166



>gb|KDO80822.1| hypothetical protein CISIN_1g0118121mg, partial [Citrus sinensis]
Length=137

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 125/143 (87%), Gaps = 6/143 (4%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENADVF      L  HDFLERMRQPSAADFVK+IKSFIVSFSNNAPDPERDS AVQ FL
Sbjct  1    MENADVF------LGLHDFLERMRQPSAADFVKSIKSFIVSFSNNAPDPERDSAAVQSFL  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
             NMEAAFRAH LWAGCSEEEL+SAGEGLEKYVMTKLF+ VFAS P+DVK D+QL EKIAL
Sbjct  55   ANMEAAFRAHPLWAGCSEEELDSAGEGLEKYVMTKLFTRVFASIPDDVKTDEQLSEKIAL  114

Query  456  IQQFVRPENLDIKPVFQNETSWL  524
            +QQFVRPENLDIK  FQNETSWL
Sbjct  115  VQQFVRPENLDIKASFQNETSWL  137



>gb|KDO80820.1| hypothetical protein CISIN_1g0118122mg, partial [Citrus sinensis]
 gb|KDO80821.1| hypothetical protein CISIN_1g0118122mg, partial [Citrus sinensis]
Length=340

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +3

Query  525  LAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIK  704
            LAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NASI+ NENPPGAD+FLPVLIYVTIK
Sbjct  1    LAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASIALNENPPGADEFLPVLIYVTIK  60

Query  705  ANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            ANPPQLHSNLLYIQR+R Q+RLV EAAYFFTN+LSAESFI NIDA+ALSM+E+EF
Sbjct  61   ANPPQLHSNLLYIQRYRRQSRLVGEAAYFFTNMLSAESFISNIDAQALSMEESEF  115



>ref|XP_008661165.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Zea mays]
Length=221

 Score =   212 bits (539),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = +3

Query  372  MTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKI  551
            MTKLF   F +  EDV  D  + EKI L+QQFV+P +LDI  V  NE  WLLA KEL KI
Sbjct  1    MTKLFDRTFGTSTEDVVSDMDISEKIGLLQQFVKPRHLDIPKVQHNEALWLLAVKELQKI  60

Query  552  NMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSN  731
            N +KAPR+KLLCI++CC+VINNLL+N S+S +    GAD+FLP+LIYVTIKANPPQLHSN
Sbjct  61   NSFKAPREKLLCIMSCCQVINNLLLNISMSNDRTLSGADEFLPILIYVTIKANPPQLHSN  120

Query  732  LLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            L ++Q FR +T+L+ E  Y+ TNL+SA+ FI+++ A +LSM+E+EF
Sbjct  121  LKFVQLFRRETKLILEVEYYLTNLISAKMFIIDVSAHSLSMEESEF  166



>gb|AFW88574.1| hypothetical protein ZEAMMB73_536018 [Zea mays]
Length=228

 Score =   212 bits (539),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = +3

Query  372  MTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKI  551
            MTKLF   F +  EDV  D  + EKI L+QQFV+P +LDI  V  NE  WLLA KEL KI
Sbjct  1    MTKLFDRTFGTSTEDVVSDMDISEKIGLLQQFVKPRHLDIPKVQHNEALWLLAVKELQKI  60

Query  552  NMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSN  731
            N +KAPR+KLLCI++CC+VINNLL+N S+S +    GAD+FLP+LIYVTIKANPPQLHSN
Sbjct  61   NSFKAPREKLLCIMSCCQVINNLLLNISMSNDRTLSGADEFLPILIYVTIKANPPQLHSN  120

Query  732  LLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            L ++Q FR +T+L+ E  Y+ TNL+SA+ FI+++ A +LSM+E+EF
Sbjct  121  LKFVQLFRRETKLILEVEYYLTNLISAKMFIIDVSAHSLSMEESEF  166



>gb|EMT32991.1| hypothetical protein F775_07723 [Aegilops tauschii]
Length=205

 Score =   211 bits (537),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 143/197 (73%), Gaps = 0/197 (0%)
 Frame = +3

Query  120  SSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFR  299
            S+ + + ++ FL+RMR+P AAD  ++IKSF+ S S + P  E D   VQ F   MEAA R
Sbjct  6    SAASRVDFYGFLDRMRRPEAADLFRSIKSFLASLSLDEPSAEADGARVQAFFAEMEAAIR  65

Query  300  AHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPE  479
             H LWA  + +E++ A EGLEKY+MTKLF   FA+ PED   D ++ +KI L+Q+FVRP 
Sbjct  66   GHPLWADATHQEIDHALEGLEKYIMTKLFDRTFAASPEDAAADAEVSDKIGLLQRFVRPH  125

Query  480  NLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPP  659
            +LDI  V  NE SWL+A KEL KIN +K+P +KLLC+++CC+VINNLL+N S++ +  P 
Sbjct  126  HLDIPKVLNNEASWLIAVKELQKINSFKSPWEKLLCMMSCCQVINNLLLNVSMTNDRTPS  185

Query  660  GADDFLPVLIYVTIKAN  710
            GAD+FLP+LIY+TIKA+
Sbjct  186  GADEFLPILIYITIKAS  202



>ref|NP_001030728.1| guanine nucleotide exchange factor VPS9a [Arabidopsis thaliana]
 gb|AEE76285.1| guanine nucleotide exchange factor VPS9a [Arabidopsis thaliana]
Length=384

 Score =   211 bits (538),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +3

Query  522  LLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTI  701
            + AQKEL KINMYKAPRDKL+CILNCCKVINNLL+NASI++NEN PGAD+FLPVLIYVTI
Sbjct  1    MAAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASIASNENAPGADEFLPVLIYVTI  60

Query  702  KANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            KANPPQLHSNLLYIQR+R +++LV EAAYFFTN+LSAESFI NIDAK++S+DE EF
Sbjct  61   KANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSAESFISNIDAKSISLDEAEF  116



>ref|XP_003083380.1| Vacuolar assembly/sorting protein VPS9 (ISS) [Ostreococcus tauri]
 emb|CAL57656.1| Vacuolar sorting protein 9 [Ostreococcus tauri]
Length=483

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/249 (48%), Positives = 152/249 (61%), Gaps = 17/249 (7%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPE---------RDS----KAVQEF  272
            PLT+  FLE+MRQPSA   V+ +K FI        D           RD+    + V+ F
Sbjct  11   PLTFQTFLEKMRQPSAGSLVREVKRFIAELDARGGDASANERVEDLPRDASSLGREVRAF  70

Query  273  LGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIA  452
            L   EAAF  H  WA  S  ELE++GEGLEKYVMTK    VF     D + D  L  +IA
Sbjct  71   LKKTEAAFERHPAWANASAAELEASGEGLEKYVMTKAHGRVFGRGRRDEERDVALRRRIA  130

Query  453  LIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINA  632
             +++ +  +NLD+        SW LA+ EL K+N +KAPRDKL+C+LN C++INN L   
Sbjct  131  ALRELIEAKNLDVAESSHARASWALAESELGKMNQFKAPRDKLVCVLNTCRIINNTL---  187

Query  633  SISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSA  812
              S      GAD+FLPVL+YVT++ANP  L SNL YIQRFR ++RLVSEAAYFFTNL+SA
Sbjct  188  -TSRQGGDGGADEFLPVLVYVTLRANPENLESNLKYIQRFRGESRLVSEAAYFFTNLVSA  246

Query  813  ESFIMNIDA  839
             +F+    A
Sbjct  247  VAFLSRAQA  255



>ref|XP_005651348.1| hypothetical protein COCSUDRAFT_59312 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26804.1| hypothetical protein COCSUDRAFT_59312 [Coccomyxa subellipsoidea 
C-169]
Length=850

 Score =   218 bits (555),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/236 (49%), Positives = 151/236 (64%), Gaps = 32/236 (14%)
 Frame = +3

Query  162  MRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAGCseeele  341
            M++P+AAD V++IK+FI +F +  PDPERDS  VQ                         
Sbjct  1    MKEPAAADLVRSIKNFIKTFEDRKPDPERDSAFVQGL-----------------------  37

Query  342  sagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSW  521
                  EKY+MTK++   F     D + D+ L+ ++  +  F++P +LDI  ++++E +W
Sbjct  38   ------EKYLMTKIYHKTFGVSELDRERDEALHVRMRALN-FIKPSHLDIPELYRDEKAW  90

Query  522  LLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTI  701
            +LA KEL KIN YKAPRDKL+CILNCC+VINNLL +  +   E   GADDFLPVLIYV I
Sbjct  91   ILAMKELHKINNYKAPRDKLVCILNCCRVINNLL-HVQVQQGEAR-GADDFLPVLIYVVI  148

Query  702  KANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
             ANPPQL SNL YIQRFR  +R+ SE+AYFFT L SA SFI  ++A +LSMD  EF
Sbjct  149  HANPPQLASNLEYIQRFRMHSRMASESAYFFTQLYSAASFIETVNATSLSMDPDEF  204



>ref|XP_010664267.1| PREDICTED: vacuolar protein sorting-associated protein 9A isoform 
X2 [Vitis vinifera]
Length=406

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +3

Query  510  ETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLI  689
            E++  LAQKEL KINMYKAPRDKL+CILNCCKVINNLL+NASI++NE+PPGAD+FLPVLI
Sbjct  82   ESAGELAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASIASNEDPPGADEFLPVLI  141

Query  690  YVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            YVT+KANPPQLHSNLLYI R+R Q+R+V+EAAYFFTN+LSAESFI NI+A++LSMDE EF
Sbjct  142  YVTLKANPPQLHSNLLYILRYRRQSRMVAEAAYFFTNMLSAESFISNINAESLSMDEREF  201


 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MENAD F SSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDS AVQEFL
Sbjct  1    MENADPFASSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSAAVQEFL  60

Query  276  GNMEAAFRAHSLWAGC  323
             NME AFRAH LWAGC
Sbjct  61   ANMEMAFRAHPLWAGC  76



>ref|XP_001693976.1| guanine nucleotide exchange factor [Chlamydomonas reinhardtii]
 gb|EDP02912.1| guanine nucleotide exchange factor, partial [Chlamydomonas reinhardtii]
Length=495

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/261 (44%), Positives = 161/261 (62%), Gaps = 12/261 (5%)
 Frame = +3

Query  108  DVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNME  287
            ++F +ST+ L +  F+  + Q +A D V++I  F+ +F   APD E D++ VQEFL  ME
Sbjct  4    ELFSTSTSQLNFEKFISTINQEAAKDLVRSINQFMKNFRKRAPDSEADAREVQEFLTQME  63

Query  288  AAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQF  467
             AF  H LWAG    ELE+A EGLEKY+MTKL+   FA+ P D + DD L  ++A +  F
Sbjct  64   QAFARHPLWAGSGRTELENAVEGLEKYLMTKLYDRTFAADPLDRERDDVLGRRLAALAGF  123

Query  468  VRPENLDIKPVFQ------NETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLIN  629
            V P +L++    Q      +      AQ+EL ++++YK+PRDKL+ ILNCCK+INNLL +
Sbjct  124  VGPAHLEVSASLQGPLAADDGGQLAAAQRELRRMSLYKSPRDKLVQILNCCKIINNLLAS  183

Query  630  ASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLS  809
                A     GADDF P LIYVTIKA P  L SNL +++R+R+   L  EAAYFF  +  
Sbjct  184  KRAGA-----GADDFTPTLIYVTIKAQPEALASNLAFVERYRYAAHLGGEAAYFFVQMQG  238

Query  810  AESFIMNIDAKALSM-DETEF  869
            A +F+  +   +L+  D  EF
Sbjct  239  AATFLETLTTSSLAGCDPDEF  259



>ref|XP_008338875.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like, 
partial [Malus domestica]
Length=354

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  528  AQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKA  707
            AQKEL KINMYKAPRDKL+CILNCCKVINNLL+ AS+++NENPPGAD+FLPVLIYVT+KA
Sbjct  19   AQKELQKINMYKAPRDKLVCILNCCKVINNLLMKASVASNENPPGADEFLPVLIYVTLKA  78

Query  708  NPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            NPPQLH NLLYIQR+R Q+RLV EA+YFFTN+LS ESFI NIDA A+SMDE+E+
Sbjct  79   NPPQLHLNLLYIQRYRRQSRLVGEASYFFTNMLSVESFISNIDANAISMDESEY  132



>ref|XP_001421331.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99624.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=428

 Score =   202 bits (514),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 162/254 (64%), Gaps = 26/254 (10%)
 Frame = +3

Query  120  SSTAP--LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPE----------------  245
            SS AP  LT+  FLE+MRQPSA   V+ +K+FI S  ++A                    
Sbjct  3    SSPAPAVLTFQTFLEKMRQPSAGALVRDVKTFIASLDDDASTTTTTVDGEDDDDGDDDAI  62

Query  246  -RDSKAVQEFLGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVK  422
             R ++ VQ FL + EA F  H  W G S  EL+++GEGLEKYVMTK  + VFA   ED  
Sbjct  63   LRVARRVQTFLRDTEATFERHPAWRGASMAELDASGEGLEKYVMTKAHAGVFARRREDRA  122

Query  423  VDDQLYEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCC  602
             D++L +++  +++ + P++LDI    +   SW LA+ EL K+N +KAPRDKL+C+LN C
Sbjct  123  RDERLAKRVETLKKIIEPKHLDIG---ECSASWALAEVELGKMNQFKAPRDKLVCVLNTC  179

Query  603  KVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEA  782
            ++INN L     S      GADDFLPVLIYV ++ANP +L SNL YIQRFR ++RLVSEA
Sbjct  180  RIINNTLTTRQGSDG----GADDFLPVLIYVAMRANPGRLESNLKYIQRFRGESRLVSEA  235

Query  783  AYFFTNLLSAESFI  824
            AYFFTNL+SA  F+
Sbjct  236  AYFFTNLVSAARFL  249



>ref|XP_006297950.1| hypothetical protein CARUB_v10013991mg [Capsella rubella]
 gb|EOA30848.1| hypothetical protein CARUB_v10013991mg [Capsella rubella]
Length=368

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +3

Query  555  MYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNL  734
            MYKAPRDKL+CILNCCKVINNLL+NASI++N N PGAD+FLPVLIYVTIKANPPQLHSNL
Sbjct  1    MYKAPRDKLVCILNCCKVINNLLLNASIASNGNAPGADEFLPVLIYVTIKANPPQLHSNL  60

Query  735  LYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            LYIQR+R +++LV EA+YFFTN+LSAESFI NI+AK++SMDE EF
Sbjct  61   LYIQRYRRESKLVGEASYFFTNILSAESFISNINAKSISMDEAEF  105



>gb|ERM99753.1| hypothetical protein AMTR_s00099p00124940 [Amborella trichopoda]
Length=196

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 133/196 (68%), Gaps = 25/196 (13%)
 Frame = +3

Query  123  STAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRA  302
            S++P  ++DFL+RM+ P++ D V++IKSFIVSFS +A D ERD K +Q+FL  MEAA + 
Sbjct  3    SSSPANFYDFLDRMKHPASVDLVRSIKSFIVSFSFHAADAERDGKKLQDFLLTMEAAIKD  62

Query  303  HSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPEN  482
            H LW G +EEE++SA EGLEKY+MTKLFS  FAS   DVK D ++ EKI L+Q FVRPE+
Sbjct  63   HPLWYGATEEEIDSAIEGLEKYLMTKLFSRTFASSLADVKRDKEISEKICLLQNFVRPEH  122

Query  483  LDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPG  662
            LDI    QNETSWLLA+KEL KIN +KAP                         +  P G
Sbjct  123  LDISREIQNETSWLLAEKELQKINAFKAP-------------------------HRRPAG  157

Query  663  ADDFLPVLIYVTIKAN  710
            ADDFLPVLIYVTIKA 
Sbjct  158  ADDFLPVLIYVTIKAR  173



>ref|XP_008338874.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
[Malus domestica]
Length=182

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 111/137 (81%), Gaps = 6/137 (4%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            MEN DVF      L   DFLERMRQPSAADFVK+IKSFIVSFSNNAPDPERDS AVQ+F 
Sbjct  1    MENTDVF------LGLQDFLERMRQPSAADFVKSIKSFIVSFSNNAPDPERDSAAVQDFF  54

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
              ME  FRAH LWAGCSEEEL+SAGEGLEKYVMTKLF  VFAS P+DVK+D+QLYEK+AL
Sbjct  55   AXMEIDFRAHPLWAGCSEEELDSAGEGLEKYVMTKLFPRVFASLPDDVKLDEQLYEKMAL  114

Query  456  IQQFVRPENLDIKPVFQ  506
            +QQF+RPE   +   +Q
Sbjct  115  VQQFIRPEIWTLTHAYQ  131



>ref|XP_010252348.1| PREDICTED: vacuolar protein sorting-associated protein 9A-like 
isoform X3 [Nelumbo nucifera]
Length=327

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +3

Query  528  AQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKA  707
            AQKEL K+N +KAPR+KLLCILNCC+VINNLL+N ++S++  P GADDFLP+LIYVTIKA
Sbjct  82   AQKELQKMNAFKAPREKLLCILNCCRVINNLLLNVAMSSDNVPAGADDFLPILIYVTIKA  141

Query  708  NPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            NPPQLHSNL +IQ +R Q++L+SEAAY+FTNL+SA+SFI+++DAK+LS++E+EF
Sbjct  142  NPPQLHSNLKFIQLYRRQSKLISEAAYYFTNLMSAKSFIIDLDAKSLSINESEF  195


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  123  STAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRA  302
            S+  LT++DFL+RMR P++ D V++IKSFIVSFS    + E DSK +Q+FL  ME++ R 
Sbjct  4    SSNSLTFYDFLDRMRHPASLDLVRSIKSFIVSFSFCTANSESDSKKLQDFLLTMESSIRD  63

Query  303  HSLWAG  320
            H LWAG
Sbjct  64   HPLWAG  69



>ref|XP_004347671.2| hypothetical protein CAOG_04920 [Capsaspora owczarzaki ATCC 30864]
Length=536

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 118/259 (46%), Positives = 163/259 (63%), Gaps = 9/259 (3%)
 Frame = +3

Query  102  NADVFGSSTAP-LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLG  278
            N+D +   T     + DFLE+M+QPS+ + VK+IK FI SF     + +  ++ VQ F+ 
Sbjct  105  NSDAYSPFTGSSFNFPDFLEKMKQPSSYELVKSIKVFITSFLERPYNADEQTEMVQLFMQ  164

Query  279  NMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHP--EDVKVDDQLYEKIA  452
            N       H LW G S E L++A EGLEKY+M KL++  F S+P   DV +D+ L  +I 
Sbjct  165  NTARKLVVHPLWKGASPEALDNAIEGLEKYLMHKLYAAAF-SNPTSSDVYLDECLDIRIR  223

Query  453  LIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINA  632
             +  F+ P +LDIKP    + +      EL ++N YKAPRDKL+CILNCCK I N+L NA
Sbjct  224  RLS-FLTPAHLDIKPGRITDANLGPMMAELQRMNSYKAPRDKLICILNCCKTIYNVLQNA  282

Query  633  SISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSA  812
              +A      AD+FLP+LIYV ++ANP +LHS+L YIQRFRH  +L SE  Y+FTNL+SA
Sbjct  283  EGAAAG----ADEFLPILIYVVLRANPVKLHSDLQYIQRFRHPDKLTSEPMYYFTNLVSA  338

Query  813  ESFIMNIDAKALSMDETEF  869
             +FI  + +  LS+D   F
Sbjct  339  VAFIQQVTSAQLSIDPAVF  357



>gb|KJE94251.1| hypothetical protein CAOG_004920 [Capsaspora owczarzaki ATCC 
30864]
Length=554

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 118/259 (46%), Positives = 163/259 (63%), Gaps = 9/259 (3%)
 Frame = +3

Query  102  NADVFGSSTAP-LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLG  278
            N+D +   T     + DFLE+M+QPS+ + VK+IK FI SF     + +  ++ VQ F+ 
Sbjct  123  NSDAYSPFTGSSFNFPDFLEKMKQPSSYELVKSIKVFITSFLERPYNADEQTEMVQLFMQ  182

Query  279  NMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHP--EDVKVDDQLYEKIA  452
            N       H LW G S E L++A EGLEKY+M KL++  F S+P   DV +D+ L  +I 
Sbjct  183  NTARKLVVHPLWKGASPEALDNAIEGLEKYLMHKLYAAAF-SNPTSSDVYLDECLDIRIR  241

Query  453  LIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINA  632
             +  F+ P +LDIKP    + +      EL ++N YKAPRDKL+CILNCCK I N+L NA
Sbjct  242  RLS-FLTPAHLDIKPGRITDANLGPMMAELQRMNSYKAPRDKLICILNCCKTIYNVLQNA  300

Query  633  SISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSA  812
              +A      AD+FLP+LIYV ++ANP +LHS+L YIQRFRH  +L SE  Y+FTNL+SA
Sbjct  301  EGAAAG----ADEFLPILIYVVLRANPVKLHSDLQYIQRFRHPDKLTSEPMYYFTNLVSA  356

Query  813  ESFIMNIDAKALSMDETEF  869
             +FI  + +  LS+D   F
Sbjct  357  VAFIQQVTSAQLSIDPAVF  375



>gb|AAS07379.1| putative vacuolar sorting protein , 5'-partial [Oryza sativa 
Japonica Group]
Length=177

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  498  VFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFL  677
            +  NE +WLLA KEL KIN +K+PR+KL CI++CC+VINNLL+N S+S +    GADDFL
Sbjct  2    LLHNEAAWLLAVKELQKINSFKSPREKLSCIMSCCQVINNLLLNVSMSNDRTLSGADDFL  61

Query  678  PVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMD  857
            P+LIY+TIKANPPQLHSNL +IQ FR +TRL+SE  Y+ TNL+SA+ FIMN++  +LSM+
Sbjct  62   PILIYITIKANPPQLHSNLKFIQLFRRETRLISEVEYYLTNLISAKMFIMNVNGHSLSME  121

Query  858  ETEF  869
            E+ F
Sbjct  122  ESVF  125



>ref|XP_002956401.1| hypothetical protein VOLCADRAFT_119357 [Volvox carteri f. nagariensis]
 gb|EFJ42545.1| hypothetical protein VOLCADRAFT_119357, partial [Volvox carteri 
f. nagariensis]
Length=937

 Score =   185 bits (470),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 107/258 (41%), Positives = 160/258 (62%), Gaps = 11/258 (4%)
 Frame = +3

Query  96   MENADVFGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFL  275
            M + ++F +ST+ L++  F+  + Q  A D V++I  F+  F +  P  E DS+ VQEFL
Sbjct  1    MADPELFQASTSQLSFEKFINTINQDQAKDLVRSINQFMKKFRSRPPVNEIDSREVQEFL  60

Query  276  GNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIAL  455
             +ME +F  H LWAG +  EL++A EGLEKY++TKL+   F   P D + D  L  ++A 
Sbjct  61   TSMEQSFARHPLWAGSTRSELDNAVEGLEKYLLTKLYDRTFGLDPLDRERDAVLSRRLAA  120

Query  456  IQQFVRPENLDIK-----PVFQNETSWLL-AQKELLKINMYKAPRDKLLCILNCCKVINN  617
            +  F+ P +L++      P+   E   ++ A KEL K+++YK+PRDKL+ ILNCCK+I++
Sbjct  121  LAGFITPAHLEVSEQLQVPLATGEGGHVVAASKELKKMSLYKSPRDKLVQILNCCKIISD  180

Query  618  LLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFT  797
             + +    A     GADDF P LIYVTIKA P  L SNL +I+R+RH TRL  EA+YFF 
Sbjct  181  FITSRRAGA-----GADDFTPTLIYVTIKAQPEALASNLSFIERYRHSTRLNGEASYFFV  235

Query  798  NLLSAESFIMNIDAKALS  851
             +  A +F+  +   +L+
Sbjct  236  QMQGAVAFLETLSPTSLA  253



>ref|XP_006441803.1| hypothetical protein CICLE_v10020271mg [Citrus clementina]
 gb|ESR55043.1| hypothetical protein CICLE_v10020271mg [Citrus clementina]
Length=300

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +3

Query  525  LAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIK  704
            LA+KEL KIN  KAPR+K+LCI+NCC++INNLL+NASIS N    GADDFLPVLIY+ IK
Sbjct  22   LAEKELQKINALKAPREKVLCIMNCCRIINNLLLNASISENVELGGADDFLPVLIYIIIK  81

Query  705  ANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            ANPPQLHSN+ +IQ +R Q  LVSEAAY+FTNL+SA++FI++++AK+LSM+ETEF
Sbjct  82   ANPPQLHSNIKFIQLYRRQAMLVSEAAYYFTNLVSAKTFILDLNAKSLSMEETEF  136



>emb|CEI94724.1| hypothetical protein RMCBS344292_08929 [Rhizopus microsporus]
Length=262

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 108/248 (44%), Positives = 154/248 (62%), Gaps = 7/248 (3%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAP-DPERDSKAVQEFLGNMEAAFRAHS  308
            P  +H FL++M+ PSAA   +  K FI +F            K +Q+FL       R   
Sbjct  18   PFDFHRFLDQMKDPSAAPIARYTKGFISAFYRRETWTVNEQIKFIQDFLNFTFTRMRECD  77

Query  309  LWAGCseeelesagegleKYVMTKLFSHVFA-SHPEDVKVDDQLYEKIALIQQFVRPENL  485
            +W   SE+E ++A EG+EK VM +L++  FA S  +D + D+ L+ KI++ Q +++ ++L
Sbjct  78   VWKDISEKEFDNAKEGMEKLVMNRLYNATFAPSTMDDKEKDNILHHKISIFQ-WIKEKHL  136

Query  486  DIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGA  665
            DI     NE+    A+ ELLK+N YKAPRDKL+CILNCCKVI  L+ + S    +   GA
Sbjct  137  DIPETEDNESFLTFAEAELLKMNNYKAPRDKLICILNCCKVIFGLIKHMS----KEEGGA  192

Query  666  DDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKA  845
            D FLP+LIYV I++NPP+L SN+ YI RFRH   L +EA Y+ TNL+ A  FI  +DA +
Sbjct  193  DIFLPLLIYVVIRSNPPRLISNVQYISRFRHPDHLQAEAGYYLTNLMGAIEFIETMDASS  252

Query  846  LSMDETEF  869
            LS+ + EF
Sbjct  253  LSISKEEF  260



>emb|CEG65654.1| Putative Guanine nucleotide exchange factor Vps9 [Rhizopus microsporus]
 emb|CEJ02089.1| Putative Guanine nucleotide exchange factor Vps9 [Rhizopus microsporus]
Length=264

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/247 (43%), Positives = 148/247 (60%), Gaps = 5/247 (2%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAP-DPERDSKAVQEFLGNMEAAFRAHS  308
            P  +H FL++M+ PSAA   +  K FI +F            K +Q+FL       R   
Sbjct  20   PFDFHRFLDQMKDPSAAPIARYTKGFISAFYRRETWTVNEQIKFIQDFLNFTFTRMRECD  79

Query  309  LWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLD  488
            +W   SE+E ++A EG+EK VM +L++  FA +  D K  D +      I Q+++ ++LD
Sbjct  80   VWKDISEKEFDNAKEGMEKLVMNRLYNATFAPNTMDDKEKDNILHHKISIFQWIKEKHLD  139

Query  489  IKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGAD  668
            I     NE+    A+ ELLK+N YKAPRDKL+CILNCCKVI  L+ + S    +   GAD
Sbjct  140  IPETEDNESFLTFAEAELLKMNNYKAPRDKLICILNCCKVIFGLIKHMS----KEEGGAD  195

Query  669  DFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKAL  848
             FLP+LIYV I++NPP+L SN+ YI RFRH   L +EA Y+ TNL+ A  FI  +DA +L
Sbjct  196  IFLPLLIYVVIRSNPPRLISNVQYISRFRHPDHLQAEAGYYLTNLMGAIEFIETMDASSL  255

Query  849  SMDETEF  869
            S+ + EF
Sbjct  256  SISKEEF  262



>emb|CEG62775.1| hypothetical protein RMATCC62417_00051 [Rhizopus microsporus]
Length=454

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/247 (43%), Positives = 151/247 (61%), Gaps = 7/247 (3%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  ++ FLE+M+  SA    +  KSF+ +F           K +Q+FL  +    R + +
Sbjct  69   PFDFNRFLEQMKSRSAKPITRYFKSFLQAFDRRPWTVNEQVKIIQDFLDFIYVKMRENEI  128

Query  312  WAGCseeelesagegleKYVMTKLFSHVFA-SHPEDVKVDDQLYEKIALIQQFVRPENLD  488
            W   SE+E  +A EG+EK VM +L+   F  S  +D + DD LY+KI++ + ++R  +LD
Sbjct  129  WKDMSEQEFFNAKEGMEKLVMNRLYYATFCPSTTDDKERDDLLYQKISIFR-WIRERHLD  187

Query  489  IKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGAD  668
            I     NE     A+ ELLK+N YKAPRDKL+CILNCCKVI  L+ +      E   GAD
Sbjct  188  IPETEHNEAFLTFAESELLKMNNYKAPRDKLICILNCCKVIFGLIKHV-----EGEGGAD  242

Query  669  DFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKAL  848
             FLP+LIYV I+ANPP+L SN  YI RFR   +L +EA Y+ TNL+ A +FI  ++AK+L
Sbjct  243  KFLPILIYVIIRANPPRLVSNTQYIYRFRSIDQLQAEAGYYLTNLMGAIAFIETMEAKSL  302

Query  849  SMDETEF  869
            S+ + EF
Sbjct  303  SITKEEF  309



>emb|CDH48555.1| related to vps9 (involved in vacuoletrafficking) [Lichtheimia 
corymbifera JMRC:FSU:9682]
Length=699

 Score =   175 bits (443),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 107/247 (43%), Positives = 154/247 (62%), Gaps = 7/247 (3%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  ++ FLE+MR+ SA    +  KSF+ +F           K +Q+FL  +    R   +
Sbjct  207  PFDFNRFLEQMRRRSATPIKRYFKSFLQAFDRRPWAVNEQIKIIQDFLDFIYVKMRECEV  266

Query  312  WAGCseeelesagegleKYVMTKLFSHVFA-SHPEDVKVDDQLYEKIALIQQFVRPENLD  488
            W   SE+E E+A EG+EK VM +L+   F  S  +D + D+ L++KI++ + ++R E+LD
Sbjct  267  WRNVSEQEFENAKEGMEKLVMNRLYHATFTPSTTDDKERDEILHQKISIFR-WIRAEHLD  325

Query  489  IKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGAD  668
            I     NE+    A+ ELLKIN YKAPRDKL+CILNCCKVI  L+ +          GAD
Sbjct  326  IPDTTHNESFLTFAESELLKINNYKAPRDKLICILNCCKVIFGLIKHVDGEG-----GAD  380

Query  669  DFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKAL  848
             FLP+LIYV ++ANPP+L SN+ YI RFR+   L SE+ Y+ TNLL + +FI ++DA +L
Sbjct  381  KFLPILIYVVLRANPPRLVSNVQYISRFRNPEHLQSESGYYLTNLLGSITFIESMDANSL  440

Query  849  SMDETEF  869
            S+ + EF
Sbjct  441  SITKEEF  447



>emb|CDS03506.1| hypothetical protein LRAMOSA00908 [Absidia idahoensis var. thermophila]
Length=628

 Score =   174 bits (442),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 106/247 (43%), Positives = 154/247 (62%), Gaps = 7/247 (3%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  ++ FLE+MR+ SA    +  KSF+ +F           K +Q+FL  +    R   +
Sbjct  144  PFDFNRFLEQMRRRSATPIKRYFKSFLQAFDRRPWAVNEQIKIIQDFLDFIYVKMRECEV  203

Query  312  WAGCseeelesagegleKYVMTKLFSHVFA-SHPEDVKVDDQLYEKIALIQQFVRPENLD  488
            W   SE+E E+A EG+EK VM +L+   F  S  +D + D+ L++KI++ + ++R E+LD
Sbjct  204  WRNVSEQEFENAKEGMEKLVMNRLYHATFTPSTTDDKERDEILHQKISIFR-WIRAEHLD  262

Query  489  IKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGAD  668
            I     NE+    A+ ELLKIN YKAPRDKL+CILNCCKVI  L+ +          GAD
Sbjct  263  IPDTTHNESFLTFAESELLKINNYKAPRDKLICILNCCKVIFGLIKHVDGEG-----GAD  317

Query  669  DFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKAL  848
             FLP+LIYV ++ANPP+L SN+ YI RFR+   L SE+ Y+ TNL+ + +FI ++DA +L
Sbjct  318  KFLPILIYVVLRANPPRLVSNVQYISRFRNPEHLQSESGYYLTNLMGSITFIESMDANSL  377

Query  849  SMDETEF  869
            S+ + EF
Sbjct  378  SITKEEF  384



>gb|EPB92767.1| hypothetical protein HMPREF1544_00496 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=536

 Score =   172 bits (437),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 106/247 (43%), Positives = 153/247 (62%), Gaps = 7/247 (3%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  ++ FLE+MR  +A    +  KSF+ +F           K +Q+FL  +    R   +
Sbjct  111  PFDFNRFLEQMRSRNAKPITRYFKSFLQAFDRRPWTVNEQIKIIQDFLDFIFIKMRECDV  170

Query  312  WAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQ-LYEKIALIQQFVRPENLD  488
            W   SE+E  +A EG+EK VM +L+   F  +  D K  D+ L++KI++ + ++R ++LD
Sbjct  171  WRDMSEQEFGNAKEGMEKLVMNRLYHVTFCPNTTDDKERDEILHQKISIFR-WIREKHLD  229

Query  489  IKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGAD  668
            I     NE+    A+ E+LKIN YKAPRDKL+CILNCCKVI  L+ +      E   GAD
Sbjct  230  IPETEHNESFLSFAESEILKINNYKAPRDKLICILNCCKVIFGLIKHV-----EGDAGAD  284

Query  669  DFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKAL  848
             FLP+LIYV I+ANPP+L SN+ YI RFR+  +L +EA Y+ TNL+ A SFI  ++AK+L
Sbjct  285  KFLPILIYVVIRANPPKLVSNVQYIYRFRNPEQLQAEAGYYLTNLMGAISFIETMEAKSL  344

Query  849  SMDETEF  869
            S+ + EF
Sbjct  345  SITKEEF  351



>gb|EPB91334.1| hypothetical protein HMPREF1544_01851 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=454

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/254 (43%), Positives = 153/254 (60%), Gaps = 8/254 (3%)
 Frame = +3

Query  114  FGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSF-SNNAPDPERDSKAVQEFLGNMEA  290
            F +      +H FLE+M++PSAA   +  K FI +F    A       K +Q+FL     
Sbjct  33   FQADMPTFDFHRFLEQMKEPSAAHIARYTKGFIAAFHRREAWTVNEQIKFIQDFLNFTYV  92

Query  291  AFRAHSLWAGCseeelesagegleKYVMTKLFSHVFA-SHPEDVKVDDQLYEKIALIQQF  467
              R   +W   SE+E E+A EG+EK VM +L++  F+ S  +D + D+ L+ KI + + +
Sbjct  93   RMRDCDVWRDISEKEFENAKEGMEKLVMNRLYNVTFSPSTMDDKEKDEILHHKINIFR-W  151

Query  468  VRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISAN  647
            +R E+LDI     N +    A+ ELLK+N YKAPRDKL+CILNCCKVI  L+ +      
Sbjct  152  IREEHLDIPMTDDNGSFLAFAESELLKMNNYKAPRDKLICILNCCKVIFGLMKHM-----  206

Query  648  ENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIM  827
            E   GAD FLP+LIYV I+ANPP+L SN+ YI RFR+   L SEA Y+ TNL+ A  FI 
Sbjct  207  EGDEGADVFLPLLIYVVIRANPPKLISNVQYISRFRNPDHLRSEAGYYLTNLMGAIEFIE  266

Query  828  NIDAKALSMDETEF  869
             +D  +LS+ + EF
Sbjct  267  TMDVNSLSVSQEEF  280



>gb|ESA06419.1| hypothetical protein GLOINDRAFT_82458, partial [Rhizophagus irregularis 
DAOM 181602]
Length=253

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 103/253 (41%), Positives = 150/253 (59%), Gaps = 12/253 (5%)
 Frame = +3

Query  129  APLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHS  308
            A   +  FL++M  PSA +  + +K+F   F   A       + + +FL  +    R   
Sbjct  5    AQFDFGKFLQQMSNPSAQNIARYVKNFEKEFERKAWTVNEQIRIIHDFLDFIALKMRNCE  64

Query  309  LWAGCseeelesagegleKYVMTKLFSHVF--ASH----PEDVKVDDQLYEKIALIQQFV  470
            LW   S+ E E+A EG+EK VM +L+   F  A H     +D + D+ L++KI + + +V
Sbjct  65   LWRNSSDVEFENAKEGMEKLVMNRLYKLTFSPAIHGSVTTDDRERDEILHQKIQIFR-WV  123

Query  471  RPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANE  650
            + E+LDI     NE     A+KELLKIN +KAPRDKL+CILNCCKVI  L+ +      +
Sbjct  124  KEEHLDIPTAPHNEQFLDFAKKELLKINYFKAPRDKLICILNCCKVIFGLIRHV-----D  178

Query  651  NPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMN  830
               GAD FLP+LI+V + ANP  L SN+ YI RFR+  +L SEA Y+ ++L+ A SFI N
Sbjct  179  GEEGADKFLPILIFVVLSANPEHLVSNVQYISRFRNPEKLQSEAGYYLSSLMGAISFIEN  238

Query  831  IDAKALSMDETEF  869
            +DA +LS+ + +F
Sbjct  239  MDASSLSITQEDF  251



>ref|XP_003286704.1| hypothetical protein DICPUDRAFT_150717 [Dictyostelium purpureum]
 gb|EGC36758.1| hypothetical protein DICPUDRAFT_150717 [Dictyostelium purpureum]
Length=670

 Score =   166 bits (419),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 105/262 (40%), Positives = 153/262 (58%), Gaps = 25/262 (10%)
 Frame = +3

Query  144  HDFLERMRQPSAADFVKAIKSFIVSFSNNAP-DPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            ++F  +++ P A D  +++ SF+  FS   P + E     +  +   +E     H LW  
Sbjct  143  NNFYTKLKSPKAMDIRRSLLSFVTKFSEYGPANYEEQGHIIITYSRELEHKILLHPLWQD  202

Query  321  CseeelesagegleKYVMTKLFSHVFAS------HPEDVKV-----------DDQLYEKI  449
             +E ELE   +G+EKY+M KL+   F         P++  +           D +LY+ I
Sbjct  203  PTEAELEGIRDGIEKYIMNKLYHCTFFPARLGRLEPQEGNIVSESLLVPTEDDLKLYKHI  262

Query  450  ALIQQFVRPENLDIKPVFQ-NETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLI  626
             +I QF+ P++ DI+  F  NE    LA  EL K+N YK PRDK++C+ NCCKVI  LL 
Sbjct  263  -MIHQFLEPQHFDIEKFFTVNEQRQNLAISELKKMNTYKTPRDKMVCVYNCCKVIFKLLK  321

Query  627  NASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLL  806
            N     N NP GAD+FLP+LIYV +KAN P L SNL+Y+  FR Q+R+++E A +FT+L+
Sbjct  322  NT----NNNPTGADEFLPILIYVVLKANLPMLKSNLIYVSTFRDQSRMMTEIACYFTHLV  377

Query  807  SAESFIMNIDAKA-LSMDETEF  869
            SA +FI NI   A LS++E+EF
Sbjct  378  SAVTFIENISTPADLSIEESEF  399



>ref|XP_002674145.1| predicted protein [Naegleria gruberi]
 gb|EFC41401.1| predicted protein [Naegleria gruberi]
Length=678

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 143/244 (59%), Gaps = 8/244 (3%)
 Frame = +3

Query  150  FLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAGCse  329
            FL++++  S     + IK F    SN    PE   K VQ FL ++     +H  W   +E
Sbjct  251  FLQKLKDKSVVQLTRDIKKFTFEISNTDYTPEHPHK-VQSFLAHIMREISSHEQWKNATE  309

Query  330  eelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQN  509
            ++L +A EG+EKYVMTK++S VF+   ED+++D+Q+  +IAL ++ V P NLD+      
Sbjct  310  QDLMNAREGIEKYVMTKIYSKVFSPTLEDIEIDNQIGSRIALFKRVVTPANLDVSARLVT  369

Query  510  ETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINA----SISANENPPGADDFL  677
            +  +  A +EL K++ YK PRDKL+C+ NCC +  NLL  +    S  +  N P ADDFL
Sbjct  370  DPLFQKAIEELKKMSFYKTPRDKLICVSNCCHLTMNLLKRSMHEQSGGSGGNAPSADDFL  429

Query  678  PVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMD  857
            P+LI++ +++N P LHSN   I  +R+   L   + YF T+L SA +F    D   L+MD
Sbjct  430  PLLIFIVLRSNVPHLHSN---INEYRNPQSLEGHSGYFLTSLESAMAFWQGCDHTMLNMD  486

Query  858  ETEF  869
            ET F
Sbjct  487  ETTF  490



>gb|KFH69955.1| hypothetical protein MVEG_04758 [Mortierella verticillata NRRL 
6337]
Length=868

 Score =   165 bits (417),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 102/247 (41%), Positives = 146/247 (59%), Gaps = 6/247 (2%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE+MR  SA    +  +SF+  F           K + +FL  +        L
Sbjct  260  PFDFHKFLEQMRHRSAMPITRYFQSFLKEFDKKPWTVNEQIKIIHDFLDFITGKMEICDL  319

Query  312  WAGCseeelesagegleKYVMTKLFSHVFA-SHPEDVKVDDQLYEKIALIQQFVRPENLD  488
            W   +++E E+  EG+EK VM +LF++ F+ S  +D + D+ L +KI + + +VR E+LD
Sbjct  320  WKNATDQEFENVKEGMEKLVMNRLFTYTFSPSTTDDAERDEVLNQKIRIFR-WVREEHLD  378

Query  489  IKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGAD  668
            I     NE     AQ EL KIN YKAPRDK++CILNCCK I  L+      +  N  GAD
Sbjct  379  IPDSPHNEAYLNNAQSELKKINSYKAPRDKVICILNCCKFIFTLIRR----SEGNSKGAD  434

Query  669  DFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKAL  848
             FLP+LIYV +++NPP L SN+ YI RFR+  +L +EA Y+  +L+ A SFI N++A +L
Sbjct  435  TFLPILIYVVLRSNPPNLVSNVQYISRFRNPEKLQAEAGYYLASLMGAISFIENLEASSL  494

Query  849  SMDETEF  869
            S+   EF
Sbjct  495  SISLEEF  501



>gb|EXX51022.1| Vps9p [Rhizophagus irregularis DAOM 197198w]
Length=497

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/253 (41%), Positives = 150/253 (59%), Gaps = 12/253 (5%)
 Frame = +3

Query  129  APLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHS  308
            A   +  FL++M  PSA +  + +K+F   F   A       + + +FL  +    R   
Sbjct  150  AQFDFGKFLQQMSNPSAQNIARYVKNFEKEFERKAWTVNEQIRIIHDFLDFIALKMRNCE  209

Query  309  LWAGCseeelesagegleKYVMTKLFSHVF--ASH----PEDVKVDDQLYEKIALIQQFV  470
            LW   S+ E E+A EG+EK VM +L+   F  A H     +D + D+ L++KI + + +V
Sbjct  210  LWRNSSDVEFENAKEGMEKLVMNRLYKLTFSPAIHGSVTTDDRERDEILHQKIQIFR-WV  268

Query  471  RPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANE  650
            + E+LDI     NE     A+KELLKIN +KAPRDKL+CILNCCKVI  L+ +      +
Sbjct  269  KEEHLDIPTAPHNEQFLDFAKKELLKINYFKAPRDKLICILNCCKVIFGLIRHV-----D  323

Query  651  NPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMN  830
               GAD FLP+LI+V + ANP  L SN+ YI RFR+  +L SEA Y+ ++L+ A SFI N
Sbjct  324  GEEGADKFLPILIFVVLSANPEHLVSNVQYISRFRNPEKLQSEAGYYLSSLMGAISFIEN  383

Query  831  IDAKALSMDETEF  869
            +DA +LS+ + +F
Sbjct  384  MDASSLSITQEDF  396



>emb|CEP07299.1| hypothetical protein [Parasitella parasitica]
Length=522

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 106/253 (42%), Positives = 150/253 (59%), Gaps = 11/253 (4%)
 Frame = +3

Query  114  FGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSF-SNNAPDPERDSKAVQEFLGNMEA  290
            F +      +H FLE+M++PSAA   +  K FI +F    A       K +Q+FL     
Sbjct  99   FQADMPTFDFHRFLEQMKEPSAAHIARYTKGFIAAFHRREAWTVNEQIKFIQDFLNFTNV  158

Query  291  AFRAHSLWAGCseeelesagegleKYVMTKLFSHVFA-SHPEDVKVDDQLYEKIALIQQF  467
              R   +W   S++E E+A EG+EK VM +LF+  F+ S  +D + D+ L+ KI + + +
Sbjct  159  KMRDCDVWRDISDKEFENAKEGMEKLVMNRLFNATFSPSTMDDKEKDEILHHKINIFR-W  217

Query  468  VRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISAN  647
            VR E++DI     N++    A+ ELLK+N YKAPRDKL+CILNCCKVI  L+ +      
Sbjct  218  VREEHIDIPKTDDNDSFLTFAESELLKMNNYKAPRDKLICILNCCKVIFGLMKHM-----  272

Query  648  ENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIM  827
            E   GAD FLP+LIYV I+ANPP+L SN+ YI RFR+   L SEA Y+ TNL    +F  
Sbjct  273  EGDEGADVFLPLLIYVVIRANPPKLISNVQYISRFRNPDHLQSEAGYYLTNLA---NFDD  329

Query  828  NIDAKALSMDETE  866
            NI+     +D+ +
Sbjct  330  NIERTMAELDQEQ  342



>dbj|GAN10056.1| guanine nucleotide exchange factor [Mucor ambiguus]
Length=529

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 108/272 (40%), Positives = 152/272 (56%), Gaps = 25/272 (9%)
 Frame = +3

Query  114  FGSSTAPLTWHDFLERMRQPSAADFVKAIKSFIVSF-SNNAPDPERDSKAVQEFLG-NME  287
            F +      +H FLE+M++PSA    +  K FI +F    A       K +Q+FL  ++E
Sbjct  76   FQADMPTFDFHRFLEQMKEPSANHIARYTKGFIAAFHRREAWTVNEQIKFIQDFLNVSIE  135

Query  288  AA------------------FRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPE  413
                                 R   +W   SE+E E+A EG+EK VM +L++  F+ +  
Sbjct  136  KQRVRGCSAELSLPQFTYVRMRDCDVWRDISEKEFENAKEGMEKLVMNRLYNVTFSPNTM  195

Query  414  DVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCIL  593
            D K  D++      I +++R E+LDI     N++    A+ ELLK+N YKAPRDKL+CIL
Sbjct  196  DDKEKDEILHHKINIFRWIREEHLDIPVTDDNDSFLTFAESELLKMNNYKAPRDKLICIL  255

Query  594  NCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLV  773
            NCCKVI  L+ +      E   GAD FLP+LIYV I+ANPP+L SN+ YI RFR+   L 
Sbjct  256  NCCKVIFGLMKHM-----EGDEGADVFLPLLIYVVIRANPPKLISNVQYISRFRNPDHLR  310

Query  774  SEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            SEA Y+ TNL+ A  FI  +D  +LS+ + EF
Sbjct  311  SEAGYYLTNLMGAIEFIETMDVNSLSISQEEF  342



>ref|XP_002174022.1| guanyl-nucleotide exchange factor Vps901 [Schizosaccharomyces 
japonicus yFS275]
 gb|EEB07729.1| guanyl-nucleotide exchange factor Vps901 [Schizosaccharomyces 
japonicus yFS275]
Length=579

 Score =   159 bits (403),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 101/255 (40%), Positives = 149/255 (58%), Gaps = 18/255 (7%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R   A    K +KSF+  FS        ++K +++F+  ++     +  +  
Sbjct  114  FHSFLEQLRSKPAEPVAKYLKSFLSEFSKRQWPLVYETKLIKDFINFIDEKLEQYEPFKS  173

Query  321  CseeelesagegleKYVMTKLFSHVF------------ASHPEDVKVDDQLYEKIALIQQ  464
            CSEEE E+A EG+EK VM +L++ VF              H +D++ D  + EK+ L   
Sbjct  174  CSEEERENAREGMEKLVMNRLYTQVFSPEIKKAGLPLTGEHSDDIEQDRVVSEKMRLFS-  232

Query  465  FVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISA  644
            +VR E+LDI P   N   + LA KEL +IN Y APRDK++CILNCCKVI + L       
Sbjct  233  WVREEHLDITPHKSNSRFFELASKELRRINDYHAPRDKIICILNCCKVIYSYL-----RI  287

Query  645  NENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFI  824
             E+   AD F+P+LIYV ++ANP  L SN+ YIQRFR+  +L  E +Y+ + L  A SFI
Sbjct  288  VEHEECADKFVPILIYVLLRANPNHLVSNIQYIQRFRNPIKLAGEVSYYLSTLEGALSFI  347

Query  825  MNIDAKALSMDETEF  869
             N+D  +L++ E +F
Sbjct  348  QNLDRSSLTISEEDF  362



>gb|EXX51021.1| Vps9p [Rhizophagus irregularis DAOM 197198w]
Length=647

 Score =   159 bits (403),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 103/253 (41%), Positives = 150/253 (59%), Gaps = 12/253 (5%)
 Frame = +3

Query  129  APLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHS  308
            A   +  FL++M  PSA +  + +K+F   F   A       + + +FL  +    R   
Sbjct  150  AQFDFGKFLQQMSNPSAQNIARYVKNFEKEFERKAWTVNEQIRIIHDFLDFIALKMRNCE  209

Query  309  LWAGCseeelesagegleKYVMTKLFSHVF--ASH----PEDVKVDDQLYEKIALIQQFV  470
            LW   S+ E E+A EG+EK VM +L+   F  A H     +D + D+ L++KI + + +V
Sbjct  210  LWRNSSDVEFENAKEGMEKLVMNRLYKLTFSPAIHGSVTTDDRERDEILHQKIQIFR-WV  268

Query  471  RPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANE  650
            + E+LDI     NE     A+KELLKIN +KAPRDKL+CILNCCKVI  L+ +      +
Sbjct  269  KEEHLDIPTAPHNEQFLDFAKKELLKINYFKAPRDKLICILNCCKVIFGLIRHV-----D  323

Query  651  NPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMN  830
               GAD FLP+LI+V + ANP  L SN+ YI RFR+  +L SEA Y+ ++L+ A SFI N
Sbjct  324  GEEGADKFLPILIFVVLSANPEHLVSNVQYISRFRNPEKLQSEAGYYLSSLMGAISFIEN  383

Query  831  IDAKALSMDETEF  869
            +DA +LS+ + +F
Sbjct  384  MDASSLSITQEDF  396



>gb|ERS95192.1| hypothetical protein HMPREF1624_08403 [Sporothrix schenckii ATCC 
58251]
Length=906

 Score =   160 bits (406),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 101/278 (36%), Positives = 146/278 (53%), Gaps = 38/278 (14%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R   A    + +KSF+  F+          K + +FL  +        +
Sbjct  378  PFDFHRFLEQLRHKKADPVARYLKSFLAEFAKKQWMVHEQVKIISDFLAFIADKMAVCEV  437

Query  312  WAGCseeelesagegleKYVMTKLFSHVFA-----------------------------S  404
            W   S+   ++A EG+EK VM +L++  F+                              
Sbjct  438  WRDLSDAAFDNAREGMEKLVMNRLYAQTFSPAIPPPQPIPGARPKRRGGERPMGPGRRGQ  497

Query  405  HPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETS---WLLAQKELLKINMYKAPRD  575
            H EDV+ D+ L +KI  I  +VR  +LDI PV   E+      LAQ+ELLKI  Y+APRD
Sbjct  498  HQEDVERDEVLSQKIT-IYGWVRERHLDIAPVAAEESGRRFLRLAQQELLKIKTYRAPRD  556

Query  576  KLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR  755
            K++C+LNCCKVI  LL       N+    AD F+P+LIYV ++ANP  L SN+ YI RFR
Sbjct  557  KIICVLNCCKVIFGLL-----KHNKADESADAFMPLLIYVVLQANPDHLVSNVQYILRFR  611

Query  756  HQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            HQ +L  EA Y+ ++L+ A  FI N+D   L++ + EF
Sbjct  612  HQDKLAGEAGYYLSSLMGAVQFIENMDRTTLTITDAEF  649



>gb|KIH87120.1| guanine nucleotide exchange factor [Sporothrix brasiliensis 5110]
Length=965

 Score =   160 bits (406),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 102/278 (37%), Positives = 146/278 (53%), Gaps = 38/278 (14%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R   A    + +KSF+  F+          K + +FL  +        +
Sbjct  456  PFDFHRFLEQLRHKKADPVARYLKSFLAEFAKKQWMVHEQVKIISDFLAFIADKMAVCEV  515

Query  312  WAGCseeelesagegleKYVMTKLFSHVFA-----------------------------S  404
            W   S+   ++A EG+EK VM +L+S  F+                              
Sbjct  516  WRDLSDAAFDNAREGMEKLVMNRLYSQTFSPAIPPPQPIPGARPKRRGGERPMGPGRRGQ  575

Query  405  HPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETS---WLLAQKELLKINMYKAPRD  575
            H EDV+ D+ L +KI  I  +VR  +LDI PV   E+      LAQ+ELLKI  Y+APRD
Sbjct  576  HQEDVERDEVLSQKIT-IYGWVRERHLDIAPVAAEESGRRFLRLAQQELLKIKTYRAPRD  634

Query  576  KLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR  755
            K++C+LNCCKVI  LL       N+    AD F+P+LIYV ++ANP  L SN+ YI RFR
Sbjct  635  KIICVLNCCKVIFGLL-----KHNKADESADAFMPLLIYVVLQANPDHLVSNVQYILRFR  689

Query  756  HQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            HQ +L  EA Y+ ++L+ A  FI N+D   L++ + EF
Sbjct  690  HQDKLAGEAGYYLSSLMGAVQFIENMDRTTLTITDAEF  727



>ref|XP_003652940.1| hypothetical protein THITE_2114800 [Thielavia terrestris NRRL 
8126]
 gb|AEO66604.1| hypothetical protein THITE_2114800 [Thielavia terrestris NRRL 
8126]
Length=730

 Score =   159 bits (401),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 103/276 (37%), Positives = 152/276 (55%), Gaps = 36/276 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R   A    + +KSF+  F           K + +FL  +        +
Sbjct  246  PFDFHRFLEQLRNKKADPVARYLKSFLSEFGKRQWMVHEQVKIISDFLAFIANKMAQCDV  305

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-----------------------------AS  404
            W   S+ E ++A EG+EK VM +L+S  F                               
Sbjct  306  WKDVSDAEFDNAREGMEKLVMNRLYSQTFSPAIPPPQPIPGAKPKRRGGERPMGPGRRGQ  365

Query  405  HPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKL  581
            H EDV+ D+ L +KI+ I  +VR E+LDI PV ++   +L LAQ+ELLKI  Y+APRDK+
Sbjct  366  HQEDVERDEVLAQKIS-IYGWVREEHLDIPPVSESGKRFLKLAQQELLKIKSYRAPRDKI  424

Query  582  LCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQ  761
            +C+LNCCKVI  LL ++   ++     AD F+P+LIYV ++ANP  L SN+ YI RFR+Q
Sbjct  425  ICVLNCCKVIFGLLKHSKSDSS-----ADSFMPMLIYVVLQANPEHLVSNVQYILRFRNQ  479

Query  762  TRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
             +L  EA Y+ ++L+ A  FI N+D  AL++ + EF
Sbjct  480  EKLGGEAGYYLSSLMGAIQFIENMDRTALTITDEEF  515



>gb|KJR89981.1| hypothetical protein SPSK_05911 [Sporothrix schenckii 1099-18]
Length=965

 Score =   160 bits (405),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 101/278 (36%), Positives = 146/278 (53%), Gaps = 38/278 (14%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R   A    + +KSF+  F+          K + +FL  +        +
Sbjct  443  PFDFHRFLEQLRHKKADPVARYLKSFLAEFAKKQWMVHEQVKIISDFLAFIADKMAVCEV  502

Query  312  WAGCseeelesagegleKYVMTKLFSHVFA-----------------------------S  404
            W   S+   ++A EG+EK VM +L++  F+                              
Sbjct  503  WRDLSDAAFDNAREGMEKLVMNRLYAQTFSPAIPPPQPIPGARPKRRGGERPMGPGRRGQ  562

Query  405  HPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETS---WLLAQKELLKINMYKAPRD  575
            H EDV+ D+ L +KI  I  +VR  +LDI PV   E+      LAQ+ELLKI  Y+APRD
Sbjct  563  HQEDVERDEVLSQKIT-IYGWVRERHLDIAPVAAEESGRRFLRLAQQELLKIKTYRAPRD  621

Query  576  KLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR  755
            K++C+LNCCKVI  LL       N+    AD F+P+LIYV ++ANP  L SN+ YI RFR
Sbjct  622  KIICVLNCCKVIFGLL-----KHNKADESADAFMPLLIYVVLQANPDHLVSNVQYILRFR  676

Query  756  HQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            HQ +L  EA Y+ ++L+ A  FI N+D   L++ + EF
Sbjct  677  HQDKLAGEAGYYLSSLMGAVQFIENMDRTTLTITDAEF  714



>ref|XP_008869177.1| hypothetical protein H310_06051 [Aphanomyces invadans]
 gb|ETW02572.1| hypothetical protein H310_06051 [Aphanomyces invadans]
Length=617

 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/264 (38%), Positives = 140/264 (53%), Gaps = 19/264 (7%)
 Frame = +3

Query  135  LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDP----------------ERDSKAVQ  266
            L++  FLER+  P + D V+AI+ F+ S      D                 E   +  +
Sbjct  323  LSYSVFLERLSLPGSKDIVEAIRRFVGSVLGPRGDGCPPTSAHFVDYIFYGHESFQQRCE  382

Query  267  EFLGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFS---HVFASHPEDVKVDDQL  437
            EF  +++     H  W    E  L  A +G+EKYVM KL     H           D  L
Sbjct  383  EFFRSIDETLATHPAWRHAPERILRHARDGIEKYVMDKLADVPLHKLRESAAWKAEDAAL  442

Query  438  YEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINN  617
            + ++ ++ QFV P+ LDIKP  +NE  W +AQ EL  IN Y++P DK+ CI+ CC +I +
Sbjct  443  WRRMQVLSQFVTPDMLDIKPSMRNEVVWSIAQDELRHINEYRSPGDKINCIVRCCSIIFS  502

Query  618  LLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFT  797
            +L  A  S   + PGADDFLPV IY+ + +  P L SN  YI  +R+   L+S+A Y F 
Sbjct  503  VLNLARGSDVMSRPGADDFLPVFIYLVLHSQVPSLVSNAEYIAAYRNPADLMSKAGYCFV  562

Query  798  NLLSAESFIMNIDAKALSMDETEF  869
            NL SA  FI+ +DA  LS+DETEF
Sbjct  563  NLRSAIEFILVLDASMLSIDETEF  586



>gb|KIW67139.1| hypothetical protein PV04_06411 [Capronia semiimmersa]
Length=751

 Score =   158 bits (399),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 107/275 (39%), Positives = 148/275 (54%), Gaps = 37/275 (13%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  SA    K ++SF+  F           K + +FL  +        +W  
Sbjct  274  FHRFLEQLRHKSADPVAKFLRSFLTEFGKKQWMVHEQVKIIGDFLAFITNKMALCDVWRE  333

Query  321  CseeelesagegleKYVMTKLFSHVF-------------------------------ASH  407
             S+ E ++A EG+EK VM +L+S  F                                 H
Sbjct  334  VSDNEFDNAKEGMEKLVMNRLYSQTFSPAIPPPPQVGRSRSRGRRKELEKSSAPGRRGQH  393

Query  408  PEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKLL  584
             EDV+ DD L +KI  I  +VR E+LDI PV  N   +L LAQ+ELLKI  Y+APRDK++
Sbjct  394  QEDVERDDILAQKIR-IYSWVREEHLDIPPVGPNGERFLKLAQQELLKIKGYRAPRDKVI  452

Query  585  CILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQT  764
            C+LNCCKVI  LL NA  S       AD F+P+LIYV ++ANP  + SN+ YI RFR+Q 
Sbjct  453  CVLNCCKVIFGLLKNAKSSDT----SADSFVPLLIYVVLQANPENMVSNVQYILRFRNQD  508

Query  765  RLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +LV EA Y+ ++L  A  FI N+D   L++ + EF
Sbjct  509  KLVGEAGYYLSSLSGAIQFIENLDRTTLTVSDEEF  543



>gb|EEH17796.1| hypothetical protein PABG_00359 [Paracoccidioides brasiliensis 
Pb03]
Length=801

 Score =   158 bits (399),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 105/278 (38%), Positives = 147/278 (53%), Gaps = 37/278 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F           K + +FL  +        +
Sbjct  319  PFDFHRFLEQLRHRTADPVAKFLRSFLTEFGKKQWMVHEQVKIISDFLAFITNKMAQCEV  378

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-------------------------------  398
            W   S+ E ++A EG+EK VM +L+S  F                               
Sbjct  379  WREVSDVEFDNAKEGMEKLVMNRLYSQTFSPAIPPPLTPPRSRSKGRKKYLNSPQGPGRR  438

Query  399  ASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRD  575
              H EDV+ D+ L +K+  I  +VR E+LDI PV  N   +L LAQ+ELLKI  Y+APRD
Sbjct  439  GQHQEDVERDEILAQKVR-IYSWVREEHLDIPPVGPNGRRFLALAQQELLKIKGYRAPRD  497

Query  576  KLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR  755
            K++C+LNCCKVI  LL NA          AD F+P+LIYV +KANP  L SNL YI RFR
Sbjct  498  KVICVLNCCKVIFGLLRNAKSGDT----SADSFVPLLIYVVLKANPEHLVSNLQYILRFR  553

Query  756  HQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +Q +L  EA Y+ ++L  A  FI  +D  +L++ + EF
Sbjct  554  NQDKLAGEAGYYLSSLSGAIQFIETLDRTSLTISDKEF  591



>gb|EEH37209.2| hypothetical protein PAAG_07765 [Paracoccidioides sp. 'lutzii' 
Pb01]
Length=801

 Score =   158 bits (399),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 105/278 (38%), Positives = 147/278 (53%), Gaps = 37/278 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F           K + +FL  +        +
Sbjct  319  PFDFHRFLEQLRHRTADPVAKFLRSFLTEFGKKQWMVHEQVKIISDFLAFITNKMAQCEV  378

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-------------------------------  398
            W   S+ E ++A EG+EK VM +L+S  F                               
Sbjct  379  WREVSDVEFDNAKEGMEKLVMNRLYSQTFSPAIPPPLTPPRSRSKGRKKYLNNPQGPGRR  438

Query  399  ASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRD  575
              H EDV+ D+ L +K+  I  +VR E+LDI PV  N   +L LAQ+ELLKI  Y+APRD
Sbjct  439  GQHQEDVERDEILAQKVR-IYSWVREEHLDIPPVGPNGRRFLALAQQELLKIKGYRAPRD  497

Query  576  KLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR  755
            K++C+LNCCKVI  LL NA          AD F+P+LIYV +KANP  L SNL YI RFR
Sbjct  498  KVICVLNCCKVIFGLLRNAKSGDT----SADSFVPLLIYVVLKANPEHLVSNLQYILRFR  553

Query  756  HQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +Q +L  EA Y+ ++L  A  FI  +D  +L++ + EF
Sbjct  554  NQDKLAGEAGYYLSSLSGAIQFIETLDRTSLTISDKEF  591



>ref|XP_010758125.1| hypothetical protein PADG_02772 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH46674.2| hypothetical protein PADG_02772 [Paracoccidioides brasiliensis 
Pb18]
Length=801

 Score =   157 bits (398),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 105/278 (38%), Positives = 147/278 (53%), Gaps = 37/278 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F           K + +FL  +        +
Sbjct  319  PFDFHRFLEQLRHRTADPVAKFLRSFLTEFGKKQWMVHEQVKIISDFLAFITNKMAQCEV  378

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-------------------------------  398
            W   S+ E ++A EG+EK VM +L+S  F                               
Sbjct  379  WREVSDVEFDNAKEGMEKLVMNRLYSQTFSPAIPPPLTPPRSRSKGRKKYLNSPQGPGRR  438

Query  399  ASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRD  575
              H EDV+ D+ L +K+  I  +VR E+LDI PV  N   +L LAQ+ELLKI  Y+APRD
Sbjct  439  GQHQEDVERDEILAQKVR-IYSWVREEHLDIPPVGPNGRRFLALAQQELLKIKGYRAPRD  497

Query  576  KLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR  755
            K++C+LNCCKVI  LL NA          AD F+P+LIYV +KANP  L SNL YI RFR
Sbjct  498  KVICVLNCCKVIFGLLRNAKSGDT----SADSFVPLLIYVVLKANPEHLVSNLQYILRFR  553

Query  756  HQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +Q +L  EA Y+ ++L  A  FI  +D  +L++ + EF
Sbjct  554  NQDKLAGEAGYYLSSLSGAIQFIETLDRTSLTISDKEF  591



>tpe|CBF75630.1| TPA: guanine nucleotide exchange factor Vps9, putative (AFU_orthologue; 
AFUA_4G12490) [Aspergillus nidulans FGSC A4]
Length=767

 Score =   157 bits (397),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 105/278 (38%), Positives = 150/278 (54%), Gaps = 37/278 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F           K + +FL  +     A  +
Sbjct  283  PFDFHRFLEQLRHRTADPVAKFLRSFLHEFGKRQWMVHEQVKIISDFLAFITNKMAACEV  342

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-------------------------------  398
            W   S+ E ++A EG+EK VM +L++  F                               
Sbjct  343  WRDVSDSEFDNAKEGMEKLVMNRLYTQTFSPTIPSPPSIPRSASRSKRREMERLHGPWRK  402

Query  399  ASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRD  575
              H EDV+ D+ L +K+  I  +VR E+LDI PV  +   +L LAQ+ELLKIN Y+APRD
Sbjct  403  GQHQEDVERDEVLAQKM-RIYSWVREEHLDIAPVSSSGRRFLNLAQQELLKINGYRAPRD  461

Query  576  KLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR  755
            K++CILNCCKVI  LL NA  S       AD F+P+LIYV ++ANP  L SN+ YI RFR
Sbjct  462  KVICILNCCKVIFGLLRNAKKSDT----SADSFIPLLIYVVLQANPEHLVSNIQYILRFR  517

Query  756  HQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +Q +L  EA Y+ ++L  A  FI  +D  +L++ + EF
Sbjct  518  NQEKLGGEAGYYLSSLSGAIQFIETLDRTSLTVSDEEF  555



>gb|KIZ01817.1| hypothetical protein MNEG_6145 [Monoraphidium neglectum]
Length=684

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 123/196 (63%), Gaps = 5/196 (3%)
 Frame = +3

Query  282  MEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQ  461
            ME A   H L+AG   +EL++A E LEKY+MTKL    F    ED + D  L  +   +Q
Sbjct  1    METAMAKHPLFAGSGPQELDAATEALEKYLMTKLHDRTFGMATEDTERDALLAVRCEALQ  60

Query  462  QFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASIS  641
             FVRPE+L+I     ++ +   A  EL ++N YKAPRDKL+CILNCC+VI N+L +   +
Sbjct  61   -FVRPEHLEIAEGVAHDGALGQAAHELNRMNNYKAPRDKLVCILNCCRVIGNMLHSGPRA  119

Query  642  ANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESF  821
             N    GADDF P+LI   I+A P +L SNL Y++R+R ++R+  EAAY+F  L SA +F
Sbjct  120  GN-GVAGADDFTPMLILAVIRARPSKLGSNLGYVERYRLRSRMAGEAAYYFVQLCSAATF  178

Query  822  IMNIDAKAL---SMDE  860
            I  +DA +L   S DE
Sbjct  179  IEMVDASSLHGVSADE  194



>gb|EQB49461.1| hypothetical protein CGLO_11199 [Colletotrichum gloeosporioides 
Cg-14]
Length=619

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 99/276 (36%), Positives = 149/276 (54%), Gaps = 36/276 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R   A    + +KSF+  F           K + +FL  +        +
Sbjct  20   PFDFHRFLEQLRNKKADPVARYLKSFLSEFGKRQWMVHEQVKIISDFLAFIANKMAQCEV  79

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-----------------------------AS  404
            W   S+ E ++A EG+EK VM +L++  F                               
Sbjct  80   WRDVSDAEFDNAREGMEKLVMNRLYTQTFSPAIPPPQPIPGAKPKRRGGERPMGPGRRGQ  139

Query  405  HPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKL  581
            H ED++ DD L +KI  I  ++R E+LDI P  ++   +L LAQ+ELLKI  Y+APRDK+
Sbjct  140  HQEDIERDDVLTQKIQ-IYAWLREEHLDIPPAGESGRRFLKLAQQELLKIKSYRAPRDKI  198

Query  582  LCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQ  761
            +C+LNCCKVI  LL ++   ++     AD F+P+LIYV ++ANP  L SN+ YI RFR+Q
Sbjct  199  ICVLNCCKVIFGLLKHSKSDSS-----ADSFMPLLIYVVLQANPEHLVSNVQYILRFRNQ  253

Query  762  TRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
             +L  EA Y+ ++L+ A  FI N+D   L++ + EF
Sbjct  254  EKLGGEAGYYLSSLMGAIQFIENMDRTTLTITDEEF  289



>ref|XP_001243139.1| hypothetical protein CIMG_07035 [Coccidioides immitis RS]
 gb|EAS31556.1| guanine nucleotide exchange factor Vps9 [Coccidioides immitis 
RS]
Length=805

 Score =   157 bits (396),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 107/278 (38%), Positives = 148/278 (53%), Gaps = 37/278 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F           K + +FL  +        +
Sbjct  316  PFDFHRFLEQLRHRTADPVAKFLRSFLTEFGKRQWMVHEQVKIISDFLAFITNKMAMCDV  375

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-------------------------------  398
            W   S+ E ++A EG+EK VM +L+S  F                               
Sbjct  376  WKEVSDVEFDNAKEGMEKLVMNRLYSQTFSPAIPPPPVLPRNRSRGRKKDLEKLLGPGRR  435

Query  399  ASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRD  575
              H EDV+ D+ L +KI  I  +VR E+LDI PV  N   +L LAQ+ELLKI  Y+APRD
Sbjct  436  GQHQEDVERDEILAQKIR-IYSWVREEHLDIPPVSSNGHRFLHLAQQELLKIKGYRAPRD  494

Query  576  KLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR  755
            K++CILNCCKVI  LL N+  S       AD F+P+LIYV +KANP  L SNL YI RFR
Sbjct  495  KVICILNCCKVIFGLLKNSRDSDT----SADSFMPLLIYVVLKANPEHLVSNLQYILRFR  550

Query  756  HQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +Q +L  EA Y+ ++L  A  FI  +D  +L++ + EF
Sbjct  551  NQEKLGGEAGYYLSSLSGAIQFIETLDRTSLTVSQEEF  588



>ref|XP_005850796.1| hypothetical protein CHLNCDRAFT_140312 [Chlorella variabilis]
 gb|EFN58694.1| hypothetical protein CHLNCDRAFT_140312 [Chlorella variabilis]
Length=570

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 95/240 (40%), Positives = 138/240 (58%), Gaps = 6/240 (3%)
 Frame = +3

Query  162  MRQPSAADFVKAIKSFIVSF----SNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAGCse  329
            MR P+AAD V+ IKSFI  F    + +  DPE DS  VQ FL   E  FR H +W GC  
Sbjct  1    MRDPAAADLVRNIKSFIRQFEERPAGHQVDPEADSAKVQAFLAQSEQLFRQHPVWRGCQP  60

Query  330  eelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQN  509
            E L+ A EGLEKYVM+K++   FA   ED + D++ Y+++     FV    L    V  +
Sbjct  61   EVLDQAVEGLEKYVMSKVWRQTFAVWQEDRERDER-YQRLMQALDFVDLPTLMGANVEPD  119

Query  510  ETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLI  689
                 LAQ ELLK++ YKAPRDKLLC++N   ++ N+ +  +     N  GAD F PV +
Sbjct  120  SNLLALAQSELLKMDRYKAPRDKLLCLVNVKTMVENI-VQLAAKGGANIGGADAFFPVFL  178

Query  690  YVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +V +++  P L SN+ Y++RFR + RL  +  Y   NL SA  ++  ++ + L++ +  F
Sbjct  179  FVVMRSRLPHLASNVEYVKRFRSRARLSGQFDYMLCNLESAAMYLDTVNYEHLAVSQETF  238



>gb|KJE96549.1| hypothetical protein, variant [Capsaspora owczarzaki ATCC 30864]
Length=487

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 99/250 (40%), Positives = 147/250 (59%), Gaps = 7/250 (3%)
 Frame = +3

Query  135  LTWHDFLERMRQPSAADFVKAIKSFIVSFSNN-APDPERDSKAVQEFLGNMEAAFRAHSL  311
             T+HDFL  M++P A D V   K FI +FS + A   E  S+++Q FL NM      H L
Sbjct  238  FTFHDFLTDMKKPQAQDLVMQTKRFIENFSTSTALSSEEQSESIQIFLQNMGNRISTHPL  297

Query  312  WAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDI  491
            W    +EELE+A +G+EKYVMTKL+S VF+    D    D+L ++     ++V   +L +
Sbjct  298  WKNSQQEELENAIDGIEKYVMTKLYSQVFSPSSTDDTAKDELIDQRIRRLRWVTLGHLGL  357

Query  492  KPVFQNETS---WLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPG  662
              +  NE        A   L +++  +AP+DK+ CI+ C K++  +L   +++   +   
Sbjct  358  DAMELNEKCDEPLKAAMHSLCEMDAKRAPQDKVACIVKCSKLVFTIL--QAMAGASHAAS  415

Query  663  ADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVS-EAAYFFTNLLSAESFIMNIDA  839
            AD+FLPVLI+  I+A+P +L SNL YI RF + TRL+S E  YFFTN+  A +F+ N+ A
Sbjct  416  ADEFLPVLIFTVIRAHPARLQSNLQYISRFCNPTRLISGEGGYFFTNMCCAVAFLENLQA  475

Query  840  KALSMDETEF  869
             +  MDE EF
Sbjct  476  SSFKMDEQEF  485



>ref|XP_009522430.1| hypothetical protein PHYSODRAFT_327908 [Phytophthora sojae]
 gb|EGZ19713.1| hypothetical protein PHYSODRAFT_327908 [Phytophthora sojae]
Length=898

 Score =   157 bits (397),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 104/279 (37%), Positives = 151/279 (54%), Gaps = 24/279 (9%)
 Frame = +3

Query  99   ENADVFGSSTA---PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPD--PERDSKAV  263
            +N+D  G   A    LT+ +FL+R+  P++ D +  I+ F+ S      D  P R +  V
Sbjct  404  KNSDPVGGDKADEDSLTYGEFLQRISLPASRDILDKIRMFVGSILGPRGDGRPPRSTDYV  463

Query  264  Q--------------EFLGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFA  401
            +               F   ME     H  W   SE +L  A +G+EKYVM K+    F 
Sbjct  464  EYDFYGKHEFRRRCNRFFETMEEILLNHPAWRHASEGKLAKARDGIEKYVMDKVSDIAFN  523

Query  402  SHPED---VKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPR  572
               E    +K D+ L  ++ L+  F+ P  LDIKP  +NE  W +A+ EL +IN +++P 
Sbjct  524  QLKECQQWMKEDEALLRRMQLLS-FITPAMLDIKPCMRNEVVWSMAEDELRRINSFRSPG  582

Query  573  DKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRF  752
            DK+ CI+ CC VI ++L N S   + + PGADDFLPV IY+ + +  P+LHSN  YI  +
Sbjct  583  DKINCIVRCCSVIFSVL-NLSRGDSGSRPGADDFLPVFIYIVLHSQIPRLHSNCEYISAY  641

Query  753  RHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            R+Q  L+S+A Y F NL SA  FIM +D   LS+ + EF
Sbjct  642  RNQADLMSKAGYCFVNLRSAIEFIMVMDGSMLSISDDEF  680



>gb|EGD91802.2| hypothetical protein TERG_08020 [Trichophyton rubrum CBS 118892]
Length=585

 Score =   155 bits (391),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 104/275 (38%), Positives = 148/275 (54%), Gaps = 37/275 (13%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  +A    K ++SF+  F           K + +FL  +        +W G
Sbjct  106  FHRFLEQLRHRTADPVAKFLRSFLNEFGKRQWMVHEQVKIISDFLAFITNKMAQCEVWKG  165

Query  321  CseeelesagegleKYVMTKLFSHVF-------------------------------ASH  407
             S+ E ++A EG+EK VM +L++  F                                 H
Sbjct  166  VSDVEFDNAKEGMEKLVMNRLYTQTFSPTIPPPAAPSRSRSRGRRKELERMHHPGRRGQH  225

Query  408  PEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSW-LLAQKELLKINMYKAPRDKLL  584
             EDV+ D+ L +K+  I  +VR E+LDI PV  N   + LLAQ+ELLKI  Y+APRDK++
Sbjct  226  QEDVERDEILAQKVR-IYSWVREEHLDIPPVGPNGRRFLLLAQQELLKIKGYRAPRDKVI  284

Query  585  CILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQT  764
            CILNCCKVI  LL +A  S       AD F+P+LIYV +KANP  L SN+ YI RFR+Q 
Sbjct  285  CILNCCKVIFGLLRHAKNSDT----SADSFIPLLIYVVLKANPEHLVSNVQYILRFRNQE  340

Query  765  RLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +L  EA Y+ ++L  A  FI  +D  +L++ + EF
Sbjct  341  KLSGEAGYYLSSLSGAIQFIETLDRTSLTVSDEEF  375



>ref|XP_007758222.1| hypothetical protein A1O7_06026 [Cladophialophora yegresii CBS 
114405]
 gb|EXJ58599.1| hypothetical protein A1O7_06026 [Cladophialophora yegresii CBS 
114405]
Length=740

 Score =   156 bits (394),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 105/275 (38%), Positives = 147/275 (53%), Gaps = 37/275 (13%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  SA    K ++SF+  F           K + +FL  +        +W  
Sbjct  267  FHRFLEQLRHKSADPVAKFLRSFLTEFGKKQWMVHEQVKIIGDFLAFITNKMALCDVWRE  326

Query  321  CseeelesagegleKYVMTKLFSHVF-------------------------------ASH  407
             S+ E ++A EG+EK VM +L+S  F                                 H
Sbjct  327  VSDNEFDNAKEGMEKLVMNRLYSQTFSPAIPPPPQVGRSRSRGRRKELEKASVPGRRGQH  386

Query  408  PEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKLL  584
             EDV+ DD L +KI  I  +VR E+LDI PV  N   +L LAQ+ELLKI  Y+APRDK++
Sbjct  387  QEDVERDDILAQKIR-IYSWVREEHLDIAPVGPNGERFLKLAQQELLKIKGYRAPRDKVI  445

Query  585  CILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQT  764
            C+LNCCKVI  LL N+  S       AD F+P+LIYV ++ANP  + SN+ YI RFR+Q 
Sbjct  446  CVLNCCKVIFGLLKNSKSSDT----SADSFVPLLIYVVLQANPENMVSNVQYILRFRNQE  501

Query  765  RLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +LV EA Y+ ++L  A  FI  +D   L++ + EF
Sbjct  502  KLVGEAGYYLSSLSGAIQFIEGLDRTTLTVSDEEF  536



>ref|XP_003070197.1| Vacuolar sorting protein 9 domain containing protein [Coccidioides 
posadasii C735 delta SOWgp]
 gb|EER28052.1| Vacuolar sorting protein 9 domain containing protein [Coccidioides 
posadasii C735 delta SOWgp]
Length=799

 Score =   156 bits (395),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 107/278 (38%), Positives = 148/278 (53%), Gaps = 37/278 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F           K + +FL  +        +
Sbjct  317  PFDFHRFLEQLRHRTADPVAKFLRSFLTEFGKRQWMVHEQVKIIGDFLAFITNKMAMCDV  376

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-------------------------------  398
            W   S+ E ++A EG+EK VM +L+S  F                               
Sbjct  377  WKEVSDVEFDNAKEGMEKLVMNRLYSQTFSPAIPPPPVLPRNRSRGRKKDLEKLLGPGRR  436

Query  399  ASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRD  575
              H EDV+ D+ L +KI  I  +VR E+LDI PV  N   +L LAQ+ELLKI  Y+APRD
Sbjct  437  GQHQEDVERDEILAQKIR-IYSWVREEHLDIPPVSSNGHRFLHLAQQELLKIKGYRAPRD  495

Query  576  KLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR  755
            K++CILNCCKVI  LL N+  S       AD F+P+LIYV +KANP  L SNL YI RFR
Sbjct  496  KVICILNCCKVIFGLLKNSRDSDT----SADSFMPLLIYVVLKANPEHLVSNLQYILRFR  551

Query  756  HQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +Q +L  EA Y+ ++L  A  FI  +D  +L++ + EF
Sbjct  552  NQEKLGGEAGYYLSSLSGAIQFIETLDRTSLTVSQEEF  589



>gb|EFW23197.1| guanine nucleotide exchange factor Vps9 [Coccidioides posadasii 
str. Silveira]
Length=799

 Score =   156 bits (395),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 107/278 (38%), Positives = 148/278 (53%), Gaps = 37/278 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F           K + +FL  +        +
Sbjct  317  PFDFHRFLEQLRHRTADPVAKFLRSFLTEFGKRQWMVHEQVKIIGDFLAFITNKMAMCDV  376

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-------------------------------  398
            W   S+ E ++A EG+EK VM +L+S  F                               
Sbjct  377  WKEVSDVEFDNAKEGMEKLVMNRLYSQTFSPAIPPPPVLPRNRSRGRKKDLEKLLGPGRR  436

Query  399  ASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRD  575
              H EDV+ D+ L +KI  I  +VR E+LDI PV  N   +L LAQ+ELLKI  Y+APRD
Sbjct  437  GQHQEDVERDEILAQKIR-IYSWVREEHLDIPPVSSNGHRFLHLAQQELLKIKGYRAPRD  495

Query  576  KLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR  755
            K++CILNCCKVI  LL N+  S       AD F+P+LIYV +KANP  L SNL YI RFR
Sbjct  496  KVICILNCCKVIFGLLKNSRDSDT----SADSFMPLLIYVVLKANPEHLVSNLQYILRFR  551

Query  756  HQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +Q +L  EA Y+ ++L  A  FI  +D  +L++ + EF
Sbjct  552  NQEKLGGEAGYYLSSLSGAIQFIETLDRTSLTVSQEEF  589



>ref|XP_008729052.1| hypothetical protein G647_06510 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI22435.1| hypothetical protein G647_06510 [Cladophialophora carrionii CBS 
160.54]
Length=747

 Score =   155 bits (393),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 105/275 (38%), Positives = 147/275 (53%), Gaps = 37/275 (13%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  SA    K ++SF+  F           K + +FL  +        +W  
Sbjct  276  FHRFLEQLRHKSADPVAKFLRSFLTEFGKKQWMVHEQVKIIGDFLAFITNKMALCDVWRE  335

Query  321  CseeelesagegleKYVMTKLFSHVF-------------------------------ASH  407
             S+ E ++A EG+EK VM +L+S  F                                 H
Sbjct  336  VSDNEFDNAKEGMEKLVMNRLYSQTFSPAIPPPPQLGRSRSRGRRKELEKSSVPGRRGQH  395

Query  408  PEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKLL  584
             EDV+ DD L +KI  I  +VR E+LDI PV  N   +L LAQ+ELLKI  Y+APRDK++
Sbjct  396  QEDVERDDILAQKIR-IYSWVREEHLDIAPVGPNGERFLKLAQQELLKIKGYRAPRDKVI  454

Query  585  CILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQT  764
            C+LNCCKVI  LL N+  S       AD F+P+LIYV ++ANP  + SN+ YI RFR+Q 
Sbjct  455  CVLNCCKVIFGLLKNSKSSDT----SADSFVPLLIYVVLQANPENMVSNVQYILRFRNQE  510

Query  765  RLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +LV EA Y+ ++L  A  FI  +D   L++ + EF
Sbjct  511  KLVGEAGYYLSSLSGAIQFIEGLDRTTLTVSDEEF  545



>emb|CEP17622.1| hypothetical protein [Parasitella parasitica]
Length=575

 Score =   154 bits (390),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 103/252 (41%), Positives = 148/252 (59%), Gaps = 21/252 (8%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKS-FIVSFSNNAPDPERDSKAVQEFLGNMEAAF----  296
            P  ++ FLE+MR  ++    +  K  + V+            K +Q+FL + E  F    
Sbjct  108  PFDFNRFLEQMRSRNSKPITRYFKRPWTVN---------EQIKIIQDFL-DSEFQFIFIK  157

Query  297  -RAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVR  473
             R   +W   SE+E  +A EG+EK VM +L+   F     D K  D++  +   I +++R
Sbjct  158  MRECDVWKDMSEQEFGNAKEGMEKLVMNRLYHVTFCPTTTDDKERDEILSQKISIFRWIR  217

Query  474  PENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANEN  653
             ++LDI     NE+    A+ E+LKIN YKAPRDKL+CILNCCKVI  L+ +      E 
Sbjct  218  EKHLDIPETEHNESFLSFAESEILKINNYKAPRDKLICILNCCKVIFGLIKHV-----EG  272

Query  654  PPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNI  833
              GAD FLP+LIYV I+ANPP+L SN+ YI RFR+  +L +EA Y+ TNL+ A SFI  +
Sbjct  273  DAGADKFLPILIYVVIRANPPKLVSNVQYIYRFRNPDQLQAEAGYYLTNLMGAISFIETM  332

Query  834  DAKALSMDETEF  869
            +AK+LS+ + EF
Sbjct  333  EAKSLSITKEEF  344



>ref|XP_639976.1| vacuolar sorting protein 9 domain-containing protein [Dictyostelium 
discoideum AX4]
 gb|EAL65000.1| vacuolar sorting protein 9 domain-containing protein [Dictyostelium 
discoideum AX4]
Length=726

 Score =   155 bits (392),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 98/261 (38%), Positives = 150/261 (57%), Gaps = 23/261 (9%)
 Frame = +3

Query  147  DFLERMRQPSAADFVKAIKSFIVSFSNNAPD-PERDSKAVQEFLGNMEAAFRAHSLWAGC  323
            +F  +++  +A D  +++ +F+  FS N P   E     +  +   +E    +  LWA  
Sbjct  147  NFYTKLKHKNAIDIRRSLLNFVTQFSTNGPSLIEEQGHTIITYTRELEHWVLSLPLWANA  206

Query  324  seeelesagegleKYVMTKLFSHVF---------------ASHPEDVKVDD--QLYEKIA  452
             E E+E   +G+EKY+M KL+   F                S    +  ++  +L++ I 
Sbjct  207  GEAEVEGIRDGIEKYIMGKLYHCTFPPARLGGLELTEGNIVSEGSLIPTEEDLKLFKHIT  266

Query  453  LIQQFVRPENLDIKP-VFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLIN  629
             I  F+ P++LDI+  +  NE    LA  EL KIN YK PRDK++C+ NCCKVI  LL  
Sbjct  267  -IHGFLEPQHLDIQQFINSNEQRQNLAISELRKINTYKTPRDKMVCVYNCCKVIFKLL--  323

Query  630  ASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLS  809
             S++ N NP GAD+FLP+LIYV +K+NP  L SN+ Y+  FR Q+R+++E A +FT+L+S
Sbjct  324  KSVNPNGNPSGADEFLPILIYVVLKSNPIMLKSNITYVNTFRDQSRMMTEIACYFTHLVS  383

Query  810  AESFIMNIDAKA-LSMDETEF  869
            A SFI NI     L+++E+EF
Sbjct  384  AVSFIENITTPVDLTIEESEF  404



>gb|EEH06551.1| vacuolar sorting-associated protein [Histoplasma capsulatum G186AR]
Length=766

 Score =   155 bits (393),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 104/278 (37%), Positives = 147/278 (53%), Gaps = 37/278 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F           K + +FL  +        +
Sbjct  319  PFDFHRFLEQLRHRTADPVAKFLRSFLTEFGKKQWMVHEQVKIISDFLAFITNKMAQCEV  378

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-------------------------------  398
            W   S+ E ++A EG+EK VM +L+S  F                               
Sbjct  379  WRDISDVEFDNAKEGIEKLVMNRLYSQTFSPAIPPPPAPSRSRSRGQKKDTGRYLGPGRR  438

Query  399  ASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRD  575
              H EDV+ D+ L +K+  I  +VR E+LDI PV  N   +L LAQ+ELLKI  Y+APRD
Sbjct  439  GQHQEDVERDEVLAQKV-RIYSWVREEHLDIPPVGPNGRRFLALAQQELLKIKGYRAPRD  497

Query  576  KLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR  755
            K++C+LNCCKVI  LL NA          AD F+P+LIYV +KANP  L SN+ YI RFR
Sbjct  498  KVICVLNCCKVIFGLLRNAPNGDT----SADSFVPLLIYVVLKANPEHLVSNIQYILRFR  553

Query  756  HQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +Q +L  EA Y+ ++L  A  FI  +D  +L++ + EF
Sbjct  554  NQEKLAGEAGYYLSSLSGAIQFIETLDRTSLTISDEEF  591



>gb|ELR07775.1| hypothetical protein GMDG_00398 [Pseudogymnoascus destructans 
20631-21]
Length=823

 Score =   156 bits (394),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 100/276 (36%), Positives = 151/276 (55%), Gaps = 36/276 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F           K + +FL  +        +
Sbjct  344  PFDFHRFLEQLRHRTADPVAKFLRSFLQEFGKKQWMVHEQVKIIGDFLAFITNKMAQCEI  403

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-----------------------------AS  404
            W   S+ E ++A EG+EK VM +L++  F                               
Sbjct  404  WKEVSDAEFDNAREGMEKLVMNRLYTQTFSPAIPPPQPIPGARPRRRNGERPLGPGRRGQ  463

Query  405  HPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKL  581
            H EDV+ DD L +K+  I  +V+ E+LDI PV ++   +L LAQ+ELLKIN Y+APRDK+
Sbjct  464  HQEDVERDDILAQKVG-IYGWVKEEHLDIPPVGESGKRFLILAQQELLKINTYRAPRDKI  522

Query  582  LCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQ  761
            +C+LNCCKVI  LL ++   ++     AD F+P+LIY  ++ANP  L SN+ YI RFR+Q
Sbjct  523  ICVLNCCKVIFGLLKHSKSDSS-----ADSFMPLLIYTVLQANPEHLVSNVQYILRFRNQ  577

Query  762  TRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
             +L  EA Y+ ++LL A  FI N+D   L++ + +F
Sbjct  578  EKLGGEAGYYLSSLLGAVQFIENLDRTTLTISDEDF  613



>ref|XP_004344475.1| hypothetical protein CAOG_06854 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE96548.1| hypothetical protein CAOG_006854 [Capsaspora owczarzaki ATCC 
30864]
Length=581

 Score =   154 bits (389),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 99/250 (40%), Positives = 147/250 (59%), Gaps = 7/250 (3%)
 Frame = +3

Query  135  LTWHDFLERMRQPSAADFVKAIKSFIVSFSNN-APDPERDSKAVQEFLGNMEAAFRAHSL  311
             T+HDFL  M++P A D V   K FI +FS + A   E  S+++Q FL NM      H L
Sbjct  238  FTFHDFLTDMKKPQAQDLVMQTKRFIENFSTSTALSSEEQSESIQIFLQNMGNRISTHPL  297

Query  312  WAGCseeelesagegleKYVMTKLFSHVFASHPEDVKVDDQLYEKIALIQQFVRPENLDI  491
            W    +EELE+A +G+EKYVMTKL+S VF+    D    D+L ++     ++V   +L +
Sbjct  298  WKNSQQEELENAIDGIEKYVMTKLYSQVFSPSSTDDTAKDELIDQRIRRLRWVTLGHLGL  357

Query  492  KPVFQNETS---WLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISANENPPG  662
              +  NE        A   L +++  +AP+DK+ CI+ C K++  +L   +++   +   
Sbjct  358  DAMELNEKCDEPLKAAMHSLCEMDAKRAPQDKVACIVKCSKLVFTIL--QAMAGASHAAS  415

Query  663  ADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVS-EAAYFFTNLLSAESFIMNIDA  839
            AD+FLPVLI+  I+A+P +L SNL YI RF + TRL+S E  YFFTN+  A +F+ N+ A
Sbjct  416  ADEFLPVLIFTVIRAHPARLQSNLQYISRFCNPTRLISGEGGYFFTNMCCAVAFLENLQA  475

Query  840  KALSMDETEF  869
             +  MDE EF
Sbjct  476  SSFKMDEQEF  485



>emb|CAK43884.1| unnamed protein product [Aspergillus niger]
Length=527

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 103/278 (37%), Positives = 149/278 (54%), Gaps = 37/278 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F           K + +FL  +        +
Sbjct  103  PFDFHRFLEQLRHRTADPVAKFLRSFLHEFGKRQWMVHEQVKIISDFLVFITNKMAQCEV  162

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-------------------------------  398
            W   S+ E ++A EG+EK VM +L+S  F                               
Sbjct  163  WRDVSDSEFDNAKEGMEKLVMNRLYSQTFSPAIPGPPTIPRSARRSKRREMERMHGPWRR  222

Query  399  ASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRD  575
              H ED++ D+ L +K+  I  +VR E+LDI PV  +   +L LAQ+ELLKIN Y+APRD
Sbjct  223  GQHQEDIERDEVLAQKMR-IYSWVREEHLDIPPVSSHGRRFLNLAQQELLKINGYRAPRD  281

Query  576  KLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR  755
            K++CILNCCKVI  LL N+  S       AD F+P+LIYV ++ANP  L SN+ YI RFR
Sbjct  282  KVICILNCCKVIFGLLRNSKRSDT----SADSFVPLLIYVVLQANPEHLVSNIQYILRFR  337

Query  756  HQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +Q +L  EA Y+ ++L  A  FI  +D  +L++ + EF
Sbjct  338  NQDKLGGEAGYYLSSLSGAIQFIETLDRTSLTVSDEEF  375



>gb|EGC47352.1| vacuolar sorting-associated protein [Histoplasma capsulatum H88]
Length=790

 Score =   155 bits (393),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 104/278 (37%), Positives = 147/278 (53%), Gaps = 37/278 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F           K + +FL  +        +
Sbjct  319  PFDFHRFLEQLRHRTADPVAKFLRSFLTEFGKKQWMVHEQVKIISDFLAFITNKMAQCEV  378

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-------------------------------  398
            W   S+ E ++A EG+EK VM +L+S  F                               
Sbjct  379  WREISDVEFDNAKEGIEKLVMNRLYSQTFSPAIPPPPAPSRSRSRGPKKDTGRYLGPGRR  438

Query  399  ASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRD  575
              H EDV+ D+ L +K+  I  +VR E+LDI PV  N   +L LAQ+ELLKI  Y+APRD
Sbjct  439  GQHQEDVERDEVLAQKVR-IYSWVREEHLDIPPVGPNGRRFLALAQQELLKIKGYRAPRD  497

Query  576  KLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR  755
            K++C+LNCCKVI  LL NA          AD F+P+LIYV +KANP  L SN+ YI RFR
Sbjct  498  KVICVLNCCKVIFGLLRNAPNGDT----SADSFVPLLIYVVLKANPEHLVSNIQYILRFR  553

Query  756  HQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +Q +L  EA Y+ ++L  A  FI  +D  +L++ + EF
Sbjct  554  NQEKLAGEAGYYLSSLSGAIQFIETLDRTSLTISDEEF  591



>gb|KIV79896.1| hypothetical protein PV11_07437 [Exophiala sideris]
Length=740

 Score =   155 bits (391),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 104/276 (38%), Positives = 148/276 (54%), Gaps = 38/276 (14%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  SA    K ++SF+  F           K + +FL  +        +W  
Sbjct  274  FHRFLEQLRHKSADPVAKFLRSFLTEFGKKQWMVHEQVKIIGDFLAFITNKMALCDVWRE  333

Query  321  CseeelesagegleKYVMTKLFSHVF--------------------------------AS  404
             S+ E ++A EG+EK VM +L+S  F                                  
Sbjct  334  VSDNEFDNAKEGMEKLVMNRLYSQTFSPAIPPPPPQPSRSRSRGRRKEQEKNPLPGRRGQ  393

Query  405  HPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKL  581
            H EDV+ DD L +KI  I  ++R E+LD++PV  N   +L LAQ+ELLKI  Y+APRDK+
Sbjct  394  HQEDVERDDILAQKIR-IYSWIREEHLDLEPVGPNGERFLRLAQQELLKIKGYRAPRDKV  452

Query  582  LCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQ  761
            +C+LNCCKVI  LL NA  S       AD F+P+LIYV ++ANP  L SN+ YI RFR+Q
Sbjct  453  ICVLNCCKVIFGLLKNAKSSDT----SADSFVPLLIYVVLQANPENLVSNVQYILRFRNQ  508

Query  762  TRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
             +L  EA Y+ ++L  A  FI N+D   L++ + +F
Sbjct  509  DKLGGEAGYYLSSLSGAIQFIENLDRTTLTVSDEDF  544



>ref|XP_003660286.1| hypothetical protein MYCTH_2298407 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO55041.1| hypothetical protein MYCTH_2298407 [Myceliophthora thermophila 
ATCC 42464]
Length=764

 Score =   155 bits (391),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 101/275 (37%), Positives = 149/275 (54%), Gaps = 35/275 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R   A    + +KSF+  F           K + +FL  +        +
Sbjct  298  PFDFHRFLEQLRNKKADPVARYLKSFLSEFGKRQWMVHEQVKIISDFLAFIANKMAQCEV  357

Query  312  WAGCseeelesagegleKYVMTKLFSHVF----------------------------ASH  407
            W   S+ E ++A EG+EK VM +L++  F                              H
Sbjct  358  WKDVSDAEFDNAREGMEKLVMNRLYAQTFSPAIPPPQPLPGPRKRRGQERIMGPGRRGQH  417

Query  408  PEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKLL  584
             EDV+ D+ L +KI  I  +VR E+LDI PV ++   +L LAQ+ELLKI  Y+APRDK++
Sbjct  418  QEDVERDEVLAQKIK-IYSWVREEHLDIPPVSESGKRFLKLAQQELLKIKSYRAPRDKII  476

Query  585  CILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQT  764
            C+LNCCKVI  LL +    ++     AD F+P+LIYV ++ANP  L SN+ YI RFR+Q 
Sbjct  477  CVLNCCKVIFGLLKHTKSDSS-----ADSFMPLLIYVVLQANPEHLVSNVQYILRFRNQE  531

Query  765  RLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +L  EA Y+ ++L+ A  FI N+D   L++ + EF
Sbjct  532  KLGGEAGYYLSSLMGAIQFIENMDRTTLTISDEEF  566



>ref|XP_003437304.1| unnamed protein product [Podospora anserina S mat+]
 emb|CAP65389.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP31384.1| Putative Vacuolar protein sorting-associated protein 9 [Podospora 
anserina S mat+]
Length=777

 Score =   155 bits (391),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 103/278 (37%), Positives = 150/278 (54%), Gaps = 36/278 (13%)
 Frame = +3

Query  126  TAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAH  305
            T P  +H FLE++R   A    + +KSF+  F           K + +FL  +       
Sbjct  309  TLPFDFHRFLEQLRNKKADPVARYLKSFLSEFGKRQWMVHEQVKIISDFLTFIANKMGQC  368

Query  306  SLWAGCseeelesagegleKYVMTKLFSHVF-----------------------------  398
             +W   S+ E ++A EG+EK VM +L+S  F                             
Sbjct  369  EVWRDVSDAEFDNAREGMEKLVMNRLYSQTFSPAIPPPQPIPGAKPRRRGGERPMGPGRR  428

Query  399  ASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRD  575
              H EDV+ D+ L +KI  I  +VR ++LDI PV ++   +L LAQ+ELLKI  Y+APRD
Sbjct  429  GQHQEDVERDEILAQKIN-IYSWVREDHLDIPPVNESGKRFLKLAQQELLKIKSYRAPRD  487

Query  576  KLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR  755
            K++C+LNCCKVI  LL +A   ++     AD F+P+LIYV + ANP  L SN+ YI RFR
Sbjct  488  KIICVLNCCKVIFGLLKHAKSDSS-----ADSFMPMLIYVVLHANPEHLVSNVQYILRFR  542

Query  756  HQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +Q +L  EA Y+ ++L+ A  FI N+D   L++ + EF
Sbjct  543  NQEKLGGEAGYYLSSLMGAIQFIENMDRTTLTITDEEF  580



>ref|XP_002628058.1| guanine nucleotide exchange factor Vps9 [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ72736.1| guanine nucleotide exchange factor Vps9 [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ88855.1| guanine nucleotide exchange factor Vps9 [Blastomyces dermatitidis 
ER-3]
 gb|EGE81737.1| guanine nucleotide exchange factor Vps9 [Blastomyces dermatitidis 
ATCC 18188]
 gb|EQL31385.1| hypothetical protein BDFG_06210 [Blastomyces dermatitidis ATCC 
26199]
Length=791

 Score =   155 bits (392),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 103/278 (37%), Positives = 147/278 (53%), Gaps = 37/278 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F           K + +FL  +        +
Sbjct  320  PFDFHRFLEQLRHRTADPVAKFLRSFLTEFGKKQWMVHEQVKIISDFLAFITNKMAQCEV  379

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-------------------------------  398
            W   S+ E ++A EG+EK VM +L+S  F                               
Sbjct  380  WREVSDVEFDNAKEGMEKLVMNRLYSQTFSPAIPPPPTSSRSRSRGRKKDLDRYLGPGRR  439

Query  399  ASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRD  575
              H EDV+ D+ L +K+  I  ++R E+LDI PV  N   +L LAQ+ELLKI  Y+APRD
Sbjct  440  GQHQEDVERDEILAQKV-RIYSWIREEHLDIPPVGPNGRRFLALAQQELLKIKGYRAPRD  498

Query  576  KLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR  755
            K++C+LNCCKVI  LL NA          AD F+P+LIYV +KANP  L SN+ YI RFR
Sbjct  499  KVICVLNCCKVIFGLLRNAQSGDT----SADSFVPLLIYVVLKANPEHLVSNIQYILRFR  554

Query  756  HQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +Q +L  EA Y+ ++L  A  FI  +D  +L++ + EF
Sbjct  555  NQDKLAGEAGYYLSSLSGAIQFIETLDRTSLTISDEEF  592



>gb|KFY04368.1| hypothetical protein O988_00821, partial [Pseudogymnoascus pannorum 
VKM F-3808]
Length=682

 Score =   154 bits (389),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 99/276 (36%), Positives = 151/276 (55%), Gaps = 36/276 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F           K + +FL  +        +
Sbjct  202  PFDFHRFLEQLRHRTADPVAKFLRSFLQEFGKKQWMVHEQVKIIGDFLAFITNKMAQCEI  261

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-----------------------------AS  404
            W   S+ E ++A EG+EK VM +L++  F                               
Sbjct  262  WKEVSDAEFDNAREGMEKLVMNRLYTQTFSPAIPPPQPIPGARPRRRNGERPLGPGRRGQ  321

Query  405  HPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKL  581
            H EDV+ DD L +K++ I  +V+ E+LDI PV ++   +L LAQ+ELLKI  Y+APRDK+
Sbjct  322  HQEDVERDDILAQKVS-IYGWVKEEHLDIPPVGESGKRFLILAQQELLKIKTYRAPRDKI  380

Query  582  LCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQ  761
            +C+LNCCKVI  LL ++   ++     AD F+P+LIY  ++ANP  L SN+ YI RFR+Q
Sbjct  381  ICVLNCCKVIFGLLKHSKSDSS-----ADSFMPLLIYTVLQANPEHLVSNVQYILRFRNQ  435

Query  762  TRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
             +L  EA Y+ ++LL A  FI N+D   L++ + +F
Sbjct  436  DKLGGEAGYYLSSLLGAVQFIENLDRTTLTISDEDF  471



>ref|XP_006962723.1| guanine nucleotide exchange factor [Trichoderma reesei QM6a]
 gb|EGR51184.1| guanine nucleotide exchange factor [Trichoderma reesei QM6a]
 gb|ETS04534.1| hypothetical protein M419DRAFT_73212 [Trichoderma reesei RUT 
C-30]
Length=636

 Score =   154 bits (388),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 101/276 (37%), Positives = 150/276 (54%), Gaps = 36/276 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R   A    + +KSF+  F           K + +FL  +        +
Sbjct  168  PFDFHRFLEQLRNKKADPVARYLKSFLFEFGKRQWMVHEQVKIISDFLAFIANKMMLCEV  227

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-----------------------------AS  404
            W   S+ E ++A EG+EK VM +L++  F                               
Sbjct  228  WRDVSDAEFDNAREGMEKLVMNRLYTQTFSPAIPPPKPIPGAKPKRRGGDPPLGPGRRGQ  287

Query  405  HPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKL  581
            H EDV+ DD + +KI  I  +VR E+LDI PV  +   +L LAQ+ELLKI  Y+APRDK+
Sbjct  288  HQEDVERDDIVTQKIN-IYGWVREEHLDIPPVGDSGRRFLKLAQQELLKIKSYRAPRDKI  346

Query  582  LCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQ  761
            +C+LNCCKVI  LL +     N++   AD F+P+LIYV +++NP  L SN+ YI RFR+Q
Sbjct  347  ICVLNCCKVIFGLLKH-----NKSDSSADSFMPLLIYVVLQSNPEHLVSNVQYILRFRNQ  401

Query  762  TRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
             +L  EA Y+ ++L+ A  FI N+D  +L++ + EF
Sbjct  402  EKLGGEAGYYLSSLMGAVQFIENMDRTSLTITDEEF  437



>ref|XP_007747659.1| hypothetical protein A1O5_08888 [Cladophialophora psammophila 
CBS 110553]
 gb|EXJ68273.1| hypothetical protein A1O5_08888 [Cladophialophora psammophila 
CBS 110553]
Length=733

 Score =   154 bits (390),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 105/275 (38%), Positives = 148/275 (54%), Gaps = 37/275 (13%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  SA    K ++SF+  F           K + +FL  +        +W  
Sbjct  265  FHRFLEQLRHKSADPVAKFLRSFLTEFGKKQWMVHEQVKIIGDFLAFITNKMALCEVWRE  324

Query  321  CseeelesagegleKYVMTKLFSHVF-------------------------------ASH  407
             S+ E ++A EG+EK VM +L+S  F                                 H
Sbjct  325  VSDNEFDNAKEGMEKLVMNRLYSQTFSPAIPPSPPVARSRSRGRRKELEKSQAPGRRGQH  384

Query  408  PEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKLL  584
             EDV+ D+ L +KI  I  +VR E+LDI+PV  N   +L LAQ+ELLKI  Y+APRDK++
Sbjct  385  QEDVERDEILAQKIR-IYSWVREEHLDIEPVGPNGERFLRLAQQELLKIKGYRAPRDKVI  443

Query  585  CILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQT  764
            C+LNCCKVI  LL NA  S       AD F+P+LIYV ++ANP  L SN+ YI RFR+Q 
Sbjct  444  CVLNCCKVIFGLLKNAKSSDT----SADSFVPLLIYVVLQANPENLVSNIQYILRFRNQD  499

Query  765  RLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +L  EA Y+ ++L  A  FI ++D   L++ + EF
Sbjct  500  KLGGEAGYYLSSLSGAIQFIESLDRTTLTVSDEEF  534



>emb|CDO73317.1| hypothetical protein BN946_scf185008.g79 [Trametes cinnabarina]
Length=648

 Score =   154 bits (388),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 96/251 (38%), Positives = 148/251 (59%), Gaps = 17/251 (7%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +  FL++M+   A    K ++SF+ +F+          + + +FL  + A  R   +
Sbjct  240  PFDFQKFLDQMKLKGAEPVAKYLRSFLSNFAKRTFTVNDQVRLINDFLTFIAARMRESEV  299

Query  312  WAGCseeelesagegleKYVMTKLFSHVFASH-----------PEDVKVDDQLYEKIALI  458
            W   S+ E ++A EG+EK VM +L+   F               +D++ D  L ++IAL 
Sbjct  300  WRNASDAEFDNAMEGMEKLVMNRLYEFTFTPQVAKAVPPRPITADDLERDRVLSQRIALF  359

Query  459  QQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASI  638
            + ++ P++LD+     +E   + AQ+ELLK+N YKAPRDKL+CILNCCKVI  L+ +  +
Sbjct  360  K-WIEPKHLDVPEGEGSEGFLMFAQQELLKVNHYKAPRDKLICILNCCKVIFGLIRH--L  416

Query  639  SANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAES  818
              +E+   AD FLP+LIYV IKANPP L SN+ +I RFR+  +L SEA Y+ ++L+ A S
Sbjct  417  HKDES---ADSFLPILIYVVIKANPPHLLSNVEFINRFRNPAKLQSEAGYYLSSLMGAVS  473

Query  819  FIMNIDAKALS  851
            FI  +D  +LS
Sbjct  474  FIETMDHTSLS  484



>ref|XP_007738290.1| hypothetical protein A1O3_10009 [Capronia epimyces CBS 606.96]
 gb|EXJ77780.1| hypothetical protein A1O3_10009 [Capronia epimyces CBS 606.96]
Length=736

 Score =   154 bits (390),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 104/276 (38%), Positives = 148/276 (54%), Gaps = 38/276 (14%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  SA    K ++SF+  F           K + +FL  +        +W  
Sbjct  269  FHRFLEQLRHKSADPVAKFLRSFLTEFGKKQWMVHEQVKIIGDFLAFITNKMALCEVWRD  328

Query  321  CseeelesagegleKYVMTKLFSHVF--------------------------------AS  404
             SE E ++A EG+EK VM +L+S  F                                  
Sbjct  329  VSENEFDNAKEGMEKLVMNRLYSQTFSPAIAPPAAPPARSRSRGRRKDLEKSLMPGRRGQ  388

Query  405  HPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKL  581
            H EDV+ D+ L +KI  I  +VR E+LD++PV  N   +L LAQ+ELLKI  Y+APRDK+
Sbjct  389  HQEDVERDEILAQKIR-IYSWVREEHLDLEPVGPNGERFLKLAQQELLKIKGYRAPRDKV  447

Query  582  LCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQ  761
            +C+LNCCKVI  LL N   S       AD F+P+LIYV ++ANP  L SN+ YI RFR+Q
Sbjct  448  ICVLNCCKVIFGLLKNTKSSDT----SADSFVPLLIYVVLQANPEHLVSNVQYILRFRNQ  503

Query  762  TRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
             +L  EA Y+ ++L  A  FI ++D  +L++ + EF
Sbjct  504  EKLGGEAGYYLSSLSGAIQFIESLDRTSLTVSDEEF  539



>gb|KIW85768.1| hypothetical protein Z517_01160 [Fonsecaea pedrosoi CBS 271.37]
Length=733

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 105/275 (38%), Positives = 148/275 (54%), Gaps = 37/275 (13%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  SA    K ++SF++ F           K + +FL  +        +W  
Sbjct  265  FHRFLEQLRHKSADPVAKFLRSFLIEFGKKQWMVHEQVKIIGDFLAFITNKMALCEVWRE  324

Query  321  CseeelesagegleKYVMTKLFSHVF-------------------------------ASH  407
             S+ E ++A EG+EK VM +L+S  F                                 H
Sbjct  325  VSDNEFDNAKEGMEKLVMNRLYSQTFSPAIPPAPPVARSRSRGRRKELEKSDIPGRRGQH  384

Query  408  PEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKLL  584
             EDV+ D+ L +KI  I  +VR E+LDI PV  N   +L LAQ+ELLKI  Y+APRDK++
Sbjct  385  QEDVERDEILAQKIR-IYSWVREEHLDIAPVGPNGERFLRLAQQELLKIKGYRAPRDKVI  443

Query  585  CILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQT  764
            C+LNCCKVI  LL NA  S       AD F+P+LIYV ++ANP  L SN+ YI RFR+Q 
Sbjct  444  CVLNCCKVIFGLLKNAKSSDT----SADSFVPLLIYVVLQANPENLVSNVQYILRFRNQD  499

Query  765  RLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +L  EA Y+ ++L  A  FI ++D   L++ + EF
Sbjct  500  KLGGEAGYYLSSLSGAIQFIESLDRTTLTVSDEEF  534



>ref|XP_004361013.1| vacuolar sorting protein 9 domain-containing protein [Dictyostelium 
fasciculatum]
 gb|EGG23162.1| vacuolar sorting protein 9 domain-containing protein [Dictyostelium 
fasciculatum]
Length=1424

 Score =   156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 101/264 (38%), Positives = 152/264 (58%), Gaps = 27/264 (10%)
 Frame = +3

Query  144  HDFLERMRQPSAADFVKAIKSFIVSFSNNAPDP-ERDSKAVQEFLGNMEAAFRAHSLWAG  320
              F+++++ P A+D  K++  +I  F  N P   E    ++  +   +E A   + LW  
Sbjct  146  QGFMQKIKHPKASDIRKSLSGYIHYFLTNGPSKIEDQGNSIINYTRELENAIVVNPLWEN  205

Query  321  CseeelesagegleKYVMTKLFSHVFASH-------------PE----DVKVDDQLYEKI  449
             SE E+E   +G+EK +MT++F   F                PE      + D +LY+ +
Sbjct  206  ASEAEVEGIRDGIEKLIMTRVFHVSFMPARLGRLEPTEGNYVPEYGLIATEEDIKLYKHM  265

Query  450  ALIQQFVRPENLDIKPVFQ--NETSWL-LAQKELLKINMYKAPRDKLLCILNCCKVINNL  620
             L+  F+ P +LDI+   Q    T+++  A +EL KIN YK+PRDK++CI NCCKVI  L
Sbjct  266  -LVHAFITPTHLDIQKFIQPPASTNYIDKAVQELKKINTYKSPRDKMVCIYNCCKVIFKL  324

Query  621  LINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTN  800
            L     S N  P GADDFLP+LIYV +K+NPP LHSN+ YI  FR+ +R+ +E   +FT+
Sbjct  325  LS----SLNNTPSGADDFLPILIYVVLKSNPPLLHSNVQYISTFRNPSRMSTETGCYFTH  380

Query  801  LLSAESFIMNI-DAKALSMDETEF  869
            L+S  +FI NI D K L++ E+E+
Sbjct  381  LVSTLTFIENIVDHKQLTISESEY  404



>gb|KIW95181.1| hypothetical protein Z519_03765 [Cladophialophora bantiana CBS 
173.52]
Length=733

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 105/275 (38%), Positives = 148/275 (54%), Gaps = 37/275 (13%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  SA    K ++SF+  F           K + +FL  +        +W  
Sbjct  265  FHRFLEQLRHKSADPVAKFLRSFLTEFGKKQWMVHEQVKIIGDFLAFITNKMALCEVWRE  324

Query  321  CseeelesagegleKYVMTKLFSHVF-------------------------------ASH  407
             S+ E ++A EG+EK VM +L+S  F                                 H
Sbjct  325  VSDNEFDNAKEGMEKLVMNRLYSQTFSPAIPPSPPVARSRSRGRKKELEKSLIPGRRGQH  384

Query  408  PEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKLL  584
             EDV+ D+ L +KI  I  +VR E+LDI+PV  N   +L LAQ+ELLKI  Y+APRDK++
Sbjct  385  QEDVERDEILAQKIR-IYSWVREEHLDIEPVGPNGERFLRLAQQELLKIKGYRAPRDKVI  443

Query  585  CILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQT  764
            C+LNCCKVI  LL NA  S       AD F+P+LIYV ++ANP  L SN+ YI RFR+Q 
Sbjct  444  CVLNCCKVIFGLLKNAKSSDT----SADSFVPLLIYVVLQANPENLVSNVQYILRFRNQD  499

Query  765  RLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +L  EA Y+ ++L  A  FI ++D   L++ + EF
Sbjct  500  KLGGEAGYYLSSLSGAIQFIESLDRTTLTVSDEEF  534



>gb|EFQ36027.1| hypothetical protein GLRG_11171 [Colletotrichum graminicola M1.001]
Length=805

 Score =   154 bits (390),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 101/276 (37%), Positives = 149/276 (54%), Gaps = 36/276 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R   A    + +KSF+  F           K + +FL  +        +
Sbjct  332  PFDFHRFLEQLRNKKADPVARYLKSFLSEFGKRQWMVHEQVKIISDFLAFIANKMAQCEV  391

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-----------------------------AS  404
            W   S+ E ++A EG+EK VM +L++  F                               
Sbjct  392  WRDVSDAEFDNAREGMEKLVMNRLYTQTFSPAIPPPQPIPGAKPKRRGGERPMGPGRRGQ  451

Query  405  HPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKL  581
            H EDV+ DD L +KI  I  ++R E+LDI P   + T +L LAQ+ELLKI  Y+APRDK+
Sbjct  452  HQEDVERDDILTQKIN-IYAWLREEHLDIPPAGDSGTRFLKLAQQELLKIKSYRAPRDKI  510

Query  582  LCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQ  761
            +C+LNCCKVI  LL ++   ++     AD F+P+LIYV ++ANP  L SN+ YI RFR+Q
Sbjct  511  ICVLNCCKVIFGLLKHSKSDSS-----ADSFMPLLIYVVLQANPEHLVSNVQYILRFRNQ  565

Query  762  TRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
             +L  EA Y+ ++L+ A  FI N+D   L++ + EF
Sbjct  566  EKLGGEAGYYLSSLMGAIQFIENMDRTTLTITDEEF  601



>gb|KIX94401.1| hypothetical protein Z520_09787 [Fonsecaea multimorphosa CBS 
102226]
Length=739

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 105/275 (38%), Positives = 147/275 (53%), Gaps = 37/275 (13%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  SA    K ++SF+  F           K + +FL  +        +W  
Sbjct  265  FHRFLEQLRHKSADPVAKFLRSFLTEFGKKQWMVHEQVKIIGDFLAFITNKMALCEVWRE  324

Query  321  CseeelesagegleKYVMTKLFSHVF-------------------------------ASH  407
             S+ E ++A EG+EK VM +L+S  F                                 H
Sbjct  325  VSDNEFDNAKEGMEKLVMNRLYSQTFSPAIPPSPPVARSRSRGRRKELEKSQGPGRRGQH  384

Query  408  PEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKLL  584
             EDV+ D+ L +KI  I  +VR E+LDI PV  N   +L LAQ+ELLKI  Y+APRDK++
Sbjct  385  QEDVERDEILAQKIR-IYSWVREEHLDIAPVGPNGERFLRLAQQELLKIKGYRAPRDKVI  443

Query  585  CILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQT  764
            C+LNCCKVI  LL NA  S       AD F+P+LIYV ++ANP  L SN+ YI RFR+Q 
Sbjct  444  CVLNCCKVIFGLLKNAKSSDT----SADSFVPLLIYVVLQANPENLVSNIQYILRFRNQD  499

Query  765  RLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +L  EA Y+ ++L  A  FI ++D   L++ + EF
Sbjct  500  KLGGEAGYYLSSLSGAIQFIESLDRTTLTVSDEEF  534



>ref|XP_007725461.1| hypothetical protein A1O1_06392 [Capronia coronata CBS 617.96]
 gb|EXJ86023.1| hypothetical protein A1O1_06392 [Capronia coronata CBS 617.96]
Length=732

 Score =   154 bits (388),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 104/276 (38%), Positives = 149/276 (54%), Gaps = 38/276 (14%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  SA    K ++SF+  F           K + +FL  +        +W  
Sbjct  265  FHRFLEQLRHKSADPVAKFLRSFLTEFGKKQWMVHEQVKIIGDFLAFITNKMALCDVWRD  324

Query  321  CseeelesagegleKYVMTKLFSHVF--------------------------------AS  404
             SE E ++A EG+EK VM +L+S  F                                  
Sbjct  325  VSENEFDNAKEGMEKLVMNRLYSQTFSPAIPPPPAQPARSRSRGRRRELDKNNLPGRRGQ  384

Query  405  HPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKL  581
            H EDV+ D+ L +KI  I  +VR E+LD++PV  N   +L LAQ+ELLKI  Y+APRDK+
Sbjct  385  HQEDVERDEILAQKIR-IYSWVREEHLDLEPVGPNGERFLKLAQQELLKIKGYRAPRDKV  443

Query  582  LCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQ  761
            +C+LNCCKVI  LL N+  S       AD F+P+LIYV ++ANP  L SN+ YI RFR+Q
Sbjct  444  ICVLNCCKVIFGLLKNSKSSDT----SADAFVPLLIYVVLQANPEHLVSNVQYILRFRNQ  499

Query  762  TRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
             +L  EA Y+ ++L  A  FI N+D  +L++ + +F
Sbjct  500  DKLGGEAGYYLSSLSGAIQFIENLDRTSLTVSDEDF  535



>gb|EPQ64616.1| guanine nucleotide exchange factor [Blumeria graminis f. sp. 
tritici 96224]
Length=771

 Score =   154 bits (389),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/276 (36%), Positives = 151/276 (55%), Gaps = 36/276 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F           K + +FL  +        +
Sbjct  292  PFDFHRFLEQLRHRTADPVAKFLRSFLQEFGKKQWMVHEQVKIISDFLAFITNKMAQCDV  351

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-----------------------------AS  404
            W   S+ E ++A EG+EK VM +L++  F                               
Sbjct  352  WCEVSDAEFDNAREGMEKLVMNRLYTQTFSPAIPPAQPITASKHRRRGPERLMGPGRRGQ  411

Query  405  HPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKL  581
            H EDV+ D+ L +K++ I  +++ E+LDI  V +   S+L LAQ+ELLKI  Y+APRDK+
Sbjct  412  HQEDVERDEILAQKVS-IYGWIKEEHLDIPSVAEGGKSYLKLAQQELLKIKTYRAPRDKI  470

Query  582  LCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQ  761
            +C+LNCCKVI  LL ++   ++     AD F+P+LIYV ++ANP  L SN+ YI RFR+Q
Sbjct  471  ICVLNCCKVIFGLLRHSKFDSS-----ADSFMPLLIYVVLQANPEHLVSNVQYILRFRNQ  525

Query  762  TRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
             +L  EA Y+ ++LL A  FI N+D   L++ + +F
Sbjct  526  EKLAGEAGYYLSSLLGAVHFIENLDRTTLTISDEDF  561



>gb|KDN65593.1| hypothetical protein CSUB01_03125 [Colletotrichum sublineola]
Length=804

 Score =   154 bits (390),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 101/276 (37%), Positives = 149/276 (54%), Gaps = 36/276 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R   A    + +KSF+  F           K + +FL  +        +
Sbjct  332  PFDFHRFLEQLRNKKADPVARYLKSFLSEFGKRQWMVHEQVKIISDFLAFIANKMAQCEV  391

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-----------------------------AS  404
            W   S+ E ++A EG+EK VM +L++  F                               
Sbjct  392  WRDVSDAEFDNAREGMEKLVMNRLYTQTFSPAIPPPQPIPGAKPKRRGGERPMGPGRRGQ  451

Query  405  HPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKL  581
            H EDV+ DD L +KI  I  ++R E+LDI P   + T +L LAQ+ELLKI  Y+APRDK+
Sbjct  452  HQEDVERDDILTQKIN-IYAWIREEHLDIPPAGDSGTRFLKLAQQELLKIKSYRAPRDKI  510

Query  582  LCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQ  761
            +C+LNCCKVI  LL ++   ++     AD F+P+LIYV ++ANP  L SN+ YI RFR+Q
Sbjct  511  ICVLNCCKVIFGLLKHSKSDSS-----ADSFMPLLIYVVLQANPEHLVSNVQYILRFRNQ  565

Query  762  TRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
             +L  EA Y+ ++L+ A  FI N+D   L++ + EF
Sbjct  566  EKLGGEAGYYLSSLMGAIQFIENMDRTTLTITDEEF  601



>emb|CCU75364.1| vacuolar protein sorting-associated protein 9 [Blumeria graminis 
f. sp. hordei DH14]
Length=771

 Score =   154 bits (389),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/276 (36%), Positives = 151/276 (55%), Gaps = 36/276 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F           K + +FL  +        +
Sbjct  292  PFDFHRFLEQLRHRTADPVAKFLRSFLQEFGKKQWMVHEQVKIISDFLAFITNKMAQCDV  351

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-----------------------------AS  404
            W   S+ E ++A EG+EK VM +L++  F                               
Sbjct  352  WCEVSDAEFDNAREGMEKLVMNRLYTQTFSPAIPPAQLITASKHRRRGPERLMGPGRRGQ  411

Query  405  HPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKL  581
            H EDV+ D+ L +K++ I  +++ E+LDI  V +   S+L LAQ+ELLKI  Y+APRDK+
Sbjct  412  HQEDVERDEILAQKVS-IYGWIKEEHLDIPSVAEGGKSYLKLAQQELLKIKTYRAPRDKI  470

Query  582  LCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQ  761
            +C+LNCCKVI  LL ++   ++     AD F+P+LIYV ++ANP  L SN+ YI RFR+Q
Sbjct  471  ICVLNCCKVIFGLLRHSKFDSS-----ADSFMPLLIYVVLQANPEHLVSNVQYILRFRNQ  525

Query  762  TRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
             +L  EA Y+ ++LL A  FI N+D   L++ + +F
Sbjct  526  EKLAGEAGYYLSSLLGAVHFIENLDRTTLTISDEDF  561



>ref|XP_003174431.1| hypothetical protein MGYG_04604 [Microsporum gypseum CBS 118893]
 gb|EFR01601.1| hypothetical protein MGYG_04604 [Microsporum gypseum CBS 118893]
Length=774

 Score =   154 bits (389),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 104/277 (38%), Positives = 150/277 (54%), Gaps = 36/277 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F           K + +FL  +        +
Sbjct  293  PFDFHRFLEQLRHRTADPVAKFLRSFLNEFGKRQWMVHEQVKIISDFLAFITNKMAQCDV  352

Query  312  WAGCseeelesagegleKYVMTKLFSHVF------------------------------A  401
            W G S+ E ++A EG+EK VM +L++  F                               
Sbjct  353  WKGVSDVEFDNAKEGMEKLVMNRLYTQTFSPTIPPPAPSRSRSRGRRKEIERMHNPGRRG  412

Query  402  SHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWLL-AQKELLKINMYKAPRDK  578
             H EDV+ D+ L +K+  I  +VR E+LDI PV  N   +LL AQ+ELLKI  Y+APRDK
Sbjct  413  QHQEDVERDEILAQKV-RIYSWVREEHLDIPPVGPNGRRFLLLAQQELLKIKGYRAPRDK  471

Query  579  LLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRH  758
            ++CILNCCKVI  LL +A  S       AD F+P+LIYV ++ANP  L SN+ YI RFR+
Sbjct  472  VICILNCCKVIFGLLRHAKNSDT----SADSFIPLLIYVVLRANPEHLVSNVQYILRFRN  527

Query  759  QTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            Q +L  EA Y+ ++L  A  FI ++D  +L++ + EF
Sbjct  528  QDKLSGEAGYYLSSLSGAIQFIESLDRTSLTVSDEEF  564



>gb|KIL95104.1| hypothetical protein FAVG1_02036 [Fusarium avenaceum]
Length=782

 Score =   154 bits (389),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 101/278 (36%), Positives = 152/278 (55%), Gaps = 36/278 (13%)
 Frame = +3

Query  126  TAPLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAH  305
            T P  +H FLE++R   A    + +KSF+  F           K + +FL  +       
Sbjct  321  TQPFDFHRFLEQLRNKKADPVARYLKSFLSEFGKRQWMVHEQVKIIGDFLAFIANKMAQC  380

Query  306  SLWAGCseeelesagegleKYVMTKLFSHVF-----------------------------  398
             +W   S+ E ++A EG+EK VM +L++  F                             
Sbjct  381  EVWRDVSDTEFDNAREGMEKLVMNRLYTQTFSPAIQAPKPIPGAKPKRKGGDIPLGPGRR  440

Query  399  ASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRD  575
              H EDV+ DD + +K++ I  +VR E+LDI PV ++   +L LAQ+ELLKI  Y+APRD
Sbjct  441  GQHQEDVERDDIVRQKMS-IYGWVREEHLDIPPVGESGRRFLKLAQQELLKIKSYRAPRD  499

Query  576  KLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR  755
            K++C+LNCCKVI  LL +     N++   AD F+P+LIYV +++NP  L SN+ YI RFR
Sbjct  500  KIICVLNCCKVIFGLLKH-----NKSDSSADSFMPLLIYVVLQSNPEHLVSNVQYILRFR  554

Query  756  HQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +Q +L  EA Y+ ++L+ A  FI N+D   L++ + EF
Sbjct  555  NQEKLGGEAGYYLSSLMGAVQFIENMDRTTLTITDEEF  592



>ref|XP_008711274.1| hypothetical protein HMPREF1541_00747 [Cyphellophora europaea 
CBS 101466]
 gb|ETN46562.1| hypothetical protein HMPREF1541_00747 [Cyphellophora europaea 
CBS 101466]
Length=739

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 105/278 (38%), Positives = 149/278 (54%), Gaps = 37/278 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  SA    K ++SF+  F           K + +FL  +        +
Sbjct  252  PFDFHRFLEQLRHKSADPVAKFLRSFLTEFGKKQWMVHEQVKIISDFLFFITNKMALCEI  311

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-------------------------------  398
            W   SE E ++A EG+EK VM +L++  F                               
Sbjct  312  WRDVSENEFDNAKEGMEKLVMNRLYAQTFSPAIPPPATIPRSRSRGRRKDVEKILGPGRK  371

Query  399  ASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRD  575
              H EDV+ DD L +KI  I  +V+ ++LDI PV  N   +L LAQ+ELLKI  Y+APRD
Sbjct  372  GQHQEDVERDDVLAQKI-RIYSWVKEQHLDIPPVGPNGERFLRLAQQELLKIKSYRAPRD  430

Query  576  KLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR  755
            K++C+LNCCKVI  LL NA  S       AD F+P+LIYV ++ANP  L SN+ YI RFR
Sbjct  431  KVICVLNCCKVIFGLLKNAKSSDT----SADSFVPLLIYVVLQANPENLVSNIQYILRFR  486

Query  756  HQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +Q +L  EA Y+ ++L  A  FI ++D  +L++ + EF
Sbjct  487  NQDKLGGEAGYYLSSLSGAIQFIESLDRTSLTVSDEEF  524



>gb|ETL50097.1| hypothetical protein, variant 2 [Phytophthora parasitica]
Length=542

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 145/264 (55%), Gaps = 21/264 (8%)
 Frame = +3

Query  135  LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPD--PERDSKAVQ--------------  266
            LT+ +FL+R+  P++ D +  I+ F+ S      D  P R +  V+              
Sbjct  267  LTYGEFLQRISLPASRDILDKIRMFVGSILGPRGDGRPPRSTDYVEYDFYGKHEFRRRCI  326

Query  267  EFLGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPED---VKVDDQL  437
             F  +ME     H  W   SE +L  A +G+EKYVM K+    F    E    +  D+ L
Sbjct  327  RFFESMEDILLNHPAWRHVSEAKLAKARDGIEKYVMDKVSDIAFNKLKECQQWMNEDEAL  386

Query  438  YEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINN  617
              ++ L+  F+ PE LDIKP  +NE  W +A+ EL +IN +++P DK+ CI+ CC VI +
Sbjct  387  LRRMQLLS-FITPEMLDIKPCMRNEVVWSMAEDELRRINSFRSPGDKINCIVRCCSVIFS  445

Query  618  LLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFT  797
            +L N S   + + PGADDFLPV IY+ + +  P+L+SN  YI  +R+Q  L+S+A Y F 
Sbjct  446  VL-NLSRGDSGSRPGADDFLPVFIYIVLHSQIPRLYSNCEYISAYRNQADLMSKAGYCFV  504

Query  798  NLLSAESFIMNIDAKALSMDETEF  869
            NL SA  FI  +D   LS+ + EF
Sbjct  505  NLRSAVEFITAMDGSMLSISDDEF  528



>gb|EPS33524.1| hypothetical protein PDE_08486 [Penicillium oxalicum 114-2]
Length=762

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 104/278 (37%), Positives = 147/278 (53%), Gaps = 37/278 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F+          K + +FL  +        +
Sbjct  274  PFDFHRFLEQLRHRTADPVAKFLRSFLTEFAKKQWMAHEQVKIISDFLAFITNKMAMCEV  333

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-------------------------------  398
            W   S+ E ++A EG+EK VM +L+S  F                               
Sbjct  334  WRDVSDAEFDNAKEGMEKLVMNRLYSQTFSPAIPAPPSIPRSVSRSRRREIERLHGPWRR  393

Query  399  ASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRD  575
              H EDV+ DD L +KI  I  +V+ E+LDI PV  +   +L LAQ+ELLKIN Y+APRD
Sbjct  394  GQHQEDVERDDILAQKI-RIYSWVKEEHLDITPVSGSGRRFLTLAQQELLKINGYRAPRD  452

Query  576  KLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFR  755
            K++CILNCCKVI  LL N+          AD F+P+LIYV + ANP  L SN+ YI RFR
Sbjct  453  KVICILNCCKVIFGLLRNSKKGDT----SADSFIPLLIYVVLHANPGNLVSNIQYILRFR  508

Query  756  HQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +Q +L  EA Y+ ++L  A  FI  +D   L++ + EF
Sbjct  509  NQDKLGGEAGYYLSSLSGAIQFIETLDRTTLTVSDEEF  546



>gb|ETI56956.1| hypothetical protein, variant 2 [Phytophthora parasitica P1569]
Length=542

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 145/264 (55%), Gaps = 21/264 (8%)
 Frame = +3

Query  135  LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPD--PERDSKAVQ--------------  266
            LT+ +FL+R+  P++ D +  I+ F+ S      D  P R +  V+              
Sbjct  267  LTYGEFLQRISLPASRDILDKIRMFVGSILGPRGDGRPPRSTDYVEYDFYGKHEFRRRCI  326

Query  267  EFLGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPED---VKVDDQL  437
             F  +ME     H  W   SE +L  A +G+EKYVM K+    F    E    +  D+ L
Sbjct  327  RFFESMEDILLNHPAWRHVSEAKLAKARDGIEKYVMDKVSDIAFNKLKECQQWMNEDEAL  386

Query  438  YEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINN  617
              ++ L+  F+ PE LDIKP  +NE  W +A+ EL +IN +++P DK+ CI+ CC VI +
Sbjct  387  LRRMQLLS-FITPEMLDIKPCMRNEVVWSMAEDELRRINSFRSPGDKINCIVRCCSVIFS  445

Query  618  LLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFT  797
            +L N S   + + PGADDFLPV IY+ + +  P+L+SN  YI  +R+Q  L+S+A Y F 
Sbjct  446  VL-NLSRGDSGSRPGADDFLPVFIYIVLHSQIPRLYSNCEYISAYRNQADLMSKAGYCFV  504

Query  798  NLLSAESFIMNIDAKALSMDETEF  869
            NL SA  FI  +D   LS+ + EF
Sbjct  505  NLRSAVEFITAMDGSMLSISDDEF  528



>gb|KIN01912.1| hypothetical protein OIDMADRAFT_103171 [Oidiodendron maius Zn]
Length=800

 Score =   154 bits (389),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 100/273 (37%), Positives = 150/273 (55%), Gaps = 36/273 (13%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  +A    K ++SF+  F           K + +FL  +        +W  
Sbjct  331  FHRFLEQLRHRTADPVAKFLRSFLQEFGKKQWMVHEQVKIIGDFLLFITNKMAQCEVWRD  390

Query  321  CseeelesagegleKYVMTKLFSHVF-----------------------------ASHPE  413
             S+ E  +A EG+EK VM +L++  F                               H E
Sbjct  391  VSDAEFANAREGMEKLVMNRLYTQTFSPAIPPPQPIPGSKPKRKGGERPLGPGRRGQHQE  450

Query  414  DVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKLLCI  590
            DV+ DD L +K++ I  ++R E+LDI PV  +   +L LAQ+ELLKI  Y+APRDK++C+
Sbjct  451  DVERDDILAQKVS-IYGWIREEHLDIPPVGDSGKRFLVLAQQELLKIKTYRAPRDKIICV  509

Query  591  LNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRL  770
            LNCCKVI  LL ++   ++     AD F+P+LIYV ++ANP  L SN+ YI RFR+Q +L
Sbjct  510  LNCCKVIFGLLKHSKSDSS-----ADSFMPLLIYVVLQANPEHLVSNVQYILRFRNQEKL  564

Query  771  VSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
              EA Y+ ++LL A  FI N+D  +L++ + EF
Sbjct  565  GGEAGYYLSSLLGAVQFIENLDRTSLTISDEEF  597



>ref|XP_003710228.1| vacuolar protein sorting-associated protein 9 [Magnaporthe oryzae 
70-15]
 gb|EHA57616.1| vacuolar protein sorting-associated protein 9 [Magnaporthe oryzae 
70-15]
Length=747

 Score =   153 bits (387),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 99/277 (36%), Positives = 151/277 (55%), Gaps = 37/277 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R   A    + +KSF+  F           K + +FL  +        +
Sbjct  269  PFDFHRFLEQLRNKKADPVARYLKSFLSEFGKRQWMVHEQVKIIGDFLAFIANKMAQCDV  328

Query  312  WAGCseeelesagegleKYVMTKLFSHVF------------------------------A  401
            W   S+ E ++A EG+EK VM +L++  F                               
Sbjct  329  WREVSDAEFDNAREGMEKLVMNRLYTQTFSPAIPPPQPIPGSKPNRKRGGERPMGPGRRG  388

Query  402  SHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDK  578
             H EDV+ D+ L +KI  I  +VR E+LDI P+ ++   +L LAQ+ELLKI+ Y+APRDK
Sbjct  389  QHQEDVERDEILAQKIK-IYGWVREEHLDIPPIAESGRRFLKLAQQELLKISTYRAPRDK  447

Query  579  LLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRH  758
            ++C+LNCCKVI  LL ++   ++     AD F+P+LIYV ++ANP  L SN+ YI RFR+
Sbjct  448  IICVLNCCKVIFGLLKHSKSDSS-----ADSFMPLLIYVVLQANPDHLVSNVQYILRFRN  502

Query  759  QTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            Q +L  EA Y+ ++L+ A  F+ N+D   L++ + EF
Sbjct  503  QEKLGGEAGYYLSSLMGAVQFVENMDRTTLTITDNEF  539



>ref|XP_008890206.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 gb|ETM03155.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETM56422.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETN24108.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 gb|ETO85724.1| hypothetical protein, variant 2 [Phytophthora parasitica P1976]
 gb|ETP26747.1| hypothetical protein, variant 2 [Phytophthora parasitica CJ01A1]
 gb|ETP54732.1| hypothetical protein, variant 2 [Phytophthora parasitica P10297]
Length=542

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 145/264 (55%), Gaps = 21/264 (8%)
 Frame = +3

Query  135  LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPD--PERDSKAVQ--------------  266
            LT+ +FL+R+  P++ D +  I+ F+ S      D  P R +  V+              
Sbjct  267  LTYGEFLQRISLPASRDILDKIRMFVGSILGPRGDGRPPRSTDYVEYDFYGKHEFRRRCI  326

Query  267  EFLGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPED---VKVDDQL  437
             F  +ME     H  W   SE +L  A +G+EKYVM K+    F    E    +  D+ L
Sbjct  327  RFFESMEDILLNHPAWRHVSEAKLAKARDGIEKYVMDKVSDIAFNKLKECQQWMNEDEAL  386

Query  438  YEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINN  617
              ++ L+  F+ PE LDIKP  +NE  W +A+ EL +IN +++P DK+ CI+ CC VI +
Sbjct  387  LRRMQLLS-FITPEMLDIKPCMRNEVVWSMAEDELRRINSFRSPGDKINCIVRCCSVIFS  445

Query  618  LLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFT  797
            +L N S   + + PGADDFLPV IY+ + +  P+L+SN  YI  +R+Q  L+S+A Y F 
Sbjct  446  VL-NLSRGDSGSRPGADDFLPVFIYIVLHSQIPRLYSNCEYISAYRNQADLMSKAGYCFV  504

Query  798  NLLSAESFIMNIDAKALSMDETEF  869
            NL SA  FI  +D   LS+ + EF
Sbjct  505  NLRSAVEFITAMDGSMLSISDDEF  528



>gb|KFY12804.1| hypothetical protein V492_03654 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=812

 Score =   154 bits (389),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 99/276 (36%), Positives = 150/276 (54%), Gaps = 36/276 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F           K + +FL  +        +
Sbjct  331  PFDFHRFLEQLRHRTADPVAKFLRSFLQEFGKKQWMVHEQVKIIGDFLAFITNKMAQCEI  390

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-----------------------------AS  404
            W   S+ E ++A EG+EK VM +L++  F                               
Sbjct  391  WKEVSDAEFDNAREGMEKLVMNRLYTQTFSPAIPPPQPIPGARPRRRNGERPLGPGRRGQ  450

Query  405  HPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKL  581
            H EDV+ DD L +K+  I  +V+ E+LDI PV ++   +L LAQ+ELLKI  Y+APRDK+
Sbjct  451  HQEDVERDDILAQKVG-IYGWVKEEHLDIPPVGESGKRFLILAQQELLKIKTYRAPRDKI  509

Query  582  LCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQ  761
            +C+LNCCKVI  LL ++   ++     AD F+P+LIY  ++ANP  L SN+ YI RFR+Q
Sbjct  510  ICVLNCCKVIFGLLKHSKSDSS-----ADSFMPLLIYTVLQANPEHLVSNVQYILRFRNQ  564

Query  762  TRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
             +L  EA Y+ ++LL A  FI N+D   L++ + +F
Sbjct  565  EKLGGEAGYYLSSLLGAVQFIENLDRTTLTISDEDF  600



>gb|EFA77417.1| vacuolar sorting protein 9 domain-containing protein [Polysphondylium 
pallidum PN500]
Length=542

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 102/285 (36%), Positives = 156/285 (55%), Gaps = 32/285 (11%)
 Frame = +3

Query  93   AMENADVFGSSTAPLTWHD-------FLERMRQPSAADFVKAIKSFIVSFSNNAPDP-ER  248
             MEN  + G     +T  +       F  +++ P A +  K++ +F   F++N P   E 
Sbjct  86   GMENVRI-GGGNGIVTVEESAREKASFFTKLKNPKALEIKKSLNNFTHQFASNGPGKLEE  144

Query  249  DSKAVQEFLGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVF---------A  401
                V  +   +E    ++ LW   ++ E+E   +G+EK++MTK+F   F         A
Sbjct  145  QGHTVVTYSRELENWILSNQLWENANDAEIEGIRDGIEKFIMTKVFHCTFMPARLGGLEA  204

Query  402  SH----PED----VKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKIN  554
            S     PE      + D ++Y K+ L   F+ P +LDI+   Q+  + +  +  EL K+N
Sbjct  205  SDGNIVPEQGLIATEEDLKIY-KLILTLSFITPLHLDIQKFVQSNGALIEKSMIELRKMN  263

Query  555  MYKAPRDKLLCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNL  734
             YK PRDK++CI N CKVI  LL     S N  P GADDFLP+LI+V +KANPP LHSN+
Sbjct  264  TYKTPRDKMICIYNSCKVIFRLLS----SMNNTPSGADDFLPILIFVVLKANPPMLHSNI  319

Query  735  LYIQRFRHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
             YI  FR+ +R+ +E   +FT+L+SA +FI NI    L+++E+EF
Sbjct  320  QYISTFRNPSRMSTETGCYFTHLVSALTFIENIQPSDLTIEESEF  364



>gb|KIW46837.1| hypothetical protein PV06_02469 [Exophiala oligosperma]
Length=748

 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 105/276 (38%), Positives = 147/276 (53%), Gaps = 38/276 (14%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  SA    K ++SF+  F           K + +FL  +        +W  
Sbjct  274  FHRFLEQLRHKSADPVAKFLRSFLTEFGKKQWMVHEQVKIIGDFLAFITNKMAICDVWRE  333

Query  321  CseeelesagegleKYVMTKLFSHVF--------------------------------AS  404
             S+ E E+A EG+EK VM +L+S  F                                  
Sbjct  334  VSDNEFENAKEGMEKLVMNRLYSQTFSPAIPPPPSLPARSRSRGRRKEQEKNLGVGRRGQ  393

Query  405  HPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKL  581
            H EDV+ D+ L +KI  I  ++R E+LD+ PV  N   +L LAQ+ELLKI  Y+APRDK+
Sbjct  394  HQEDVERDEILAQKI-RIYSWIREEHLDLPPVGPNGERFLRLAQQELLKIKGYRAPRDKV  452

Query  582  LCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQ  761
            +CILNCCKVI  LL NA  S       AD F+P+LIYV ++ANP  L SN+ YI RFR+Q
Sbjct  453  ICILNCCKVIFGLLKNAKSSDT----SADSFVPLLIYVVLQANPENLVSNVQYILRFRNQ  508

Query  762  TRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
             +L  EA Y+ ++L  A  FI N+D   L++ + +F
Sbjct  509  DKLGGEAGYYLSSLSGAIQFIENLDRTTLTVSDEDF  544



>gb|KFY37167.1| hypothetical protein V494_04868 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=812

 Score =   154 bits (388),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 99/276 (36%), Positives = 150/276 (54%), Gaps = 36/276 (13%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F           K + +FL  +        +
Sbjct  331  PFDFHRFLEQLRHRTADPVAKFLRSFLQEFGKKQWMVHEQVKIIGDFLAFITNKMAQCEI  390

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-----------------------------AS  404
            W   S+ E ++A EG+EK VM +L++  F                               
Sbjct  391  WKEVSDAEFDNAREGMEKLVMNRLYTQTFSPAIPPPQPIPGARPRRRNGERPLGPGRRGQ  450

Query  405  HPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKL  581
            H EDV+ DD L +K+  I  +V+ E+LDI PV ++   +L LAQ+ELLKI  Y+APRDK+
Sbjct  451  HQEDVERDDILAQKVG-IYGWVKEEHLDIPPVGESGKRFLILAQQELLKIKTYRAPRDKI  509

Query  582  LCILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQ  761
            +C+LNCCKVI  LL ++   ++     AD F+P+LIY  ++ANP  L SN+ YI RFR+Q
Sbjct  510  ICVLNCCKVIFGLLKHSKSDSS-----ADSFMPLLIYTVLQANPEHLVSNVQYILRFRNQ  564

Query  762  TRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
             +L  EA Y+ ++LL A  FI N+D   L++ + +F
Sbjct  565  EKLGGEAGYYLSSLLGAVQFIENLDRTTLTISDEDF  600



>gb|KIV88709.1| hypothetical protein PV10_08367 [Exophiala mesophila]
Length=741

 Score =   153 bits (386),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 103/275 (37%), Positives = 147/275 (53%), Gaps = 37/275 (13%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  SA    K ++SF+  F           K + +FL  +        +W  
Sbjct  273  FHRFLEQLRHKSADPVAKFLRSFLTEFGKKQWMVHEQVKIIGDFLAFITNKMAVCDVWRE  332

Query  321  CseeelesagegleKYVMTKLFSHVF-------------------------------ASH  407
             S+ E ++A EG+EK VM +L+S  F                                 H
Sbjct  333  VSDNEFDNAKEGMEKLVMNRLYSQTFSPAISPPAQPARSRSRGRRKDAEKALLPGRRGQH  392

Query  408  PEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKLL  584
             EDV+ D+ L +KI  I  ++R E+LD+ PV  N   +L LAQ+ELLKI  Y+APRDK++
Sbjct  393  QEDVERDEILSQKI-RIYSWIREEHLDLVPVGSNGERFLRLAQQELLKIKGYRAPRDKVI  451

Query  585  CILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQT  764
            C+LNCCKVI  LL NA  S       AD F+P+LIYV ++ANP  L SN+ YI RFR+Q 
Sbjct  452  CVLNCCKVIFGLLKNAKSSDT----SADSFVPLLIYVVLQANPEHLVSNIQYILRFRNQD  507

Query  765  RLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +L  EA Y+ ++L  A  FI ++D   L++ + EF
Sbjct  508  KLGGEAGYYLSSLSGAIQFIESLDRTTLTVSDDEF  542



>gb|EGE08560.1| guanine nucleotide exchange factor Vps9 [Trichophyton equinum 
CBS 127.97]
Length=778

 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 104/275 (38%), Positives = 149/275 (54%), Gaps = 37/275 (13%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  +A    K ++SF+  F           K + +FL  +        +W G
Sbjct  299  FHRFLEQLRHRTADPVAKFLRSFLNEFGKRQWMVHEQVKIISDFLAFITNKMAQCEVWKG  358

Query  321  CseeelesagegleKYVMTKLFSHVF-------------------------------ASH  407
             S+ E ++A EG+EK VM +L++  F                                 H
Sbjct  359  VSDVEFDNAKEGMEKLVMNRLYTQTFSPTIPPPAAPSRSRSRGRRKEIERMHHPGRRGQH  418

Query  408  PEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSW-LLAQKELLKINMYKAPRDKLL  584
             EDV+ D+ L +K+  I  +VR E+LDI PV  N   + LLAQ+ELLKI  Y+APRDK++
Sbjct  419  QEDVERDEILAQKV-RIYSWVREEHLDIPPVGPNGRRFLLLAQQELLKIKGYRAPRDKVI  477

Query  585  CILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQT  764
            CILNCCKVI  LL +A  S       AD F+P+LIYV +KANP  L SN+ YI RFR+Q 
Sbjct  478  CILNCCKVIFGLLRHAKNSDT----SADSFIPLLIYVVLKANPEHLVSNVQYILRFRNQE  533

Query  765  RLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +L  EA Y+ ++L  A  FI ++D  +L++ + EF
Sbjct  534  KLSGEAGYYLSSLSGAIQFIESLDRTSLTVSDEEF  568



>gb|KIW31945.1| hypothetical protein PV07_03531 [Cladophialophora immunda]
Length=742

 Score =   153 bits (386),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 105/275 (38%), Positives = 147/275 (53%), Gaps = 37/275 (13%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  SA    K ++SF+  F           K + +FL  +        +W  
Sbjct  274  FHRFLEQLRHKSADPVAKFLRSFLTEFGKKQWMVHEQVKIIGDFLAFITNKMALCEVWRE  333

Query  321  CseeelesagegleKYVMTKLFSHVF-------------------------------ASH  407
             S+ E ++A EG+EK VM +L+S  F                                 H
Sbjct  334  VSDNEFDNAKEGMEKLVMNRLYSQTFSPAIPPSPPVARSRSRGRRKELEKSQAPGRRGQH  393

Query  408  PEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKLL  584
             EDV+ D+ L +KI  I  +VR E+LDI PV  N   +L LAQ+ELLKI  Y+APRDK++
Sbjct  394  QEDVERDEILAQKI-RIYSWVREEHLDIAPVGPNGERFLRLAQQELLKIKGYRAPRDKVI  452

Query  585  CILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQT  764
            C+LNCCKVI  LL NA  S       AD F+P+LIYV ++ANP  L SN+ YI RFR+Q 
Sbjct  453  CVLNCCKVIFGLLKNAKSSDT----SADSFVPLLIYVVLQANPENLVSNVQYILRFRNQD  508

Query  765  RLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +L  EA Y+ ++L  A  FI ++D   L++ + EF
Sbjct  509  KLGGEAGYYLSSLSGAIQFIESLDRTTLTVSDEEF  543



>ref|XP_002151505.1| guanine nucleotide exchange factor Vps9, putative [Talaromyces 
marneffei ATCC 18224]
 gb|EEA20505.1| guanine nucleotide exchange factor Vps9, putative [Talaromyces 
marneffei ATCC 18224]
Length=705

 Score =   152 bits (385),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 103/279 (37%), Positives = 150/279 (54%), Gaps = 39/279 (14%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F           K + +FL  +        +
Sbjct  269  PFDFHRFLEQLRHRTADPVAKFLRSFLTEFGKKQWLVHEQVKIISDFLAFITNKMAQCEV  328

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-------------------------------  398
            W   S+ E ++A EG+EK VM +L+S  F                               
Sbjct  329  WRHVSDAEFDNAKEGMEKLVMNRLYSQTFSPAIPPPPPVPQSASRSKRRELERIHGPGRR  388

Query  399  ASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRD  575
              H EDV+ D+ L +KI  I  ++RPE+LDI P+  N   ++ LAQ+EL KI  Y+APRD
Sbjct  389  GQHQEDVERDEILAQKIR-IYSWIRPEHLDIPPLGNNGRRFINLAQQELSKIKGYRAPRD  447

Query  576  KLLCILNCCKVINNLLINASISANENP-PGADDFLPVLIYVTIKANPPQLHSNLLYIQRF  752
            K++CILNCCKVI  LL ++     +NP   AD F+P+LIYV +KANP  L SN+ YI RF
Sbjct  448  KVICILNCCKVIFGLLKHS-----KNPDTSADSFVPILIYVVLKANPEHLVSNVQYILRF  502

Query  753  RHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            R+Q +L  EA Y+ ++L  A  FI  +D  +L++ + EF
Sbjct  503  RNQDKLGGEAGYYLSSLSGAIQFIETLDRTSLTVSDEEF  541



>gb|EGD99859.1| guanine nucleotide exchange factor Vps9 [Trichophyton tonsurans 
CBS 112818]
Length=775

 Score =   153 bits (387),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 104/275 (38%), Positives = 149/275 (54%), Gaps = 37/275 (13%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  +A    K ++SF+  F           K + +FL  +        +W G
Sbjct  296  FHRFLEQLRHRTADPVAKFLRSFLNEFGKRQWMVHEQVKIISDFLAFITNKMAQCEVWKG  355

Query  321  CseeelesagegleKYVMTKLFSHVF-------------------------------ASH  407
             S+ E ++A EG+EK VM +L++  F                                 H
Sbjct  356  VSDVEFDNAKEGMEKLVMNRLYTQTFSPTIPPPAAPSRSRSRGRRKEIERMHHPGRRGQH  415

Query  408  PEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSW-LLAQKELLKINMYKAPRDKLL  584
             EDV+ D+ L +K+  I  +VR E+LDI PV  N   + LLAQ+ELLKI  Y+APRDK++
Sbjct  416  QEDVERDEILAQKV-RIYSWVREEHLDIPPVGPNGRRFLLLAQQELLKIKGYRAPRDKVI  474

Query  585  CILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQT  764
            CILNCCKVI  LL +A  S       AD F+P+LIYV +KANP  L SN+ YI RFR+Q 
Sbjct  475  CILNCCKVIFGLLRHAKNSDT----SADSFIPLLIYVVLKANPEHLVSNVQYILRFRNQE  530

Query  765  RLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +L  EA Y+ ++L  A  FI ++D  +L++ + EF
Sbjct  531  KLSGEAGYYLSSLSGAIQFIESLDRTSLTVSDEEF  565



>gb|EZF27115.1| hypothetical protein H100_00911 [Trichophyton rubrum MR850]
 gb|EZF46210.1| hypothetical protein H102_00903 [Trichophyton rubrum CBS 100081]
 gb|EZF56722.1| hypothetical protein H103_00911 [Trichophyton rubrum CBS 288.86]
 gb|EZF67355.1| hypothetical protein H104_00895 [Trichophyton rubrum CBS 289.86]
 gb|EZF78068.1| hypothetical protein H105_00910 [Trichophyton soudanense CBS 
452.61]
 gb|EZF88645.1| hypothetical protein H110_00912 [Trichophyton rubrum MR1448]
 gb|EZF99448.1| hypothetical protein H113_00912 [Trichophyton rubrum MR1459]
 gb|EZG10674.1| hypothetical protein H106_00708 [Trichophyton rubrum CBS 735.88]
 gb|EZG20994.1| hypothetical protein H107_00961 [Trichophyton rubrum CBS 202.88]
 gb|KDB37911.1| hypothetical protein H112_00912 [Trichophyton rubrum D6]
Length=776

 Score =   153 bits (387),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 104/275 (38%), Positives = 148/275 (54%), Gaps = 37/275 (13%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  +A    K ++SF+  F           K + +FL  +        +W G
Sbjct  297  FHRFLEQLRHRTADPVAKFLRSFLNEFGKRQWMVHEQVKIISDFLAFITNKMAQCEVWKG  356

Query  321  CseeelesagegleKYVMTKLFSHVF-------------------------------ASH  407
             S+ E ++A EG+EK VM +L++  F                                 H
Sbjct  357  VSDVEFDNAKEGMEKLVMNRLYTQTFSPTIPPPAAPSRSRSRGRRKELERMHHPGRRGQH  416

Query  408  PEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSW-LLAQKELLKINMYKAPRDKLL  584
             EDV+ D+ L +K+  I  +VR E+LDI PV  N   + LLAQ+ELLKI  Y+APRDK++
Sbjct  417  QEDVERDEILAQKV-RIYSWVREEHLDIPPVGPNGRRFLLLAQQELLKIKGYRAPRDKVI  475

Query  585  CILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQT  764
            CILNCCKVI  LL +A  S       AD F+P+LIYV +KANP  L SN+ YI RFR+Q 
Sbjct  476  CILNCCKVIFGLLRHAKNSDT----SADSFIPLLIYVVLKANPEHLVSNVQYILRFRNQE  531

Query  765  RLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +L  EA Y+ ++L  A  FI  +D  +L++ + EF
Sbjct  532  KLSGEAGYYLSSLSGAIQFIETLDRTSLTVSDEEF  566



>gb|ETK96743.1| hypothetical protein L915_00612 [Phytophthora parasitica]
Length=667

 Score =   152 bits (384),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 145/264 (55%), Gaps = 21/264 (8%)
 Frame = +3

Query  135  LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPD--PERDSKAVQ--------------  266
            LT+ +FL+R+  P++ D +  I+ F+ S      D  P R +  V+              
Sbjct  392  LTYGEFLQRISLPASRDILDKIRMFVGSILGPRGDGRPPRSTDYVEYDFYGKHEFRRRCI  451

Query  267  EFLGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPED---VKVDDQL  437
             F  +ME     H  W   SE +L  A +G+EKYVM K+    F    E    +  D+ L
Sbjct  452  RFFESMEDILLNHPAWRHVSEAKLAKARDGIEKYVMDKVSDIAFNKLKECQQWMNEDEAL  511

Query  438  YEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINN  617
              ++ L+  F+ PE LDIKP  +NE  W +A+ EL +IN +++P DK+ CI+ CC VI +
Sbjct  512  LRRMQLLS-FITPEMLDIKPCMRNEVVWSMAEDELRRINSFRSPGDKINCIVRCCSVIFS  570

Query  618  LLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFT  797
            +L N S   + + PGADDFLPV IY+ + +  P+L+SN  YI  +R+Q  L+S+A Y F 
Sbjct  571  VL-NLSRGDSGSRPGADDFLPVFIYIVLHSQIPRLYSNCEYISAYRNQADLMSKAGYCFV  629

Query  798  NLLSAESFIMNIDAKALSMDETEF  869
            NL SA  FI  +D   LS+ + EF
Sbjct  630  NLRSAVEFITAMDGSMLSISDDEF  653



>ref|XP_003349944.1| hypothetical protein SMAC_00836 [Sordaria macrospora k-hell]
 emb|CCC06806.1| unnamed protein product [Sordaria macrospora k-hell]
Length=755

 Score =   153 bits (386),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 100/273 (37%), Positives = 148/273 (54%), Gaps = 36/273 (13%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H F+E++R   A    + +KSF+  F           K + +FL  +        LW  
Sbjct  294  FHRFVEQLRNKKADPVARYLKSFLFEFGKRQWMVHEQVKIISDFLAFISNKMAQCELWRS  353

Query  321  CseeelesagegleKYVMTKLFSHVF-----------------------------ASHPE  413
             S+ E ++A EG+EK VM +L++  F                               H E
Sbjct  354  VSDAEFDNAREGMEKLVMNRLYTQTFSPAIPPPQPIPGAKNKGRRGERPMGPGRRGQHQE  413

Query  414  DVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRDKLLCI  590
            DV+ D+ L +KI  I  +VR E+LDI PV ++   +L LAQ+ELLKI  Y+APRDK++C+
Sbjct  414  DVERDEVLSQKIN-IYHWVREEHLDIPPVSESGKRFLKLAQQELLKIKSYRAPRDKIICV  472

Query  591  LNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRL  770
            LNCCKVI  LL ++    +     AD F+P+LIYV ++ANP  L SN+ YI RFR+Q +L
Sbjct  473  LNCCKVIFGLLKHSKSDGS-----ADSFMPMLIYVVLQANPEHLVSNVQYILRFRNQDKL  527

Query  771  VSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
              EA Y+ ++L+ A  FI N+D   L++ + EF
Sbjct  528  GGEAGYYLSSLMGAIQFIENMDRTTLTITDEEF  560



>gb|ETK96744.1| hypothetical protein, variant 1 [Phytophthora parasitica]
Length=662

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 145/264 (55%), Gaps = 21/264 (8%)
 Frame = +3

Query  135  LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPD--PERDSKAVQ--------------  266
            LT+ +FL+R+  P++ D +  I+ F+ S      D  P R +  V+              
Sbjct  387  LTYGEFLQRISLPASRDILDKIRMFVGSILGPRGDGRPPRSTDYVEYDFYGKHEFRRRCI  446

Query  267  EFLGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPED---VKVDDQL  437
             F  +ME     H  W   SE +L  A +G+EKYVM K+    F    E    +  D+ L
Sbjct  447  RFFESMEDILLNHPAWRHVSEAKLAKARDGIEKYVMDKVSDIAFNKLKECQQWMNEDEAL  506

Query  438  YEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINN  617
              ++ L+  F+ PE LDIKP  +NE  W +A+ EL +IN +++P DK+ CI+ CC VI +
Sbjct  507  LRRMQLLS-FITPEMLDIKPCMRNEVVWSMAEDELRRINSFRSPGDKINCIVRCCSVIFS  565

Query  618  LLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFT  797
            +L N S   + + PGADDFLPV IY+ + +  P+L+SN  YI  +R+Q  L+S+A Y F 
Sbjct  566  VL-NLSRGDSGSRPGADDFLPVFIYIVLHSQIPRLYSNCEYISAYRNQADLMSKAGYCFV  624

Query  798  NLLSAESFIMNIDAKALSMDETEF  869
            NL SA  FI  +D   LS+ + EF
Sbjct  625  NLRSAVEFITAMDGSMLSISDDEF  648



>gb|KDB21467.1| hypothetical protein H109_06635 [Trichophyton interdigitale MR816]
Length=775

 Score =   153 bits (386),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 104/275 (38%), Positives = 149/275 (54%), Gaps = 37/275 (13%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  +A    K ++SF+  F           K + +FL  +        +W G
Sbjct  296  FHRFLEQLRHRTADPVAKFLRSFLNEFGKRQWMVHEQVKIISDFLAFITNKMAQCEVWKG  355

Query  321  CseeelesagegleKYVMTKLFSHVF-------------------------------ASH  407
             S+ E ++A EG+EK VM +L++  F                                 H
Sbjct  356  VSDVEFDNAKEGMEKLVMNRLYTQTFSPTIPAPAAPSRSRSRGRRKEIERMHHPGRRGQH  415

Query  408  PEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSW-LLAQKELLKINMYKAPRDKLL  584
             EDV+ D+ L +K+  I  +VR E+LDI PV  N   + LLAQ+ELLKI  Y+APRDK++
Sbjct  416  QEDVERDEILAQKV-RIYSWVREEHLDIPPVGPNGRRFLLLAQQELLKIKGYRAPRDKVI  474

Query  585  CILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQT  764
            CILNCCKVI  LL +A  S       AD F+P+LIYV +KANP  L SN+ YI RFR+Q 
Sbjct  475  CILNCCKVIFGLLRHAKNSDT----SADSFIPLLIYVVLKANPEHLVSNVQYILRFRNQE  530

Query  765  RLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +L  EA Y+ ++L  A  FI ++D  +L++ + EF
Sbjct  531  KLSGEAGYYLSSLSGAIQFIESLDRTSLTVSDEEF  565



>ref|XP_003231721.1| guanine nucleotide exchange factor Vps9 [Trichophyton rubrum 
CBS 118892]
Length=755

 Score =   153 bits (386),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 104/275 (38%), Positives = 148/275 (54%), Gaps = 37/275 (13%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  +A    K ++SF+  F           K + +FL  +        +W G
Sbjct  276  FHRFLEQLRHRTADPVAKFLRSFLNEFGKRQWMVHEQVKIISDFLAFITNKMAQCEVWKG  335

Query  321  CseeelesagegleKYVMTKLFSHVF-------------------------------ASH  407
             S+ E ++A EG+EK VM +L++  F                                 H
Sbjct  336  VSDVEFDNAKEGMEKLVMNRLYTQTFSPTIPPPAAPSRSRSRGRRKELERMHHPGRRGQH  395

Query  408  PEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSW-LLAQKELLKINMYKAPRDKLL  584
             EDV+ D+ L +K+  I  +VR E+LDI PV  N   + LLAQ+ELLKI  Y+APRDK++
Sbjct  396  QEDVERDEILAQKV-RIYSWVREEHLDIPPVGPNGRRFLLLAQQELLKIKGYRAPRDKVI  454

Query  585  CILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQT  764
            CILNCCKVI  LL +A  S       AD F+P+LIYV +KANP  L SN+ YI RFR+Q 
Sbjct  455  CILNCCKVIFGLLRHAKNSDT----SADSFIPLLIYVVLKANPEHLVSNVQYILRFRNQE  510

Query  765  RLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +L  EA Y+ ++L  A  FI  +D  +L++ + EF
Sbjct  511  KLSGEAGYYLSSLSGAIQFIETLDRTSLTVSDEEF  545



>gb|EPX74057.1| guanyl-nucleotide exchange factor Vps901 [Schizosaccharomyces 
octosporus yFS286]
Length=564

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 142/255 (56%), Gaps = 18/255 (7%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R   A    K +KSF+  F           K +Q+FL  +      +  W  
Sbjct  112  FHRFLEQLRSSPAEPVAKYLKSFLSEFMKRRWSVSYQVKLIQDFLAFIGEKIEQYEPWVS  171

Query  321  CseeelesagegleKYVMTKLFSHVFA------------SHPEDVKVDDQLYEKIALIQQ  464
             S+ E+++A EG+EK V  +L+S +F+             H +DV+ D  LY+K+ L Q 
Sbjct  172  GSQAEIDNAKEGMEKLVSNRLYSRLFSPEIAKEGMPLSSEHSDDVEEDHILYQKMELFQ-  230

Query  465  FVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINNLLINASISA  644
            +VR E+LDIK    +   + LA  EL +IN Y APRDK++C++NCCKVI + L N     
Sbjct  231  WVREEHLDIKRAKSSSKFFRLAADELRRINDYHAPRDKIICLMNCCKVIYSYLRNVV---  287

Query  645  NENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFTNLLSAESFI  824
                  AD F+PVLI+V +KA+P  L SN+ YIQRFR   +L  E  Y+ + L+ A SFI
Sbjct  288  --KEESADAFVPVLIFVLLKAHPKHLVSNIQYIQRFRSPEKLSGEVLYYLSTLMGAMSFI  345

Query  825  MNIDAKALSMDETEF  869
              +D  +L++ E EF
Sbjct  346  QALDTNSLTISEEEF  360



>gb|EZF29427.1| hypothetical protein H101_06898 [Trichophyton interdigitale H6]
Length=775

 Score =   153 bits (386),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 104/275 (38%), Positives = 149/275 (54%), Gaps = 37/275 (13%)
 Frame = +3

Query  141  WHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSLWAG  320
            +H FLE++R  +A    K ++SF+  F           K + +FL  +        +W G
Sbjct  296  FHRFLEQLRHRTADPVAKFLRSFLNEFGKRQWMVHEQVKIISDFLAFITNKMAQCEVWKG  355

Query  321  CseeelesagegleKYVMTKLFSHVF-------------------------------ASH  407
             S+ E ++A EG+EK VM +L++  F                                 H
Sbjct  356  VSDVEFDNAKEGMEKLVMNRLYTQTFSPTIPAPAAPSRSRSRGRRKEIERMHHPGRRGQH  415

Query  408  PEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSW-LLAQKELLKINMYKAPRDKLL  584
             EDV+ D+ L +K+  I  +VR E+LDI PV  N   + LLAQ+ELLKI  Y+APRDK++
Sbjct  416  QEDVERDEILAQKV-RIYSWVREEHLDIPPVGPNGRRFLLLAQQELLKIKGYRAPRDKVI  474

Query  585  CILNCCKVINNLLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQT  764
            CILNCCKVI  LL +A  S       AD F+P+LIYV +KANP  L SN+ YI RFR+Q 
Sbjct  475  CILNCCKVIFGLLRHAKNSDT----SADSFIPLLIYVVLKANPEHLVSNVQYILRFRNQE  530

Query  765  RLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            +L  EA Y+ ++L  A  FI ++D  +L++ + EF
Sbjct  531  KLSGEAGYYLSSLSGAIQFIESLDRTSLTVSDEEF  565



>ref|XP_002151507.1| guanine nucleotide exchange factor Vps9, putative [Talaromyces 
marneffei ATCC 18224]
 gb|EEA20507.1| guanine nucleotide exchange factor Vps9, putative [Talaromyces 
marneffei ATCC 18224]
Length=676

 Score =   152 bits (384),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 103/279 (37%), Positives = 150/279 (54%), Gaps = 39/279 (14%)
 Frame = +3

Query  132  PLTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPDPERDSKAVQEFLGNMEAAFRAHSL  311
            P  +H FLE++R  +A    K ++SF+  F           K + +FL  +        +
Sbjct  269  PFDFHRFLEQLRHRTADPVAKFLRSFLTEFGKKQWLVHEQVKIISDFLAFITNKMAQCEV  328

Query  312  WAGCseeelesagegleKYVMTKLFSHVF-------------------------------  398
            W   S+ E ++A EG+EK VM +L+S  F                               
Sbjct  329  WRHVSDAEFDNAKEGMEKLVMNRLYSQTFSPAIPPPPPVPQSASRSKRRELERIHGPGRR  388

Query  399  ASHPEDVKVDDQLYEKIALIQQFVRPENLDIKPVFQNETSWL-LAQKELLKINMYKAPRD  575
              H EDV+ D+ L +KI  I  ++RPE+LDI P+  N   ++ LAQ+EL KI  Y+APRD
Sbjct  389  GQHQEDVERDEILAQKIR-IYSWIRPEHLDIPPLGNNGRRFINLAQQELSKIKGYRAPRD  447

Query  576  KLLCILNCCKVINNLLINASISANENP-PGADDFLPVLIYVTIKANPPQLHSNLLYIQRF  752
            K++CILNCCKVI  LL ++     +NP   AD F+P+LIYV +KANP  L SN+ YI RF
Sbjct  448  KVICILNCCKVIFGLLKHS-----KNPDTSADSFVPILIYVVLKANPEHLVSNVQYILRF  502

Query  753  RHQTRLVSEAAYFFTNLLSAESFIMNIDAKALSMDETEF  869
            R+Q +L  EA Y+ ++L  A  FI  +D  +L++ + EF
Sbjct  503  RNQDKLGGEAGYYLSSLSGAIQFIETLDRTSLTVSDEEF  541



>gb|ETI56954.1| hypothetical protein F443_00670 [Phytophthora parasitica P1569]
Length=667

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 145/264 (55%), Gaps = 21/264 (8%)
 Frame = +3

Query  135  LTWHDFLERMRQPSAADFVKAIKSFIVSFSNNAPD--PERDSKAVQ--------------  266
            LT+ +FL+R+  P++ D +  I+ F+ S      D  P R +  V+              
Sbjct  392  LTYGEFLQRISLPASRDILDKIRMFVGSILGPRGDGRPPRSTDYVEYDFYGKHEFRRRCI  451

Query  267  EFLGNMEAAFRAHSLWAGCseeelesagegleKYVMTKLFSHVFASHPED---VKVDDQL  437
             F  +ME     H  W   SE +L  A +G+EKYVM K+    F    E    +  D+ L
Sbjct  452  RFFESMEDILLNHPAWRHVSEAKLAKARDGIEKYVMDKVSDIAFNKLKECQQWMNEDEAL  511

Query  438  YEKIALIQQFVRPENLDIKPVFQNETSWLLAQKELLKINMYKAPRDKLLCILNCCKVINN  617
              ++ L+  F+ PE LDIKP  +NE  W +A+ EL +IN +++P DK+ CI+ CC VI +
Sbjct  512  LRRMQLLS-FITPEMLDIKPCMRNEVVWSMAEDELRRINSFRSPGDKINCIVRCCSVIFS  570

Query  618  LLINASISANENPPGADDFLPVLIYVTIKANPPQLHSNLLYIQRFRHQTRLVSEAAYFFT  797
            +L N S   + + PGADDFLPV IY+ + +  P+L+SN  YI  +R+Q  L+S+A Y F 
Sbjct  571  VL-NLSRGDSGSRPGADDFLPVFIYIVLHSQIPRLYSNCEYISAYRNQADLMSKAGYCFV  629

Query  798  NLLSAESFIMNIDAKALSMDETEF  869
            NL SA  FI  +D   LS+ + EF
Sbjct  630  NLRSAVEFITAMDGSMLSISDDEF  653



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1949878542686