BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10874

Length=821
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006364246.1|  PREDICTED: uncharacterized protein LOC102582944    197   5e-57   Solanum tuberosum [potatoes]
ref|XP_009770926.1|  PREDICTED: uncharacterized protein LOC104221...    197   8e-56   Nicotiana sylvestris
ref|XP_004250862.1|  PREDICTED: uncharacterized protein LOC101266789    192   1e-55   Solanum lycopersicum
ref|XP_009770927.1|  PREDICTED: uncharacterized protein LOC104221...    196   2e-55   Nicotiana sylvestris
ref|XP_009601278.1|  PREDICTED: uncharacterized protein LOC104096598    195   3e-55   Nicotiana tomentosiformis
ref|XP_011090390.1|  PREDICTED: uncharacterized protein LOC105171076    181   1e-51   Sesamum indicum [beniseed]
gb|EYU18021.1|  hypothetical protein MIMGU_mgv1a006895mg                173   2e-48   Erythranthe guttata [common monkey flower]
emb|CDP17402.1|  unnamed protein product                                168   2e-47   Coffea canephora [robusta coffee]
ref|XP_010091981.1|  hypothetical protein L484_007965                   171   1e-46   Morus notabilis
ref|XP_007014946.1|  Golgin subfamily A member 4, putative              160   5e-43   
ref|XP_008219321.1|  PREDICTED: uncharacterized protein LOC103319544    152   2e-42   Prunus mume [ume]
ref|XP_006446030.1|  hypothetical protein CICLE_v10014934mg             162   2e-42   Citrus clementina [clementine]
ref|XP_010044999.1|  PREDICTED: uncharacterized protein LOC104433823    151   3e-42   Eucalyptus grandis [rose gum]
emb|CBI16417.3|  unnamed protein product                                160   5e-42   Vitis vinifera
ref|XP_006446029.1|  hypothetical protein CICLE_v10014934mg             161   7e-42   Citrus clementina [clementine]
ref|XP_010651263.1|  PREDICTED: uncharacterized protein LOC100248...    159   1e-41   Vitis vinifera
ref|XP_007205040.1|  hypothetical protein PRUPE_ppa004532mg             149   2e-41   Prunus persica
ref|XP_002513456.1|  conserved hypothetical protein                     155   3e-41   Ricinus communis
gb|KDO64855.1|  hypothetical protein CISIN_1g010127mg                   158   5e-41   Citrus sinensis [apfelsine]
ref|XP_006493661.1|  PREDICTED: uncharacterized protein LOC102624964    157   1e-40   Citrus sinensis [apfelsine]
gb|EYU46295.1|  hypothetical protein MIMGU_mgv1a007217mg                149   2e-40   Erythranthe guttata [common monkey flower]
ref|XP_008449739.1|  PREDICTED: uncharacterized protein LOC103491531    150   2e-40   Cucumis melo [Oriental melon]
ref|XP_010943589.1|  PREDICTED: uncharacterized protein LOC105061278    151   2e-38   Elaeis guineensis
ref|XP_008804461.1|  PREDICTED: uncharacterized protein LOC103717745    149   6e-38   
ref|XP_012092771.1|  PREDICTED: uncharacterized protein LOC105650470    145   9e-38   Jatropha curcas
ref|XP_010265792.1|  PREDICTED: uncharacterized protein LOC104603457    148   2e-37   Nelumbo nucifera [Indian lotus]
ref|XP_011653583.1|  PREDICTED: uncharacterized protein LOC101212...    139   3e-37   Cucumis sativus [cucumbers]
ref|XP_010527661.1|  PREDICTED: uncharacterized protein LOC104804...    147   5e-37   Tarenaya hassleriana [spider flower]
ref|XP_010257369.1|  PREDICTED: uncharacterized protein LOC104597490    146   6e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010492029.1|  PREDICTED: uncharacterized protein LOC104769...    146   7e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010492028.1|  PREDICTED: uncharacterized protein LOC104769...    146   8e-37   Camelina sativa [gold-of-pleasure]
ref|XP_008352427.1|  PREDICTED: uncharacterized protein LOC103415920    131   2e-36   
ref|XP_009419177.1|  PREDICTED: uncharacterized protein LOC103999225    140   3e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011042063.1|  PREDICTED: uncharacterized protein LOC105137...    139   3e-36   Populus euphratica
ref|XP_011042064.1|  PREDICTED: uncharacterized protein LOC105137...    139   4e-36   Populus euphratica
ref|XP_010453345.1|  PREDICTED: uncharacterized protein LOC104735281    144   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_011653584.1|  PREDICTED: uncharacterized protein LOC101212...    135   6e-36   Cucumis sativus [cucumbers]
emb|CAN80883.1|  hypothetical protein VITISV_018652                     143   1e-35   Vitis vinifera
ref|XP_008465843.1|  PREDICTED: uncharacterized protein LOC103503437    137   2e-35   Cucumis melo [Oriental melon]
ref|XP_002304759.1|  hypothetical protein POPTR_0003s22270g             135   3e-35   
ref|XP_009376465.1|  PREDICTED: uncharacterized protein LOC103965173    128   3e-35   Pyrus x bretschneideri [bai li]
ref|XP_004486942.1|  PREDICTED: uncharacterized serine-rich prote...    142   3e-35   Cicer arietinum [garbanzo]
gb|KHG04253.1|  Inactive rhomboid 1                                     131   6e-35   Gossypium arboreum [tree cotton]
ref|XP_010419852.1|  PREDICTED: uncharacterized protein LOC104705532    140   7e-35   Camelina sativa [gold-of-pleasure]
ref|NP_196797.1|  uncharacterized protein                               140   1e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KEH39471.1|  hypothetical protein MTR_2g098330                       127   5e-34   Medicago truncatula
gb|KJB83505.1|  hypothetical protein B456_013G250600                    128   9e-34   Gossypium raimondii
gb|AES67714.2|  hypothetical protein MTR_2g098330                       127   9e-34   Medicago truncatula
ref|XP_002873588.1|  hypothetical protein ARALYDRAFT_909241             137   1e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_010519735.1|  PREDICTED: uncharacterized protein LOC104799094    133   1e-33   Tarenaya hassleriana [spider flower]
ref|XP_006399779.1|  hypothetical protein EUTSA_v10013519mg             136   1e-33   Eutrema salsugineum [saltwater cress]
ref|XP_011037865.1|  PREDICTED: uncharacterized protein LOC105134...    129   4e-33   Populus euphratica
ref|XP_010673592.1|  PREDICTED: uncharacterized protein LOC104889947    127   4e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011461896.1|  PREDICTED: uncharacterized protein LOC101298111    124   4e-33   Fragaria vesca subsp. vesca
ref|XP_006287723.1|  hypothetical protein CARUB_v10000933mg             135   5e-33   
ref|XP_006287724.1|  hypothetical protein CARUB_v10000933mg             135   7e-33   Capsella rubella
ref|XP_002297789.2|  hypothetical protein POPTR_0001s05490g             126   3e-32   
ref|XP_004486940.1|  PREDICTED: uncharacterized serine-rich prote...    132   8e-32   
ref|XP_004486941.1|  PREDICTED: uncharacterized serine-rich prote...    131   2e-31   
ref|XP_003597463.1|  hypothetical protein MTR_2g098330                  127   2e-31   
gb|KJB83504.1|  hypothetical protein B456_013G250600                    128   3e-31   Gossypium raimondii
ref|XP_009379490.1|  PREDICTED: uncharacterized protein LOC103967884    120   9e-31   
ref|XP_007150392.1|  hypothetical protein PHAVU_005G149400g             116   1e-30   Phaseolus vulgaris [French bean]
ref|XP_002304758.2|  hypothetical protein POPTR_0003s22260g             126   1e-30   
gb|KFK25530.1|  hypothetical protein AALP_AA8G127100                    129   2e-30   Arabis alpina [alpine rockcress]
ref|XP_006595048.1|  PREDICTED: uncharacterized protein LOC100803132    115   3e-30   Glycine max [soybeans]
ref|XP_010913932.1|  PREDICTED: uncharacterized protein LOC105039471    123   2e-28   Elaeis guineensis
ref|XP_003546996.1|  PREDICTED: uncharacterized protein LOC100814573    122   2e-28   Glycine max [soybeans]
ref|XP_011042182.1|  PREDICTED: uncharacterized protein LOC105137928    120   9e-28   Populus euphratica
ref|XP_008787278.1|  PREDICTED: uncharacterized protein LOC103705...    119   4e-27   Phoenix dactylifera
ref|XP_009131302.1|  PREDICTED: uncharacterized protein LOC103855986    108   2e-23   Brassica rapa
ref|XP_003578326.1|  PREDICTED: uncharacterized protein LOC100823716    107   3e-23   Brachypodium distachyon [annual false brome]
tpg|DAA40394.1|  TPA: hypothetical protein ZEAMMB73_682569            98.6    1e-20   
ref|NP_001183063.1|  hypothetical protein                             99.8    2e-20   Zea mays [maize]
emb|CDX78495.1|  BnaA03g04070D                                        97.4    6e-20   
gb|EAZ09565.1|  hypothetical protein OsI_31844                        95.1    8e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_001175908.1|  Os09g0488600                                     94.7    1e-18   
emb|CDX70483.1|  BnaC03g05670D                                        90.9    3e-18   
ref|XP_002460453.1|  hypothetical protein SORBIDRAFT_02g028340        89.7    6e-17   Sorghum bicolor [broomcorn]
emb|CDX91156.1|  BnaC02g04410D                                        87.0    6e-17   
ref|XP_004957186.1|  PREDICTED: uncharacterized protein LOC101762101  87.8    3e-16   Setaria italica
emb|CDX85682.1|  BnaA02g01310D                                        83.6    1e-15   
ref|XP_009125870.1|  PREDICTED: uncharacterized protein LOC103850833  83.6    1e-15   Brassica rapa
gb|ERN03580.1|  hypothetical protein AMTR_s00042p00126370             79.0    3e-13   Amborella trichopoda
ref|XP_011622427.1|  PREDICTED: uncharacterized protein LOC18431724   79.0    3e-13   Amborella trichopoda
gb|KHN33331.1|  hypothetical protein glysoja_005373                   76.6    1e-12   Glycine soja [wild soybean]
gb|EEE69948.1|  hypothetical protein OsJ_29828                        75.1    5e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001780022.1|  predicted protein                                69.7    5e-10   
ref|XP_001778551.1|  predicted protein                                68.2    2e-09   
ref|XP_008366179.1|  PREDICTED: uncharacterized protein LOC103429...  46.6    3e-09   
ref|XP_001753723.1|  predicted protein                                67.4    3e-09   
ref|XP_008366178.1|  PREDICTED: uncharacterized protein LOC103429...  46.6    6e-08   
ref|XP_001775595.1|  predicted protein                                59.7    1e-06   
ref|XP_001769979.1|  predicted protein                                58.9    2e-06   
ref|XP_004486943.1|  PREDICTED: uncharacterized serine-rich prote...  57.4    5e-06   Cicer arietinum [garbanzo]



>ref|XP_006364246.1| PREDICTED: uncharacterized protein LOC102582944 [Solanum tuberosum]
Length=440

 Score =   197 bits (502),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 142/180 (79%), Gaps = 8/180 (4%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVSLSPFT + SP+PRRLSSC++QPSQP++AKRQLAWVSLQGRL+GAEEASS+R IGGGL
Sbjct  24   LVSLSPFTSSVSPSPRRLSSCYSQPSQPIKAKRQLAWVSLQGRLIGAEEASSARKIGGGL  83

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            +P+EAVAW+LF+P+ R+L+VAV   A +AANSKKNK I  L+KSV+LRDQVLL MQQKLD
Sbjct  84   NPKEAVAWELFSPIHRILIVAV--VAVAAANSKKNKQICRLKKSVELRDQVLLGMQQKLD  141

Query  528  NLCEQVNSFNDQLEPASN--NCWLCEQHKHLPKLFPMTDSGRKMSMGEEVIKSEVLIPAN  701
             LCEQVN F DQ E A++  + +LCEQH +    F      R M  GEE++K E+   AN
Sbjct  142  TLCEQVNYFKDQPETAADTYDYFLCEQHLNQSNNF----YERNMIKGEEMLKFEMPPAAN  197


 Score = 52.0 bits (123),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  706  TEPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
             EPEERRMSDLSD A  V SSVDIQ+NT  + QD Y L
Sbjct  199  AEPEERRMSDLSDWAASVTSSVDIQLNTSAIEQDFYNL  236



>ref|XP_009770926.1| PREDICTED: uncharacterized protein LOC104221561 isoform X1 [Nicotiana 
sylvestris]
Length=441

 Score =   197 bits (500),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 132/175 (75%), Gaps = 8/175 (5%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVSLSPFTP+  P+PRRLSSC++QPSQP++AKRQLAWVSLQGRLVGAEE+SS++ IGGGL
Sbjct  23   LVSLSPFTPSVPPSPRRLSSCYSQPSQPIKAKRQLAWVSLQGRLVGAEESSSAKKIGGGL  82

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            + +EAV W+LF+P+ R+L+VAV+  AA+ +   K   I  L+KSV+LRDQVLL MQQKLD
Sbjct  83   NHKEAVVWELFSPIHRILIVAVVAVAAANSKKNKE--ILRLKKSVELRDQVLLGMQQKLD  140

Query  528  NLCEQVNSFNDQLEPA--SNNCWLCEQHKHLPKLFPMTDSGRKMSMGEEVIKSEV  686
             LCEQVN F DQ E A  +N C+LCEQH +    F      + M  GEEV K E 
Sbjct  141  TLCEQVNYFKDQPETAADTNGCFLCEQHMNQSNNF----YEKNMMKGEEVFKYET  191



>ref|XP_004250862.1| PREDICTED: uncharacterized protein LOC101266789 [Solanum lycopersicum]
Length=440

 Score =   192 bits (489),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 142/180 (79%), Gaps = 8/180 (4%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVSLSPFT + SP+PRRLSSC++QPSQP++AKR+LAWVSLQGRL+GAEEASSSR IGGGL
Sbjct  24   LVSLSPFTSSVSPSPRRLSSCYSQPSQPIKAKRELAWVSLQGRLIGAEEASSSRKIGGGL  83

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            +P+EAVAW+LF+P+ R+L+VAV   A +AANSKKNK I  L+KSV+LRDQVLL MQQKLD
Sbjct  84   NPKEAVAWELFSPIHRILIVAV--VAIAAANSKKNKQICRLKKSVELRDQVLLGMQQKLD  141

Query  528  NLCEQVNSFNDQLEPASN--NCWLCEQHKHLPKLFPMTDSGRKMSMGEEVIKSEVLIPAN  701
             LCEQVN F DQ E A++  + +LCEQH +    F      R M  GEE++K E+   AN
Sbjct  142  TLCEQVNYFKDQPETAADAYDYFLCEQHFNQSNNF----FERDMIKGEEILKFEMPPAAN  197


 Score = 52.0 bits (123),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            EPEERRMSDLSD A  VASSVDIQ+N+  + QD Y L
Sbjct  200  EPEERRMSDLSDWATSVASSVDIQLNSSAIEQDFYNL  236



>ref|XP_009770927.1| PREDICTED: uncharacterized protein LOC104221561 isoform X2 [Nicotiana 
sylvestris]
Length=440

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 131/175 (75%), Gaps = 9/175 (5%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVSLSPFTP+  P+PRRLSSC++QPSQP++AKRQLAWVSLQGRLVGAEE+SS++ IGGGL
Sbjct  23   LVSLSPFTPSVPPSPRRLSSCYSQPSQPIKAKRQLAWVSLQGRLVGAEESSSAKKIGGGL  82

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            + +EAV W+LF+P+ R+L+VAV+  AA+ +   K   I  L+KSV+LRDQVLL MQQKLD
Sbjct  83   NHKEAVVWELFSPIHRILIVAVVAVAAANSKKNKE--ILRLKKSVELRDQVLLGMQQKLD  140

Query  528  NLCEQVNSFNDQLEPA--SNNCWLCEQHKHLPKLFPMTDSGRKMSMGEEVIKSEV  686
             LCEQVN F DQ E A  +N C+LCEQH +    F        M  GEEV K E 
Sbjct  141  TLCEQVNYFKDQPETAADTNGCFLCEQHMNQSNNF-----YENMMKGEEVFKYET  190



>ref|XP_009601278.1| PREDICTED: uncharacterized protein LOC104096598 [Nicotiana tomentosiformis]
Length=440

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 133/180 (74%), Gaps = 8/180 (4%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVSLSPFTP+  P+PRRLSSC++QP+QP++ KRQLAWVSLQGRLVGAEEASS++ IGGGL
Sbjct  23   LVSLSPFTPSVPPSPRRLSSCYSQPNQPIKVKRQLAWVSLQGRLVGAEEASSAKKIGGGL  82

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            +P+EAV W+LF+P+ R+L+VAV+  AA+ +   K   I  L+KSV+LRDQVLL MQQKLD
Sbjct  83   NPKEAVVWELFSPIHRILIVAVVSVAAANSKKNKE--ILRLKKSVELRDQVLLGMQQKLD  140

Query  528  NLCEQVNSFNDQLEPA--SNNCWLCEQHKHLPKLFPMTDSGRKMSMGEEVIKSEVLIPAN  701
             LCEQVN F DQ E A  +N C+LC+QH +    F      R M  G EV K E    AN
Sbjct  141  TLCEQVNYFKDQPEIAADTNGCFLCDQHMNQSNNF----YERNMMKGVEVFKYETPPAAN  196



>ref|XP_011090390.1| PREDICTED: uncharacterized protein LOC105171076 [Sesamum indicum]
Length=439

 Score =   181 bits (459),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 134/183 (73%), Gaps = 16/183 (9%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIG--G  341
            LVSL+PFTP+ SP+PRRLSSCFT PS+PVRAKRQLAWVSLQGRLVGAEEA+S++ IG  G
Sbjct  16   LVSLTPFTPSVSPSPRRLSSCFTHPSKPVRAKRQLAWVSLQGRLVGAEEATSAKTIGRNG  75

Query  342  GLSPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQK  521
            G + +EA AW+LFTP+QRVLVVA++   A+A NS+KNK I +L KSV+LRDQVLL MQQK
Sbjct  76   GFTAKEAAAWELFTPIQRVLVVAIVA--AAAINSRKNKQISKLRKSVELRDQVLLSMQQK  133

Query  522  LDNLCEQVNSFNDQLEPASN-----------NCWLCEQHKHLPKLFPMTDSGRKMSMGEE  668
            LDNLC+Q+N F DQ + A+             C  C+ HK LP      ++  K   G+E
Sbjct  134  LDNLCQQMNYFKDQPDVATVVDISVTKWTDCGCKPCQHHK-LPPNHASENASAKEPKGDE  192

Query  669  VIK  677
            V K
Sbjct  193  VFK  195


 Score = 50.1 bits (118),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQD  807
            EPEERRMSDLSD AP V SSVDIQ++T+ +  D
Sbjct  203  EPEERRMSDLSDWAPSVTSSVDIQLDTLAIEHD  235



>gb|EYU18021.1| hypothetical protein MIMGU_mgv1a006895mg [Erythranthe guttata]
Length=427

 Score =   173 bits (438),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 133/194 (69%), Gaps = 18/194 (9%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAI--GG  341
            LV L+PFTP+ASP+PRRLSSCFTQ ++P+RAKRQLAWVSLQGRLVGAEEA+S++++   G
Sbjct  19   LVYLTPFTPSASPSPRRLSSCFTQATKPIRAKRQLAWVSLQGRLVGAEEATSAKSVDRNG  78

Query  342  GLSPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQK  521
              SP EA AW+LFTP+QRVL+VAV+ AAA+ +   +   I +L+KSVQLRDQVLL MQQK
Sbjct  79   AFSPREAAAWELFTPIQRVLLVAVVAAAAANSEKNRR--ILKLQKSVQLRDQVLLSMQQK  136

Query  522  LDNLCEQVNSFNDQLEPASNN------------CWLCEQHKHLPKLFPMTDSGRKMSMGE  665
            LDNLC+QV+ F DQ E  S +            C  C+ H   P    +    +  S G+
Sbjct  137  LDNLCQQVDYFKDQTEFVSADDDVTVAQRMNCSCKPCQHHIQPPDDVVL--GNKSESNGD  194

Query  666  EVIKSEVLIPANXN  707
            EV K +  +P   N
Sbjct  195  EVFKYKYKMPLENN  208


 Score = 47.4 bits (111),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQD  807
            EP+ERRMSDLSD AP VASSVDIQ++   +  D
Sbjct  211  EPDERRMSDLSDWAPSVASSVDIQLDNFVIEHD  243



>emb|CDP17402.1| unnamed protein product [Coffea canephora]
Length=443

 Score =   168 bits (426),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 124/157 (79%), Gaps = 9/157 (6%)
 Frame = +3

Query  168  LVSLSPFTPTASPAP-RRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGG  344
             ++LSPF+P   P+P RRLSSCFT+PS+PVRA R+LAWVSLQGRLVGAE ASS++ I G 
Sbjct  19   FITLSPFSPACYPSPSRRLSSCFTEPSRPVRAARRLAWVSLQGRLVGAEFASSAKTIAGE  78

Query  345  ----LSPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKM  512
                 S +EAVAW+LF+P+ R+L+VAV   A + ANSK+N+ I +L+K+V+LRDQVLL+M
Sbjct  79   NGSLFSRKEAVAWELFSPIHRILIVAV--IAVAVANSKRNRQIFQLKKAVELRDQVLLRM  136

Query  513  QQKLDNLCEQVNSFNDQLEPAS--NNCWLCEQHKHLP  617
            Q+KLDNLCEQ+N F DQ E A+  N C LC+QHKH P
Sbjct  137  QEKLDNLCEQINFFKDQPEIATEKNGCQLCQQHKHEP  173


 Score = 48.5 bits (114),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (60%), Gaps = 10/57 (18%)
 Frame = +1

Query  649  RCQWGRK*SSLKYSSRQMXTEPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            +C+W          +  +  EPEERRMSDLSD    V SSVD+Q+N+ ++ QD + L
Sbjct  192  KCKW----------APTIEAEPEERRMSDLSDWGSSVTSSVDLQLNSFSIEQDIHKL  238



>ref|XP_010091981.1| hypothetical protein L484_007965 [Morus notabilis]
 gb|EXB48387.1| hypothetical protein L484_007965 [Morus notabilis]
Length=432

 Score =   171 bits (433),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 126/181 (70%), Gaps = 17/181 (9%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVSL+PF+P  SP+ RRLSSCF +PS+PV A R+LAWVSLQGRL+ A+EASS+  I GGL
Sbjct  18   LVSLTPFSPVPSPSTRRLSSCFVEPSRPVAAARRLAWVSLQGRLINADEASSATTIKGGL  77

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            +P+EAV+W+LF+PVQR L+VAVIG   + A SKKN  I  L KSV+LRDQVL  MQQKLD
Sbjct  78   APKEAVSWELFSPVQRFLIVAVIG--VAVAESKKNAQISRLRKSVELRDQVLSSMQQKLD  135

Query  528  NLCEQVNSFN-----------DQLEPASNNCWLCEQHKHLPKLFPMTDSGRKMSMGEEVI  674
            +LCEQ+N+ N           D+ +     C LC+QH  +     +T    K + G+E++
Sbjct  136  SLCEQLNNKNMELSEIDVFGSDKTKFVDCGCCLCDQHHDMLAGKSVT----KATNGDEIL  191

Query  675  K  677
            +
Sbjct  192  Q  192


 Score = 43.5 bits (101),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            E EERRMSDLSD A  V S+ +IQ+N++ + QD Y L
Sbjct  202  EQEERRMSDLSDWASSVTSAAEIQMNSLAIEQDIYNL  238



>ref|XP_007014946.1| Golgin subfamily A member 4, putative [Theobroma cacao]
 gb|EOY32565.1| Golgin subfamily A member 4, putative [Theobroma cacao]
Length=443

 Score =   160 bits (406),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 131/197 (66%), Gaps = 32/197 (16%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPV-RAKRQLAWVSLQGRLVGAEEASSSRAIGGG  344
            LVSLSPF    SP PRRLS+ F QPS+PV  + RQLAWVSLQGRL+ AEEASS+RAIGGG
Sbjct  14   LVSLSPF----SPCPRRLSTNFLQPSRPVVSSARQLAWVSLQGRLINAEEASSARAIGGG  69

Query  345  LSPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKL  524
             S +EAVAW+LF+P++R L+VAVIG   + A SKKN+++ +L+ S++LRDQVL  MQQK+
Sbjct  70   FSRDEAVAWELFSPIERFLIVAVIG--VATAESKKNRLLCQLKNSIELRDQVLSSMQQKV  127

Query  525  DNLCEQVNSFNDQL---------EPASNN------------CWLCEQHKHLPKLFPMTDS  641
            DNLCEQ+N+   Q           P + N            CW+C+QH+   K     +S
Sbjct  128  DNLCEQLNTAGKQQGTGAKANVESPLNENFGSGSIKFVDCGCWICDQHREQFK----GNS  183

Query  642  GRKMSMGEEVIKSEVLI  692
              K S G+E ++ ++ +
Sbjct  184  IMKTSGGDETLQYKMAL  200


 Score = 42.0 bits (97),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  706  TEPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            TE EERRMSDLSD A  V S+ +IQ + + + QD + L
Sbjct  204  TEQEERRMSDLSDWASSVTSAAEIQFSNLAIEQDIFNL  241



>ref|XP_008219321.1| PREDICTED: uncharacterized protein LOC103319544 [Prunus mume]
Length=504

 Score =   152 bits (384),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 128/195 (66%), Gaps = 28/195 (14%)
 Frame = +3

Query  186  FTPTASPAP-RRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEA  362
             TP  +P+  RRLSS F + S+PV A+R+LAWVSL GRLV A+EASS+RAI GGL+PE+A
Sbjct  19   LTPILAPSSTRRLSSSFNETSRPVPARRKLAWVSLDGRLVNADEASSARAIKGGLNPEQA  78

Query  363  VAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQ  542
            VAW+LF+P+QR L VAVI    +AA SKKN+ I +L KSV+LRDQ+L  MQQKLD+LCEQ
Sbjct  79   VAWELFSPIQRFLFVAVIS--VAAAESKKNRHITQLTKSVELRDQLLSSMQQKLDSLCEQ  136

Query  543  VNSFNDQ---LEPA--------SN-------------NCWLCEQHKHLPKLFPMTDSGRK  650
            +N+  D    +EP+        SN              CWLC+QH+ L       ++  K
Sbjct  137  MNNIKDHSATVEPSTLENAELQSNESFGSHKIKFVDCGCWLCDQHRDLQNGL-GGNNVMK  195

Query  651  MSMGEEVIKSEVLIP  695
             S G+E ++ ++ +P
Sbjct  196  ASNGDETLQYKMSLP  210


 Score = 48.5 bits (114),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            E EERRMSDLSDLA  V S+ DIQ+NT+ + QD Y L
Sbjct  214  EQEERRMSDLSDLASSVTSAADIQLNTLAIEQDIYNL  250



>ref|XP_006446030.1| hypothetical protein CICLE_v10014934mg [Citrus clementina]
 gb|ESR59270.1| hypothetical protein CICLE_v10014934mg [Citrus clementina]
Length=517

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 128/199 (64%), Gaps = 28/199 (14%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVSL+ F    SP+PRRLSS FT+PS+PV ++R LAWVSL+GRL+ AEEASS+RA+ GGL
Sbjct  29   LVSLNAFRSMPSPSPRRLSSNFTRPSEPV-SRRNLAWVSLEGRLMNAEEASSARAVKGGL  87

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            S EEAVAW+LF+P+QR L+VAVIG   +AA SKKN++I +L KSV+ RDQVL  MQQKLD
Sbjct  88   SREEAVAWELFSPIQRFLIVAVIG--VAAAESKKNRLISQLTKSVEFRDQVLSSMQQKLD  145

Query  528  NLCEQVNSFNDQLEPASN-------------------------NCWLCEQHKHLPKLFPM  632
            +LCEQ+    DQ    +N                          CWLC+QH +    F  
Sbjct  146  SLCEQLYYVKDQQGIIANMSLSGKAESAQSETFGSDKINFVDCGCWLCDQHHNQLSGFAQ  205

Query  633  TDSGRKMSMGEEVIKSEVL  689
                 K S G+E++  +++
Sbjct  206  GSCAGKNSSGDEMMPYKMI  224



>ref|XP_010044999.1| PREDICTED: uncharacterized protein LOC104433823 [Eucalyptus grandis]
 gb|KCW87140.1| hypothetical protein EUGRSUZ_B03667 [Eucalyptus grandis]
Length=467

 Score =   151 bits (382),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 131/198 (66%), Gaps = 28/198 (14%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVSL+PF    SPAPRRLSS F +P++PV + R+LA+VSLQGRLV AEEA+S+RAIGGGL
Sbjct  23   LVSLAPFAAAPSPAPRRLSSQFAEPARPVPSARKLAYVSLQGRLVNAEEATSARAIGGGL  82

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            S EEAVAW+LF PVQRVL+VAVIG  A+ A S+KN MI +L  SV+LRDQ+L  MQQKLD
Sbjct  83   SREEAVAWELFGPVQRVLLVAVIG--AAVAESRKNWMISQLRNSVELRDQILSSMQQKLD  140

Query  528  NLCEQVNSFNDQ-------------------------LEPASNNCWLCEQHKHLPKLFPM  632
             LC+QV++  D+                         +E     CWLC+QH H      M
Sbjct  141  KLCQQVHNVKDREGNGMEASNVKNLGFPFDATFESNGIEFVDCGCWLCDQH-HKQFGGQM  199

Query  633  TDSGRKMSMGEEVIKSEV  686
             +S  ++S G ++ +S++
Sbjct  200  GNSIMRVSNGNDIHQSKM  217


 Score = 48.1 bits (113),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            EPEERRMSDLSD A  V S+ +IQ N + + QD Y L
Sbjct  224  EPEERRMSDLSDWASSVTSAAEIQTNAIAIEQDVYNL  260



>emb|CBI16417.3| unnamed protein product [Vitis vinifera]
Length=422

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVSL PF+P+ SP+PRRLSS FTQPS+PVRA RQLAWV L+GRLVGAEE SS+RAIG GL
Sbjct  17   LVSLLPFSPSVSPSPRRLSSNFTQPSRPVRAARQLAWVDLRGRLVGAEECSSARAIGSGL  76

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
              EEAVAW+LF+P+ R+L+VAVI  AA+ +      M  +L KSVQ RDQVLL MQQKLD
Sbjct  77   RREEAVAWELFSPIHRILIVAVIAVAATESKKNHRIM--QLNKSVQTRDQVLLSMQQKLD  134

Query  528  NLCEQVNSFNDQ---------LEPASN------------NCWLCEQHKHLPKLFPMTDSG  644
            +LCEQVNS  DQ         L P+S              C LC+QH  L     M +  
Sbjct  135  SLCEQVNSIKDQPDMLLIKNVLLPSSEVFASDKLKLVGCGCRLCDQHLGLSNDL-MDNLV  193

Query  645  RKMSMGEEVIK  677
             K S  +E+ K
Sbjct  194  SKTSSEDEIFK  204



>ref|XP_006446029.1| hypothetical protein CICLE_v10014934mg [Citrus clementina]
 gb|ESR59269.1| hypothetical protein CICLE_v10014934mg [Citrus clementina]
Length=516

 Score =   161 bits (407),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 131/199 (66%), Gaps = 29/199 (15%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVSL+ F    SP+PRRLSS FT+PS+PV ++R LAWVSL+GRL+ AEEASS+RA+ GGL
Sbjct  29   LVSLNAFRSMPSPSPRRLSSNFTRPSEPV-SRRNLAWVSLEGRLMNAEEASSARAVKGGL  87

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            S EEAVAW+LF+P+QR L+VAVIG   +AA SKKN++I +L KSV+ RDQVL  MQQKLD
Sbjct  88   SREEAVAWELFSPIQRFLIVAVIG--VAAAESKKNRLISQLTKSVEFRDQVLSSMQQKLD  145

Query  528  NLCEQVNSFNDQLEPASN-------------------------NCWLCEQHKHLPKLFPM  632
            +LCEQ+    DQ    +N                          CWLC+QH +    F  
Sbjct  146  SLCEQLYYVKDQQGIIANMSLSGKAESAQSETFGSDKINFVDCGCWLCDQHHNQLSGFAG  205

Query  633  TDSGRKMSMGEEVIKSEVL  689
            + +G K S G+E++  +++
Sbjct  206  SCAG-KNSSGDEMMPYKMI  223



>ref|XP_010651263.1| PREDICTED: uncharacterized protein LOC100248335 isoform X1 [Vitis 
vinifera]
 ref|XP_010651264.1| PREDICTED: uncharacterized protein LOC100248335 isoform X2 [Vitis 
vinifera]
Length=449

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVSL PF+P+ SP+PRRLSS FTQPS+PVRA RQLAWV L+GRLVGAEE SS+RAIG GL
Sbjct  17   LVSLLPFSPSVSPSPRRLSSNFTQPSRPVRAARQLAWVDLRGRLVGAEECSSARAIGSGL  76

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
              EEAVAW+LF+P+ R+L+VAVI  AA+ +      M  +L KSVQ RDQVLL MQQKLD
Sbjct  77   RREEAVAWELFSPIHRILIVAVIAVAATESKKNHRIM--QLNKSVQTRDQVLLSMQQKLD  134

Query  528  NLCEQVNSFNDQ---------LEPASN------------NCWLCEQHKHLPKLFPMTDSG  644
            +LCEQVNS  DQ         L P+S              C LC+QH  L     M +  
Sbjct  135  SLCEQVNSIKDQPDMLLIKNVLLPSSEVFASDKLKLVGCGCRLCDQHLGLSNDL-MDNLV  193

Query  645  RKMSMGEEVIK  677
             K S  +E+ K
Sbjct  194  SKTSSEDEIFK  204



>ref|XP_007205040.1| hypothetical protein PRUPE_ppa004532mg [Prunus persica]
 gb|EMJ06239.1| hypothetical protein PRUPE_ppa004532mg [Prunus persica]
Length=504

 Score =   149 bits (376),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 125/199 (63%), Gaps = 29/199 (15%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLS  350
            VSL+P    A  + RRLSS F + S+PV A+R+LAWVSL GRLV A+EASS+RAI GGL+
Sbjct  17   VSLTPIL--APSSTRRLSSSFIETSRPVPARRKLAWVSLDGRLVNADEASSARAIKGGLN  74

Query  351  PEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDN  530
            PE+AVAW+LF+P QR L VAVI  AA+ +   ++  I +L KSV+LRDQ+L  MQQKLD+
Sbjct  75   PEQAVAWELFSPTQRFLFVAVISVAAAESKKNRH--ITQLTKSVELRDQLLSSMQQKLDS  132

Query  531  LCEQVNSFNDQ---LEPAS---------------------NNCWLCEQHKHLPKLFPMTD  638
            LCEQ+N+  D    ++P++                       CWLC+QH+ L       +
Sbjct  133  LCEQMNNIKDHSATVDPSTLENAELQRNESFGSHKIKFVDCGCWLCDQHRDLQNGL-GGN  191

Query  639  SGRKMSMGEEVIKSEVLIP  695
            +  K S G+E ++ ++  P
Sbjct  192  NVMKASNGDETLQYKMSFP  210


 Score = 48.1 bits (113),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            E EERRMSDLSDLA  V S+ DIQ+NT+ + QD Y L
Sbjct  214  EQEERRMSDLSDLASSVTSAADIQLNTLAIEQDIYNL  250



>ref|XP_002513456.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48859.1| conserved hypothetical protein [Ricinus communis]
Length=490

 Score =   155 bits (392),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 121/195 (62%), Gaps = 30/195 (15%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            +V+LSPF+P   P+ RRLSS F  PS+PV + R+LAWVSL+GRLV AEEASS++AIG  L
Sbjct  19   VVTLSPFSPIPVPSSRRLSSHFI-PSRPVPSARRLAWVSLRGRLVNAEEASSAKAIG--L  75

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            S EE VAW+LF+P+QR L+VAVIG A + +      +I +L+KSV LRDQVL  MQQKLD
Sbjct  76   SREETVAWELFSPIQRFLIVAVIGVAVAESKKNL--LISQLKKSVDLRDQVLSNMQQKLD  133

Query  528  NLCEQVNSFNDQLEPASN-------------------------NCWLCEQHKHLPKLFPM  632
            +LCEQVNS  +   P +N                          CW C+ H +L      
Sbjct  134  DLCEQVNSIKNHSRPEANASFNKNTESLSSDAFGGDKIKFVDCGCWHCDHHYNLFADPMH  193

Query  633  TDSGRKMSMGEEVIK  677
             ++  K S G+EV++
Sbjct  194  GNAVMKTSRGDEVLQ  208


 Score = 41.6 bits (96),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            E EERRMSDLSD A  V+S+ DIQ+N   V  D Y L
Sbjct  218  EQEERRMSDLSDWASSVSSTADIQMNMSAVDHDIYNL  254



>gb|KDO64855.1| hypothetical protein CISIN_1g010127mg [Citrus sinensis]
Length=517

 Score =   158 bits (400),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 127/199 (64%), Gaps = 28/199 (14%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVSL+ F    SP+PRRLSS F +PS+PV ++R LAWVSL+GRLV A++ASS+RA+ GGL
Sbjct  29   LVSLNAFRSMPSPSPRRLSSNFKRPSEPV-SRRNLAWVSLEGRLVNADKASSARAVKGGL  87

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            S EEAVAW+LF+P+QR L+VAVIG   +AA SKKN++I +L KSV+ RDQVL  MQQKLD
Sbjct  88   SREEAVAWELFSPIQRFLIVAVIG--VAAAESKKNRLISQLTKSVEFRDQVLSSMQQKLD  145

Query  528  NLCEQVNSFNDQLEPASN-------------------------NCWLCEQHKHLPKLFPM  632
            +LCEQ+    DQ    +N                          CWLC+QH +    F  
Sbjct  146  SLCEQLYYVKDQQGIIANMSLSGKAESAQSETFGSDKINFVDCGCWLCDQHHNQLSGFAQ  205

Query  633  TDSGRKMSMGEEVIKSEVL  689
                 K S G+E++  +++
Sbjct  206  GSCAGKNSSGDEMMPYKMI  224



>ref|XP_006493661.1| PREDICTED: uncharacterized protein LOC102624964 [Citrus sinensis]
 gb|KDO64856.1| hypothetical protein CISIN_1g010127mg [Citrus sinensis]
Length=516

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 130/199 (65%), Gaps = 29/199 (15%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVSL+ F    SP+PRRLSS F +PS+PV ++R LAWVSL+GRLV A++ASS+RA+ GGL
Sbjct  29   LVSLNAFRSMPSPSPRRLSSNFKRPSEPV-SRRNLAWVSLEGRLVNADKASSARAVKGGL  87

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            S EEAVAW+LF+P+QR L+VAVIG   +AA SKKN++I +L KSV+ RDQVL  MQQKLD
Sbjct  88   SREEAVAWELFSPIQRFLIVAVIG--VAAAESKKNRLISQLTKSVEFRDQVLSSMQQKLD  145

Query  528  NLCEQVNSFNDQLEPASN-------------------------NCWLCEQHKHLPKLFPM  632
            +LCEQ+    DQ    +N                          CWLC+QH +    F  
Sbjct  146  SLCEQLYYVKDQQGIIANMSLSGKAESAQSETFGSDKINFVDCGCWLCDQHHNQLSGFAG  205

Query  633  TDSGRKMSMGEEVIKSEVL  689
            + +G K S G+E++  +++
Sbjct  206  SCAG-KNSSGDEMMPYKMI  223



>gb|EYU46295.1| hypothetical protein MIMGU_mgv1a007217mg [Erythranthe guttata]
Length=415

 Score =   149 bits (376),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 122/182 (67%), Gaps = 9/182 (5%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKR-QLAWVSLQGRLVGAEEASSSRAIG--  338
            LV+L+ F  + SP+PRRLSSCF QP++PV+  R QLAWVSLQGRLVGAEEA S+R +   
Sbjct  18   LVNLTSFPCSVSPSPRRLSSCFMQPAEPVKPIRSQLAWVSLQGRLVGAEEACSARTVDKY  77

Query  339  GGLSPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQ  518
            G LS EEA AW++FTP+QRVL+VAV  AAA++ANS KN  I  L  SVQLRDQVLL MQQ
Sbjct  78   GALSAEEAAAWEVFTPIQRVLIVAV--AAAASANSNKNMQISRLLNSVQLRDQVLLSMQQ  135

Query  519  KLDNLCEQVNSFNDQ---LEPASNNCWLCEQHKHLPKLFPMTDSGRKMSMGEEVIKSEVL  689
            KLDNLCEQVN  N     L     +C  C+ H   P       S + +  G EV +  V 
Sbjct  136  KLDNLCEQVNYSNQPEVVLSQRECDCKPCQHHNLPPNASSFNTSSKGLHEG-EVFRCSVP  194

Query  690  IP  695
            +P
Sbjct  195  LP  196


 Score = 44.7 bits (104),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQD  807
            EP+ERRMSDLSD AP VASS+DIQ+    +  D
Sbjct  200  EPDERRMSDLSDWAPSVASSLDIQLENFGIGYD  232



>ref|XP_008449739.1| PREDICTED: uncharacterized protein LOC103491531 [Cucumis melo]
Length=465

 Score =   150 bits (378),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 106/161 (66%), Gaps = 21/161 (13%)
 Frame = +3

Query  189  TPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVA  368
            +P  +P+ RRLSS FTQP  P+ + R+L+WVSLQGRLV AE+ASS R+IG G  P+EA+A
Sbjct  23   SPLHTPSHRRLSSNFTQPRPPIPSARRLSWVSLQGRLVNAEQASSVRSIGAGFGPDEAIA  82

Query  369  WDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVN  548
            W LF+P++R L+VAVIG A S + S     I +L+++V+LRDQVLL MQQKLD+LC QVN
Sbjct  83   WQLFSPIERFLIVAVIGVAVSESKSNHR--ISQLKRAVELRDQVLLSMQQKLDDLCNQVN  140

Query  549  SF-------------------NDQLEPASNNCWLCEQHKHL  614
                                 ND+++     CWLC++H  L
Sbjct  141  PVKDQSGTENDMALRKNADFGNDKIKFVDCGCWLCDEHLDL  181


 Score = 43.9 bits (102),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            E EERRMSDLSD A  V S  DIQ+NT+++ QD   L
Sbjct  211  EQEERRMSDLSDWASSVTSVADIQMNTLSIEQDVLFL  247



>ref|XP_010943589.1| PREDICTED: uncharacterized protein LOC105061278 [Elaeis guineensis]
Length=471

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 109/147 (74%), Gaps = 4/147 (3%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSCFTQPSQPVR-AKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            VSL+PF+P  SP PRRLSSCF  PS+    A ++LAWVSLQGRLVGA+EA+S+ ++G  L
Sbjct  22   VSLAPFSPFISPTPRRLSSCFNDPSRAATPAWKKLAWVSLQGRLVGAQEATSASSVGRCL  81

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            +P EAVAW+LF+P+QRVL+VA++  AAS +   +   I +L +SV +RDQVLL MQQKLD
Sbjct  82   APPEAVAWELFSPLQRVLIVAIVAVAASKSKRARK--IAQLHRSVDIRDQVLLSMQQKLD  139

Query  528  NLCEQVNSFNDQLEPASNNCWLCEQHK  608
            NLCEQ+NS  ++    S N +  E H+
Sbjct  140  NLCEQMNSLQNESMKQSIN-FSSENHR  165



>ref|XP_008804461.1| PREDICTED: uncharacterized protein LOC103717745 [Phoenix dactylifera]
Length=464

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 102/128 (80%), Gaps = 3/128 (2%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSCFTQPSQPVR-AKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            VSL+PF P  SP PRRLSSCF +PSQ    A+++LAWVSLQGRLVG +EA+S+ A+GGGL
Sbjct  22   VSLAPFAPFVSPTPRRLSSCFNEPSQAATPARKKLAWVSLQGRLVGTQEATSASAVGGGL  81

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            +P EA AW+LFTP+QRVL+VAV+  A+S +   +   I +L +SV +RDQVLL MQQKLD
Sbjct  82   TPVEAAAWELFTPLQRVLIVAVVAVASSKSKRARK--IAQLHRSVDIRDQVLLSMQQKLD  139

Query  528  NLCEQVNS  551
            NLCE++NS
Sbjct  140  NLCERMNS  147



>ref|XP_012092771.1| PREDICTED: uncharacterized protein LOC105650470 [Jatropha curcas]
 gb|KDP20188.1| hypothetical protein JCGZ_07908 [Jatropha curcas]
Length=469

 Score =   145 bits (365),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 117/177 (66%), Gaps = 29/177 (16%)
 Frame = +3

Query  231  FTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLFTPVQRVLVVA  410
            FT PS+PV + R+LAW+SLQGRLV AEEASS+ AIGGGLS E+ +AW+LF+PVQR L+VA
Sbjct  44   FT-PSRPVPSARKLAWLSLQGRLVNAEEASSAEAIGGGLSREQTIAWELFSPVQRFLIVA  102

Query  411  VIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVNS------------F  554
            VIG   + A SKKN++I  L KSV+LRDQVL  MQQKLD+LCEQ+NS             
Sbjct  103  VIG--VAVAESKKNRIILRLSKSVELRDQVLSGMQQKLDDLCEQLNSIKNHSRAEANTLL  160

Query  555  NDQLEPASNN-------------CWLCEQHKHLPKLFPMTDSGRKMSMGEEVIKSEV  686
            N+ +E  S+N             CW C+ H++L     M +S  K+S G+EV + +V
Sbjct  161  NENVESLSSNVFGCARIKFVDCGCWHCDHHQNLFAGL-MDNSVEKLSQGDEVFEYKV  216


 Score = 40.0 bits (92),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  715  EERRMSDLSDLAPXVASSVDIQVNTVTV  798
            EERRMSDLSD A  V SS DIQ+N+ +V
Sbjct  225  EERRMSDLSDWASSVTSSADIQMNSSSV  252



>ref|XP_010265792.1| PREDICTED: uncharacterized protein LOC104603457 [Nelumbo nucifera]
Length=464

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVSL PF+P+ + +PRRLS+ F++PS+P+RA RQL WVSLQGRLVGAEEASS +AIGG L
Sbjct  18   LVSLVPFSPSITSSPRRLSTHFSEPSRPIRAARQLCWVSLQGRLVGAEEASSVKAIGGKL  77

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            S EE +AW+LF P+ R+L+VA++  A +  N KK++ I +L +SV LRDQVL  MQ+KLD
Sbjct  78   SGEEGLAWELFKPIHRILIVAIVAIAVADLNFKKSRQIWQLRRSVDLRDQVLSSMQKKLD  137

Query  528  NLCEQVNSFNDQLEP  572
            +LCEQ++S  ++  P
Sbjct  138  DLCEQLSSMKEKEHP  152


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            E EERRMSDLSD AP V+SS +IQ+NT+ V QD Y L
Sbjct  222  EQEERRMSDLSDWAPSVSSSAEIQLNTLAVEQDIYNL  258



>ref|XP_011653583.1| PREDICTED: uncharacterized protein LOC101212475 isoform X1 [Cucumis 
sativus]
Length=462

 Score =   139 bits (350),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 121/198 (61%), Gaps = 29/198 (15%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVS +  +P  +P+ RRLSS FTQP  P+ A R+L+WVSLQGRLV A++ASS  +IGGG 
Sbjct  18   LVSFA--SPLHTPSHRRLSSNFTQPRPPIPAPRRLSWVSLQGRLVNAQQASSVPSIGGGF  75

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
             P+EA+AW LF+P++R L+VAVIG A S + S     I +L+++V+LRDQVLL MQQKLD
Sbjct  76   GPDEAIAWQLFSPIERFLIVAVIGVAVSESKSNHQ--IGQLKRAVELRDQVLLSMQQKLD  133

Query  528  NLCEQVNSF-------------------------NDQLEPASNNCWLCEQHKHLPKLFPM  632
            +LC QVN                           ND+++     CWLC++H  L      
Sbjct  134  DLCNQVNPVKDQSGTENDMALKKNADLEDSGAFGNDKIKFDDCGCWLCDEHLDLLSRLEQ  193

Query  633  TDSGRKMSMGEEVIKSEV  686
             ++  K S G E+++ ++
Sbjct  194  GNAATKHSCGAEMLQYKM  211


 Score = 44.3 bits (103),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            E EERRMSDLSD A  V S  DIQ+NT+++ QD   L
Sbjct  218  EQEERRMSDLSDWASSVTSVADIQMNTLSIEQDMLFL  254



>ref|XP_010527661.1| PREDICTED: uncharacterized protein LOC104804971 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010527662.1| PREDICTED: uncharacterized protein LOC104804971 isoform X2 [Tarenaya 
hassleriana]
Length=465

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 117/175 (67%), Gaps = 29/175 (17%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSCFTQPSQPVRA--KRQLAWVSLQGRLVGAEEASSSRAIGGG  344
            V+L+PF+P   P+ RRLSS FT+P +PV +  +R+LA++SL G LV A+EASSSR+IGGG
Sbjct  25   VNLAPFSPVPPPSARRLSSHFTRPHRPVESAHRRKLAYISLHGVLVNADEASSSRSIGGG  84

Query  345  LSPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKL  524
            LS E AVAW+LFTP+QR L+VAV+G A + +   +   IR+L+KSV LRDQ+L  MQQKL
Sbjct  85   LSSEVAVAWELFTPIQRFLIVAVVGVAVAESKKNRA--IRKLQKSVDLRDQLLSDMQQKL  142

Query  525  DNLCEQVN------------SFNDQLEP------ASNN-------CWLCEQHKHL  614
            D+LCEQ+N            S +D L+        S N       CWLC+QH HL
Sbjct  143  DDLCEQLNLIKHHSGTGPKASDDDNLQRTLKETFGSQNIKFIDCGCWLCDQHHHL  197



>ref|XP_010257369.1| PREDICTED: uncharacterized protein LOC104597490 [Nelumbo nucifera]
Length=451

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 108/138 (78%), Gaps = 2/138 (1%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            +VSLSPF+P+ +P+PRRLSS F+ PS P+R+ RQL WVSLQGRLVGAEE SS++ +GG  
Sbjct  18   IVSLSPFSPSVTPSPRRLSSHFSAPSPPIRSARQLCWVSLQGRLVGAEECSSAKVVGGDF  77

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            S EEAVAW+LF+P+ R+L+VAV   A + A+ KK + I +L++SV LRDQ+L  MQQKLD
Sbjct  78   SREEAVAWELFSPIHRILIVAV--VAVATADMKKFRQIWKLKRSVDLRDQILSSMQQKLD  135

Query  528  NLCEQVNSFNDQLEPASN  581
            +LCE +N+  ++ E  S+
Sbjct  136  DLCELLNAIKERPEIGSD  153



>ref|XP_010492029.1| PREDICTED: uncharacterized protein LOC104769501 isoform X2 [Camelina 
sativa]
Length=444

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 115/174 (66%), Gaps = 31/174 (18%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSCFTQ-PSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            V LSPF+ +  P P  LS+ FT+ P QP+++ R+LA++SLQG LV ++EASS+R+IGGGL
Sbjct  20   VHLSPFSSSLVPPP--LSTHFTRRPCQPLQSSRRLAYISLQGLLVNSDEASSARSIGGGL  77

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            S +E +AW+LFTP QR L+VAVIG   +A+ SKKN +IR+L+KSV LRDQVL  MQQKLD
Sbjct  78   SRDETLAWELFTPYQRFLIVAVIG--VAASESKKNGLIRQLQKSVDLRDQVLTSMQQKLD  135

Query  528  NLCEQVNSFNDQ-------------LEPASN-------------NCWLCEQHKH  611
            +LC+Q+N   DQ             L+P                 CWLC+QH H
Sbjct  136  DLCQQLNLVKDQSGTGTKVSVHDDDLQPTLKEKFGSERINFVDCGCWLCDQHHH  189



>ref|XP_010492028.1| PREDICTED: uncharacterized protein LOC104769501 isoform X1 [Camelina 
sativa]
Length=445

 Score =   146 bits (368),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 115/174 (66%), Gaps = 31/174 (18%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSCFTQ-PSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            V LSPF+ +  P P  LS+ FT+ P QP+++ R+LA++SLQG LV ++EASS+R+IGGGL
Sbjct  20   VHLSPFSSSLVPPP--LSTHFTRRPCQPLQSSRRLAYISLQGLLVNSDEASSARSIGGGL  77

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            S +E +AW+LFTP QR L+VAVIG   +A+ SKKN +IR+L+KSV LRDQVL  MQQKLD
Sbjct  78   SRDETLAWELFTPYQRFLIVAVIG--VAASESKKNGLIRQLQKSVDLRDQVLTSMQQKLD  135

Query  528  NLCEQVNSFNDQ-------------LEPASN-------------NCWLCEQHKH  611
            +LC+Q+N   DQ             L+P                 CWLC+QH H
Sbjct  136  DLCQQLNLVKDQSGTGTKVSVHDDDLQPTLKEKFGSERINFVDCGCWLCDQHHH  189



>ref|XP_008352427.1| PREDICTED: uncharacterized protein LOC103415920 [Malus domestica]
Length=327

 Score =   131 bits (330),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 111/179 (62%), Gaps = 27/179 (15%)
 Frame = +3

Query  231  FTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLFTPVQRVLVVA  410
            F + ++PV A R+LAWV+L+GR+V A+EASS+  I GGL PE+A AW+LF+P QR L VA
Sbjct  36   FNERNRPVPACRKLAWVNLEGRMVNADEASSAGTIKGGLRPEQAAAWELFSPFQRFLFVA  95

Query  411  VIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVNSFNDQ--------L  566
            VI AAA+ +   ++  I +L+KSV+LRDQ+L  MQQKLD+LCEQ+N+  D         L
Sbjct  96   VISAAAAESKKNRH--ISKLKKSVELRDQILSSMQQKLDSLCEQMNNIKDHSGTLVPSTL  153

Query  567  EPA----------------SNNCWLCEQHKHLPKLFPMTDSGRKMSMGEEVIKSEVLIP  695
            E A                   CWLC+QH+ LP    + ++  K S G+ ++  ++ +P
Sbjct  154  ESAELQRNESFGSHKIKFVDCGCWLCDQHRDLPNGL-VDNNAEKXSDGDRILXYKMSLP  211


 Score = 48.9 bits (115),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            E EERRMSDLSDLA  V S+ DIQ+NT+ + QD Y L
Sbjct  215  EQEERRMSDLSDLASSVTSAADIQLNTLAIEQDIYNL  251



>ref|XP_009419177.1| PREDICTED: uncharacterized protein LOC103999225 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009419178.1| PREDICTED: uncharacterized protein LOC103999225 [Musa acuminata 
subsp. malaccensis]
Length=424

 Score =   140 bits (353),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 118/173 (68%), Gaps = 10/173 (6%)
 Frame = +3

Query  198  ASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDL  377
             SP+PRRLS CF +PS+P  A +++AWVSLQGRLVGAEEA+S+ AIGGGLS +EAVAWDL
Sbjct  26   GSPSPRRLSGCFEEPSRP--ALKKIAWVSLQGRLVGAEEATSAGAIGGGLSADEAVAWDL  83

Query  378  FTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVNSFN  557
            F+P+ RVLVVAV   AA+A NSK+ + I + ++SV+LRD+VLL MQQKLDNLCEQ+NS  
Sbjct  84   FSPLHRVLVVAV--VAAAAYNSKRARQIEQFQRSVELRDEVLLSMQQKLDNLCEQMNSLQ  141

Query  558  DQLEPASNNCWLCEQHKHLPKLFPMTDSGRKMSMGEEVIKSEVLIPANXNRTR  716
            DQ  P      L  ++      F   D+    S  EE   ++ LIP      R
Sbjct  142  DQ--PVKCISGLSLENDQ----FNSEDATGIESAKEEAFNADNLIPTEQEERR  188


 Score = 40.0 bits (92),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  706  TEPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            TE EERRMSDLSD    V SSVD Q++ +   Q+ Y L
Sbjct  182  TEQEERRMSDLSDFNWSVTSSVDFQLSALASEQEFYNL  219



>ref|XP_011042063.1| PREDICTED: uncharacterized protein LOC105137860 isoform X1 [Populus 
euphratica]
Length=473

 Score =   139 bits (350),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 123/197 (62%), Gaps = 32/197 (16%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
             V+LSPF P ++P  RR  S    P+  V   R++A VSLQGRLV AEEASS++AI  GL
Sbjct  29   FVTLSPFPPISTPPSRRRLSSQCTPNLAVPLARRMARVSLQGRLVDAEEASSAKAI--GL  86

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            S E  VAW+LF+PVQR L+VAVIG   + + SKKN++I +L+KSV+LRDQVL  MQQKLD
Sbjct  87   SREAGVAWELFSPVQRFLIVAVIG--VAVSKSKKNRIIDQLKKSVELRDQVLSSMQQKLD  144

Query  528  NLCEQVNSFNDQ--------------LEPASNN-------------CWLCEQHKHLPKLF  626
            +LC+Q++S N++              LEP  N+             CW C+QH  L    
Sbjct  145  DLCDQLSSINNRAGTKTITSFNNNKNLEPPCNDVFGCDKIKFVDCGCWYCDQHHDLLAGL  204

Query  627  PMTDSGRKMSMGEEVIK  677
             M +S  K+S G+EV++
Sbjct  205  -MGNSVVKVSKGDEVLQ  220


 Score = 40.4 bits (93),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            E EERRMSDLSD A  V S+ ++Q+NT  + QD + L
Sbjct  230  EQEERRMSDLSDWASSVTSAAEMQMNTYAIDQDMFNL  266



>ref|XP_011042064.1| PREDICTED: uncharacterized protein LOC105137860 isoform X2 [Populus 
euphratica]
Length=466

 Score =   139 bits (350),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 123/197 (62%), Gaps = 32/197 (16%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
             V+LSPF P ++P  RR  S    P+  V   R++A VSLQGRLV AEEASS++AI  GL
Sbjct  29   FVTLSPFPPISTPPSRRRLSSQCTPNLAVPLARRMARVSLQGRLVDAEEASSAKAI--GL  86

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            S E  VAW+LF+PVQR L+VAVIG   + + SKKN++I +L+KSV+LRDQVL  MQQKLD
Sbjct  87   SREAGVAWELFSPVQRFLIVAVIG--VAVSKSKKNRIIDQLKKSVELRDQVLSSMQQKLD  144

Query  528  NLCEQVNSFNDQ--------------LEPASNN-------------CWLCEQHKHLPKLF  626
            +LC+Q++S N++              LEP  N+             CW C+QH  L    
Sbjct  145  DLCDQLSSINNRAGTKTITSFNNNKNLEPPCNDVFGCDKIKFVDCGCWYCDQHHDLLAGL  204

Query  627  PMTDSGRKMSMGEEVIK  677
             M +S  K+S G+EV++
Sbjct  205  -MGNSVVKVSKGDEVLQ  220


 Score = 40.8 bits (94),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            E EERRMSDLSD A  V S+ ++Q+NT  + QD + L
Sbjct  230  EQEERRMSDLSDWASSVTSAAEMQMNTYAIDQDMFNL  266



>ref|XP_010453345.1| PREDICTED: uncharacterized protein LOC104735281 [Camelina sativa]
Length=445

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 114/174 (66%), Gaps = 31/174 (18%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSCFTQPS-QPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            V LSPF+ +  P P  LS+ FT+   QP+++ R+LA++SLQG LV +EEASS+R+IGGGL
Sbjct  20   VHLSPFSSSLVPPP--LSTHFTRRRCQPLQSSRRLAYISLQGLLVNSEEASSARSIGGGL  77

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            S +E +AW+LFTP QR L+VAVIG   +A+ SKKN +IR+L+KSV LRDQVL  MQQKLD
Sbjct  78   SRDETLAWELFTPYQRFLIVAVIG--VAASESKKNGLIRQLQKSVDLRDQVLSSMQQKLD  135

Query  528  NLCEQVN-------------SFNDQLEPASN-------------NCWLCEQHKH  611
            +LC+Q+N               +D L+P                 CWLC+QH H
Sbjct  136  DLCQQLNLVKDQSGTGTKVSDHDDDLQPTFKEKFGSERINFVDCGCWLCDQHHH  189



>ref|XP_011653584.1| PREDICTED: uncharacterized protein LOC101212475 isoform X2 [Cucumis 
sativus]
 gb|KGN54157.1| hypothetical protein Csa_4G290730 [Cucumis sativus]
Length=461

 Score =   135 bits (339),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 121/198 (61%), Gaps = 30/198 (15%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVS +  +P  +P+ RRLSS FTQP  P+ A R+L+WVSLQGRLV A++ASS  +IGGG 
Sbjct  18   LVSFA--SPLHTPSHRRLSSNFTQPRPPIPAPRRLSWVSLQGRLVNAQQASSVPSIGGGF  75

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
             P+EA+AW LF+P++R L+VAVIG A S + S     I +L+++V+LRDQVLL MQQKLD
Sbjct  76   GPDEAIAWQLFSPIERFLIVAVIGVAVSESKSNHQ--IGQLKRAVELRDQVLLSMQQKLD  133

Query  528  NLCEQVNSF-------------------------NDQLEPASNNCWLCEQHKHLPKLFPM  632
            +LC QVN                           ND+++     CWLC++H  L      
Sbjct  134  DLCNQVNPVKDQSGTENDMALKKNADLEDSGAFGNDKIKFDDCGCWLCDEHLDLLSRLE-  192

Query  633  TDSGRKMSMGEEVIKSEV  686
             ++  K S G E+++ ++
Sbjct  193  GNAATKHSCGAEMLQYKM  210


 Score = 44.3 bits (103),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            E EERRMSDLSD A  V S  DIQ+NT+++ QD   L
Sbjct  217  EQEERRMSDLSDWASSVTSVADIQMNTLSIEQDMLFL  253



>emb|CAN80883.1| hypothetical protein VITISV_018652 [Vitis vinifera]
Length=522

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 126/194 (65%), Gaps = 24/194 (12%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVSL PF+P+ SP+PRRLSS FTQPS+PVRA RQLAWV L+GRLVGAEE SS+RAIG GL
Sbjct  17   LVSLLPFSPSVSPSPRRLSSNFTQPSRPVRAARQLAWVDLRGRLVGAEECSSARAIGSGL  76

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
              EEAVAW+LF+P+ R+L+VAVI  AA  +      M  +L KSVQ RDQVLL MQQKLD
Sbjct  77   RREEAVAWELFSPIHRILIVAVIAVAAXESKKNHRIM--QLNKSVQTRDQVLLSMQQKLD  134

Query  528  NLCEQVNSFNDQ---------LEPASN------------NCWLCEQHKHLPKLFPMTDSG  644
            +LCEQVNS  DQ         L P+S              C LC+QH  L     M +  
Sbjct  135  SLCEQVNSIKDQPDMLLIKNVLLPSSEVFASDKLKLVGCGCRLCDQHLGLSNDL-MDNLV  193

Query  645  RKMSMGEEVIKSEV  686
             K S  +E+ K ++
Sbjct  194  SKTSSEDEIFKYKM  207



>ref|XP_008465843.1| PREDICTED: uncharacterized protein LOC103503437 [Cucumis melo]
Length=209

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 95/131 (73%), Gaps = 2/131 (2%)
 Frame = +3

Query  189  TPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVA  368
            +P  +P+ RRLSS FTQP  P+   R+L+WVSLQGRLV AE+ASS R+IGGG  P +A+A
Sbjct  24   SPLHTPSHRRLSSNFTQPRLPIPFVRRLSWVSLQGRLVNAEQASSVRSIGGGFGPGKAIA  83

Query  369  WDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVN  548
            W LF+P++  L+V VIG A S + S     I +L+++V+LRDQVLL MQQKLD+LC QVN
Sbjct  84   WQLFSPIEWFLIVVVIGVAVSESKSNHQ--IGQLKQAVELRDQVLLSMQQKLDDLCNQVN  141

Query  549  SFNDQLEPASN  581
               DQ E  ++
Sbjct  142  PVKDQSETEND  152



>ref|XP_002304759.1| hypothetical protein POPTR_0003s22270g [Populus trichocarpa]
 gb|EEE79738.1| hypothetical protein POPTR_0003s22270g [Populus trichocarpa]
Length=483

 Score =   135 bits (341),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 99/215 (46%), Positives = 129/215 (60%), Gaps = 51/215 (24%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRR-LSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGG  344
             V+LSPF P ++P+ RR LSS FT PS+ V   R+LA VSLQGRLV AEEASS++AI  G
Sbjct  29   FVTLSPFPPISTPSSRRRLSSQFT-PSRAVPLARRLARVSLQGRLVDAEEASSAKAI--G  85

Query  345  LSPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLR-----------  491
            LS E  VAW+LF+PVQR L+VAVIG   + + SKKN++I +L+KSV+LR           
Sbjct  86   LSGEAGVAWELFSPVQRFLIVAVIG--VAVSESKKNRIINQLKKSVELREFKDSAFESSF  143

Query  492  ------DQVLLKMQQKLDNLCEQVNSFNDQ--------------LEPASNN---------  584
                  DQVL  MQQKLD+LC+Q++S N+Q              LEP  N+         
Sbjct  144  FNSWALDQVLSSMQQKLDDLCDQLSSINNQAGTKGNASFNNNKNLEPPCNDVFGCDKIKF  203

Query  585  ----CWLCEQHKHLPKLFPMTDSGRKMSMGEEVIK  677
                CW C+QH  L     M +S  K+S G+EV++
Sbjct  204  VDCGCWHCDQHHDLLAGL-MGNSVVKVSKGDEVLQ  237


 Score = 40.8 bits (94),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            E EERRMSDLSD A  V S+ ++Q+NT  + QD + L
Sbjct  247  EQEERRMSDLSDWASSVTSAAEMQMNTYAIDQDMFNL  283



>ref|XP_009376465.1| PREDICTED: uncharacterized protein LOC103965173 [Pyrus x bretschneideri]
Length=476

 Score =   128 bits (322),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 114/192 (59%), Gaps = 35/192 (18%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLS  350
            V+L P  PT S + RRLSS F + S+P      LAWV+L+GR+V A+EASS+  I GGL 
Sbjct  18   VTLIPI-PTPS-SMRRLSSSFNERSRP------LAWVNLEGRMVNADEASSAGTIKGGLR  69

Query  351  PEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDN  530
             E+A AW+LF+P QR L VAVI  A + +   ++  I +L+KSV+LRDQ+L  MQQKLD+
Sbjct  70   TEQAAAWELFSPFQRFLFVAVISVATAESKKPRH--ISQLKKSVELRDQILSSMQQKLDS  127

Query  531  LCEQVNSFNDQ--------LEPA----------------SNNCWLCEQHKHLPKLFPMTD  638
            LCEQ+N+  D         LE A                   CWLC+QH++LP    + +
Sbjct  128  LCEQMNNIKDHSGTLVPSTLESAELQRNESFGSHKIKFVDCGCWLCDQHRNLPNGL-VDN  186

Query  639  SGRKMSMGEEVI  674
            +  K S G+ ++
Sbjct  187  NAEKASDGDRIL  198


 Score = 48.1 bits (113),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            E EERRMSDLSDLA  V S+ DIQ+NT+ + QD Y L
Sbjct  209  EQEERRMSDLSDLASSVTSAADIQLNTLAIEQDIYNL  245



>ref|XP_004486942.1| PREDICTED: uncharacterized serine-rich protein C215.13-like isoform 
X3 [Cicer arietinum]
Length=452

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 112/197 (57%), Gaps = 33/197 (17%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSC--FTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGG  341
            LVS+ PF    S   RRLS+   F +PS PV  ++ +AW+SLQGRLV A+EASS+R IGG
Sbjct  16   LVSIPPF----SGNRRRLSTTTTFVKPSCPVSLQKPMAWISLQGRLVNADEASSARTIGG  71

Query  342  GLSPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQK  521
            GL+ E A AWDLF P+ R L+VAVIG   + + SK N+ I  L+KSV+LRDQVL  MQQK
Sbjct  72   GLTDELAFAWDLFPPIHRFLIVAVIG--VAVSQSKNNQQILNLKKSVELRDQVLSSMQQK  129

Query  522  LDNLCEQVNSFNDQLEPASNN-------------------------CWLCEQHKHLPKLF  626
            LDNLCEQ+NS  +    A N                          CW CE+H       
Sbjct  130  LDNLCEQLNSSKENTVTAVNKLSTKDEELLLDETFGSEKIKFVDCGCWHCEEHSSFCDEL  189

Query  627  PMTDSGRKMSMGEEVIK  677
                S R+ S   EV++
Sbjct  190  MQGASSRRASSANEVLQ  206



>gb|KHG04253.1| Inactive rhomboid 1 [Gossypium arboreum]
Length=446

 Score =   131 bits (330),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 106/169 (63%), Gaps = 25/169 (15%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSCFTQPSQPV-RAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            VSLSPF+P      RRLS  F   S+PV  +  +LA VSLQGRLV AEEASS+R +GGGL
Sbjct  18   VSLSPFSPVRRQR-RRLSVHFADLSRPVVSSATRLARVSLQGRLVNAEEASSARTVGGGL  76

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
              +EAVAW+LF+P++R L+VAVIG   + A SKKN +I  L KSV+LRD+VL  MQQK+D
Sbjct  77   GCKEAVAWELFSPIERFLIVAVIG--VATAESKKNWLISHLRKSVELRDEVLSSMQQKVD  134

Query  528  NLCEQVNS----------------FNDQLEPASNN-----CWLCEQHKH  611
            NLCEQ+N+                 N+     S       CW+C QH+ 
Sbjct  135  NLCEQLNNGEEKPRIGAKIEVGTPLNETFGSGSMKVDDCGCWICYQHRE  183


 Score = 44.3 bits (103),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  706  TEPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            TE EERRMSDLSD A  V S+ +IQ+N + + QD + L
Sbjct  205  TEQEERRMSDLSDWASSVTSASEIQLNNLAIEQDTFNL  242



>ref|XP_010419852.1| PREDICTED: uncharacterized protein LOC104705532 [Camelina sativa]
Length=445

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 114/174 (66%), Gaps = 31/174 (18%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSCFTQ-PSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            V LSPF+ +  P P  LS+ FT+ P QP+++ R+L+++SLQG LV ++EASS+R+IGGGL
Sbjct  20   VHLSPFSSSLIPPP--LSAHFTRRPCQPLQSSRRLSYISLQGLLVNSDEASSARSIGGGL  77

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            S +E +AW+LFTP QR L+VAVI    +A+ SKKN +IR+L+KSV LRDQVL  MQQKLD
Sbjct  78   SRDETLAWELFTPYQRFLIVAVIS--VAASESKKNGLIRKLQKSVGLRDQVLSSMQQKLD  135

Query  528  NLCEQVNSFNDQ-------------LEPASN-------------NCWLCEQHKH  611
            +LC+Q+N   DQ             L+P                 CWLC+QH H
Sbjct  136  DLCQQLNLVKDQSGTGTKISEHDDDLQPTFKEKFGSERINFVDCGCWLCDQHHH  189



>ref|NP_196797.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB88257.1| putative protein [Arabidopsis thaliana]
 gb|ACF22896.1| At5g12930 [Arabidopsis thaliana]
 gb|AED91832.1| uncharacterized protein AT5G12930 [Arabidopsis thaliana]
Length=439

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 110/172 (64%), Gaps = 30/172 (17%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLS  350
            V L+PF    SP  RRLS+ FT+  QP+++   LA++SLQG LV ++EASS+R+IGGGLS
Sbjct  20   VHLAPF---FSPYTRRLSTHFTRRCQPLQSSPPLAYISLQGLLVNSDEASSARSIGGGLS  76

Query  351  PEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDN  530
             EE++AW+LFTP QR L+VAVIG   +AA SKKN +IR+L+KSV LRDQ+L  MQQKLD+
Sbjct  77   REESLAWELFTPYQRFLLVAVIG--VAAAQSKKNGVIRQLQKSVDLRDQLLSSMQQKLDD  134

Query  531  LCEQVNSFNDQLEPASN-------------------------NCWLCEQHKH  611
            LC ++N   DQ    S                           CWLC+QH H
Sbjct  135  LCHELNLAKDQSGAVSKVSDHDYPQSALKEKFGSERINFVDCGCWLCDQHHH  186



>gb|KEH39471.1| hypothetical protein MTR_2g098330 [Medicago truncatula]
Length=453

 Score =   127 bits (320),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 106/195 (54%), Gaps = 30/195 (15%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVS+ P T +      RLS+   +P  P+   + +AW++L+GR+V A EAS++R IGGGL
Sbjct  17   LVSIPPITLSRR---HRLSATTVEPRCPISFSKPMAWINLEGRVVNANEASAARTIGGGL  73

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            S E A AWDLF P+ R L+VAVIG AA+ +   +   I  L+KSV+LRDQ+L  MQ+KLD
Sbjct  74   SDELAFAWDLFPPIHRFLIVAVIGVAAAQSKKDRE--IFNLKKSVELRDQLLSSMQEKLD  131

Query  528  NLCEQVNSFNDQLEPASNN-------------------------CWLCEQHKHLPKLFPM  632
            NLCEQ NS  +    A N                          CW C++H      +  
Sbjct  132  NLCEQFNSSKENTVAAVNKLSTKDGELQLDETFGSERIKFVDCGCWHCDEHSSFCNEYMQ  191

Query  633  TDSGRKMSMGEEVIK  677
                R+ S G EV++
Sbjct  192  GALSRRASGGNEVLQ  206


 Score = 44.7 bits (104),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +1

Query  679  LKYSSRQMXTEPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            L+Y S     + EERRMS LSDLA  V S+ DIQ N + V QD Y L
Sbjct  205  LQYKSPFSNEDQEERRMSGLSDLASSVTSAADIQFNNLAVEQDVYNL  251



>gb|KJB83505.1| hypothetical protein B456_013G250600 [Gossypium raimondii]
Length=446

 Score =   128 bits (322),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 106/169 (63%), Gaps = 25/169 (15%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSCFTQPSQPV-RAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            VSLSPF+P      RRLS  F   S+PV  +  +LA VSLQGRLV AEEASS+R +GGGL
Sbjct  18   VSLSPFSPVRRRR-RRLSVHFADLSRPVVSSATRLARVSLQGRLVNAEEASSARTVGGGL  76

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
              EEAVAW+LF+P++R L+VAV+G   + A SKKN +I  L KSV+LRD+VL  MQQK+D
Sbjct  77   GCEEAVAWELFSPIERFLIVAVVG--VATAESKKNWLISHLRKSVELRDEVLSSMQQKVD  134

Query  528  NLCEQVNS----------------FNDQLEPASNN-----CWLCEQHKH  611
            NLCEQ+N+                 N+     S       CW+C QH+ 
Sbjct  135  NLCEQLNNGEEKPIIGAKIEVGTPLNETFGSGSMKVDDCGCWICYQHRE  183


 Score = 43.1 bits (100),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  706  TEPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            TE EERRMSDLSD A  V S+ +IQ+N + + QD + L
Sbjct  205  TEQEERRMSDLSDWASSVTSASEIQLNNLAIEQDIFNL  242



>gb|AES67714.2| hypothetical protein MTR_2g098330 [Medicago truncatula]
Length=452

 Score =   127 bits (318),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 107/195 (55%), Gaps = 31/195 (16%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVS+ P T +      RLS+   +P  P+   + +AW++L+GR+V A EAS++R IGGGL
Sbjct  17   LVSIPPITLSRR---HRLSATTVEPRCPISFSKPMAWINLEGRVVNANEASAARTIGGGL  73

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            S E A AWDLF P+ R L+VAVIG AA+ +   +   I  L+KSV+LRDQ+L  MQ+KLD
Sbjct  74   SDELAFAWDLFPPIHRFLIVAVIGVAAAQSKKDRE--IFNLKKSVELRDQLLSSMQEKLD  131

Query  528  NLCEQVNSFNDQLEPASNN-------------------------CWLCEQHKHLPKLFPM  632
            NLCEQ NS  +    A N                          CW C++H      + M
Sbjct  132  NLCEQFNSSKENTVAAVNKLSTKDGELQLDETFGSERIKFVDCGCWHCDEHSSFCNEY-M  190

Query  633  TDSGRKMSMGEEVIK  677
                R+ S G EV++
Sbjct  191  GALSRRASGGNEVLQ  205


 Score = 44.7 bits (104),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +1

Query  679  LKYSSRQMXTEPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            L+Y S     + EERRMS LSDLA  V S+ DIQ N + V QD Y L
Sbjct  204  LQYKSPFSNEDQEERRMSGLSDLASSVTSAADIQFNNLAVEQDVYNL  250



>ref|XP_002873588.1| hypothetical protein ARALYDRAFT_909241 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49847.1| hypothetical protein ARALYDRAFT_909241 [Arabidopsis lyrata subsp. 
lyrata]
Length=442

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 109/172 (63%), Gaps = 30/172 (17%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLS  350
            V L+PF  +  P    LS+ FT+  QP+++ R LA++SLQG LV  +EASS+R+IGGGLS
Sbjct  20   VHLAPFFSSLVPP---LSAHFTRRCQPLQSSRPLAYISLQGLLVNFDEASSARSIGGGLS  76

Query  351  PEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDN  530
             EEA+AW+LFTP QR L+VAVIG   +AA SKKN +IR+L+KSV LRDQVL  MQQKLD+
Sbjct  77   REEALAWELFTPYQRFLIVAVIG--VAAAESKKNGLIRQLQKSVDLRDQVLSSMQQKLDD  134

Query  531  LCEQVNSFNDQLEPASN-------------------------NCWLCEQHKH  611
            LC++++   DQ    S                           CWLC+QH H
Sbjct  135  LCQELHLVKDQSGTLSKVLDHDDLRSTPKEKFGSEKITFVDCGCWLCDQHHH  186



>ref|XP_010519735.1| PREDICTED: uncharacterized protein LOC104799094 [Tarenaya hassleriana]
Length=459

 Score =   133 bits (335),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 110/175 (63%), Gaps = 31/175 (18%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSCFTQPSQPVRA--KRQLAWVSLQGRLVGAEEASSSRAIGGG  344
            V L+PF+P      RRLSS FT P +PV +  +R+LA++SL+G LV AEEASS+ +IG  
Sbjct  19   VRLAPFSPVQPSLARRLSSHFTGPQRPVESTRRRKLAYISLRGELVNAEEASSAASIG--  76

Query  345  LSPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKL  524
            LSPEEAVAW+LFTP+QR L+VAVIG   +AA SKKN++I +L+K+V  R+Q++  MQQKL
Sbjct  77   LSPEEAVAWELFTPIQRFLIVAVIG--VAAAKSKKNRLIWKLQKTVDRREQLVSNMQQKL  134

Query  525  DNLCEQVNSFNDQLEPASN-------------------------NCWLCEQHKHL  614
            D + EQ+N    Q E  S                           CWLC+QH HL
Sbjct  135  DEMSEQLNLAKGQSETGSKASDCDDLQRTFKESFGSEKIKFIDCGCWLCDQHHHL  189


 Score = 37.7 bits (86),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +1

Query  706  TEPEERRMSDLSDLAPXVASSVDIQVNTVTVYQD  807
            TEP+ERRMSD+SD    V S+ +I  N ++  QD
Sbjct  218  TEPDERRMSDMSDCCSSVTSAAEIYYNNLSFEQD  251



>ref|XP_006399779.1| hypothetical protein EUTSA_v10013519mg [Eutrema salsugineum]
 gb|ESQ41232.1| hypothetical protein EUTSA_v10013519mg [Eutrema salsugineum]
Length=451

 Score =   136 bits (343),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 105/176 (60%), Gaps = 29/176 (16%)
 Frame = +3

Query  171  VSLSPFTPTASP-APRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGG-  344
            V L+PF     P + R LSS FT+ +QP+ + R+L + SLQG LV + EASS+R+IGGG 
Sbjct  18   VHLAPFFSLGPPPSARLLSSHFTRRTQPLHSSRRLGYTSLQGLLVNSHEASSARSIGGGG  77

Query  345  LSPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKL  524
            LS EE +AW+LFTP QR L+VAVIG AAS +      +IR+L+KSV LRD VL  MQQKL
Sbjct  78   LSREETLAWELFTPYQRFLIVAVIGVAASESKKNG--LIRQLQKSVDLRDHVLSSMQQKL  135

Query  525  DNLCEQVNSFNDQLEPASN-------------------------NCWLCEQHKHLP  617
            D+LC+Q+N   DQ   A                            CWLC+QH H P
Sbjct  136  DDLCQQLNLAKDQSGNAFKVSDHDDLQSTFTENFGSEKVKFVDCGCWLCDQHHHSP  191


 Score = 34.7 bits (78),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +1

Query  706  TEPEERRMSDLSDLAPXVASSVDIQVNTVTVYQD  807
            TEPEERRMS +SD    V S+ +I    +++ QD
Sbjct  206  TEPEERRMSYMSDWCSSVTSAAEIHFENLSLDQD  239



>ref|XP_011037865.1| PREDICTED: uncharacterized protein LOC105134939 isoform X1 [Populus 
euphratica]
 ref|XP_011037866.1| PREDICTED: uncharacterized protein LOC105134939 isoform X1 [Populus 
euphratica]
 ref|XP_011037867.1| PREDICTED: uncharacterized protein LOC105134939 isoform X1 [Populus 
euphratica]
 ref|XP_011037868.1| PREDICTED: uncharacterized protein LOC105134939 isoform X2 [Populus 
euphratica]
 ref|XP_011037869.1| PREDICTED: uncharacterized protein LOC105134939 isoform X3 [Populus 
euphratica]
 ref|XP_011037870.1| PREDICTED: uncharacterized protein LOC105134939 isoform X2 [Populus 
euphratica]
Length=468

 Score =   129 bits (324),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 113/175 (65%), Gaps = 33/175 (19%)
 Frame = +3

Query  231  FTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLFTPVQRVLVVA  410
            FT P++ V +  +LAWVSL+GRLV AEEASS+ AI  GL  E+ VAW+LF+P QR L+VA
Sbjct  49   FT-PTRAVTSSLRLAWVSLRGRLVNAEEASSANAI--GLRLEDGVAWELFSPAQRFLIVA  105

Query  411  VIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVNSFNDQ---------  563
            VIG   + + SKKN +I +L+KSV+LRDQVL  MQQKLDNLC+Q+++ N Q         
Sbjct  106  VIG--VAVSESKKNGIINQLKKSVELRDQVLSSMQQKLDNLCDQLSNINSQAGTKANASF  163

Query  564  ----LEPASNN-------------CWLCEQHKHLPKLFPMTDSGRKMSMGEEVIK  677
                +EP SN+             CW C+QH+ L  L  M +S  K+S G+EV++
Sbjct  164  NNKNVEPPSNDVFGCDETKFVDCGCWHCDQHQDLGGL--MGNSIVKVSRGDEVLQ  216


 Score = 40.4 bits (93),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQD  807
            E EERRMSDLSD A  V S+ D+Q+N   + QD
Sbjct  226  EHEERRMSDLSDWASSVTSAADMQMNAFAIDQD  258



>ref|XP_010673592.1| PREDICTED: uncharacterized protein LOC104889947 [Beta vulgaris 
subsp. vulgaris]
Length=462

 Score =   127 bits (320),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 126/208 (61%), Gaps = 39/208 (19%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQ-------LAWVSLQGRLVGAEEASSS  326
            LV+LSP  P+ S  PRRLSS FT+P+ P+RA  +       LAW+SLQGRLVGAEEA+S+
Sbjct  16   LVTLSPI-PSPSLNPRRLSSRFTKPNSPIRAGSKKKLTAPPLAWISLQGRLVGAEEATSA  74

Query  327  RAIGGGLSPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLL  506
              IGG LS EE+V W+LF+P+ RVL+VAV+  AA+     +   I +L   V+LRD++L+
Sbjct  75   TTIGG-LSREESVCWELFSPIHRVLIVAVVAVAAAKCEKNR--QIVQLRNCVKLRDEILM  131

Query  507  KMQQKLDNLCEQVNSFNDQLE-----PASNN--------------------CWLCEQHKH  611
             MQQKLD+LCEQ+N   DQ +      AS N                    CW C+Q + 
Sbjct  132  SMQQKLDDLCEQMNCMKDQSQEVTELSASKNLDFSSRRLSFPGKSDSICTDCWFCDQRR-  190

Query  612  LPKLFPMT-DSGRKMSMGEEVIKSEVLI  692
              +L  ++ +S  K + G+E++K+ + +
Sbjct  191  -AELDDLSGNSFVKAASGDEMLKNTLSV  217


 Score = 41.6 bits (96),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  715  EERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            EERRMSDLSD A  + S+ DIQ+N + + QD + L
Sbjct  224  EERRMSDLSDWASSITSAADIQLNNLAMEQDTHNL  258



>ref|XP_011461896.1| PREDICTED: uncharacterized protein LOC101298111 [Fragaria vesca 
subsp. vesca]
Length=518

 Score =   124 bits (311),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 105/175 (60%), Gaps = 34/175 (19%)
 Frame = +3

Query  186  FTPTASPAPRRLS-SCFTQPSQPVR-----AKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
             +P  SP+ RRLS     +PS   R     A RQL+W+SLQG L  A++A+S+RAI GGL
Sbjct  25   LSPIPSPSTRRLSIGSAERPSHRGRNIASAAARQLSWLSLQGWLADADDATSARAIRGGL  84

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
             P +AVAW+LFTP+QR+L VAVI    +AA S+KN++I  L+KSV+ RDQVLL MQ KLD
Sbjct  85   EPAQAVAWELFTPIQRILFVAVIS--VAAAESRKNRIISRLKKSVEFRDQVLLNMQHKLD  142

Query  528  NLCEQVNSFNDQ-------LEPASN-------------------NCWLCEQHKHL  614
            +LC Q+++  D        + P  +                    CWLC+QH+ +
Sbjct  143  SLCAQISNIKDHPGTETPVMSPTKDIEMQSDEAFGCDKIKFVDCGCWLCDQHRDV  197


 Score = 45.4 bits (106),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            E EERRMSDLSDLA  V S+ D Q+N++ + QD Y L
Sbjct  227  EQEERRMSDLSDLASSVTSAADFQLNSLAIEQDMYNL  263



>ref|XP_006287723.1| hypothetical protein CARUB_v10000933mg [Capsella rubella]
 gb|EOA20621.1| hypothetical protein CARUB_v10000933mg [Capsella rubella]
Length=430

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 109/173 (63%), Gaps = 31/173 (18%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSC-FTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            V LSPF+   S  P  LSS  FT+  QP+++ R+ A++SLQG LV ++ ASS+R+IGGGL
Sbjct  20   VHLSPFS---SLVPPHLSSTHFTRRCQPLQSSRRPAYISLQGLLVNSDVASSARSIGGGL  76

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            + +EA+AW+LFTP QR L+VAVIG   + A SKKN +IR+L+KSV LRDQVL  MQQKLD
Sbjct  77   TRDEALAWELFTPYQRFLIVAVIG--VATAESKKNGVIRQLQKSVDLRDQVLSSMQQKLD  134

Query  528  NLCEQVNSFNDQLEPASN-------------------------NCWLCEQHKH  611
            +LC+Q+N   DQ    S                           CWLC+QH H
Sbjct  135  DLCQQLNLVKDQSAAGSKVSDHDALQSTLKEKFGSERINFVDCGCWLCDQHLH  187



>ref|XP_006287724.1| hypothetical protein CARUB_v10000933mg [Capsella rubella]
 gb|EOA20622.1| hypothetical protein CARUB_v10000933mg [Capsella rubella]
Length=454

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 109/173 (63%), Gaps = 31/173 (18%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSC-FTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            V LSPF   +S  P  LSS  FT+  QP+++ R+ A++SLQG LV ++ ASS+R+IGGGL
Sbjct  20   VHLSPF---SSLVPPHLSSTHFTRRCQPLQSSRRPAYISLQGLLVNSDVASSARSIGGGL  76

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            + +EA+AW+LFTP QR L+VAVIG   + A SKKN +IR+L+KSV LRDQVL  MQQKLD
Sbjct  77   TRDEALAWELFTPYQRFLIVAVIG--VATAESKKNGVIRQLQKSVDLRDQVLSSMQQKLD  134

Query  528  NLCEQVNSFNDQLEPASN-------------------------NCWLCEQHKH  611
            +LC+Q+N   DQ    S                           CWLC+QH H
Sbjct  135  DLCQQLNLVKDQSAAGSKVSDHDALQSTLKEKFGSERINFVDCGCWLCDQHLH  187



>ref|XP_002297789.2| hypothetical protein POPTR_0001s05490g [Populus trichocarpa]
 gb|EEE82594.2| hypothetical protein POPTR_0001s05490g [Populus trichocarpa]
Length=469

 Score =   126 bits (317),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 112/175 (64%), Gaps = 32/175 (18%)
 Frame = +3

Query  231  FTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLFTPVQRVLVVA  410
            FT P++ + +  +LAWVSL+GRLV AEEASS+ AI  GL  E+ VAW+LF+P QR L+VA
Sbjct  49   FT-PTRAITSSLRLAWVSLRGRLVNAEEASSANAI--GLRLEDGVAWELFSPAQRFLIVA  105

Query  411  VIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVNSFNDQ---------  563
            VIG   + + SKKN +I +L+KSV+LRDQVL  MQQKLDNLC+Q+++ N Q         
Sbjct  106  VIG--VAVSESKKNGIINQLKKSVELRDQVLSSMQQKLDNLCDQLSNINSQAGTKANASF  163

Query  564  ----LEPASNN-------------CWLCEQHKHLPKLFPMTDSGRKMSMGEEVIK  677
                +EP SN+             CW C+QH+ L     M +S  K+S G+EV++
Sbjct  164  NNKNVEPPSNDVFGCDKIKFVDCGCWHCDQHQDLLAGL-MGNSVVKVSRGDEVLQ  217


 Score = 40.4 bits (93),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQD  807
            E EERRMSDLSD A  V S+ D+Q+N   + QD
Sbjct  227  EHEERRMSDLSDWASSVTSAADMQMNVFAIDQD  259



>ref|XP_004486940.1| PREDICTED: uncharacterized serine-rich protein C215.13-like isoform 
X1 [Cicer arietinum]
Length=455

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 99/172 (58%), Gaps = 27/172 (16%)
 Frame = +3

Query  237  QPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLFTPVQRVLVVAVI  416
            +PS PV  ++ +AW+SLQGRLV A+EASS+R IGGGL+ E A AWDLF P+ R L+VAVI
Sbjct  40   KPSCPVSLQKPMAWISLQGRLVNADEASSARTIGGGLTDELAFAWDLFPPIHRFLIVAVI  99

Query  417  GaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVNSFNDQLEPASN-----  581
            G   + + SK N+ I  L+KSV+LRDQVL  MQQKLDNLCEQ+NS  +    A N     
Sbjct  100  G--VAVSQSKNNQQILNLKKSVELRDQVLSSMQQKLDNLCEQLNSSKENTVTAVNKLSTK  157

Query  582  --------------------NCWLCEQHKHLPKLFPMTDSGRKMSMGEEVIK  677
                                 CW CE+H           S R+ S   EV++
Sbjct  158  DEELLLDETFGSEKIKFVDCGCWHCEEHSSFCDELMQGASSRRASSANEVLQ  209



>ref|XP_004486941.1| PREDICTED: uncharacterized serine-rich protein C215.13-like isoform 
X2 [Cicer arietinum]
Length=454

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 100/172 (58%), Gaps = 28/172 (16%)
 Frame = +3

Query  237  QPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLFTPVQRVLVVAVI  416
            +PS PV  ++ +AW+SLQGRLV A+EASS+R IGGGL+ E A AWDLF P+ R L+VAVI
Sbjct  40   KPSCPVSLQKPMAWISLQGRLVNADEASSARTIGGGLTDELAFAWDLFPPIHRFLIVAVI  99

Query  417  GaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVNSFNDQLEPASN-----  581
            G   + + SK N+ I  L+KSV+LRDQVL  MQQKLDNLCEQ+NS  +    A N     
Sbjct  100  G--VAVSQSKNNQQILNLKKSVELRDQVLSSMQQKLDNLCEQLNSSKENTVTAVNKLSTK  157

Query  582  --------------------NCWLCEQHKHLPKLFPMTDSGRKMSMGEEVIK  677
                                 CW CE+H        M  S R+ S   EV++
Sbjct  158  DEELLLDETFGSEKIKFVDCGCWHCEEHSSFCDEL-MGASSRRASSANEVLQ  208



>ref|XP_003597463.1| hypothetical protein MTR_2g098330 [Medicago truncatula]
Length=479

 Score =   127 bits (318),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 107/195 (55%), Gaps = 31/195 (16%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVS+ P T +      RLS+   +P  P+   + +AW++L+GR+V A EAS++R IGGGL
Sbjct  17   LVSIPPITLSRR---HRLSATTVEPRCPISFSKPMAWINLEGRVVNANEASAARTIGGGL  73

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            S E A AWDLF P+ R L+VAVIG AA+ +   +   I  L+KSV+LRDQ+L  MQ+KLD
Sbjct  74   SDELAFAWDLFPPIHRFLIVAVIGVAAAQSKKDRE--IFNLKKSVELRDQLLSSMQEKLD  131

Query  528  NLCEQVNSFNDQLEPASN-------------------------NCWLCEQHKHLPKLFPM  632
            NLCEQ NS  +    A N                          CW C++H      + M
Sbjct  132  NLCEQFNSSKENTVAAVNKLSTKDGELQLDETFGSERIKFVDCGCWHCDEHSSFCNEY-M  190

Query  633  TDSGRKMSMGEEVIK  677
                R+ S G EV++
Sbjct  191  GALSRRASGGNEVLQ  205


 Score = 36.6 bits (83),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +1

Query  679  LKYSSRQMXTEPEERRMSDLSDLAPXVASSVDIQV  783
            L+Y S     + EERRMS LSDLA  V S+ DIQV
Sbjct  204  LQYKSPFSNEDQEERRMSGLSDLASSVTSAADIQV  238



>gb|KJB83504.1| hypothetical protein B456_013G250600 [Gossypium raimondii]
Length=438

 Score =   128 bits (322),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 106/169 (63%), Gaps = 25/169 (15%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSCFTQPSQPV-RAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            VSLSPF+P      RRLS  F   S+PV  +  +LA VSLQGRLV AEEASS+R +GGGL
Sbjct  18   VSLSPFSPVRRRR-RRLSVHFADLSRPVVSSATRLARVSLQGRLVNAEEASSARTVGGGL  76

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
              EEAVAW+LF+P++R L+VAV+G   + A SKKN +I  L KSV+LRD+VL  MQQK+D
Sbjct  77   GCEEAVAWELFSPIERFLIVAVVG--VATAESKKNWLISHLRKSVELRDEVLSSMQQKVD  134

Query  528  NLCEQVNS----------------FNDQLEPASNN-----CWLCEQHKH  611
            NLCEQ+N+                 N+     S       CW+C QH+ 
Sbjct  135  NLCEQLNNGEEKPIIGAKIEVGTPLNETFGSGSMKVDDCGCWICYQHRE  183


 Score = 34.7 bits (78),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +1

Query  706  TEPEERRMSDLSDLAPXVASSVDIQ  780
            TE EERRMSDLSD A  V S+ +IQ
Sbjct  205  TEQEERRMSDLSDWASSVTSASEIQ  229



>ref|XP_009379490.1| PREDICTED: uncharacterized protein LOC103967884 [Pyrus x bretschneideri]
Length=274

 Score =   120 bits (301),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 109/195 (56%), Gaps = 44/195 (23%)
 Frame = +3

Query  186  FTPTASPAP-RRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEA  362
             TP  +P+  RRLSS F + S+PV A+R+LAWV+L+G                 LSPE+A
Sbjct  20   LTPIRTPSSKRRLSSSFNERSRPVPARRKLAWVNLEG----------------DLSPEQA  63

Query  363  VAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQ  542
             AW+LFTP QR L VAVI  AA+ +   +   I +L+KSV+LRDQ+L  MQQKLD+LCEQ
Sbjct  64   AAWELFTPFQRFLFVAVISVAAAESKKNR--HISQLKKSVELRDQILSSMQQKLDSLCEQ  121

Query  543  VNSFNDQ---LEPAS---------------------NNCWLCEQHKHLPKLFPMTDSGRK  650
            +N+  D    L P++                       CWLC+QH+ LP    + +   K
Sbjct  122  MNNIKDHSGTLVPSTLENVELQRNESFSSHKIKFVDCGCWLCDQHRDLPNGL-VDNIAEK  180

Query  651  MSMGEEVIKSEVLIP  695
             S G+ +++ +V +P
Sbjct  181  ASDGDHILRYKVSLP  195


 Score = 41.2 bits (95),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQD  807
            E EERRMSDLSDL   V S+ D Q+N + + Q+
Sbjct  199  EQEERRMSDLSDLCSSVTSAADFQLNAIAIEQE  231



>ref|XP_007150392.1| hypothetical protein PHAVU_005G149400g [Phaseolus vulgaris]
 gb|ESW22386.1| hypothetical protein PHAVU_005G149400g [Phaseolus vulgaris]
Length=417

 Score =   116 bits (291),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 97/160 (61%), Gaps = 27/160 (17%)
 Frame = +3

Query  201  SPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLF  380
            S + RRLS+ F + S+PV +++  AW+SLQGRL+ A+EASS+R IGGGLS E A+AW+LF
Sbjct  23   SASRRRLSASFVERSRPVSSEKPTAWLSLQGRLLNADEASSARTIGGGLSAELALAWNLF  82

Query  381  TPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVNSFND  560
             P+QR LVVAVIGAAA+ +       I  L KSV+LRDQVL  MQQKLD LCE VN+  +
Sbjct  83   PPIQRFLVVAVIGAAAARSRKDLR--ICHLNKSVELRDQVLSSMQQKLDTLCELVNNSKE  140

Query  561  QLEPASNN-------------------------CWLCEQH  605
                A  N                         CW CEQH
Sbjct  141  YSTTAMENSCDKDGELQLNETFGIEKVKLVDCGCWHCEQH  180


 Score = 44.7 bits (104),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  715  EERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            EERRMSD+SD A  V SS DIQ+N + V QD Y L
Sbjct  212  EERRMSDMSDWASSVTSSADIQLNNLAVEQDIYNL  246



>ref|XP_002304758.2| hypothetical protein POPTR_0003s22260g [Populus trichocarpa]
 gb|EEE79737.2| hypothetical protein POPTR_0003s22260g [Populus trichocarpa]
Length=487

 Score =   126 bits (316),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 117/187 (63%), Gaps = 19/187 (10%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVSLS F+P ++P   RLSS F +PSQ V + R+L WV  Q +LV   EASS  AIG G 
Sbjct  18   LVSLSLFSPVSAPTSPRLSSQF-KPSQAVPSPRRLPWVDPQEQLVNEGEASSDIAIGIGF  76

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            + +E V  +LF+P+QR L+VA +G A + +   +  +I +L+KSV+LRD+VL  M+QKLD
Sbjct  77   NRDENVGSELFSPIQRFLIVAALGLAVAGSRKNR--VINQLKKSVELRDEVLSSMEQKLD  134

Query  528  NLCEQVNSFNDQLEPASNNC-------------WLCEQHK-HLPKLFPMTDSGRKMSMGE  665
            NLC+Q+N  N+Q E  +N+              W C++H+ H+  L  + +S  +M  G+
Sbjct  135  NLCDQLNDINNQEETKANDAFGCDRIEFVDGGSWQCDEHQEHVAGL--VGNSAVRMPRGD  192

Query  666  EVIKSEV  686
            EV+  ++
Sbjct  193  EVLHCKI  199


 Score = 34.7 bits (78),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 1/37 (3%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            EPEE++MSD SD      S+ +IQ+NT  + QD + L
Sbjct  206  EPEEQKMSDFSDWG-STGSAEEIQMNTFAIDQDMFNL  241



>gb|KFK25530.1| hypothetical protein AALP_AA8G127100 [Arabis alpina]
Length=456

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 105/175 (60%), Gaps = 35/175 (20%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSCFTQPS--QPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGG  344
            V LSPF   + P+  RL   FT     QPVR+ R LA++SL G LV + E +S+R+IGGG
Sbjct  18   VHLSPFF--SPPSSHRL---FTHHRRIQPVRSSRPLAYISLHGLLVNSNETTSARSIGGG  72

Query  345  LSPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKL  524
            LS EE +AW+LFTP QR+L+VAVIG   +AA SKKN +IR L+KSV LRDQ+L  MQQK 
Sbjct  73   LSREETLAWELFTPYQRLLIVAVIG--VAAAESKKNCVIRNLQKSVDLRDQLLSSMQQKF  130

Query  525  DNLCEQVNSFNDQLEPASNN--------------------------CWLCEQHKH  611
            ++LC+++N   DQ    + N                          CWLC+QH H
Sbjct  131  EDLCQELNLVKDQSGNGTKNFSDHDDLESTLQEKFGSEKIKFVDCGCWLCDQHHH  185



>ref|XP_006595048.1| PREDICTED: uncharacterized protein LOC100803132 [Glycine max]
Length=457

 Score =   115 bits (287),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 100/165 (61%), Gaps = 34/165 (21%)
 Frame = +3

Query  201  SPAPRRLSSCFTQPSQ----PVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL-SPEEAV  365
            S + RRLS+ F + S+         + +AWVSLQGRL+ A+EASS+R IGGG+ S E+A+
Sbjct  25   SGSRRRLSTSFVERSRLHFSSSEKLKPMAWVSLQGRLLNADEASSARTIGGGVFSAEQAI  84

Query  366  AWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQV  545
            AW+LF P+ R L+VAVIG  A+ A S+K+  I +L+ SVQLRDQVLL MQQKLD+LCE V
Sbjct  85   AWNLFPPIHRFLLVAVIG--AAVARSRKDFQICQLKNSVQLRDQVLLNMQQKLDSLCELV  142

Query  546  NSFNDQLEPASN-------------------------NCWLCEQH  605
               N+  E ++N                          CW CEQH
Sbjct  143  --VNNSKEHSTNKSCDKDGELQLNETLGAGKINFIDCGCWHCEQH  185


 Score = 44.7 bits (104),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  715  EERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            EERRMSD+SD A  V SS DIQ+N + V QD Y L
Sbjct  220  EERRMSDMSDWASSVTSSADIQLNNLAVEQDMYNL  254



>ref|XP_010913932.1| PREDICTED: uncharacterized protein LOC105039471 [Elaeis guineensis]
Length=511

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 94/117 (80%), Gaps = 5/117 (4%)
 Frame = +3

Query  207  APRRLSSCFTQPSQ--PVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLF  380
            + RRLSSCF++PS+  PV A+R LAWVSLQGRLVGA+E++S++A+G GL P EA AW+LF
Sbjct  28   SARRLSSCFSEPSRVVPV-ARRTLAWVSLQGRLVGAQESTSAKAVGQGLRPVEAAAWELF  86

Query  381  TPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVNS  551
            +P+ RVL+VA++  A + +   +   I +L++SV +RDQVLL MQ+KLD+LCEQ+NS
Sbjct  87   SPLHRVLIVAIVAVAVAESKKAQK--ISQLQRSVDIRDQVLLSMQKKLDDLCEQLNS  141



>ref|XP_003546996.1| PREDICTED: uncharacterized protein LOC100814573 [Glycine max]
Length=454

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 109/188 (58%), Gaps = 29/188 (15%)
 Frame = +3

Query  201  SPAPRRLSSCFTQPSQ-PVRAKRQL---AWVSLQGRLVGAEEASSSRAIGGGLSPEEAVA  368
            S + RRLS+ F + S+ PV +  +L   AW+SLQGRL+ A+EASS+R I GG S E A+A
Sbjct  25   SGSRRRLSTSFLELSRRPVSSSEKLKPMAWISLQGRLLNADEASSARTICGGFSAELALA  84

Query  369  WDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVN  548
            W+LF P+ R LVVAVIG   + A S+K+  I +L+ SV LRDQVLL MQQKLD+LCE VN
Sbjct  85   WNLFPPIHRFLVVAVIG--TAVARSRKDLQIFQLKNSVHLRDQVLLNMQQKLDSLCELVN  142

Query  549  S-----------------FNDQLEPASNN-----CWLCEQHKHLPKLFPMTDSGRKMSMG  662
            +                  N+ L     N     CW CEQH        M DS  + S  
Sbjct  143  NSKLHSTNKSCDKDGELQLNETLGSGKINFVDCGCWHCEQHSAFLNEL-MVDSVARTSGA  201

Query  663  EEVIKSEV  686
             EV++ ++
Sbjct  202  NEVLQYKM  209



>ref|XP_011042182.1| PREDICTED: uncharacterized protein LOC105137928 [Populus euphratica]
Length=495

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 99/145 (68%), Gaps = 3/145 (2%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            LVSLS F+P ++P   RLSS F +PSQ V + R+L WV  + +LV   EASS  AIG G 
Sbjct  20   LVSLSLFSPVSAPTSPRLSSQF-KPSQAVPSPRRLPWVDPEEQLVNEGEASSDIAIGIGF  78

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
            + +E V  DL +P+QR L+VA +G A + +   +  +I +L+KSV+LRD+VL  M+QKLD
Sbjct  79   NRDENVGSDLSSPIQRFLIVAALGLAVAESRKNR--LINQLKKSVELRDEVLSSMEQKLD  136

Query  528  NLCEQVNSFNDQLEPASNNCWLCEQ  602
            NLC+Q+N  N+Q E  +N+ + C++
Sbjct  137  NLCDQLNDINNQEETKANDAFGCDR  161



>ref|XP_008787278.1| PREDICTED: uncharacterized protein LOC103705371 isoform X1 [Phoenix 
dactylifera]
Length=511

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 99/135 (73%), Gaps = 6/135 (4%)
 Frame = +3

Query  207  APRRLSSCFTQPSQ--PVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLF  380
            + R LSSCF++ S+  PV A+R LAWVSLQGRLVGA+EA+S+ A+G GLSP EA AW++F
Sbjct  28   SARCLSSCFSETSRVVPV-ARRTLAWVSLQGRLVGAQEATSASAVGQGLSPVEAAAWEIF  86

Query  381  TPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVNSFN-  557
            +P+ RVL+VA++  A + +   +   I +L +S  LRDQVLL MQQKLD+LCEQ+NS   
Sbjct  87   SPLHRVLIVAIVAVAVAESKKSQK--ISQLRRSADLRDQVLLSMQQKLDDLCEQLNSSKY  144

Query  558  DQLEPASNNCWLCEQ  602
            + +E A  +C + +Q
Sbjct  145  ESMENARESCPVDDQ  159



>ref|XP_009131302.1| PREDICTED: uncharacterized protein LOC103855986 [Brassica rapa]
Length=448

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 99/177 (56%), Gaps = 36/177 (20%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQP-SQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGG  344
            L S S  TP   P+ R L S    P ++P+ +   L ++SLQG L   +EASS+R+IGGG
Sbjct  20   LASFSSLTPP--PSARLLLSRHVTPRTRPLESSTPLPYLSLQGLL---DEASSARSIGGG  74

Query  345  -LSPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQK  521
             LS EEA+AW+LFTP QR L+VAVIG AA+ +      ++ +L+ SV LRDQ+L  MQQK
Sbjct  75   GLSREEALAWELFTPYQRFLIVAVIGVAAAESKKND--VMAQLQNSVDLRDQLLSCMQQK  132

Query  522  LDNLCEQVNSFNDQLEPASN---------------------------NCWLCEQHKH  611
            LDNLC+Q++   DQ    S                             CWLC+QH H
Sbjct  133  LDNLCQQLSLTKDQSGDGSKVVDYDGDLQSAIKVKFGSENVKKIVDCGCWLCDQHHH  189



>ref|XP_003578326.1| PREDICTED: uncharacterized protein LOC100823716 [Brachypodium 
distachyon]
Length=456

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 84/115 (73%), Gaps = 6/115 (5%)
 Frame = +3

Query  219  LSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLFTPVQRV  398
            LSS F +P+ P    R+ AWVSLQGRLVGAE+A+S+     GLSPEEA+AW+LF+P+ RV
Sbjct  37   LSSRFCEPASP----RRHAWVSLQGRLVGAEDAASADVAAPGLSPEEAMAWELFSPLHRV  92

Query  399  LVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVNSFNDQ  563
            L+VA + AA+S ++  +   I +L++S+ +RD+VL  MQQKLD+L  ++NS   Q
Sbjct  93   LLVATVAAASSRSHDARR--IEQLQRSIHIRDEVLQSMQQKLDDLFAEMNSLQQQ  145



>tpg|DAA40394.1| TPA: hypothetical protein ZEAMMB73_682569 [Zea mays]
Length=261

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 86/122 (70%), Gaps = 9/122 (7%)
 Frame = +3

Query  210  PRR---LSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLF  380
            PRR   L+S F +P+ P    R+ AWVSLQGRL+GA+EAS + +   GL P+EAVAW+LF
Sbjct  29   PRRRCALASRFQEPAAP----RRHAWVSLQGRLIGADEASCAASAAPGLLPDEAVAWELF  84

Query  381  TPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVNSFND  560
            +P+ RVL+VA +  AA+++ S   + I +L++S+ LRD+VL  MQQKLD+L  +++S   
Sbjct  85   SPLHRVLLVATV--AAASSRSHAARRIEQLQRSIHLRDEVLESMQQKLDDLLVEMSSLQQ  142

Query  561  QL  566
            Q 
Sbjct  143  QY  144



>ref|NP_001183063.1| hypothetical protein [Zea mays]
 ref|XP_008668542.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACR35608.1| unknown [Zea mays]
 tpg|DAA40393.1| TPA: hypothetical protein ZEAMMB73_682569 [Zea mays]
Length=450

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 86/122 (70%), Gaps = 9/122 (7%)
 Frame = +3

Query  210  PRR---LSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLF  380
            PRR   L+S F +P+ P    R+ AWVSLQGRL+GA+EAS + +   GL P+EAVAW+LF
Sbjct  29   PRRRCALASRFQEPAAP----RRHAWVSLQGRLIGADEASCAASAAPGLLPDEAVAWELF  84

Query  381  TPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVNSFND  560
            +P+ RVL+VA +  AA+++ S   + I +L++S+ LRD+VL  MQQKLD+L  +++S   
Sbjct  85   SPLHRVLLVATV--AAASSRSHAARRIEQLQRSIHLRDEVLESMQQKLDDLLVEMSSLQQ  142

Query  561  QL  566
            Q 
Sbjct  143  QY  144



>emb|CDX78495.1| BnaA03g04070D [Brassica napus]
Length=444

 Score = 97.4 bits (241),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 95/175 (54%), Gaps = 36/175 (21%)
 Frame = +3

Query  168  LVSLSPFTPTASPAPRRLSSCFTQP-SQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGG  344
            L S S  TP   P+ R L S    P ++P+ +   L ++SLQG L   + ASS+R+IG  
Sbjct  20   LASFSSLTPP--PSARLLLSRHVTPRTRPLESSPPLPYLSLQGLL---DVASSARSIG--  72

Query  345  LSPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKL  524
            LS +E +AW+LFTP QR L+VAVIG AA+ +      +I +L+ SV LRDQ+L  MQQKL
Sbjct  73   LSRDETLAWELFTPYQRFLIVAVIGVAAAESKKNG--VIAQLQNSVDLRDQLLSCMQQKL  130

Query  525  DNLCEQVNSFNDQLEPASN--------------------------NCWLCEQHKH  611
            DNLC+Q++   DQ    S                            CWLC+QH H
Sbjct  131  DNLCQQLSLTKDQSGDGSKVVDLDGDLQQTFKEKFGSEKVKFVECGCWLCDQHHH  185


 Score = 28.1 bits (61),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQD  807
            EPEERRMS LSD      ++ ++  + +++ QD
Sbjct  203  EPEERRMSYLSDWCSSDTTAAEMHFDNLSLDQD  235



>gb|EAZ09565.1| hypothetical protein OsI_31844 [Oryza sativa Indica Group]
Length=456

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 85/116 (73%), Gaps = 6/116 (5%)
 Frame = +3

Query  219  LSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLFTPVQRV  398
            L+S F +P+ P    R+ AWVSLQGRLVGAEEA+S+ +   GL P+EAVAW+LF+P+ RV
Sbjct  36   LTSRFREPASP----RRHAWVSLQGRLVGAEEATSAASAAPGLPPDEAVAWELFSPLHRV  91

Query  399  LVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVNSFNDQL  566
            L+VA + AA+S ++  +   I +L++S+ +RD+VL  MQQKLD+L +++NS   Q 
Sbjct  92   LLVATVAAASSRSHEARR--IEQLQRSIHIRDEVLQSMQQKLDDLFDEMNSLQQQY  145



>ref|NP_001175908.1| Os09g0488600 [Oryza sativa Japonica Group]
 dbj|BAH94636.1| Os09g0488600 [Oryza sativa Japonica Group]
Length=456

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 85/116 (73%), Gaps = 6/116 (5%)
 Frame = +3

Query  219  LSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLFTPVQRV  398
            L+S F +P+ P    R+ AWVSLQGRLVGAEEA+S+ +   GL P+EAVAW+LF+P+ RV
Sbjct  36   LTSRFREPASP----RRHAWVSLQGRLVGAEEATSAASAAPGLPPDEAVAWELFSPLHRV  91

Query  399  LVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVNSFNDQL  566
            L+VA + AA+S ++  +   + +L++S+ +RD+VL  MQQKLD+L +++NS   Q 
Sbjct  92   LLVATVAAASSRSHEARR--VEQLQRSIHIRDEVLQSMQQKLDDLFDEMNSLQQQY  145



>emb|CDX70483.1| BnaC03g05670D [Brassica napus]
Length=379

 Score = 90.9 bits (224),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 68/125 (54%), Gaps = 34/125 (27%)
 Frame = +3

Query  321  SSRAIGGG-LSPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQ  497
            S+R+IGGG LS EEA+AW+LFTP QR L+VAVIG A  +       +I +L+ SV LRDQ
Sbjct  17   SARSIGGGGLSREEALAWELFTPYQRFLIVAVIGVAKKSG------VIAQLQNSVDLRDQ  70

Query  498  VLLKMQQKLDNLCEQVNSFNDQLEPASN---------------------------NCWLC  596
            +L  MQQKLD LC+Q+N   DQ    S                             CWLC
Sbjct  71   LLSGMQQKLDALCKQLNHTKDQSGNGSKVVDLDDDLQSAFREKFGSENVKKIVECGCWLC  130

Query  597  EQHKH  611
            +QH H
Sbjct  131  DQHHH  135


 Score = 28.5 bits (62),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQD  807
            EPEERRMS LSD      ++ ++  + +++ QD
Sbjct  150  EPEERRMSYLSDWCSSDTTAAEMHFDNLSLDQD  182



>ref|XP_002460453.1| hypothetical protein SORBIDRAFT_02g028340 [Sorghum bicolor]
 gb|EER96974.1| hypothetical protein SORBIDRAFT_02g028340 [Sorghum bicolor]
Length=451

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 87/122 (71%), Gaps = 9/122 (7%)
 Frame = +3

Query  210  PRR---LSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLF  380
            PRR   L+S F +P+ P    R+ AWVSLQGRL+GAEEASS+ +   GL P+EAVAW+LF
Sbjct  29   PRRRCALASRFREPAAP----RRHAWVSLQGRLIGAEEASSAASAAPGLPPDEAVAWELF  84

Query  381  TPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVNSFND  560
            +P+ RVL+VA +  AA+++ S   + I +L++S+ LRD+VL  MQQKLD+L  +++S   
Sbjct  85   SPLHRVLLVATV--AAASSRSHAARRIEQLQRSIHLRDEVLEGMQQKLDDLLVEMSSLQQ  142

Query  561  QL  566
            Q 
Sbjct  143  QY  144



>emb|CDX91156.1| BnaC02g04410D [Brassica napus]
Length=420

 Score = 87.0 bits (214),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 90/152 (59%), Gaps = 15/152 (10%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLS  350
            V LSPF+  A P P        + +QP+++  +  + SL+  L   + + S+ +IG    
Sbjct  18   VHLSPFSSLAPPPPSARLHFTRRRTQPLQSSPR--YSSLKSLL--DDPSGSALSIGR---  70

Query  351  PEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDN  530
             +E +AW+LFTP QR+++VAVIGAAA+ +      +IR+L+KS+ LRDQ L  MQQ LD+
Sbjct  71   -DETLAWELFTPHQRLMLVAVIGAAAADSKKNG--LIRQLQKSIDLRDQALTGMQQMLDD  127

Query  531  LCEQ-----VNSFNDQLEPASNNCWLCEQHKH  611
            LC+Q     V+  +D LE       LC+QH H
Sbjct  128  LCQQLSLVKVSGHDDDLESKFKEKLLCDQHHH  159


 Score = 28.1 bits (61),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQDDYLL  819
            E EERR+S LSD    V S+ ++  + +++ QD + L
Sbjct  177  EQEERRLSYLSDWCSSVTSAAELHFDNLSLDQDMFSL  213



>ref|XP_004957186.1| PREDICTED: uncharacterized protein LOC101762101 [Setaria italica]
Length=447

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 84/117 (72%), Gaps = 6/117 (5%)
 Frame = +3

Query  219  LSSCFTQPSQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLFTPVQRV  398
            L+S F +P+ P    R+ AWVSLQGRLVGAEEASS+ +   GL P+EAVAW+LF+P+ RV
Sbjct  36   LASRFREPAAP----RRHAWVSLQGRLVGAEEASSAASAAPGLPPDEAVAWELFSPLHRV  91

Query  399  LVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVNSFNDQLE  569
            L+VA +  AA+++ S   + I +L++S+ LRD+VL  MQQKLD+L  ++N     ++
Sbjct  92   LLVATV--AAASSRSHAARRIEQLQRSINLRDEVLEGMQQKLDDLLVEMNCLQQHVK  146



>emb|CDX85682.1| BnaA02g01310D [Brassica napus]
Length=428

 Score = 83.6 bits (205),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 99/166 (60%), Gaps = 32/166 (19%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSCFTQP-SQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            V LSPF+  A P   RL   FT+  +QP+++ R   + SL+  L   +  SS+R+IG   
Sbjct  18   VHLSPFSSLAPPPSARLH--FTRRRTQPLQSSR---YTSLKSLL--DDPTSSARSIGR--  68

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
              +EA+AW+LFTP QRV++VAVIGAAA+ +      +IR+L KS+ L+DQVL  MQQKLD
Sbjct  69   --DEALAWELFTPHQRVMIVAVIGAAAAESKKNG--VIRQLRKSIDLKDQVLTGMQQKLD  124

Query  528  NLCEQ-----VNSFNDQLEP------ASNN-------CWLCEQHKH  611
            +LC+Q     V+  +D LE        S N       C LC+QH H
Sbjct  125  DLCQQLSLVKVSGHDDDLESKFREKFGSENVKFVECGCLLCDQHHH  170


 Score = 27.3 bits (59),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQD  807
            E EERR+S LSD    V S+ ++  + +++ QD
Sbjct  188  EQEERRLSYLSDWCSSVTSAAELHFDNLSLDQD  220



>ref|XP_009125870.1| PREDICTED: uncharacterized protein LOC103850833 [Brassica rapa]
Length=429

 Score = 83.6 bits (205),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 99/166 (60%), Gaps = 32/166 (19%)
 Frame = +3

Query  171  VSLSPFTPTASPAPRRLSSCFTQP-SQPVRAKRQLAWVSLQGRLVGAEEASSSRAIGGGL  347
            V LSPF+  A P   RL   FT+  +QP+++ R   + SL+  L   +  SS+R+IG   
Sbjct  18   VHLSPFSSLAPPPSARLH--FTRRRTQPLQSSR---YTSLKSLL--DDPTSSARSIGR--  68

Query  348  SPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLD  527
              +EA+AW+LFTP QRV++VAVIGAAA+ +      +IR+L KS+ L+DQVL  MQQKLD
Sbjct  69   --DEALAWELFTPHQRVMIVAVIGAAAAESKKNG--VIRQLRKSIDLKDQVLTGMQQKLD  124

Query  528  NLCEQ-----VNSFNDQLEP------ASNN-------CWLCEQHKH  611
            +LC+Q     V+  +D LE        S N       C LC+QH H
Sbjct  125  DLCQQLSLVKVSGHDDDLESKFREKFGSENVKFVECGCLLCDQHHH  170


 Score = 27.3 bits (59),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQD  807
            E EERR+S LSD    V S+ ++  + +++ QD
Sbjct  188  EQEERRLSYLSDWCSSVTSAAELHFDNLSLDQD  220



>gb|ERN03580.1| hypothetical protein AMTR_s00042p00126370 [Amborella trichopoda]
Length=441

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 72/103 (70%), Gaps = 3/103 (3%)
 Frame = +3

Query  270  LAWVSLQGRLVGAEEAS-SSRAIGGGLSPEEAVAWDLFTPVQRVLVVAVIGaaasaansk  446
            LAW++L+GRLVG      SS  +G   S EEAV+W+LFTP+QRVL+VAV+ AA++  N+ 
Sbjct  51   LAWINLEGRLVGCPANDLSSDIVGLVKSSEEAVSWELFTPIQRVLIVAVVAAASAKCNNN  110

Query  447  knkM--IRELEKSVQLRDQVLLKMQQKLDNLCEQVNSFNDQLE  569
             +++  I  LE+S+Q RD+VL  MQQKLD LC ++    DQ E
Sbjct  111  NHQLRRIAHLERSIQDRDEVLHNMQQKLDELCGRMGFMQDQPE  153



>ref|XP_011622427.1| PREDICTED: uncharacterized protein LOC18431724 [Amborella trichopoda]
Length=438

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 72/103 (70%), Gaps = 3/103 (3%)
 Frame = +3

Query  270  LAWVSLQGRLVGAEEAS-SSRAIGGGLSPEEAVAWDLFTPVQRVLVVAVIGaaasaansk  446
            LAW++L+GRLVG      SS  +G   S EEAV+W+LFTP+QRVL+VAV+ AA++  N+ 
Sbjct  51   LAWINLEGRLVGCPANDLSSDIVGLVKSSEEAVSWELFTPIQRVLIVAVVAAASAKCNNN  110

Query  447  knkM--IRELEKSVQLRDQVLLKMQQKLDNLCEQVNSFNDQLE  569
             +++  I  LE+S+Q RD+VL  MQQKLD LC ++    DQ E
Sbjct  111  NHQLRRIAHLERSIQDRDEVLHNMQQKLDELCGRMGFMQDQPE  153



>gb|KHN33331.1| hypothetical protein glysoja_005373 [Glycine soja]
Length=368

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 70/144 (49%), Gaps = 25/144 (17%)
 Frame = +3

Query  354  EEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIRELEKSVQLRDQVLLKMQQKLDNL  533
            E A+AW+LF P+ R LVVAVIG A + +       I +L+ SV LRDQVLL MQQKLD+L
Sbjct  23   ELALAWNLFPPIHRFLVVAVIGTAVARSRKDL--QIFQLKNSVHLRDQVLLNMQQKLDSL  80

Query  534  CEQVNS-----------------FNDQLEPASNN-----CWLCEQHKHLPKLFPMTDSGR  647
            CE VN+                  N+ L     N     CW CEQH        M DS  
Sbjct  81   CELVNNSKLHSTNKSCDKDGELQLNETLGSGKINFVDCGCWHCEQHSAFLNEL-MVDSVA  139

Query  648  KMSMGEEVIKSEVLIPANXNRTRR  719
            + S   EV++ ++         RR
Sbjct  140  RTSGANEVLQYKMPFSNEDQEERR  163



>gb|EEE69948.1| hypothetical protein OsJ_29828 [Oryza sativa Japonica Group]
Length=433

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 69/92 (75%), Gaps = 2/92 (2%)
 Frame = +3

Query  291  GRLVGAEEASSSRAIGGGLSPEEAVAWDLFTPVQRVLVVAVIGaaasaanskknkMIREL  470
            GRLVGAEEA+S+ +   GL P+EAVAW+LF+P+ RVL+VA + AA+S ++  +   + +L
Sbjct  33   GRLVGAEEATSAASAAPGLPPDEAVAWELFSPLHRVLLVATVAAASSRSHEARR--VEQL  90

Query  471  EKSVQLRDQVLLKMQQKLDNLCEQVNSFNDQL  566
            ++S+ +RD+VL  MQQKLD+L +++NS   Q 
Sbjct  91   QRSIHIRDEVLQSMQQKLDDLFDEMNSLQQQY  122



>ref|XP_001780022.1| predicted protein [Physcomitrella patens]
 gb|EDQ55125.1| predicted protein [Physcomitrella patens]
Length=1262

 Score = 69.7 bits (169),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 67/102 (66%), Gaps = 0/102 (0%)
 Frame = +3

Query  267  QLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLFTPVQRVLVVAVIGaaasaansk  446
            + A+VSL GRL+ AE A+S  +IGG L  +EA AW+ F P+QRVL+VA+  AAA+ A  +
Sbjct  275  KFAYVSLDGRLINAELATSISSIGGKLGDQEAQAWEDFAPIQRVLIVALSAAAAAEAKHR  334

Query  447  knkMIRELEKSVQLRDQVLLKMQQKLDNLCEQVNSFNDQLEP  572
              + I  L K+V+ R+  L+ ++Q+   LC+Q ++   Q+ P
Sbjct  335  NREEIDLLFKAVEKRENELILLRQQFSLLCKQNHTDTLQIHP  376



>ref|XP_001778551.1| predicted protein [Physcomitrella patens]
 gb|EDQ56581.1| predicted protein [Physcomitrella patens]
Length=1215

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +3

Query  270  LAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLFTPVQRVLVVAVIGaaasaanskk  449
            +A +SL GR++ A  A+SSR IGG L  EEA AWD F P+QRVL+VAV  AAA+++    
Sbjct  194  MAHISLDGRIINAVSATSSRRIGGDLGEEEAQAWDCFAPLQRVLIVAVAAAAAASSKHVN  253

Query  450  nkMIRELEKSVQLRDQVLLKMQQKLDNLCEQV  545
             K I  L+K+V  ++  L  M+++L NL  QV
Sbjct  254  RKEIDRLQKAVNAQEDALSLMRRELSNLWGQV  285



>ref|XP_008366179.1| PREDICTED: uncharacterized protein LOC103429832 isoform X2 [Malus 
domestica]
Length=363

 Score = 46.6 bits (109),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 25/86 (29%)
 Frame = +3

Query  510  MQQKLDNLCEQVNSFNDQ---LEPAS---------------------NNCWLCEQHKHLP  617
            MQQKLD+LCEQ+N+  D    L P++                       CWLC+QH+ LP
Sbjct  1    MQQKLDSLCEQMNNIKDHPGTLVPSTLENVELQRNESFSSHKIKFVDCGCWLCDQHRDLP  60

Query  618  KLFPMTDSGRKMSMGEEVIKSEVLIP  695
                + ++  K S G+ +++ +V +P
Sbjct  61   NGL-VDNNAEKASDGDHILRYKVSLP  85


 Score = 42.7 bits (99),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDIQVNTVTVYQD  807
            E EERRMSDLSDL   V S+ DIQ+N V + QD
Sbjct  89   EQEERRMSDLSDLCSSVTSAADIQLNAVDIEQD  121



>ref|XP_001753723.1| predicted protein [Physcomitrella patens]
 gb|EDQ81475.1| predicted protein [Physcomitrella patens]
Length=1280

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +3

Query  270  LAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLFTPVQRVLVVAVIGaaasaanskk  449
            +A +SL GR+  A  A+SS  IGG L  EEA AWD F P+QRVL+VAV  AAA+++  K 
Sbjct  217  MAHISLDGRITNAVSATSSATIGGDLGEEEAQAWDCFAPLQRVLIVAVAAAAAASSKHKN  276

Query  450  nkMIRELEKSVQLRDQVLLKMQQKLDNLCEQV  545
            +K I  L+K V  ++  L  M+++L NL +QV
Sbjct  277  HKEINRLQKEVHAQENALSLMRRELSNLWDQV  308



>ref|XP_008366178.1| PREDICTED: uncharacterized protein LOC103429832 isoform X1 [Malus 
domestica]
Length=364

 Score = 46.6 bits (109),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 25/86 (29%)
 Frame = +3

Query  510  MQQKLDNLCEQVNSFNDQ---LEPAS---------------------NNCWLCEQHKHLP  617
            MQQKLD+LCEQ+N+  D    L P++                       CWLC+QH+ LP
Sbjct  1    MQQKLDSLCEQMNNIKDHPGTLVPSTLENVELQRNESFSSHKIKFVDCGCWLCDQHRDLP  60

Query  618  KLFPMTDSGRKMSMGEEVIKSEVLIP  695
                + ++  K S G+ +++ +V +P
Sbjct  61   NGL-VDNNAEKASDGDHILRYKVSLP  85


 Score = 38.1 bits (87),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 1/34 (3%)
 Frame = +1

Query  709  EPEERRMSDLSDLAPXVASSVDI-QVNTVTVYQD  807
            E EERRMSDLSDL   V S+ DI Q+N V + QD
Sbjct  89   EQEERRMSDLSDLCSSVTSAADIQQLNAVDIEQD  122



>ref|XP_001775595.1| predicted protein [Physcomitrella patens]
 gb|EDQ59542.1| predicted protein [Physcomitrella patens]
Length=1254

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +3

Query  267  QLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLFTPVQRVLVVAV  413
            + A++SL GRL+ AE A+S  +IGG L  +EA AW+ F P+QRVL+VAV
Sbjct  226  KFAYISLDGRLINAELATSVTSIGGKLGDKEAQAWEDFAPMQRVLIVAV  274



>ref|XP_001769979.1| predicted protein [Physcomitrella patens]
 gb|EDQ65155.1| predicted protein [Physcomitrella patens]
Length=1392

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = +3

Query  258  AKRQLAWVSLQGRLVGAEEASSSRAIGGGLSPEEAVAWDLFTPVQRVLVVAVIGaaasaa  437
            A  + A++SL GRLV AE A+S+  IGG L  EEA AW+ F P+ RVL+VA+  AAASAA
Sbjct  317  ASGKFAYISLDGRLVNAELATSAINIGGDLGAEEAQAWEDFAPMYRVLIVALSAAAASAA  376

Query  438  nskknkMIRELEKSVQLRDQVLLKMQQKLDN  530
              K +  I+ L K V  +++ L+ ++Q+L +
Sbjct  377  KDKNSVEIQSLLKMVTEQEKELVILRQQLSD  407



>ref|XP_004486943.1| PREDICTED: uncharacterized serine-rich protein C215.13-like isoform 
X4 [Cicer arietinum]
Length=390

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 44/98 (45%), Gaps = 25/98 (26%)
 Frame = +3

Query  459  IRELEKSVQLRDQVLLKMQQKLDNLCEQVNSFNDQLEPASNN------------------  584
            I  L+KSV+LRDQVL  MQQKLDNLCEQ+NS  +    A N                   
Sbjct  47   ILNLKKSVELRDQVLSSMQQKLDNLCEQLNSSKENTVTAVNKLSTKDEELLLDETFGSEK  106

Query  585  -------CWLCEQHKHLPKLFPMTDSGRKMSMGEEVIK  677
                   CW CE+H           S R+ S   EV++
Sbjct  107  IKFVDCGCWHCEEHSSFCDELMQGASSRRASSANEVLQ  144



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1738401790104