BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10858

Length=821
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006359369.1|  PREDICTED: dynamin-related protein 3A-like         347   3e-109   Solanum tuberosum [potatoes]
ref|XP_009768280.1|  PREDICTED: dynamin-related protein 3A-like         345   6e-109   Nicotiana sylvestris
ref|XP_002269774.2|  PREDICTED: dynamin-related protein 3B isofor...    343   4e-108   Vitis vinifera
ref|XP_009599814.1|  PREDICTED: dynamin-related protein 3A-like         343   7e-108   Nicotiana tomentosiformis
ref|XP_006351713.1|  PREDICTED: dynamin-related protein 3A-like         337   1e-105   Solanum tuberosum [potatoes]
ref|XP_011092457.1|  PREDICTED: dynamin-related protein 3A-like         334   1e-104   Sesamum indicum [beniseed]
gb|KJB32126.1|  hypothetical protein B456_005G226100                    331   2e-104   Gossypium raimondii
gb|KJB32129.1|  hypothetical protein B456_005G226100                    333   5e-104   Gossypium raimondii
gb|KJB47248.1|  hypothetical protein B456_008G017900                    332   7e-104   Gossypium raimondii
ref|XP_007042814.1|  Dynamin-related protein 3A isoform 2               332   1e-103   
gb|KJB47251.1|  hypothetical protein B456_008G017900                    332   1e-103   Gossypium raimondii
gb|KJB47250.1|  hypothetical protein B456_008G017900                    332   1e-103   Gossypium raimondii
ref|XP_007042813.1|  Dynamin-related protein 3A isoform 1               332   1e-103   Theobroma cacao [chocolate]
gb|KJB47249.1|  hypothetical protein B456_008G017900                    331   1e-103   Gossypium raimondii
ref|XP_011087964.1|  PREDICTED: dynamin-related protein 3A              331   2e-103   Sesamum indicum [beniseed]
gb|KHF99511.1|  Dynamin-related 3A -like protein                        330   3e-103   Gossypium arboreum [tree cotton]
ref|XP_004250727.1|  PREDICTED: dynamin-related protein 3A-like i...    329   1e-102   Solanum lycopersicum
ref|XP_010313067.1|  PREDICTED: dynamin-related protein 3A-like i...    329   1e-102   Solanum lycopersicum
emb|CDO97375.1|  unnamed protein product                                327   1e-101   Coffea canephora [robusta coffee]
gb|KCW56936.1|  hypothetical protein EUGRSUZ_I02611                     321   1e-101   Eucalyptus grandis [rose gum]
gb|KCW56935.1|  hypothetical protein EUGRSUZ_I02611                     322   2e-101   Eucalyptus grandis [rose gum]
ref|XP_008348876.1|  PREDICTED: dynamin-related protein 3A-like         312   1e-100   
ref|XP_010029998.1|  PREDICTED: dynamin-related protein 3A isofor...    323   3e-100   Eucalyptus grandis [rose gum]
ref|XP_010029997.1|  PREDICTED: dynamin-related protein 3A isofor...    322   4e-100   Eucalyptus grandis [rose gum]
ref|XP_010029996.1|  PREDICTED: dynamin-related protein 3A isofor...    322   6e-100   Eucalyptus grandis [rose gum]
gb|KHG14620.1|  Dynamin-related 3A -like protein                        322   7e-100   Gossypium arboreum [tree cotton]
ref|XP_010029995.1|  PREDICTED: dynamin-related protein 3A isofor...    322   7e-100   Eucalyptus grandis [rose gum]
gb|EYU39106.1|  hypothetical protein MIMGU_mgv1a001369mg                322   8e-100   Erythranthe guttata [common monkey flower]
gb|KJB79569.1|  hypothetical protein B456_013G054900                    322   8e-100   Gossypium raimondii
gb|KGN53891.1|  Dynamin                                                 315   1e-99    Cucumis sativus [cucumbers]
ref|XP_010277557.1|  PREDICTED: dynamin-related protein 3A-like         321   2e-99    Nelumbo nucifera [Indian lotus]
ref|XP_010254582.1|  PREDICTED: dynamin-related protein 3A-like         321   2e-99    Nelumbo nucifera [Indian lotus]
ref|XP_002532763.1|  dynamin, putative                                  320   4e-99    Ricinus communis
ref|XP_006377100.1|  hypothetical protein POPTR_0012s14790g             303   1e-98    
ref|XP_004292471.1|  PREDICTED: dynamin-related protein 3A              318   2e-98    Fragaria vesca subsp. vesca
ref|XP_002309855.2|  hypothetical protein POPTR_0007s02960g             317   3e-98    
ref|XP_004147508.1|  PREDICTED: dynamin-related protein 3A              315   2e-97    Cucumis sativus [cucumbers]
ref|XP_009366330.1|  PREDICTED: dynamin-related protein 3A-like         315   2e-97    Pyrus x bretschneideri [bai li]
ref|XP_011003246.1|  PREDICTED: dynamin-related protein 3A-like i...    315   3e-97    Populus euphratica
ref|XP_009343811.1|  PREDICTED: dynamin-related protein 3A-like         315   3e-97    Pyrus x bretschneideri [bai li]
ref|XP_011003245.1|  PREDICTED: dynamin-related protein 3A-like i...    315   3e-97    Populus euphratica
gb|EYU18402.1|  hypothetical protein MIMGU_mgv1a001513mg                314   4e-97    Erythranthe guttata [common monkey flower]
ref|XP_006597367.1|  PREDICTED: dynamin-related protein 3A-like i...    311   4e-97    
ref|XP_008237240.1|  PREDICTED: dynamin-related protein 3A              314   7e-97    Prunus mume [ume]
ref|XP_010315139.1|  PREDICTED: dynamin-related protein 3B-like         313   1e-96    Solanum lycopersicum
ref|XP_008373223.1|  PREDICTED: dynamin-related protein 3A-like         313   1e-96    Malus domestica [apple tree]
ref|XP_007148356.1|  hypothetical protein PHAVU_006G201400g             313   1e-96    Phaseolus vulgaris [French bean]
gb|KDO44159.1|  hypothetical protein CISIN_1g003355mg                   310   2e-96    Citrus sinensis [apfelsine]
ref|XP_006423649.1|  hypothetical protein CICLE_v10027825mg             310   2e-96    
gb|KDO44158.1|  hypothetical protein CISIN_1g003355mg                   310   2e-96    Citrus sinensis [apfelsine]
ref|XP_009590784.1|  PREDICTED: dynamin-related protein 3B-like i...    311   4e-96    Nicotiana tomentosiformis
ref|XP_007199665.1|  hypothetical protein PRUPE_ppa001399mg             312   4e-96    Prunus persica
ref|XP_009590783.1|  PREDICTED: dynamin-related protein 3B-like i...    311   8e-96    Nicotiana tomentosiformis
ref|XP_003545730.1|  PREDICTED: dynamin-related protein 3A-like i...    311   8e-96    Glycine max [soybeans]
gb|KDO44157.1|  hypothetical protein CISIN_1g003355mg                   311   9e-96    Citrus sinensis [apfelsine]
ref|XP_009793686.1|  PREDICTED: dynamin-related protein 3B-like         311   9e-96    Nicotiana sylvestris
ref|XP_006423650.1|  hypothetical protein CICLE_v10027825mg             311   1e-95    Citrus clementina [clementine]
ref|XP_008382203.1|  PREDICTED: dynamin-related protein 3A              310   2e-95    
ref|XP_009368315.1|  PREDICTED: dynamin-related protein 3A-like         310   2e-95    Pyrus x bretschneideri [bai li]
ref|XP_010112241.1|  Dynamin-related protein 3A                         309   5e-95    Morus notabilis
ref|XP_006373004.1|  dynamin-like family protein                        308   1e-94    
ref|XP_011006401.1|  PREDICTED: dynamin-related protein 3A-like i...    308   1e-94    Populus euphratica
ref|XP_011006400.1|  PREDICTED: dynamin-related protein 3A-like i...    308   2e-94    Populus euphratica
ref|XP_006373005.1|  hypothetical protein POPTR_0017s06930g             307   2e-94    
ref|XP_006487698.1|  PREDICTED: dynamin-related protein 3A-like         308   3e-94    Citrus sinensis [apfelsine]
gb|EYU18412.1|  hypothetical protein MIMGU_mgv1a022072mg                305   3e-94    Erythranthe guttata [common monkey flower]
ref|XP_010527015.1|  PREDICTED: dynamin-related protein 3A-like i...    307   4e-94    Tarenaya hassleriana [spider flower]
ref|XP_010527016.1|  PREDICTED: dynamin-related protein 3A-like i...    306   4e-94    Tarenaya hassleriana [spider flower]
ref|XP_010527014.1|  PREDICTED: dynamin-related protein 3A-like i...    306   5e-94    Tarenaya hassleriana [spider flower]
ref|XP_010645184.1|  PREDICTED: dynamin-related protein 3B isofor...    305   1e-93    Vitis vinifera
ref|XP_011658829.1|  PREDICTED: dynamin-related protein 3A isofor...    304   2e-93    Cucumis sativus [cucumbers]
ref|XP_008455130.1|  PREDICTED: dynamin-related protein 3A-like i...    304   2e-93    Cucumis melo [Oriental melon]
ref|XP_011658828.1|  PREDICTED: dynamin-related protein 3A isofor...    304   2e-93    Cucumis sativus [cucumbers]
ref|XP_008455128.1|  PREDICTED: dynamin-related protein 3A-like i...    304   4e-93    Cucumis melo [Oriental melon]
ref|XP_008455129.1|  PREDICTED: dynamin-related protein 3A-like i...    303   4e-93    Cucumis melo [Oriental melon]
emb|CBI38239.3|  unnamed protein product                                305   7e-93    Vitis vinifera
ref|XP_008454460.1|  PREDICTED: dynamin-related protein 3A-like         302   2e-92    Cucumis melo [Oriental melon]
ref|XP_009120625.1|  PREDICTED: dynamin-related protein 3A isofor...    301   3e-92    Brassica rapa
ref|XP_009120554.1|  PREDICTED: dynamin-related protein 3A isofor...    301   3e-92    Brassica rapa
ref|XP_010548840.1|  PREDICTED: dynamin-related protein 3A-like         302   3e-92    Tarenaya hassleriana [spider flower]
gb|KHN19022.1|  Dynamin-related protein 3A                              301   5e-92    Glycine soja [wild soybean]
ref|XP_003543135.1|  PREDICTED: dynamin-related protein 3A-like         301   5e-92    Glycine max [soybeans]
ref|XP_010691383.1|  PREDICTED: dynamin-related protein 3A isofor...    300   7e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010691382.1|  PREDICTED: dynamin-related protein 3A isofor...    300   8e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_012081387.1|  PREDICTED: dynamin-related protein 3A              300   1e-91    Jatropha curcas
emb|CDX75370.1|  BnaA01g03320D                                          300   2e-91    
ref|XP_006852885.1|  PREDICTED: dynamin-related protein 3A              298   6e-91    Amborella trichopoda
ref|XP_003522885.1|  PREDICTED: dynamin-related protein 3A-like         297   1e-90    Glycine max [soybeans]
ref|XP_008802260.1|  PREDICTED: dynamin-related protein 3A-like         296   4e-90    Phoenix dactylifera
emb|CDY28314.1|  BnaC03g66450D                                          295   4e-90    Brassica napus [oilseed rape]
gb|KHN34016.1|  Dynamin-related protein 3A                              295   1e-89    Glycine soja [wild soybean]
ref|XP_010926713.1|  PREDICTED: dynamin-related protein 3A-like         294   2e-89    Elaeis guineensis
ref|XP_006412330.1|  hypothetical protein EUTSA_v10024438mg             294   2e-89    Eutrema salsugineum [saltwater cress]
ref|XP_009411851.1|  PREDICTED: dynamin-related protein 3A-like         294   2e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008794571.1|  PREDICTED: dynamin-related protein 3A-like         294   2e-89    
gb|KFK29987.1|  hypothetical protein AALP_AA7G203100                    293   3e-89    Arabis alpina [alpine rockcress]
gb|EEE55903.1|  hypothetical protein OsJ_04571                          293   4e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010467215.1|  PREDICTED: dynamin-related protein 3B-like         284   5e-89    
ref|NP_001045220.1|  Os01g0920400                                       293   6e-89    
ref|XP_006645242.1|  PREDICTED: dynamin-related protein 3A-like         292   8e-89    Oryza brachyantha
gb|AAK59412.1|  putative dynamin protein ADL2                           284   9e-89    Arabidopsis thaliana [mouse-ear cress]
gb|EEC72053.1|  hypothetical protein OsI_04962                          293   9e-89    Oryza sativa Indica Group [Indian rice]
ref|XP_008654834.1|  PREDICTED: uncharacterized protein LOC100279...    292   1e-88    
emb|CDY46101.1|  BnaA03g52670D                                          291   1e-88    Brassica napus [oilseed rape]
ref|XP_004971078.1|  PREDICTED: dynamin-related protein 3A-like         291   2e-88    Setaria italica
ref|XP_008673232.1|  PREDICTED: uncharacterized protein LOC100383...    291   2e-88    
gb|AID60088.1|  dynamin-like protein 2                                  291   2e-88    Brassica napus [oilseed rape]
ref|XP_002458996.1|  hypothetical protein SORBIDRAFT_03g044010          291   2e-88    Sorghum bicolor [broomcorn]
ref|XP_009138202.1|  PREDICTED: dynamin-related protein 3A-like         291   2e-88    Brassica rapa
ref|XP_006583773.1|  PREDICTED: dynamin-related protein 3A-like         291   3e-88    Glycine max [soybeans]
gb|ABN05857.1|  Dynamin central region; Dynamin                         279   7e-88    Medicago truncatula
emb|CDX68994.1|  BnaC01g04590D                                          289   9e-88    
ref|XP_003532597.1|  PREDICTED: dynamin-related protein 3A-like         289   1e-87    Glycine max [soybeans]
emb|CDM85737.1|  unnamed protein product                                288   3e-87    Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ99253.1|  predicted protein                                      288   3e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010927716.1|  PREDICTED: dynamin-related protein 3A-like         287   7e-87    Elaeis guineensis
ref|NP_001190906.1|  dynamin-related protein 3A                         285   5e-86    Arabidopsis thaliana [mouse-ear cress]
gb|KFK39955.1|  hypothetical protein AALP_AA3G311000                    284   5e-86    Arabis alpina [alpine rockcress]
dbj|BAB85644.1|  dynamin like protein 2a                                285   5e-86    Arabidopsis thaliana [mouse-ear cress]
gb|AAC61784.1|  similar to dynamin-like protein encoded by GenBan...    285   6e-86    Arabidopsis thaliana [mouse-ear cress]
ref|NP_567931.1|  dynamin-related protein 3A                            285   6e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869201.1|  hypothetical protein ARALYDRAFT_491315             285   6e-86    
ref|XP_003593277.1|  Dynamin-related protein 3A                         277   8e-86    
ref|XP_001761534.1|  predicted protein                                  283   8e-86    
ref|XP_003564945.1|  PREDICTED: dynamin-related protein 3B-like         284   9e-86    Brachypodium distachyon [annual false brome]
ref|XP_007159159.1|  hypothetical protein PHAVU_002G213900g             283   2e-85    Phaseolus vulgaris [French bean]
ref|XP_010518214.1|  PREDICTED: dynamin-related protein 3B isofor...    282   2e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010488879.1|  PREDICTED: dynamin-related protein 3B-like         282   3e-85    Camelina sativa [gold-of-pleasure]
ref|XP_001775158.1|  predicted protein                                  281   4e-85    
ref|XP_010436273.1|  PREDICTED: dynamin-related protein 3A-like         275   4e-85    Camelina sativa [gold-of-pleasure]
ref|XP_002984035.1|  hypothetical protein SELMODRAFT_119205             281   5e-85    
emb|CDY48440.1|  BnaA08g11490D                                          282   6e-85    Brassica napus [oilseed rape]
ref|XP_009108779.1|  PREDICTED: dynamin-related protein 3A-like i...    282   7e-85    Brassica rapa
ref|XP_009108778.1|  PREDICTED: dynamin-related protein 3A-like i...    282   7e-85    Brassica rapa
gb|KHN46250.1|  Dynamin-related protein 3A                              281   9e-85    Glycine soja [wild soybean]
gb|KEH31202.1|  dynamin 3A-like protein                                 280   9e-85    Medicago truncatula
emb|CDX72418.1|  BnaC07g44400D                                          281   1e-84    
ref|XP_010447212.1|  PREDICTED: dynamin-related protein 3A-like i...    281   1e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010447213.1|  PREDICTED: dynamin-related protein 3A-like i...    281   1e-84    Camelina sativa [gold-of-pleasure]
gb|AAM61220.1|  dynamin-like protein                                    269   2e-84    Arabidopsis thaliana [mouse-ear cress]
gb|AAD25856.2|  dynamin-like protein                                    269   2e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003608404.1|  Dynamin-related protein 3A                         280   2e-84    
gb|AES90601.2|  dynamin 3A-like protein                                 280   2e-84    Medicago truncatula
ref|XP_001777446.1|  predicted protein                                  281   2e-84    
ref|XP_006409667.1|  hypothetical protein EUTSA_v10022566mg             280   3e-84    Eutrema salsugineum [saltwater cress]
ref|XP_006283135.1|  hypothetical protein CARUB_v10004162mg             280   4e-84    Capsella rubella
ref|XP_002960102.1|  hypothetical protein SELMODRAFT_437242             281   8e-84    
ref|XP_003593276.1|  Dynamin-related protein 3A                         279   9e-84    
ref|XP_003593275.1|  Dynamin-related protein 3A                         279   2e-83    
ref|XP_009381334.1|  PREDICTED: LOW QUALITY PROTEIN: dynamin-rela...    278   4e-83    
ref|XP_004485614.1|  PREDICTED: dynamin-related protein 3A-like         277   5e-83    Cicer arietinum [garbanzo]
ref|XP_010437736.1|  PREDICTED: dynamin-related protein 3A isofor...    276   7e-83    Camelina sativa [gold-of-pleasure]
ref|NP_565362.1|  dynamin-related protein 3B                            272   2e-81    Arabidopsis thaliana [mouse-ear cress]
gb|AAM20619.1|  dynamin-like protein                                    272   2e-81    Arabidopsis thaliana [mouse-ear cress]
ref|NP_565363.2|  dynamin-related protein 3B                            272   2e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006845411.1|  PREDICTED: dynamin-related protein 3A              273   2e-81    Amborella trichopoda
ref|XP_010268467.1|  PREDICTED: dynamin-related protein 3A-like i...    271   2e-81    Nelumbo nucifera [Indian lotus]
ref|XP_006297027.1|  hypothetical protein CARUB_v10013019mg             272   2e-81    Capsella rubella
ref|XP_010268464.1|  PREDICTED: dynamin-related protein 3A-like i...    272   3e-81    Nelumbo nucifera [Indian lotus]
ref|NP_001154516.1|  dynamin-related protein 3B                         272   4e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002974698.1|  hypothetical protein SELMODRAFT_101670             271   4e-81    
ref|XP_010268466.1|  PREDICTED: dynamin-related protein 3A-like i...    272   4e-81    Nelumbo nucifera [Indian lotus]
dbj|BAB85645.1|  dynamin like protein 2b                                271   5e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002885904.1|  hypothetical protein ARALYDRAFT_480333             270   2e-80    
gb|KDP33489.1|  hypothetical protein JCGZ_07060                         256   2e-80    Jatropha curcas
ref|XP_001766173.1|  predicted protein                                  268   6e-80    
ref|XP_010239800.1|  PREDICTED: dynamin-related protein 3A-like i...    254   8e-78    
ref|XP_010680388.1|  PREDICTED: dynamin-related protein 3B-like         263   8e-78    Beta vulgaris subsp. vulgaris [field beet]
dbj|BAK03569.1|  predicted protein                                      261   2e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_012076390.1|  PREDICTED: dynamin-related protein 3A-like         258   1e-76    Jatropha curcas
emb|CAE02157.2|  OSJNBa0072D21.2                                        258   4e-76    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052600.1|  Os04g0381000                                       258   4e-76    
ref|XP_010239797.1|  PREDICTED: dynamin-related protein 3A-like i...    257   6e-76    
ref|XP_010239796.1|  PREDICTED: dynamin-related protein 3A-like i...    257   6e-76    Brachypodium distachyon [annual false brome]
ref|XP_004977934.1|  PREDICTED: dynamin-related protein 3A-like         256   9e-76    
ref|XP_004291982.1|  PREDICTED: dynamin-related protein 3A-like         254   5e-75    Fragaria vesca subsp. vesca
ref|XP_007226406.1|  hypothetical protein PRUPE_ppa023178mg             252   2e-74    
ref|XP_008220636.1|  PREDICTED: dynamin-related protein 3A-like         253   4e-74    
ref|XP_007011680.1|  Dynamin-related protein 3A isoform 4               249   6e-74    
ref|XP_006450243.1|  hypothetical protein CICLE_v10010730mg             248   1e-73    
ref|XP_007011679.1|  Dynamin-related protein 3A isoform 3               249   2e-73    
gb|KJB55125.1|  hypothetical protein B456_009G064100                    247   2e-73    Gossypium raimondii
ref|XP_006483516.1|  PREDICTED: dynamin-related protein 3A-like i...    248   6e-73    
ref|XP_007011678.1|  Dynamin-related protein 3A isoform 2               249   7e-73    
ref|XP_006483515.1|  PREDICTED: dynamin-related protein 3A-like i...    248   8e-73    Citrus sinensis [apfelsine]
gb|KDO67387.1|  hypothetical protein CISIN_1g045702mg                   248   9e-73    Citrus sinensis [apfelsine]
ref|XP_007011677.1|  Dynamin-related protein 3A isoform 1               249   2e-72    
gb|KHG17659.1|  Dynamin-related 3A -like protein                        247   5e-72    Gossypium arboreum [tree cotton]
gb|KJB55123.1|  hypothetical protein B456_009G064100                    246   5e-72    Gossypium raimondii
ref|XP_006357068.1|  PREDICTED: dynamin-related protein 3A-like         246   5e-72    Solanum tuberosum [potatoes]
gb|KJB55124.1|  hypothetical protein B456_009G064100                    246   7e-72    Gossypium raimondii
ref|XP_002515392.1|  dynamin, putative                                  246   1e-71    Ricinus communis
ref|XP_009359080.1|  PREDICTED: dynamin-related protein 3A-like i...    245   2e-71    Pyrus x bretschneideri [bai li]
ref|XP_009359081.1|  PREDICTED: dynamin-related protein 3A-like i...    245   2e-71    Pyrus x bretschneideri [bai li]
gb|KDO44156.1|  hypothetical protein CISIN_1g003355mg                   245   2e-71    Citrus sinensis [apfelsine]
ref|XP_009359082.1|  PREDICTED: dynamin-related protein 3A-like i...    245   2e-71    Pyrus x bretschneideri [bai li]
ref|XP_009359079.1|  PREDICTED: dynamin-related protein 3A-like i...    245   2e-71    Pyrus x bretschneideri [bai li]
ref|XP_009359077.1|  PREDICTED: dynamin-related protein 3A-like i...    245   3e-71    Pyrus x bretschneideri [bai li]
ref|XP_008379402.1|  PREDICTED: dynamin-related protein 3A-like         243   4e-71    Malus domestica [apple tree]
ref|XP_009359078.1|  PREDICTED: dynamin-related protein 3A-like i...    245   4e-71    Pyrus x bretschneideri [bai li]
ref|XP_010108286.1|  Dynamin-related protein 3A                         240   5e-71    
ref|XP_008377478.1|  PREDICTED: dynamin-related protein 3A-like i...    244   7e-71    
ref|XP_008377481.1|  PREDICTED: dynamin-related protein 3A-like i...    243   7e-71    
ref|XP_008377480.1|  PREDICTED: dynamin-related protein 3A-like i...    243   8e-71    
ref|XP_008377477.1|  PREDICTED: dynamin-related protein 3A-like i...    243   8e-71    
ref|XP_008377475.1|  PREDICTED: dynamin-related protein 3A-like i...    244   1e-70    
ref|XP_008377476.1|  PREDICTED: dynamin-related protein 3A-like i...    243   2e-70    
gb|KHN33568.1|  Dynamin-related protein 3A                              241   2e-70    Glycine soja [wild soybean]
ref|XP_005845253.1|  hypothetical protein CHLNCDRAFT_136923             242   5e-70    Chlorella variabilis
ref|XP_009610154.1|  PREDICTED: dynamin-related protein 3A-like         236   9e-70    Nicotiana tomentosiformis
ref|XP_009363360.1|  PREDICTED: dynamin-related protein 3A-like         238   2e-69    Pyrus x bretschneideri [bai li]
emb|CDP18852.1|  unnamed protein product                                239   2e-69    Coffea canephora [robusta coffee]
ref|XP_010324551.1|  PREDICTED: dynamin-related protein 3A-like i...    238   3e-69    
ref|XP_004244503.1|  PREDICTED: dynamin-related protein 3A-like i...    238   4e-69    Solanum lycopersicum
ref|XP_009768871.1|  PREDICTED: dynamin-related protein 3A-like i...    235   5e-69    Nicotiana sylvestris
ref|XP_010324550.1|  PREDICTED: dynamin-related protein 3A-like i...    238   7e-69    Solanum lycopersicum
ref|XP_010692951.1|  PREDICTED: dynamin-related protein 3A-like i...    238   1e-68    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010692952.1|  PREDICTED: dynamin-related protein 3A-like i...    238   1e-68    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002945702.1|  dynamin-related GTPase                             239   2e-68    Volvox carteri f. nagariensis
ref|XP_009768868.1|  PREDICTED: dynamin-related protein 3A-like i...    236   3e-68    Nicotiana sylvestris
ref|XP_009768869.1|  PREDICTED: dynamin-related protein 3A-like i...    235   3e-68    Nicotiana sylvestris
ref|XP_001415897.1|  predicted protein                                  235   3e-68    Ostreococcus lucimarinus CCE9901
ref|XP_009768867.1|  PREDICTED: dynamin-related protein 3A-like i...    236   5e-68    Nicotiana sylvestris
gb|KDD74598.1|  dynamin                                                 221   2e-67    Helicosporidium sp. ATCC 50920
ref|XP_006653321.1|  PREDICTED: dynamin-related protein 3A-like         233   3e-67    Oryza brachyantha
ref|XP_011400707.1|  Dynamin-1-like protein                             229   8e-67    Auxenochlorella protothecoides
ref|XP_001697229.1|  dynamin-related GTPase                             234   9e-67    Chlamydomonas reinhardtii
gb|KDO44155.1|  hypothetical protein CISIN_1g003355mg                   231   2e-66    Citrus sinensis [apfelsine]
ref|XP_002506618.1|  predicted protein                                  231   3e-66    Micromonas commoda
ref|XP_003063165.1|  predicted protein                                  228   3e-65    Micromonas pusilla CCMP1545
gb|ABN14947.1|  dynamin 1                                               213   6e-65    Taenia asiatica [Asian tapeworm]
ref|XP_005646215.1|  hypothetical protein COCSUDRAFT_37405              223   3e-63    Coccomyxa subellipsoidea C-169
ref|XP_004348308.1|  dynamin central region family protein              219   1e-61    Capsaspora owczarzaki ATCC 30864
ref|XP_002683124.1|  dynamin                                            218   2e-61    Naegleria gruberi strain NEG-M
ref|XP_010795744.1|  PREDICTED: dynamin-1-like                          209   6e-61    Notothenia coriiceps [yellowbelly rockcod]
gb|AAX27772.2|  SJCHGC03526 protein                                     203   1e-60    Schistosoma japonicum
ref|XP_005706938.1|  dynamin GTPase                                     215   2e-60    Galdieria sulphuraria
gb|ETP37688.1|  hypothetical protein F442_14526                         214   2e-60    Phytophthora parasitica P10297
gb|ETM39716.1|  hypothetical protein L914_14151                         214   2e-60    Phytophthora parasitica
ref|XP_011215127.1|  PREDICTED: LOW QUALITY PROTEIN: dynamin-3-like     201   2e-60    
ref|XP_008910420.1|  hypothetical protein PPTG_15137                    214   2e-60    Phytophthora parasitica INRA-310
ref|XP_007118793.1|  PREDICTED: dynamin-3-like                          204   2e-60    
pdb|3L43|A  Chain A, Crystal Structure Of The Dynamin 3 Gtpase Do...    204   5e-60    Homo sapiens [man]
gb|EHJ70760.1|  putative dynamin                                        209   5e-60    
ref|XP_011563057.1|  PREDICTED: dynamin                                 214   8e-60    Plutella xylostella [cabbage moth]
gb|ENN73805.1|  hypothetical protein YQE_09583                          213   1e-59    Dendroctonus ponderosae
emb|CEF96728.1|  P-loop containing nucleoside triphosphate hydrolase    212   1e-59    Ostreococcus tauri
gb|EDM09408.1|  dynamin 3, isoform CRA_c                                205   2e-59    Rattus norvegicus [brown rat]
gb|EPQ08653.1|  Dynamin-3                                               206   2e-59    Myotis brandtii
gb|KFM63981.1|  Dynamin                                                 207   2e-59    Stegodyphus mimosarum
ref|XP_009292875.1|  PREDICTED: dynamin-3 isoform X3                    207   2e-59    
gb|EGI71097.1|  Dynamin                                                 208   2e-59    Acromyrmex echinatior
pdb|1JWY|B  Chain B, Crystal Structure Of The Dynamin A Gtpase Do...    202   2e-59    Dictyostelium discoideum
gb|KHJ83671.1|  dynamin family protein                                  202   3e-59    Oesophagostomum dentatum [nodule worm]
gb|KIM28784.1|  hypothetical protein M408DRAFT_329236                   211   3e-59    Serendipita vermifera MAFF 305830
ref|XP_002908808.1|  dynamin-2                                          211   3e-59    Phytophthora infestans T30-4
ref|XP_011484899.1|  PREDICTED: dynamin-3-like                          212   3e-59    
ref|XP_003975889.1|  PREDICTED: dynamin-3-like                          212   3e-59    Takifugu rubripes [tiger puffer]
emb|CCI11042.1|  unnamed protein product                                210   5e-59    Albugo candida
ref|XP_009860627.1|  PREDICTED: dynamin-1                               211   5e-59    
gb|ERL89643.1|  hypothetical protein D910_07008                         214   6e-59    Dendroctonus ponderosae
ref|XP_008297954.1|  PREDICTED: dynamin-1-like                          201   6e-59    Stegastes partitus
emb|CDS16358.1|  dynamin 1                                              211   6e-59    Echinococcus granulosus
gb|KFM79669.1|  Dynamin                                                 204   6e-59    Stegodyphus mimosarum
ref|XP_003241891.1|  PREDICTED: dynamin isoform X1                      211   6e-59    Acyrthosiphon pisum
ref|XP_008873394.1|  hypothetical protein H310_09175                    210   6e-59    Aphanomyces invadans
ref|XP_003241890.1|  PREDICTED: dynamin isoform X3                      211   7e-59    
ref|XP_008179241.1|  PREDICTED: dynamin isoform X7                      211   7e-59    Acyrthosiphon pisum
ref|XP_008179240.1|  PREDICTED: dynamin isoform X6                      211   8e-59    Acyrthosiphon pisum
ref|XP_008179239.1|  PREDICTED: dynamin isoform X5                      211   8e-59    Acyrthosiphon pisum
ref|XP_010369591.1|  PREDICTED: dynamin-3 isoform X2                    205   8e-59    Rhinopithecus roxellana
ref|XP_006568480.1|  PREDICTED: dynamin isoform X13                     211   1e-58    
gb|EAW90919.1|  dynamin 3, isoform CRA_e                                204   1e-58    Homo sapiens [man]
ref|XP_004567231.1|  PREDICTED: dynamin-3-like                          211   1e-58    Maylandia zebra
ref|XP_010888629.1|  PREDICTED: dynamin-3-like isoform X2               211   1e-58    Esox lucius
ref|XP_010888648.1|  PREDICTED: dynamin-3-like isoform X4               211   1e-58    Esox lucius
ref|XP_005741993.1|  PREDICTED: dynamin-3-like                          211   1e-58    Pundamilia nyererei
ref|XP_010888620.1|  PREDICTED: dynamin-3-like isoform X1               211   1e-58    Esox lucius
ref|XP_005935694.1|  PREDICTED: dynamin-3-like                          210   1e-58    Haplochromis burtoni
ref|XP_010888639.1|  PREDICTED: dynamin-3-like isoform X3               210   1e-58    
ref|XP_008291918.1|  PREDICTED: dynamin-3-like                          210   1e-58    
dbj|GAM23526.1|  hypothetical protein SAMD00019534_067010               210   1e-58    
ref|XP_008332403.1|  PREDICTED: dynamin-3-like                          210   1e-58    
gb|KIY64747.1|  hypothetical protein CYLTODRAFT_492856                  209   1e-58    
gb|KIY48336.1|  hypothetical protein FISHEDRAFT_65839                   209   2e-58    
ref|XP_006568478.1|  PREDICTED: dynamin isoform X11                     210   2e-58    
ref|XP_003453378.1|  PREDICTED: dynamin-3-like                          210   2e-58    
ref|XP_006568479.1|  PREDICTED: dynamin isoform X12                     210   2e-58    
gb|EDL39302.1|  mCG124592, isoform CRA_a                                205   2e-58    
ref|XP_006568475.1|  PREDICTED: dynamin isoform X8                      210   2e-58    
gb|KDQ33932.1|  hypothetical protein PLEOSDRAFT_1110788                 201   2e-58    
gb|EDL39303.1|  mCG124592, isoform CRA_b                                205   2e-58    
ref|XP_006612096.1|  PREDICTED: dynamin-like                            210   2e-58    
ref|XP_006568472.1|  PREDICTED: dynamin isoform X5                      210   2e-58    
ref|XP_006568473.1|  PREDICTED: dynamin isoform X6                      210   2e-58    
ref|XP_006075485.1|  PREDICTED: dynamin-3-like                          206   2e-58    
ref|XP_006568474.1|  PREDICTED: dynamin isoform X7                      210   2e-58    
gb|EKG19069.1|  hypothetical protein MPH_03759                          199   2e-58    
ref|XP_006568477.1|  PREDICTED: dynamin isoform X10                     210   2e-58    
gb|EEZ97258.1|  hypothetical protein TcasGA2_TC011058                   210   2e-58    
ref|XP_006568471.1|  PREDICTED: dynamin isoform X4                      210   2e-58    
ref|XP_006568469.1|  PREDICTED: dynamin isoform X2                      210   2e-58    
ref|XP_006568476.1|  PREDICTED: dynamin isoform X9                      209   2e-58    
ref|XP_006568470.1|  PREDICTED: dynamin isoform X3                      210   3e-58    
ref|XP_009192405.1|  PREDICTED: LOW QUALITY PROTEIN: dynamin-3-like     206   3e-58    
emb|CCA66869.1|  probable ember of the dynamin family of GTPases        208   3e-58    
ref|XP_008198822.1|  PREDICTED: dynamin isoform X1                      209   3e-58    
ref|XP_012145020.1|  PREDICTED: dynamin isoform X6                      209   3e-58    
ref|XP_006496668.1|  PREDICTED: dynamin-3 isoform X5                    205   3e-58    
ref|XP_394399.3|  PREDICTED: dynamin isoformX1                          209   3e-58    
ref|XP_003402356.1|  PREDICTED: dynamin-like                            206   3e-58    
ref|XP_004347890.1|  dynamin 1                                          209   3e-58    
ref|XP_007846433.1|  vacuolar sorting protein 1                         208   3e-58    
gb|ERL92185.1|  hypothetical protein D910_09505                         209   4e-58    
ref|XP_008179237.1|  PREDICTED: dynamin isoform X2                      209   4e-58    
ref|XP_012145019.1|  PREDICTED: dynamin isoform X5                      209   4e-58    
ref|XP_007862820.1|  hypothetical protein GLOTRDRAFT_35315              207   4e-58    
ref|XP_008198823.1|  PREDICTED: dynamin isoform X2                      209   4e-58    
ref|XP_008179238.1|  PREDICTED: dynamin isoform X4                      209   4e-58    
ref|XP_002681690.1|  dynamin                                            207   4e-58    
ref|XP_011370005.1|  PREDICTED: dynamin-3 isoform X1                    207   4e-58    
ref|XP_012064348.1|  PREDICTED: dynamin                                 209   4e-58    
emb|CAF97614.1|  unnamed protein product                                209   5e-58    
ref|XP_006142413.1|  PREDICTED: dynamin-3 isoform X2                    209   5e-58    
ref|XP_006142412.1|  PREDICTED: dynamin-3 isoform X1                    209   5e-58    
ref|XP_011872687.1|  PREDICTED: dynamin isoform X12                     209   5e-58    
ref|XP_011872689.1|  PREDICTED: dynamin isoform X14                     209   5e-58    
gb|AAI51754.1|  Unknown (protein for IMAGE:8115593)                     206   5e-58    
gb|KIO04071.1|  hypothetical protein M404DRAFT_15589                    207   5e-58    
ref|XP_010739793.1|  PREDICTED: dynamin-3-like                          209   5e-58    
ref|XP_011817700.1|  PREDICTED: dynamin-3 isoform X6                    205   5e-58    
ref|XP_006737603.1|  PREDICTED: dynamin-3 isoform X3                    205   5e-58    
ref|XP_010369589.1|  PREDICTED: dynamin-3 isoform X1                    205   5e-58    
gb|KDQ59640.1|  hypothetical protein JAAARDRAFT_126583                  207   5e-58    
ref|XP_002434810.1|  dynamin, putative                                  208   5e-58    
emb|CCA17876.1|  dynamin GTPase putative                                207   5e-58    
ref|XP_011168350.1|  PREDICTED: dynamin                                 208   6e-58    
ref|XP_011872688.1|  PREDICTED: dynamin isoform X13                     208   6e-58    
gb|EFN88785.1|  Dynamin                                                 208   6e-58    
ref|XP_011872683.1|  PREDICTED: dynamin isoform X8                      208   6e-58    
ref|XP_007238905.1|  PREDICTED: dynamin-2-like                          208   6e-58    
ref|XP_012145017.1|  PREDICTED: dynamin isoform X3                      211   6e-58    
ref|NP_001005652.1|  dynamin 1                                          201   7e-58    
ref|XP_012145015.1|  PREDICTED: dynamin isoform X1                      211   7e-58    
ref|XP_012145018.1|  PREDICTED: dynamin isoform X4                      211   7e-58    
ref|XP_011872685.1|  PREDICTED: dynamin isoform X10                     208   7e-58    
ref|XP_011872684.1|  PREDICTED: dynamin isoform X9                      208   7e-58    
ref|XP_011150772.1|  PREDICTED: dynamin isoform X10                     208   7e-58    
gb|KJJ27418.1|  Dynamin GTPase domain                                   207   7e-58    
ref|XP_011872681.1|  PREDICTED: dynamin isoform X7                      208   7e-58    
gb|KGO63582.1|  Dynamin                                                 207   8e-58    
ref|XP_007396303.1|  hypothetical protein PHACADRAFT_257004             207   8e-58    
ref|XP_011872686.1|  PREDICTED: dynamin isoform X11                     208   8e-58    
gb|KIH52561.1|  dynamin family protein                                  200   8e-58    
ref|XP_011872680.1|  PREDICTED: dynamin isoform X6                      208   8e-58    
ref|XP_002766223.1|  dynamin, putative                                  208   8e-58    
ref|XP_011056279.1|  PREDICTED: dynamin isoform X12                     208   8e-58    
ref|XP_006211186.1|  PREDICTED: dynamin-3 isoform X1                    205   8e-58    
ref|XP_007343644.1|  dynamin protein dnm1                               207   8e-58    
gb|KGO40489.1|  Dynamin GTPase effector                                 207   8e-58    
ref|XP_011872676.1|  PREDICTED: dynamin isoform X2                      208   9e-58    
ref|XP_011872679.1|  PREDICTED: dynamin isoform X5                      208   9e-58    
ref|XP_011872678.1|  PREDICTED: dynamin isoform X4                      208   9e-58    
ref|XP_009829707.1|  hypothetical protein H257_06247                    207   9e-58    
ref|XP_011150760.1|  PREDICTED: dynamin isoform X8                      208   9e-58    
ref|XP_011056092.1|  PREDICTED: dynamin isoform X10                     208   9e-58    
ref|XP_005457507.1|  PREDICTED: dynamin-1-like protein-like isofo...    206   9e-58    
ref|XP_012145016.1|  PREDICTED: dynamin isoform X2                      211   9e-58    
gb|EMD34409.1|  hypothetical protein CERSUDRAFT_117286                  207   9e-58    
ref|XP_011872675.1|  PREDICTED: dynamin isoform X1                      208   9e-58    
ref|XP_007338590.1|  hypothetical protein AURDEDRAFT_133839             207   9e-58    
ref|XP_011150767.1|  PREDICTED: dynamin isoform X9                      208   9e-58    
emb|CDQ94248.1|  unnamed protein product                                195   1e-57    
ref|XP_007555027.1|  PREDICTED: dynamin-3-like                          208   1e-57    
ref|XP_011150754.1|  PREDICTED: dynamin isoform X7                      208   1e-57    
ref|XP_011150709.1|  PREDICTED: dynamin isoform X1                      208   1e-57    
ref|XP_011872677.1|  PREDICTED: dynamin isoform X3                      208   1e-57    
ref|XP_011150715.1|  PREDICTED: dynamin isoform X2                      208   1e-57    
ref|XP_011254317.1|  PREDICTED: dynamin isoform X7                      208   1e-57    
ref|XP_011254319.1|  PREDICTED: dynamin isoform X9                      207   1e-57    
ref|XP_011507704.1|  PREDICTED: dynamin-3 isoform X9                    204   1e-57    
ref|XP_011150745.1|  PREDICTED: dynamin isoform X6                      208   1e-57    
ref|XP_011150730.1|  PREDICTED: dynamin isoform X4                      208   1e-57    
ref|XP_011056016.1|  PREDICTED: dynamin isoform X9                      208   1e-57    
gb|EFN69699.1|  Dynamin                                                 208   1e-57    
ref|XP_008431385.1|  PREDICTED: dynamin-3-like                          207   1e-57    
ref|XP_011056178.1|  PREDICTED: dynamin isoform X11                     208   1e-57    
ref|XP_011150723.1|  PREDICTED: dynamin isoform X3                      208   1e-57    
ref|XP_011500362.1|  PREDICTED: dynamin isoform X9                      207   1e-57    
dbj|GAM22540.1|  hypothetical protein SAMD00019534_057150               207   1e-57    
ref|XP_011150737.1|  PREDICTED: dynamin isoform X5                      208   1e-57    
emb|CDJ03874.1|  dynamin 1                                              208   1e-57    
ref|XP_002109446.1|  hypothetical protein TRIADDRAFT_53484              207   1e-57    
ref|XP_011254315.1|  PREDICTED: dynamin isoform X6                      207   1e-57    
ref|XP_008204240.1|  PREDICTED: dynamin isoform X7                      207   1e-57    
gb|KIP10291.1|  hypothetical protein PHLGIDRAFT_125643                  206   1e-57    
ref|XP_011055472.1|  PREDICTED: dynamin isoform X3                      207   1e-57    
dbj|BAG51664.1|  unnamed protein product                                204   1e-57    
ref|XP_008204239.1|  PREDICTED: dynamin isoform X6                      207   1e-57    
ref|XP_011055556.1|  PREDICTED: dynamin isoform X4                      207   1e-57    
ref|XP_008204238.1|  PREDICTED: dynamin isoform X5                      207   1e-57    
ref|NP_001265181.1|  dynamin-3 isoform c                                204   1e-57    
ref|XP_011055326.1|  PREDICTED: dynamin isoform X1                      207   1e-57    
ref|XP_011254318.1|  PREDICTED: dynamin isoform X8                      207   1e-57    
ref|XP_011636784.1|  PREDICTED: dynamin isoform X11                     207   1e-57    
ref|XP_008204229.1|  PREDICTED: dynamin isoform X1                      207   1e-57    
ref|XP_003662136.1|  hypothetical protein MYCTH_2302341                 206   1e-57    
gb|EKV10984.1|  Vacuolar dynamin-like GTPase VpsA, putative             206   1e-57    
ref|XP_011055644.1|  PREDICTED: dynamin isoform X5                      207   1e-57    
ref|XP_011254311.1|  PREDICTED: dynamin isoform X2                      207   1e-57    
ref|XP_008204235.1|  PREDICTED: dynamin isoform X2                      207   1e-57    
ref|NP_001121996.1|  dynamin-3                                          207   1e-57    
ref|XP_011636783.1|  PREDICTED: dynamin isoform X10                     207   1e-57    
ref|XP_011254313.1|  PREDICTED: dynamin isoform X4                      207   2e-57    
ref|XP_011055390.1|  PREDICTED: dynamin isoform X2                      207   2e-57    
ref|XP_011254310.1|  PREDICTED: dynamin isoform X1                      207   2e-57    
ref|XP_007364691.1|  hypothetical protein DICSQDRAFT_84465              206   2e-57    
ref|XP_005729455.1|  PREDICTED: dynamin-1-like protein-like isofo...    206   2e-57    
gb|ABI84147.1|  dynamin isoform A                                       207   2e-57    
ref|XP_011254314.1|  PREDICTED: dynamin isoform X5                      207   2e-57    
ref|XP_011055898.1|  PREDICTED: dynamin isoform X8                      207   2e-57    
ref|XP_011254312.1|  PREDICTED: dynamin isoform X3                      207   2e-57    
ref|XP_008204236.1|  PREDICTED: dynamin isoform X3                      207   2e-57    
ref|XP_006711331.1|  PREDICTED: dynamin-3 isoform X8                    204   2e-57    
ref|XP_011500359.1|  PREDICTED: dynamin isoform X6                      207   2e-57    
ref|XP_004544370.1|  PREDICTED: dynamin-1-like protein-like isofo...    206   2e-57    
ref|XP_011500361.1|  PREDICTED: dynamin isoform X8                      207   2e-57    
ref|XP_006006497.1|  PREDICTED: dynamin-1-like protein-like             201   2e-57    
ref|XP_011636782.1|  PREDICTED: dynamin isoform X9                      207   2e-57    
ref|XP_008204237.1|  PREDICTED: dynamin isoform X4                      207   2e-57    
ref|XP_011055730.1|  PREDICTED: dynamin isoform X6                      207   2e-57    
ref|XP_011500354.1|  PREDICTED: dynamin isoform X1                      207   2e-57    
ref|XP_011055819.1|  PREDICTED: dynamin isoform X7                      207   2e-57    
ref|XP_011500360.1|  PREDICTED: dynamin isoform X7                      207   2e-57    
ref|XP_009292874.1|  PREDICTED: dynamin-3 isoform X2                    207   2e-57    
ref|XP_011500357.1|  PREDICTED: dynamin isoform X4                      207   2e-57    
ref|XP_011636778.1|  PREDICTED: dynamin isoform X5                      207   2e-57    
ref|XP_005112895.1|  PREDICTED: LOW QUALITY PROTEIN: dynamin-1-like     204   2e-57    
gb|KDR81857.1|  hypothetical protein GALMADRAFT_135252                  206   2e-57    
ref|XP_011636776.1|  PREDICTED: dynamin isoform X3                      207   2e-57    
ref|XP_011636781.1|  PREDICTED: dynamin isoform X8                      207   2e-57    
ref|XP_011500355.1|  PREDICTED: dynamin isoform X2                      207   2e-57    
ref|XP_011636774.1|  PREDICTED: dynamin isoform X1                      207   2e-57    
ref|XP_011500358.1|  PREDICTED: dynamin isoform X5                      207   2e-57    
ref|XP_002568519.1|  Pc21g15090                                         206   2e-57    
gb|EGT57497.1|  hypothetical protein CAEBREN_26110                      207   2e-57    
ref|XP_011500356.1|  PREDICTED: dynamin isoform X3                      207   2e-57    
gb|KIK17024.1|  hypothetical protein PISMIDRAFT_238599                  206   2e-57    
ref|XP_011636777.1|  PREDICTED: dynamin isoform X4                      207   2e-57    
ref|XP_011636775.1|  PREDICTED: dynamin isoform X2                      207   2e-57    
ref|XP_005922724.1|  PREDICTED: dynamin-1-like protein-like isofo...    205   2e-57    
ref|XP_011636785.1|  PREDICTED: dynamin isoform X12                     207   2e-57    
ref|XP_005245141.1|  PREDICTED: dynamin-3 isoform X7                    204   2e-57    
ref|XP_011697645.1|  PREDICTED: dynamin isoform X9                      206   2e-57    
gb|KIW68371.1|  hypothetical protein PV04_04324                         206   3e-57    
ref|XP_008610672.1|  hypothetical protein SDRG_06656                    205   3e-57    
ref|XP_011697643.1|  PREDICTED: dynamin isoform X7                      206   3e-57    
gb|EGT32154.1|  hypothetical protein CAEBREN_24940                      206   3e-57    
gb|EXX57877.1|  Dnm1p                                                   202   3e-57    
ref|XP_002430442.1|  dynamin, putative                                  206   3e-57    
ref|XP_011636779.1|  PREDICTED: dynamin isoform X6                      206   3e-57    
ref|XP_011697644.1|  PREDICTED: dynamin isoform X8                      206   3e-57    
gb|EGT35606.1|  hypothetical protein CAEBREN_25336                      206   3e-57    
ref|XP_011636780.1|  PREDICTED: dynamin isoform X7                      206   3e-57    
ref|XP_007898507.1|  PREDICTED: dynamin-1 isoform X3                    206   3e-57    
ref|XP_002715665.1|  PREDICTED: dynamin-3 isoform X6                    206   3e-57    
ref|XP_007385138.1|  hypothetical protein PUNSTDRAFT_144490             205   3e-57    
ref|XP_007898506.1|  PREDICTED: dynamin-1 isoform X2                    206   3e-57    
emb|CDQ69369.1|  unnamed protein product                                210   3e-57    
ref|XP_007898504.1|  PREDICTED: dynamin-1 isoform X1                    206   3e-57    
ref|XP_002715664.1|  PREDICTED: dynamin-3 isoform X3                    206   4e-57    
ref|XP_004361652.1|  dynamin like protein                               206   4e-57    
ref|XP_008262286.1|  PREDICTED: dynamin-3 isoform X2                    206   4e-57    
ref|XP_008262288.1|  PREDICTED: dynamin-3 isoform X5                    206   4e-57    
ref|XP_008262285.1|  PREDICTED: dynamin-3 isoform X1                    206   4e-57    
ref|XP_011697640.1|  PREDICTED: dynamin isoform X4                      206   4e-57    
ref|NP_001024331.1|  Protein DYN-1, isoform a                           206   4e-57    
ref|XP_011697642.1|  PREDICTED: dynamin isoform X6                      206   4e-57    
ref|XP_002382656.1|  vacuolar dynamin-like GTPase VpsA, putative        205   4e-57    
ref|XP_008262289.1|  PREDICTED: dynamin-3 isoform X7                    206   4e-57    
ref|XP_011370007.1|  PREDICTED: dynamin-3 isoform X3                    206   4e-57    
ref|XP_006024371.1|  PREDICTED: dynamin-1 isoform X9                    203   4e-57    
ref|XP_007898508.1|  PREDICTED: dynamin-1 isoform X4                    206   4e-57    
gb|KIJ69655.1|  hypothetical protein HYDPIDRAFT_106305                  205   4e-57    
ref|XP_011697639.1|  PREDICTED: dynamin isoform X3                      206   4e-57    
ref|XP_011370006.1|  PREDICTED: dynamin-3 isoform X2                    206   4e-57    
ref|XP_008262287.1|  PREDICTED: dynamin-3 isoform X4                    206   4e-57    
ref|XP_011697636.1|  PREDICTED: dynamin isoform X1                      206   4e-57    
ref|XP_004928591.1|  PREDICTED: dynamin-like isoform X2                 206   4e-57    
gb|AAB72228.2|  dynamin                                                 206   5e-57    
ref|XP_004928590.1|  PREDICTED: dynamin-like isoform X1                 206   5e-57    
ref|XP_011697641.1|  PREDICTED: dynamin isoform X5                      206   5e-57    
ref|XP_006809424.1|  PREDICTED: dynamin-1-like                          196   5e-57    
ref|XP_003972969.1|  PREDICTED: dynamin-1-like protein                  204   5e-57    
ref|XP_006784098.1|  PREDICTED: dynamin-1-like protein-like isofo...    204   5e-57    
gb|EGT33064.1|  hypothetical protein CAEBREN_18349                      206   5e-57    
ref|XP_011697637.1|  PREDICTED: dynamin isoform X2                      206   5e-57    
emb|CDM29756.1|  Vacuolar protein sorting-associated protein 1          205   5e-57    
ref|XP_010791563.1|  PREDICTED: dynamin-1-like protein isoform X2       204   5e-57    
pdb|2AKA|B  Chain B, Structure Of The Nucleotide-Free Myosin Ii M...    196   5e-57    



>ref|XP_006359369.1| PREDICTED: dynamin-related protein 3A-like [Solanum tuberosum]
Length=824

 Score =   347 bits (889),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 184/202 (91%), Positives = 193/202 (96%), Gaps = 1/202 (0%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAE++VP    +S  N APLGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS
Sbjct  1    MAEDSVPVPVPSST-NTAPLGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS  59

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLEALVGRDFLPRGSDICTRRPLVLQL+QTKRKPD TD+EWGEFLHLPGK+FFDFN+IR
Sbjct  60   SVLEALVGRDFLPRGSDICTRRPLVLQLIQTKRKPDGTDDEWGEFLHLPGKRFFDFNEIR  119

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQAET+REAG NKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT
Sbjct  120  REIQAETEREAGVNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  179

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIKLPSCLILAVTPANAD
Sbjct  180  MIMSYIKLPSCLILAVTPANAD  201



>ref|XP_009768280.1| PREDICTED: dynamin-related protein 3A-like [Nicotiana sylvestris]
Length=824

 Score =   345 bits (886),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 186/204 (91%), Positives = 194/204 (95%), Gaps = 5/204 (2%)
 Frame = +2

Query  215  MAEE--AVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssg  388
            MAE+  AVP  +ST   N APLGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSG
Sbjct  1    MAEDSVAVPVPSST---NTAPLGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSG  57

Query  389  kssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFND  568
            KSSVLEALVGRDFLPRGSDICTRRPLVLQL+QTKRKPD T+EEWGEFLHLPGK+FFDFN+
Sbjct  58   KSSVLEALVGRDFLPRGSDICTRRPLVLQLIQTKRKPDGTEEEWGEFLHLPGKRFFDFNE  117

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EIQAETDREAG N+GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI
Sbjct  118  IRREIQAETDREAGMNRGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  177

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            RTMIMSYIKLPSCLILAVTPANAD
Sbjct  178  RTMIMSYIKLPSCLILAVTPANAD  201



>ref|XP_002269774.2| PREDICTED: dynamin-related protein 3B isoform X1 [Vitis vinifera]
Length=831

 Score =   343 bits (881),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 184/202 (91%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAEEAV S+ + S+ +AAPLGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS
Sbjct  1    MAEEAVSSNPTHSSSSAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS  60

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLEALVGRDFLPRGSDICTRRPLVLQLLQTKR+PD ++EE+GEFLHLPGKKFFDF++IR
Sbjct  61   SVLEALVGRDFLPRGSDICTRRPLVLQLLQTKRRPDGSEEEYGEFLHLPGKKFFDFSEIR  120

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQAETDREAG NKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT
Sbjct  121  REIQAETDREAGENKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  180

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIKLPSCLILAVTPAN+D
Sbjct  181  MIMSYIKLPSCLILAVTPANSD  202



>ref|XP_009599814.1| PREDICTED: dynamin-related protein 3A-like [Nicotiana tomentosiformis]
Length=826

 Score =   343 bits (879),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 184/204 (90%), Positives = 193/204 (95%), Gaps = 5/204 (2%)
 Frame = +2

Query  215  MAEE--AVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssg  388
            MAE+  AVP  +ST   N APLGHSVIPIVNKLQDIFAQLGSQS+IELPQVAVVGSQSSG
Sbjct  1    MAEDSVAVPDPSST---NTAPLGHSVIPIVNKLQDIFAQLGSQSSIELPQVAVVGSQSSG  57

Query  389  kssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFND  568
            KSSVLEALVGRDFLPRGSDICTRRPLVLQL+QTKRKPD T+EEWGEFLHLPGK+FFDFN+
Sbjct  58   KSSVLEALVGRDFLPRGSDICTRRPLVLQLIQTKRKPDGTEEEWGEFLHLPGKRFFDFNE  117

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EIQ ETDREAG N+GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI
Sbjct  118  IRREIQVETDREAGMNRGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  177

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            RTMIMSYIKLPSCLILAVTPANAD
Sbjct  178  RTMIMSYIKLPSCLILAVTPANAD  201



>ref|XP_006351713.1| PREDICTED: dynamin-related protein 3A-like [Solanum tuberosum]
Length=830

 Score =   337 bits (864),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 184/204 (90%), Positives = 193/204 (95%), Gaps = 2/204 (1%)
 Frame = +2

Query  215  MAEEAVPSST--STSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssg  388
            MAEE  PS++  + ++  AA LGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSG
Sbjct  1    MAEETSPSNSPDAVASAAAASLGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSG  60

Query  389  kssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFND  568
            KSSVLEALVGRDFLPRGSDICTRRPLVLQLLQTKR PD TDEEWGEFLHLPGK+FFDFN+
Sbjct  61   KSSVLEALVGRDFLPRGSDICTRRPLVLQLLQTKRNPDGTDEEWGEFLHLPGKRFFDFNE  120

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR EIQAET+REAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI
Sbjct  121  IRWEIQAETEREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  180

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            RTMIMSYIKLPSCLILAVTPAN+D
Sbjct  181  RTMIMSYIKLPSCLILAVTPANSD  204



>ref|XP_011092457.1| PREDICTED: dynamin-related protein 3A-like [Sesamum indicum]
Length=828

 Score =   334 bits (857),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 190/203 (94%), Gaps = 1/203 (0%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNA-APLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgk  391
            MAEE   ++ S+ N  A A LGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK
Sbjct  1    MAEEQSAAAASSDNGTAPAALGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK  60

Query  392  ssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDI  571
            SSVLEALVGRDFLPRG+DICTRRPLVLQL+Q KRK D TDEEWGEFLHLPGK+FFDFN+I
Sbjct  61   SSVLEALVGRDFLPRGNDICTRRPLVLQLVQMKRKADGTDEEWGEFLHLPGKRFFDFNEI  120

Query  572  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  751
            RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPG+TKVPVGDQPSDIEARIR
Sbjct  121  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGLTKVPVGDQPSDIEARIR  180

Query  752  TMIMSYIKLPSCLILAVTPANAD  820
            TMIMSYIKL SCLILAVTPAN+D
Sbjct  181  TMIMSYIKLQSCLILAVTPANSD  203



>gb|KJB32126.1| hypothetical protein B456_005G226100 [Gossypium raimondii]
Length=737

 Score =   331 bits (849),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 177/202 (88%), Positives = 193/202 (96%), Gaps = 1/202 (0%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAEEA  +ST   + +AAPLG SVIP+VNKLQDIFA+LGSQSTIELPQVAVVGSQSSGKS
Sbjct  1    MAEEAAVASTPPQS-SAAPLGSSVIPLVNKLQDIFAKLGSQSTIELPQVAVVGSQSSGKS  59

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLE+LVGRDFLPRGSDICTRRPLVLQLLQTKRKPD ++EE+GEFLHLPGK+F+DF++IR
Sbjct  60   SVLESLVGRDFLPRGSDICTRRPLVLQLLQTKRKPDGSEEEYGEFLHLPGKRFYDFSEIR  119

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT
Sbjct  120  REIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  179

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIK PSCLI+AVTPAN+D
Sbjct  180  MIMSYIKQPSCLIIAVTPANSD  201



>gb|KJB32129.1| hypothetical protein B456_005G226100 [Gossypium raimondii]
Length=828

 Score =   333 bits (853),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 177/202 (88%), Positives = 193/202 (96%), Gaps = 1/202 (0%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAEEA  +ST   + +AAPLG SVIP+VNKLQDIFA+LGSQSTIELPQVAVVGSQSSGKS
Sbjct  1    MAEEAAVASTPPQS-SAAPLGSSVIPLVNKLQDIFAKLGSQSTIELPQVAVVGSQSSGKS  59

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLE+LVGRDFLPRGSDICTRRPLVLQLLQTKRKPD ++EE+GEFLHLPGK+F+DF++IR
Sbjct  60   SVLESLVGRDFLPRGSDICTRRPLVLQLLQTKRKPDGSEEEYGEFLHLPGKRFYDFSEIR  119

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT
Sbjct  120  REIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  179

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIK PSCLI+AVTPAN+D
Sbjct  180  MIMSYIKQPSCLIIAVTPANSD  201



>gb|KJB47248.1| hypothetical protein B456_008G017900 [Gossypium raimondii]
Length=828

 Score =   332 bits (852),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 177/202 (88%), Positives = 192/202 (95%), Gaps = 2/202 (1%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAEEA  ++++   L+AAPLG SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS
Sbjct  1    MAEEA--AASTPPQLSAAPLGSSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS  58

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLE+LVGRDFLPRGSDICTRRPLVLQLLQTKRKPD ++EE+GEFLHLPGK+F+DF++IR
Sbjct  59   SVLESLVGRDFLPRGSDICTRRPLVLQLLQTKRKPDGSEEEYGEFLHLPGKRFYDFSEIR  118

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQAETDREAGGNKG SDKQIRLKIFSPNVLDI LVDLPGITKVPVGDQPSDIEARIRT
Sbjct  119  REIQAETDREAGGNKGASDKQIRLKIFSPNVLDINLVDLPGITKVPVGDQPSDIEARIRT  178

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIK PSCLILAVTPAN+D
Sbjct  179  MIMSYIKQPSCLILAVTPANSD  200



>ref|XP_007042814.1| Dynamin-related protein 3A isoform 2 [Theobroma cacao]
 gb|EOX98645.1| Dynamin-related protein 3A isoform 2 [Theobroma cacao]
Length=828

 Score =   332 bits (851),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 179/202 (89%), Positives = 191/202 (95%), Gaps = 3/202 (1%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAEEA  S+  +S   AAPLG SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS
Sbjct  1    MAEEAAASTPPSS---AAPLGSSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS  57

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLE+LVGRDFLPRGSDICTRRPLVLQLLQTK KPD ++EE+GEFLHLPGK+F+DF++IR
Sbjct  58   SVLESLVGRDFLPRGSDICTRRPLVLQLLQTKCKPDGSEEEYGEFLHLPGKRFYDFSEIR  117

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT
Sbjct  118  REIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  177

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIK PSCLILAVTPAN+D
Sbjct  178  MIMSYIKQPSCLILAVTPANSD  199



>gb|KJB47251.1| hypothetical protein B456_008G017900 [Gossypium raimondii]
Length=819

 Score =   332 bits (850),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 177/202 (88%), Positives = 192/202 (95%), Gaps = 2/202 (1%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAEEA  ++++   L+AAPLG SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS
Sbjct  1    MAEEA--AASTPPQLSAAPLGSSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS  58

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLE+LVGRDFLPRGSDICTRRPLVLQLLQTKRKPD ++EE+GEFLHLPGK+F+DF++IR
Sbjct  59   SVLESLVGRDFLPRGSDICTRRPLVLQLLQTKRKPDGSEEEYGEFLHLPGKRFYDFSEIR  118

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQAETDREAGGNKG SDKQIRLKIFSPNVLDI LVDLPGITKVPVGDQPSDIEARIRT
Sbjct  119  REIQAETDREAGGNKGASDKQIRLKIFSPNVLDINLVDLPGITKVPVGDQPSDIEARIRT  178

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIK PSCLILAVTPAN+D
Sbjct  179  MIMSYIKQPSCLILAVTPANSD  200



>gb|KJB47250.1| hypothetical protein B456_008G017900 [Gossypium raimondii]
Length=813

 Score =   332 bits (850),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 177/202 (88%), Positives = 192/202 (95%), Gaps = 2/202 (1%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAEEA  ++++   L+AAPLG SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS
Sbjct  1    MAEEA--AASTPPQLSAAPLGSSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS  58

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLE+LVGRDFLPRGSDICTRRPLVLQLLQTKRKPD ++EE+GEFLHLPGK+F+DF++IR
Sbjct  59   SVLESLVGRDFLPRGSDICTRRPLVLQLLQTKRKPDGSEEEYGEFLHLPGKRFYDFSEIR  118

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQAETDREAGGNKG SDKQIRLKIFSPNVLDI LVDLPGITKVPVGDQPSDIEARIRT
Sbjct  119  REIQAETDREAGGNKGASDKQIRLKIFSPNVLDINLVDLPGITKVPVGDQPSDIEARIRT  178

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIK PSCLILAVTPAN+D
Sbjct  179  MIMSYIKQPSCLILAVTPANSD  200



>ref|XP_007042813.1| Dynamin-related protein 3A isoform 1 [Theobroma cacao]
 gb|EOX98644.1| Dynamin-related protein 3A isoform 1 [Theobroma cacao]
Length=827

 Score =   332 bits (850),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 179/202 (89%), Positives = 191/202 (95%), Gaps = 3/202 (1%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAEEA  S+  +S   AAPLG SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS
Sbjct  1    MAEEAAASTPPSS---AAPLGSSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS  57

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLE+LVGRDFLPRGSDICTRRPLVLQLLQTK KPD ++EE+GEFLHLPGK+F+DF++IR
Sbjct  58   SVLESLVGRDFLPRGSDICTRRPLVLQLLQTKCKPDGSEEEYGEFLHLPGKRFYDFSEIR  117

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT
Sbjct  118  REIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  177

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIK PSCLILAVTPAN+D
Sbjct  178  MIMSYIKQPSCLILAVTPANSD  199



>gb|KJB47249.1| hypothetical protein B456_008G017900 [Gossypium raimondii]
Length=810

 Score =   331 bits (849),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 177/202 (88%), Positives = 192/202 (95%), Gaps = 2/202 (1%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAEEA  ++++   L+AAPLG SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS
Sbjct  1    MAEEA--AASTPPQLSAAPLGSSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS  58

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLE+LVGRDFLPRGSDICTRRPLVLQLLQTKRKPD ++EE+GEFLHLPGK+F+DF++IR
Sbjct  59   SVLESLVGRDFLPRGSDICTRRPLVLQLLQTKRKPDGSEEEYGEFLHLPGKRFYDFSEIR  118

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQAETDREAGGNKG SDKQIRLKIFSPNVLDI LVDLPGITKVPVGDQPSDIEARIRT
Sbjct  119  REIQAETDREAGGNKGASDKQIRLKIFSPNVLDINLVDLPGITKVPVGDQPSDIEARIRT  178

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIK PSCLILAVTPAN+D
Sbjct  179  MIMSYIKQPSCLILAVTPANSD  200



>ref|XP_011087964.1| PREDICTED: dynamin-related protein 3A [Sesamum indicum]
Length=820

 Score =   331 bits (848),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRG+DIC
Sbjct  18   LGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDIC  77

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQL+Q KRK D TDEEWGEFLHLPGK+FFDFN+IR+EIQAETDREAGGNKGVSD
Sbjct  78   TRRPLVLQLVQRKRKADGTDEEWGEFLHLPGKRFFDFNEIRREIQAETDREAGGNKGVSD  137

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPG+TKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA
Sbjct  138  KQIRLKIFSPNVLDITLVDLPGLTKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  197

Query  812  NAD  820
            N+D
Sbjct  198  NSD  200



>gb|KHF99511.1| Dynamin-related 3A -like protein [Gossypium arboreum]
Length=785

 Score =   330 bits (845),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 190/202 (94%), Gaps = 2/202 (1%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAEEA  S+   S+  AAPLG SVIPIVNKLQDIFAQLGSQST ELPQVAV+GSQSSGKS
Sbjct  1    MAEEAAASTPPQSS--AAPLGSSVIPIVNKLQDIFAQLGSQSTTELPQVAVIGSQSSGKS  58

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLE+LVGRDFLPRGSDICTRRPLVLQLLQTKR+PD ++EE+GEFLHLPGK+F+DF++IR
Sbjct  59   SVLESLVGRDFLPRGSDICTRRPLVLQLLQTKRRPDGSEEEYGEFLHLPGKRFYDFSEIR  118

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVD PGITKVPVGDQPSDIEARIRT
Sbjct  119  REIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDHPGITKVPVGDQPSDIEARIRT  178

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIK PSCLILAVTPAN+D
Sbjct  179  MIMSYIKQPSCLILAVTPANSD  200



>ref|XP_004250727.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Solanum 
lycopersicum]
Length=826

 Score =   329 bits (843),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +2

Query  260  NAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            N APLGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRG
Sbjct  17   NTAPLGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRG  76

Query  440  SDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNK  619
            SDICTRRPLVLQL+Q KRKPD T++E+GEFLHL GK+F+DFN+IR+EIQAET+REAG NK
Sbjct  77   SDICTRRPLVLQLIQNKRKPDGTEDEYGEFLHLSGKRFYDFNEIRREIQAETEREAGANK  136

Query  620  GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILA  799
            GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK PSCLILA
Sbjct  137  GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKRPSCLILA  196

Query  800  VTPANAD  820
            VTPANAD
Sbjct  197  VTPANAD  203



>ref|XP_010313067.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Solanum 
lycopersicum]
Length=827

 Score =   329 bits (843),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +2

Query  260  NAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            N APLGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRG
Sbjct  17   NTAPLGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRG  76

Query  440  SDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNK  619
            SDICTRRPLVLQL+Q KRKPD T++E+GEFLHL GK+F+DFN+IR+EIQAET+REAG NK
Sbjct  77   SDICTRRPLVLQLIQNKRKPDGTEDEYGEFLHLSGKRFYDFNEIRREIQAETEREAGANK  136

Query  620  GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILA  799
            GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK PSCLILA
Sbjct  137  GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKRPSCLILA  196

Query  800  VTPANAD  820
            VTPANAD
Sbjct  197  VTPANAD  203



>emb|CDO97375.1| unnamed protein product [Coffea canephora]
Length=836

 Score =   327 bits (837),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 188/208 (90%), Gaps = 6/208 (3%)
 Frame = +2

Query  215  MAEEAV------PSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgs  376
            MAEE V      PS  S SN +   LG SVIPIVNKLQDIFAQL SQSTIELPQVAVVGS
Sbjct  1    MAEEPVNDAVASPSPASQSNSSVVLLGSSVIPIVNKLQDIFAQLSSQSTIELPQVAVVGS  60

Query  377  qssgkssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFF  556
            QSSGKSSVLEALVGRDFLPRGSDICTRRPLVLQL+QT+RKPD TDEEWGEFLHLPGK+F+
Sbjct  61   QSSGKSSVLEALVGRDFLPRGSDICTRRPLVLQLVQTRRKPDGTDEEWGEFLHLPGKRFY  120

Query  557  DFNDIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDI  736
            +FN+IRKEI+AET REAG NKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDI
Sbjct  121  NFNEIRKEIEAETVREAGLNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDI  180

Query  737  EARIRTMIMSYIKLPSCLILAVTPANAD  820
            EARIRTMIMSYIK P+CLILAVTPANAD
Sbjct  181  EARIRTMIMSYIKRPTCLILAVTPANAD  208



>gb|KCW56936.1| hypothetical protein EUGRSUZ_I02611 [Eucalyptus grandis]
Length=609

 Score =   321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+SVIPIVNKLQDIFAQLGSQSTIELPQV+VVGSQSSGKSSVLE+LVGRDFLPRGS+IC
Sbjct  26   LGNSVIPIVNKLQDIFAQLGSQSTIELPQVSVVGSQSSGKSSVLESLVGRDFLPRGSEIC  85

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQLLQTKRKPD  +EE+GEFLHLPGK+F+DF+DIR+EIQAET+REAGGNKGVSD
Sbjct  86   TRRPLVLQLLQTKRKPDGAEEEYGEFLHLPGKRFYDFSDIRREIQAETEREAGGNKGVSD  145

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPG+TKVPVGDQPSDIEARIRTMIMSYIK+PSCLILAVTPA
Sbjct  146  KQIRLKIFSPNVLDITLVDLPGLTKVPVGDQPSDIEARIRTMIMSYIKVPSCLILAVTPA  205

Query  812  NAD  820
            N+D
Sbjct  206  NSD  208



>gb|KCW56935.1| hypothetical protein EUGRSUZ_I02611 [Eucalyptus grandis]
Length=693

 Score =   322 bits (826),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+SVIPIVNKLQDIFAQLGSQSTIELPQV+VVGSQSSGKSSVLE+LVGRDFLPRGS+IC
Sbjct  26   LGNSVIPIVNKLQDIFAQLGSQSTIELPQVSVVGSQSSGKSSVLESLVGRDFLPRGSEIC  85

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQLLQTKRKPD  +EE+GEFLHLPGK+F+DF+DIR+EIQAET+REAGGNKGVSD
Sbjct  86   TRRPLVLQLLQTKRKPDGAEEEYGEFLHLPGKRFYDFSDIRREIQAETEREAGGNKGVSD  145

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPG+TKVPVGDQPSDIEARIRTMIMSYIK+PSCLILAVTPA
Sbjct  146  KQIRLKIFSPNVLDITLVDLPGLTKVPVGDQPSDIEARIRTMIMSYIKVPSCLILAVTPA  205

Query  812  NAD  820
            N+D
Sbjct  206  NSD  208



>ref|XP_008348876.1| PREDICTED: dynamin-related protein 3A-like [Malus domestica]
Length=400

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGS+IC
Sbjct  23   LGNSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSEIC  82

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQLLQTKR  D TDEE+GEFLH+PGK+F+DF++IR+EIQA T+REAG NKGV+D
Sbjct  83   TRRPLVLQLLQTKRNADGTDEEYGEFLHVPGKRFYDFSEIRREIQAVTEREAGVNKGVTD  142

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK+PSCLILAVT A
Sbjct  143  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKIPSCLILAVTAA  202

Query  812  NAD  820
            N+D
Sbjct  203  NSD  205



>ref|XP_010029998.1| PREDICTED: dynamin-related protein 3A isoform X4 [Eucalyptus 
grandis]
Length=834

 Score =   323 bits (827),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+SVIPIVNKLQDIFAQLGSQSTIELPQV+VVGSQSSGKSSVLE+LVGRDFLPRGS+IC
Sbjct  26   LGNSVIPIVNKLQDIFAQLGSQSTIELPQVSVVGSQSSGKSSVLESLVGRDFLPRGSEIC  85

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQLLQTKRKPD  +EE+GEFLHLPGK+F+DF+DIR+EIQAET+REAGGNKGVSD
Sbjct  86   TRRPLVLQLLQTKRKPDGAEEEYGEFLHLPGKRFYDFSDIRREIQAETEREAGGNKGVSD  145

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPG+TKVPVGDQPSDIEARIRTMIMSYIK+PSCLILAVTPA
Sbjct  146  KQIRLKIFSPNVLDITLVDLPGLTKVPVGDQPSDIEARIRTMIMSYIKVPSCLILAVTPA  205

Query  812  NAD  820
            N+D
Sbjct  206  NSD  208



>ref|XP_010029997.1| PREDICTED: dynamin-related protein 3A isoform X3 [Eucalyptus 
grandis]
Length=836

 Score =   322 bits (826),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+SVIPIVNKLQDIFAQLGSQSTIELPQV+VVGSQSSGKSSVLE+LVGRDFLPRGS+IC
Sbjct  26   LGNSVIPIVNKLQDIFAQLGSQSTIELPQVSVVGSQSSGKSSVLESLVGRDFLPRGSEIC  85

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQLLQTKRKPD  +EE+GEFLHLPGK+F+DF+DIR+EIQAET+REAGGNKGVSD
Sbjct  86   TRRPLVLQLLQTKRKPDGAEEEYGEFLHLPGKRFYDFSDIRREIQAETEREAGGNKGVSD  145

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPG+TKVPVGDQPSDIEARIRTMIMSYIK+PSCLILAVTPA
Sbjct  146  KQIRLKIFSPNVLDITLVDLPGLTKVPVGDQPSDIEARIRTMIMSYIKVPSCLILAVTPA  205

Query  812  NAD  820
            N+D
Sbjct  206  NSD  208



>ref|XP_010029996.1| PREDICTED: dynamin-related protein 3A isoform X2 [Eucalyptus 
grandis]
 gb|KCW56934.1| hypothetical protein EUGRSUZ_I02611 [Eucalyptus grandis]
Length=837

 Score =   322 bits (826),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+SVIPIVNKLQDIFAQLGSQSTIELPQV+VVGSQSSGKSSVLE+LVGRDFLPRGS+IC
Sbjct  26   LGNSVIPIVNKLQDIFAQLGSQSTIELPQVSVVGSQSSGKSSVLESLVGRDFLPRGSEIC  85

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQLLQTKRKPD  +EE+GEFLHLPGK+F+DF+DIR+EIQAET+REAGGNKGVSD
Sbjct  86   TRRPLVLQLLQTKRKPDGAEEEYGEFLHLPGKRFYDFSDIRREIQAETEREAGGNKGVSD  145

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPG+TKVPVGDQPSDIEARIRTMIMSYIK+PSCLILAVTPA
Sbjct  146  KQIRLKIFSPNVLDITLVDLPGLTKVPVGDQPSDIEARIRTMIMSYIKVPSCLILAVTPA  205

Query  812  NAD  820
            N+D
Sbjct  206  NSD  208



>gb|KHG14620.1| Dynamin-related 3A -like protein [Gossypium arboreum]
Length=823

 Score =   322 bits (824),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +2

Query  260  NAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            + APLG SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLE+LVGRDFLPRG
Sbjct  19   SVAPLGSSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLESLVGRDFLPRG  78

Query  440  SDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNK  619
            +DICTRRPLVLQLLQTKRK D ++EE+GEFLHLPGK+F+DF++IR+EIQAETDREAGGNK
Sbjct  79   NDICTRRPLVLQLLQTKRKLDGSEEEYGEFLHLPGKRFYDFSEIRREIQAETDREAGGNK  138

Query  620  GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILA  799
            GVSD+QIRLK+FSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK PSCLILA
Sbjct  139  GVSDRQIRLKVFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKQPSCLILA  198

Query  800  VTPANAD  820
            VTPAN+D
Sbjct  199  VTPANSD  205



>ref|XP_010029995.1| PREDICTED: dynamin-related protein 3A isoform X1 [Eucalyptus 
grandis]
Length=839

 Score =   322 bits (825),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+SVIPIVNKLQDIFAQLGSQSTIELPQV+VVGSQSSGKSSVLE+LVGRDFLPRGS+IC
Sbjct  26   LGNSVIPIVNKLQDIFAQLGSQSTIELPQVSVVGSQSSGKSSVLESLVGRDFLPRGSEIC  85

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQLLQTKRKPD  +EE+GEFLHLPGK+F+DF+DIR+EIQAET+REAGGNKGVSD
Sbjct  86   TRRPLVLQLLQTKRKPDGAEEEYGEFLHLPGKRFYDFSDIRREIQAETEREAGGNKGVSD  145

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPG+TKVPVGDQPSDIEARIRTMIMSYIK+PSCLILAVTPA
Sbjct  146  KQIRLKIFSPNVLDITLVDLPGLTKVPVGDQPSDIEARIRTMIMSYIKVPSCLILAVTPA  205

Query  812  NAD  820
            N+D
Sbjct  206  NSD  208



>gb|EYU39106.1| hypothetical protein MIMGU_mgv1a001369mg [Erythranthe guttata]
Length=832

 Score =   322 bits (824),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +2

Query  269  PLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDI  448
            PLGHSVIPIVNKLQDIF+QLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRG+DI
Sbjct  21   PLGHSVIPIVNKLQDIFSQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDI  80

Query  449  CTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            CTRRPLVLQL+Q K+K D TDEEWGEFLHLPGK+F DFN+IRKEIQAET+REAGGNKGVS
Sbjct  81   CTRRPLVLQLVQMKKKGDGTDEEWGEFLHLPGKRFLDFNEIRKEIQAETEREAGGNKGVS  140

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            DKQIRLKIFSPNVLDI LVDLPG+TKVPVGDQPSDIEARIRTMIMSYIK  SCLILAVTP
Sbjct  141  DKQIRLKIFSPNVLDIALVDLPGLTKVPVGDQPSDIEARIRTMIMSYIKRQSCLILAVTP  200

Query  809  ANAD  820
            ANAD
Sbjct  201  ANAD  204



>gb|KJB79569.1| hypothetical protein B456_013G054900 [Gossypium raimondii]
Length=831

 Score =   322 bits (824),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +2

Query  260  NAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            + APLG SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLE+LVGRDFLPRG
Sbjct  19   SVAPLGSSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLESLVGRDFLPRG  78

Query  440  SDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNK  619
            +DICTRRPLVLQLLQTKRK D ++EE+GEFLHLPGK+F+DF++IR+EIQAETDREAGGNK
Sbjct  79   NDICTRRPLVLQLLQTKRKLDGSEEEYGEFLHLPGKRFYDFSEIRREIQAETDREAGGNK  138

Query  620  GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILA  799
            GVSD+QIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK PSCLILA
Sbjct  139  GVSDRQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKQPSCLILA  198

Query  800  VTPANAD  820
            VTPAN+D
Sbjct  199  VTPANSD  205



>gb|KGN53891.1| Dynamin [Cucumis sativus]
Length=589

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 189/203 (93%), Gaps = 6/203 (3%)
 Frame = +2

Query  215  MAEEAV-PSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgk  391
            MA++ V PS+ S S+  AAPLG SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK
Sbjct  1    MADDPVAPSTPSVSSSAAAPLGSSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK  60

Query  392  ssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDI  571
            SSVLEALVGRDFLPRGS ICTRRPLVLQLLQT     +TD+E+GEFLHLPGKKF+DF++I
Sbjct  61   SSVLEALVGRDFLPRGSGICTRRPLVLQLLQT-----NTDKEYGEFLHLPGKKFYDFSEI  115

Query  572  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  751
            R+EIQ+ET+RE GGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR
Sbjct  116  RREIQSETEREVGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  175

Query  752  TMIMSYIKLPSCLILAVTPANAD  820
            TMIMSYIK+PSCLILAVTPAN+D
Sbjct  176  TMIMSYIKVPSCLILAVTPANSD  198



>ref|XP_010277557.1| PREDICTED: dynamin-related protein 3A-like [Nelumbo nucifera]
Length=829

 Score =   321 bits (822),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 189/202 (94%), Gaps = 2/202 (1%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAEE  P ST  +  ++APLG+S+IPI+NKLQDIF QLGS STIELPQVAVVGSQSSGKS
Sbjct  1    MAEE--PVSTPHNPSSSAPLGYSMIPIINKLQDIFTQLGSSSTIELPQVAVVGSQSSGKS  58

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLEALVGRDFLPRGSDICTRRPLVLQL+QTKRKPD T+EE+GEFLHLP KKF+DF++IR
Sbjct  59   SVLEALVGRDFLPRGSDICTRRPLVLQLVQTKRKPDGTEEEYGEFLHLPRKKFYDFSEIR  118

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            KEIQAET+REAGGNKG+SDKQIRLKI SPNVLDITLVDLPGITKVPVGDQPSDIEARIRT
Sbjct  119  KEIQAETEREAGGNKGISDKQIRLKINSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  178

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MI+SYIK PSCLILAV+PAN+D
Sbjct  179  MILSYIKHPSCLILAVSPANSD  200



>ref|XP_010254582.1| PREDICTED: dynamin-related protein 3A-like [Nelumbo nucifera]
Length=828

 Score =   321 bits (822),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LGHSVIPIVNKLQDIF+QLGS STIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC
Sbjct  17   LGHSVIPIVNKLQDIFSQLGSSSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC  76

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQLLQTKRKPD T+EE+GEFLHLP KKF+DF++IR+EIQAET+REAGGNKG+SD
Sbjct  77   TRRPLVLQLLQTKRKPDGTEEEYGEFLHLPRKKFYDFSEIRREIQAETEREAGGNKGISD  136

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKI SPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMI+SYIK PSCLILAVTPA
Sbjct  137  KQIRLKIHSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMILSYIKHPSCLILAVTPA  196

Query  812  NAD  820
            NAD
Sbjct  197  NAD  199



>ref|XP_002532763.1| dynamin, putative [Ricinus communis]
 gb|EEF29620.1| dynamin, putative [Ricinus communis]
Length=837

 Score =   320 bits (820),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 188/205 (92%), Gaps = 3/205 (1%)
 Frame = +2

Query  215  MAEE-AVPSSTSTSNLNAA--PLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqss  385
            MAEE A PS  + +   +   PLG SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSS
Sbjct  1    MAEEPASPSHAAVAASQSQAAPLGSSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSS  60

Query  386  gkssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFN  565
            GKSSVLE+LVGRDFLPRG+DICTRRPLVLQLLQTKRK D ++EEWGEFLHLPGK+FFDF+
Sbjct  61   GKSSVLESLVGRDFLPRGNDICTRRPLVLQLLQTKRKADGSEEEWGEFLHLPGKRFFDFS  120

Query  566  DIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEAR  745
            DIR+EIQAET +EAG NKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEAR
Sbjct  121  DIRREIQAETAKEAGDNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEAR  180

Query  746  IRTMIMSYIKLPSCLILAVTPANAD  820
            IRTMIMSYIK PSCLILAVTPAN+D
Sbjct  181  IRTMIMSYIKKPSCLILAVTPANSD  205



>ref|XP_006377100.1| hypothetical protein POPTR_0012s14790g, partial [Populus trichocarpa]
 gb|ERP54897.1| hypothetical protein POPTR_0012s14790g, partial [Populus trichocarpa]
Length=317

 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 181/203 (89%), Gaps = 11/203 (5%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAEE  P+S S ++  A PLG SVIPIVNKLQDIFA LGSQSTIELPQVAVVGSQSS   
Sbjct  1    MAEE--PASPSLAS--APPLGSSVIPIVNKLQDIFAHLGSQSTIELPQVAVVGSQSS---  53

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPD-STDEEWGEFLHLPGKKFFDFNDI  571
               EALVGRDFLPRG++ICTRRPLVLQLLQTKRK D S ++EWGEFLHLPGK+F+DF++I
Sbjct  54   ---EALVGRDFLPRGNEICTRRPLVLQLLQTKRKGDGSGEDEWGEFLHLPGKRFYDFSEI  110

Query  572  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  751
            R EIQAET +EAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR
Sbjct  111  RNEIQAETAKEAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  170

Query  752  TMIMSYIKLPSCLILAVTPANAD  820
            TMIMSYIK PSCLILAVT AN+D
Sbjct  171  TMIMSYIKKPSCLILAVTAANSD  193



>ref|XP_004292471.1| PREDICTED: dynamin-related protein 3A [Fragaria vesca subsp. 
vesca]
Length=827

 Score =   318 bits (815),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGS+IC
Sbjct  19   LGNSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSEIC  78

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQLLQTKR  D TDEE+GEFLH+PGK+F+DF+DIR+EIQAET+REAGGNKGV+D
Sbjct  79   TRRPLVLQLLQTKRSADGTDEEYGEFLHVPGKRFYDFSDIRREIQAETEREAGGNKGVTD  138

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK+PSCLILAVT A
Sbjct  139  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKIPSCLILAVTAA  198

Query  812  NAD  820
            N+D
Sbjct  199  NSD  201



>ref|XP_002309855.2| hypothetical protein POPTR_0007s02960g [Populus trichocarpa]
 gb|EEE90305.2| hypothetical protein POPTR_0007s02960g [Populus trichocarpa]
Length=835

 Score =   317 bits (813),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 189/203 (93%), Gaps = 5/203 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAEE  P+S S S+  AAPLG SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS
Sbjct  1    MAEE--PASPSLSS--AAPLGSSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS  56

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPD-STDEEWGEFLHLPGKKFFDFNDI  571
            SVLEALVGRDFLPRG++ICTRRPLVLQLLQTKRK D S ++EWGEFLHLPGK+F+DF++I
Sbjct  57   SVLEALVGRDFLPRGNEICTRRPLVLQLLQTKRKGDGSGEDEWGEFLHLPGKRFYDFSEI  116

Query  572  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  751
            R EIQAET +EAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR
Sbjct  117  RSEIQAETAKEAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  176

Query  752  TMIMSYIKLPSCLILAVTPANAD  820
            TMIMSYIK PSCLILAVT AN+D
Sbjct  177  TMIMSYIKKPSCLILAVTAANSD  199



>ref|XP_004147508.1| PREDICTED: dynamin-related protein 3A [Cucumis sativus]
Length=822

 Score =   315 bits (807),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 189/203 (93%), Gaps = 6/203 (3%)
 Frame = +2

Query  215  MAEEAV-PSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgk  391
            MA++ V PS+ S S+  AAPLG SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK
Sbjct  1    MADDPVAPSTPSVSSSAAAPLGSSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK  60

Query  392  ssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDI  571
            SSVLEALVGRDFLPRGS ICTRRPLVLQLLQT     +TD+E+GEFLHLPGKKF+DF++I
Sbjct  61   SSVLEALVGRDFLPRGSGICTRRPLVLQLLQT-----NTDKEYGEFLHLPGKKFYDFSEI  115

Query  572  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  751
            R+EIQ+ET+RE GGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR
Sbjct  116  RREIQSETEREVGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  175

Query  752  TMIMSYIKLPSCLILAVTPANAD  820
            TMIMSYIK+PSCLILAVTPAN+D
Sbjct  176  TMIMSYIKVPSCLILAVTPANSD  198



>ref|XP_009366330.1| PREDICTED: dynamin-related protein 3A-like [Pyrus x bretschneideri]
Length=836

 Score =   315 bits (808),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGS+IC
Sbjct  23   LGNSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSEIC  82

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQLLQTKR  D TDEE+GEFLH+PGK+F+DF++IR+EIQAET+REAGGNKGV+D
Sbjct  83   TRRPLVLQLLQTKRNADGTDEEYGEFLHVPGKRFYDFSEIRREIQAETEREAGGNKGVTD  142

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK+P+CLILAVT A
Sbjct  143  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKIPTCLILAVTAA  202

Query  812  NAD  820
            N+D
Sbjct  203  NSD  205



>ref|XP_011003246.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Populus 
euphratica]
Length=826

 Score =   315 bits (807),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 188/203 (93%), Gaps = 5/203 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAEE  P+S S S+  A PLG SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS
Sbjct  1    MAEE--PASPSLSS--APPLGSSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS  56

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPD-STDEEWGEFLHLPGKKFFDFNDI  571
            SVLE+LVGRDFLPRG+DICTRRPLVLQLLQTKRK D S ++EWGEFLHLPGK+F+DF++I
Sbjct  57   SVLESLVGRDFLPRGNDICTRRPLVLQLLQTKRKGDGSGEDEWGEFLHLPGKRFYDFSEI  116

Query  572  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  751
            R EIQAET +EAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR
Sbjct  117  RSEIQAETAKEAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  176

Query  752  TMIMSYIKLPSCLILAVTPANAD  820
            TMIMSYIK PSCLILAVT AN+D
Sbjct  177  TMIMSYIKKPSCLILAVTAANSD  199



>ref|XP_009343811.1| PREDICTED: dynamin-related protein 3A-like [Pyrus x bretschneideri]
Length=836

 Score =   315 bits (807),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGS+IC
Sbjct  23   LGNSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSEIC  82

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQLLQTKR  D TDEE+GEFLH+PGK+F+DF++IR+EIQAET+REAGGNKGV+D
Sbjct  83   TRRPLVLQLLQTKRNADGTDEEYGEFLHVPGKRFYDFSEIRREIQAETEREAGGNKGVTD  142

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK+P+CLILAVT A
Sbjct  143  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKIPTCLILAVTAA  202

Query  812  NAD  820
            N+D
Sbjct  203  NSD  205



>ref|XP_011003245.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Populus 
euphratica]
Length=827

 Score =   315 bits (807),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 188/203 (93%), Gaps = 5/203 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAEE  P+S S S+  A PLG SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS
Sbjct  1    MAEE--PASPSLSS--APPLGSSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS  56

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPD-STDEEWGEFLHLPGKKFFDFNDI  571
            SVLE+LVGRDFLPRG+DICTRRPLVLQLLQTKRK D S ++EWGEFLHLPGK+F+DF++I
Sbjct  57   SVLESLVGRDFLPRGNDICTRRPLVLQLLQTKRKGDGSGEDEWGEFLHLPGKRFYDFSEI  116

Query  572  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  751
            R EIQAET +EAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR
Sbjct  117  RSEIQAETAKEAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  176

Query  752  TMIMSYIKLPSCLILAVTPANAD  820
            TMIMSYIK PSCLILAVT AN+D
Sbjct  177  TMIMSYIKKPSCLILAVTAANSD  199



>gb|EYU18402.1| hypothetical protein MIMGU_mgv1a001513mg [Erythranthe guttata]
Length=804

 Score =   314 bits (805),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+SVIP+VNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRG+DIC
Sbjct  16   LGNSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDIC  75

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQL Q K K D TD EWGEFLHLPGKKFFDFN+IRKEIQAETDREAGGNKGVSD
Sbjct  76   TRRPLVLQLEQRKGKADGTDHEWGEFLHLPGKKFFDFNEIRKEIQAETDREAGGNKGVSD  135

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPG+TKVPVGDQPSDIEARIRTMIMSYIK  SCLI+AVTPA
Sbjct  136  KQIRLKIFSPNVLDITLVDLPGLTKVPVGDQPSDIEARIRTMIMSYIKRQSCLIIAVTPA  195

Query  812  NAD  820
            N+D
Sbjct  196  NSD  198



>ref|XP_006597367.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Glycine 
max]
Length=690

 Score =   311 bits (797),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 170/202 (84%), Positives = 189/202 (94%), Gaps = 4/202 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MA+E VPS ++ S   A PLG SVI +VN+LQDIFA++GSQSTI+LPQVAVVGSQSSGKS
Sbjct  1    MADE-VPSPSAASTATA-PLGSSVISLVNRLQDIFARVGSQSTIDLPQVAVVGSQSSGKS  58

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLEALVGRDFLPRG+DICTRRPLVLQL+QTKRKPD  ++E+GEFLHLPG+KF DF++IR
Sbjct  59   SVLEALVGRDFLPRGNDICTRRPLVLQLVQTKRKPD--NDEYGEFLHLPGRKFHDFSEIR  116

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT
Sbjct  117  REIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  176

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIK P+CLILAVTPAN+D
Sbjct  177  MIMSYIKTPTCLILAVTPANSD  198



>ref|XP_008237240.1| PREDICTED: dynamin-related protein 3A [Prunus mume]
Length=836

 Score =   314 bits (804),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 173/205 (84%), Positives = 191/205 (93%), Gaps = 3/205 (1%)
 Frame = +2

Query  215  MAEE---AVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqss  385
            MA+E   A P   S+ + +A+PLG+SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSS
Sbjct  1    MADEPSVAPPQHGSSPSPSASPLGNSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSS  60

Query  386  gkssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFN  565
            GKSSVLEALVGRDFLPRGS+ICTRRPLVLQLLQTKR PD TDEE+GEFLH+PG++F DF+
Sbjct  61   GKSSVLEALVGRDFLPRGSEICTRRPLVLQLLQTKRNPDGTDEEYGEFLHVPGRRFHDFS  120

Query  566  DIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEAR  745
            +IR+EIQ ET+REAGGNKGV+DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEAR
Sbjct  121  EIRREIQLETEREAGGNKGVTDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEAR  180

Query  746  IRTMIMSYIKLPSCLILAVTPANAD  820
            IRTMIMSYIK+PSCLILAVT AN+D
Sbjct  181  IRTMIMSYIKVPSCLILAVTAANSD  205



>ref|XP_010315139.1| PREDICTED: dynamin-related protein 3B-like [Solanum lycopersicum]
Length=822

 Score =   313 bits (803),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 186/202 (92%), Gaps = 6/202 (3%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAEE  PS+ S    +AA LGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS
Sbjct  1    MAEEISPSN-SPDAASAASLGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKS  59

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLEALVGRDFLPRGSDICTRRPLVLQLL+      ++DEE+GEFLHLP K+F+DFN+IR
Sbjct  60   SVLEALVGRDFLPRGSDICTRRPLVLQLLK-----HNSDEEYGEFLHLPEKRFYDFNEIR  114

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
             EIQAET+REAGGNKGVSDKQIRLKI+SPNVLDITLVDLPGITKVPVGDQPSDIEARIRT
Sbjct  115  WEIQAETEREAGGNKGVSDKQIRLKIYSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  174

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIK+PSCLILAVTPAN+D
Sbjct  175  MIMSYIKVPSCLILAVTPANSD  196



>ref|XP_008373223.1| PREDICTED: dynamin-related protein 3A-like [Malus domestica]
Length=836

 Score =   313 bits (803),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+SVIPI NKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGS+IC
Sbjct  23   LGNSVIPIANKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSEIC  82

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQLLQTKR  D TDEE+GEFLH+PGK+F+DF++IR+EIQAET+REAGGNKGV+D
Sbjct  83   TRRPLVLQLLQTKRNADGTDEEYGEFLHVPGKRFYDFSEIRREIQAETEREAGGNKGVTD  142

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK+P+CLILAVT A
Sbjct  143  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKIPTCLILAVTAA  202

Query  812  NAD  820
            N+D
Sbjct  203  NSD  205



>ref|XP_007148356.1| hypothetical protein PHAVU_006G201400g [Phaseolus vulgaris]
 gb|ESW20350.1| hypothetical protein PHAVU_006G201400g [Phaseolus vulgaris]
Length=828

 Score =   313 bits (802),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 171/202 (85%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAEE   S+TS +    APLG SVI +VN+LQDIF+++GSQSTI+LPQVAVVGSQSSGKS
Sbjct  1    MAEEVSSSTTSPAASATAPLGSSVISLVNRLQDIFSRVGSQSTIDLPQVAVVGSQSSGKS  60

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLEALVGRDFLPRG+DICTRRPLVLQL+QTKRKPD+ D+E+GEFLHLPG+KF DF+DIR
Sbjct  61   SVLEALVGRDFLPRGNDICTRRPLVLQLVQTKRKPDAPDDEYGEFLHLPGRKFHDFSDIR  120

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT
Sbjct  121  REIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  180

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIK P+CLILAVTPAN+D
Sbjct  181  MIMSYIKTPTCLILAVTPANSD  202



>gb|KDO44159.1| hypothetical protein CISIN_1g003355mg [Citrus sinensis]
Length=699

 Score =   310 bits (793),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 188/203 (93%), Gaps = 6/203 (3%)
 Frame = +2

Query  215  MAEEAVPSSTST-SNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgk  391
            MA+E   ++T+  S  +A PLG SVIP+VNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK
Sbjct  1    MADEPATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK  60

Query  392  ssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDI  571
            SSVLEALVGRDFLPRG+DICTRRPLVLQLLQTK     TDEE+GEFLHLPGK+F+DF++I
Sbjct  61   SSVLEALVGRDFLPRGNDICTRRPLVLQLLQTK-----TDEEYGEFLHLPGKRFYDFSEI  115

Query  572  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  751
            R+EIQA+TD+EAGGNKGVSDKQIRLKIFSP+VLDITLVDLPGITKVPVG+QP+DIEARIR
Sbjct  116  RREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIR  175

Query  752  TMIMSYIKLPSCLILAVTPANAD  820
            TMIMSYIK PSCLILAVTPAN+D
Sbjct  176  TMIMSYIKQPSCLILAVTPANSD  198



>ref|XP_006423649.1| hypothetical protein CICLE_v10027825mg [Citrus clementina]
 gb|ESR36889.1| hypothetical protein CICLE_v10027825mg [Citrus clementina]
Length=699

 Score =   310 bits (793),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 188/203 (93%), Gaps = 6/203 (3%)
 Frame = +2

Query  215  MAEEAVPSSTST-SNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgk  391
            MA+E   ++T+  S  +A PLG SVIP+VNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK
Sbjct  1    MADEPATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK  60

Query  392  ssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDI  571
            SSVLEALVGRDFLPRG+DICTRRPLVLQLLQTK     TDEE+GEFLHLPGK+F+DF++I
Sbjct  61   SSVLEALVGRDFLPRGNDICTRRPLVLQLLQTK-----TDEEYGEFLHLPGKRFYDFSEI  115

Query  572  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  751
            R+EIQA+TD+EAGGNKGVSDKQIRLKIFSP+VLDITLVDLPGITKVPVG+QP+DIEARIR
Sbjct  116  RREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIR  175

Query  752  TMIMSYIKLPSCLILAVTPANAD  820
            TMIMSYIK PSCLILAVTPAN+D
Sbjct  176  TMIMSYIKQPSCLILAVTPANSD  198



>gb|KDO44158.1| hypothetical protein CISIN_1g003355mg [Citrus sinensis]
Length=710

 Score =   310 bits (794),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 188/203 (93%), Gaps = 6/203 (3%)
 Frame = +2

Query  215  MAEEAVPSSTST-SNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgk  391
            MA+E   ++T+  S  +A PLG SVIP+VNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK
Sbjct  1    MADEPATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK  60

Query  392  ssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDI  571
            SSVLEALVGRDFLPRG+DICTRRPLVLQLLQTK     TDEE+GEFLHLPGK+F+DF++I
Sbjct  61   SSVLEALVGRDFLPRGNDICTRRPLVLQLLQTK-----TDEEYGEFLHLPGKRFYDFSEI  115

Query  572  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  751
            R+EIQA+TD+EAGGNKGVSDKQIRLKIFSP+VLDITLVDLPGITKVPVG+QP+DIEARIR
Sbjct  116  RREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIR  175

Query  752  TMIMSYIKLPSCLILAVTPANAD  820
            TMIMSYIK PSCLILAVTPAN+D
Sbjct  176  TMIMSYIKQPSCLILAVTPANSD  198



>ref|XP_009590784.1| PREDICTED: dynamin-related protein 3B-like isoform X2 [Nicotiana 
tomentosiformis]
Length=802

 Score =   311 bits (798),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 177/186 (95%), Gaps = 3/186 (2%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC
Sbjct  18   LGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC  77

Query  452  TRRPLVLQLLQTK-RKPD--STDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKG  622
            TRRPLVLQLLQTK   P+  + D+EWGEFLH PGK+FFDFN+IR+EIQAET+RE G NKG
Sbjct  78   TRRPLVLQLLQTKPNNPNDAAGDQEWGEFLHHPGKRFFDFNEIRREIQAETEREVGANKG  137

Query  623  VSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAV  802
            +SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAV
Sbjct  138  ISDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAV  197

Query  803  TPANAD  820
            TPAN+D
Sbjct  198  TPANSD  203



>ref|XP_007199665.1| hypothetical protein PRUPE_ppa001399mg [Prunus persica]
 gb|EMJ00864.1| hypothetical protein PRUPE_ppa001399mg [Prunus persica]
Length=837

 Score =   312 bits (799),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  275  GHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICT  454
            G+SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGS+ICT
Sbjct  25   GNSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSEICT  84

Query  455  RRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSDK  634
            RRPLVLQLLQTKR PD TDEE+GEFLH+PG++F DF++IR+EIQ ET+REAGGNKGV+DK
Sbjct  85   RRPLVLQLLQTKRNPDGTDEEYGEFLHVPGRRFHDFSEIRREIQLETEREAGGNKGVTDK  144

Query  635  QIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPAN  814
            QIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK+PSCLILAVT AN
Sbjct  145  QIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKVPSCLILAVTAAN  204

Query  815  AD  820
            +D
Sbjct  205  SD  206



>ref|XP_009590783.1| PREDICTED: dynamin-related protein 3B-like isoform X1 [Nicotiana 
tomentosiformis]
Length=825

 Score =   311 bits (797),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 177/186 (95%), Gaps = 3/186 (2%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC
Sbjct  18   LGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC  77

Query  452  TRRPLVLQLLQTK-RKPD--STDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKG  622
            TRRPLVLQLLQTK   P+  + D+EWGEFLH PGK+FFDFN+IR+EIQAET+RE G NKG
Sbjct  78   TRRPLVLQLLQTKPNNPNDAAGDQEWGEFLHHPGKRFFDFNEIRREIQAETEREVGANKG  137

Query  623  VSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAV  802
            +SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAV
Sbjct  138  ISDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAV  197

Query  803  TPANAD  820
            TPAN+D
Sbjct  198  TPANSD  203



>ref|XP_003545730.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Glycine 
max]
Length=823

 Score =   311 bits (796),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 170/202 (84%), Positives = 189/202 (94%), Gaps = 4/202 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MA+E VPS ++ S   A PLG SVI +VN+LQDIFA++GSQSTI+LPQVAVVGSQSSGKS
Sbjct  1    MADE-VPSPSAASTATA-PLGSSVISLVNRLQDIFARVGSQSTIDLPQVAVVGSQSSGKS  58

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLEALVGRDFLPRG+DICTRRPLVLQL+QTKRKPD  ++E+GEFLHLPG+KF DF++IR
Sbjct  59   SVLEALVGRDFLPRGNDICTRRPLVLQLVQTKRKPD--NDEYGEFLHLPGRKFHDFSEIR  116

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT
Sbjct  117  REIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  176

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIK P+CLILAVTPAN+D
Sbjct  177  MIMSYIKTPTCLILAVTPANSD  198



>gb|KDO44157.1| hypothetical protein CISIN_1g003355mg [Citrus sinensis]
Length=827

 Score =   311 bits (796),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 188/203 (93%), Gaps = 6/203 (3%)
 Frame = +2

Query  215  MAEEAVPSSTST-SNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgk  391
            MA+E   ++T+  S  +A PLG SVIP+VNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK
Sbjct  1    MADEPATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK  60

Query  392  ssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDI  571
            SSVLEALVGRDFLPRG+DICTRRPLVLQLLQTK     TDEE+GEFLHLPGK+F+DF++I
Sbjct  61   SSVLEALVGRDFLPRGNDICTRRPLVLQLLQTK-----TDEEYGEFLHLPGKRFYDFSEI  115

Query  572  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  751
            R+EIQA+TD+EAGGNKGVSDKQIRLKIFSP+VLDITLVDLPGITKVPVG+QP+DIEARIR
Sbjct  116  RREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIR  175

Query  752  TMIMSYIKLPSCLILAVTPANAD  820
            TMIMSYIK PSCLILAVTPAN+D
Sbjct  176  TMIMSYIKQPSCLILAVTPANSD  198



>ref|XP_009793686.1| PREDICTED: dynamin-related protein 3B-like [Nicotiana sylvestris]
Length=828

 Score =   311 bits (796),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 188/206 (91%), Gaps = 4/206 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAA-PLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgk  391
            MAEE+  S+ + +   AA  LGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK
Sbjct  1    MAEESSTSNAAAAEAGAAASLGHSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK  60

Query  392  ssvLEALVGRDFLPRGSDICTRRPLVLQLLQTK-RKPD--STDEEWGEFLHLPGKKFFDF  562
            SSVLEALVGRDFLPRGSDICTRRPLVLQLLQTK   P+  + D+EWGEFLH PGK+FFDF
Sbjct  61   SSVLEALVGRDFLPRGSDICTRRPLVLQLLQTKPNNPNDAADDQEWGEFLHHPGKRFFDF  120

Query  563  NDIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEA  742
            N+IR+EIQAET+RE G NKG+SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEA
Sbjct  121  NEIRREIQAETEREVGVNKGISDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEA  180

Query  743  RIRTMIMSYIKLPSCLILAVTPANAD  820
            RIRTMIMSYIKLPSCLILAVTPAN+D
Sbjct  181  RIRTMIMSYIKLPSCLILAVTPANSD  206



>ref|XP_006423650.1| hypothetical protein CICLE_v10027825mg [Citrus clementina]
 gb|ESR36890.1| hypothetical protein CICLE_v10027825mg [Citrus clementina]
Length=827

 Score =   311 bits (796),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 188/203 (93%), Gaps = 6/203 (3%)
 Frame = +2

Query  215  MAEE-AVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgk  391
            MA+E A  ++ + S  +A PLG SVIP+VNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK
Sbjct  1    MADEPATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK  60

Query  392  ssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDI  571
            SSVLEALVGRDFLPRG+DICTRRPLVLQLLQTK     TDEE+GEFLHLPGK+F+DF++I
Sbjct  61   SSVLEALVGRDFLPRGNDICTRRPLVLQLLQTK-----TDEEYGEFLHLPGKRFYDFSEI  115

Query  572  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  751
            R+EIQA+TD+EAGGNKGVSDKQIRLKIFSP+VLDITLVDLPGITKVPVG+QP+DIEARIR
Sbjct  116  RREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIR  175

Query  752  TMIMSYIKLPSCLILAVTPANAD  820
            TMIMSYIK PSCLILAVTPAN+D
Sbjct  176  TMIMSYIKQPSCLILAVTPANSD  198



>ref|XP_008382203.1| PREDICTED: dynamin-related protein 3A [Malus domestica]
Length=837

 Score =   310 bits (794),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGS+IC
Sbjct  23   LGNSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSEIC  82

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQLLQTKR  D TDEE+GEFLH+PGK+F+DF++IR+EIQA T+REAG NKGV+D
Sbjct  83   TRRPLVLQLLQTKRNADGTDEEYGEFLHVPGKRFYDFSEIRREIQAVTEREAGVNKGVTD  142

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK+PSCLILAVT A
Sbjct  143  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKIPSCLILAVTAA  202

Query  812  NAD  820
            N+D
Sbjct  203  NSD  205



>ref|XP_009368315.1| PREDICTED: dynamin-related protein 3A-like [Pyrus x bretschneideri]
Length=837

 Score =   310 bits (794),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGS+IC
Sbjct  23   LGNSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSEIC  82

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQLLQTKR  D TDEE+GEFLH+PGK+F+DF++IR+EIQA T+REAG NKGV+D
Sbjct  83   TRRPLVLQLLQTKRNADGTDEEYGEFLHVPGKRFYDFSEIRREIQAVTEREAGVNKGVTD  142

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK+PSCLILAVT A
Sbjct  143  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKIPSCLILAVTAA  202

Query  812  NAD  820
            N+D
Sbjct  203  NSD  205



>ref|XP_010112241.1| Dynamin-related protein 3A [Morus notabilis]
 gb|EXC32997.1| Dynamin-related protein 3A [Morus notabilis]
Length=840

 Score =   309 bits (792),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  299  NKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTRRPLVLQL  478
            NKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDICTRRPLVLQL
Sbjct  40   NKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDICTRRPLVLQL  99

Query  479  LQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSDKQIRLKIFS  658
            LQTKR  D TD+E+GEFLHLPGK+F+DF+DIR+EIQAETDREAGGNKGVSDKQIRLKIFS
Sbjct  100  LQTKRSADGTDDEYGEFLHLPGKRFYDFSDIRREIQAETDREAGGNKGVSDKQIRLKIFS  159

Query  659  PNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPANAD  820
            PNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK+PSCLILAVTPAN+D
Sbjct  160  PNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKVPSCLILAVTPANSD  213



>ref|XP_006373004.1| dynamin-like family protein [Populus trichocarpa]
 gb|ERP50801.1| dynamin-like family protein [Populus trichocarpa]
Length=815

 Score =   308 bits (788),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 175/184 (95%), Gaps = 1/184 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRG++IC
Sbjct  25   LGSSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNEIC  84

Query  452  TRRPLVLQLLQTKRKPDST-DEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            TRRPLVLQLLQTKRK D   +EEWGEFLHLPGK+F+DF++IR EIQAET +EAGGNKGVS
Sbjct  85   TRRPLVLQLLQTKRKGDGCGEEEWGEFLHLPGKRFYDFSEIRSEIQAETAKEAGGNKGVS  144

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK PSCLILAVT 
Sbjct  145  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKKPSCLILAVTA  204

Query  809  ANAD  820
            AN+D
Sbjct  205  ANSD  208



>ref|XP_011006401.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Populus 
euphratica]
Length=825

 Score =   308 bits (788),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 175/184 (95%), Gaps = 1/184 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRG++IC
Sbjct  25   LGSSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNEIC  84

Query  452  TRRPLVLQLLQTKRKPDST-DEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            TRRPLVLQLLQTKRK D   +EEWGEFLHLPGK+F+DF++IR EIQAET +EAGGNKGVS
Sbjct  85   TRRPLVLQLLQTKRKGDGCGEEEWGEFLHLPGKRFYDFSEIRSEIQAETAKEAGGNKGVS  144

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK PSCLILAVT 
Sbjct  145  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKKPSCLILAVTA  204

Query  809  ANAD  820
            AN+D
Sbjct  205  ANSD  208



>ref|XP_011006400.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Populus 
euphratica]
Length=831

 Score =   308 bits (788),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 175/184 (95%), Gaps = 1/184 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRG++IC
Sbjct  25   LGSSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNEIC  84

Query  452  TRRPLVLQLLQTKRKPDST-DEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            TRRPLVLQLLQTKRK D   +EEWGEFLHLPGK+F+DF++IR EIQAET +EAGGNKGVS
Sbjct  85   TRRPLVLQLLQTKRKGDGCGEEEWGEFLHLPGKRFYDFSEIRSEIQAETAKEAGGNKGVS  144

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK PSCLILAVT 
Sbjct  145  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKKPSCLILAVTA  204

Query  809  ANAD  820
            AN+D
Sbjct  205  ANSD  208



>ref|XP_006373005.1| hypothetical protein POPTR_0017s06930g [Populus trichocarpa]
 gb|ERP50802.1| hypothetical protein POPTR_0017s06930g [Populus trichocarpa]
Length=821

 Score =   307 bits (787),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 175/184 (95%), Gaps = 1/184 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRG++IC
Sbjct  25   LGSSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNEIC  84

Query  452  TRRPLVLQLLQTKRKPDST-DEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            TRRPLVLQLLQTKRK D   +EEWGEFLHLPGK+F+DF++IR EIQAET +EAGGNKGVS
Sbjct  85   TRRPLVLQLLQTKRKGDGCGEEEWGEFLHLPGKRFYDFSEIRSEIQAETAKEAGGNKGVS  144

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK PSCLILAVT 
Sbjct  145  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKKPSCLILAVTA  204

Query  809  ANAD  820
            AN+D
Sbjct  205  ANSD  208



>ref|XP_006487698.1| PREDICTED: dynamin-related protein 3A-like [Citrus sinensis]
Length=850

 Score =   308 bits (788),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 171/216 (79%), Positives = 190/216 (88%), Gaps = 8/216 (4%)
 Frame = +2

Query  173  VFSQRSQSKLTQISMAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIEL  352
            +FS R   KL        A  ++ + S  +A PLG SVIP+VNKLQDIFAQLGSQSTIEL
Sbjct  14   IFSMR---KLGSYKYGTAATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIEL  70

Query  353  PqvavvgsqssgkssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFL  532
            PQVAVVGSQSSGKSSVLEALVGRDFLPRG+DICTRRPLVLQLLQTK     TDEE+GEFL
Sbjct  71   PQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTK-----TDEEYGEFL  125

Query  533  HLPGKKFFDFNDIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVP  712
            HLPGK+F+DF++IR+EIQA+TD+EAGGNKGVSDKQIRLKIFSP+VLDITLVDLPGITKVP
Sbjct  126  HLPGKRFYDFSEIRREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVP  185

Query  713  VGDQPSDIEARIRTMIMSYIKLPSCLILAVTPANAD  820
            VG+QP+DIEARIRTMIMSYIK PSCLILAVTPAN+D
Sbjct  186  VGEQPADIEARIRTMIMSYIKQPSCLILAVTPANSD  221



>gb|EYU18412.1| hypothetical protein MIMGU_mgv1a022072mg [Erythranthe guttata]
Length=774

 Score =   305 bits (782),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+SVIP+VNKLQDIFAQLGS+STIELPQVAVVGSQSSGKSSVLEALVGRDFLPRG+ IC
Sbjct  18   LGNSVIPLVNKLQDIFAQLGSESTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNGIC  77

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQL Q K K D  D+EWGEFLHLPG+KFFDF++IRKEIQAETDREAGGNKGVSD
Sbjct  78   TRRPLVLQLEQRKGKADGRDQEWGEFLHLPGRKFFDFDEIRKEIQAETDREAGGNKGVSD  137

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPG+TKVPVGDQPSDIEARIRTMIMSYIK  SCLI+AVTPA
Sbjct  138  KQIRLKIFSPNVLDITLVDLPGLTKVPVGDQPSDIEARIRTMIMSYIKRQSCLIIAVTPA  197

Query  812  NAD  820
            N+D
Sbjct  198  NSD  200



>ref|XP_010527015.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Tarenaya 
hassleriana]
Length=840

 Score =   307 bits (786),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 176/185 (95%), Gaps = 1/185 (1%)
 Frame = +2

Query  269  PLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDI  448
            PLG SVIPIVNKLQDIFAQLGS STIELPQVAVVGSQSSGKSSVLEALVGRDFLPRG+DI
Sbjct  32   PLGSSVIPIVNKLQDIFAQLGSHSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDI  91

Query  449  CTRRPLVLQLLQTKRKPDS-TDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGV  625
            CTRRPLVLQLLQTK + D  ++EEWGEFLHLPGK+FFDF++IR+EIQAET+R AG NKGV
Sbjct  92   CTRRPLVLQLLQTKGRSDGGSEEEWGEFLHLPGKRFFDFSEIRREIQAETNRLAGENKGV  151

Query  626  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVT  805
            SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK PSCLILAVT
Sbjct  152  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKQPSCLILAVT  211

Query  806  PANAD  820
            PAN+D
Sbjct  212  PANSD  216



>ref|XP_010527016.1| PREDICTED: dynamin-related protein 3A-like isoform X3 [Tarenaya 
hassleriana]
Length=839

 Score =   306 bits (785),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 176/185 (95%), Gaps = 1/185 (1%)
 Frame = +2

Query  269  PLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDI  448
            PLG SVIPIVNKLQDIFAQLGS STIELPQVAVVGSQSSGKSSVLEALVGRDFLPRG+DI
Sbjct  32   PLGSSVIPIVNKLQDIFAQLGSHSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDI  91

Query  449  CTRRPLVLQLLQTKRKPDS-TDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGV  625
            CTRRPLVLQLLQTK + D  ++EEWGEFLHLPGK+FFDF++IR+EIQAET+R AG NKGV
Sbjct  92   CTRRPLVLQLLQTKGRSDGGSEEEWGEFLHLPGKRFFDFSEIRREIQAETNRLAGENKGV  151

Query  626  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVT  805
            SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK PSCLILAVT
Sbjct  152  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKQPSCLILAVT  211

Query  806  PANAD  820
            PAN+D
Sbjct  212  PANSD  216



>ref|XP_010527014.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Tarenaya 
hassleriana]
Length=841

 Score =   306 bits (785),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 176/185 (95%), Gaps = 1/185 (1%)
 Frame = +2

Query  269  PLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDI  448
            PLG SVIPIVNKLQDIFAQLGS STIELPQVAVVGSQSSGKSSVLEALVGRDFLPRG+DI
Sbjct  32   PLGSSVIPIVNKLQDIFAQLGSHSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDI  91

Query  449  CTRRPLVLQLLQTKRKPDS-TDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGV  625
            CTRRPLVLQLLQTK + D  ++EEWGEFLHLPGK+FFDF++IR+EIQAET+R AG NKGV
Sbjct  92   CTRRPLVLQLLQTKGRSDGGSEEEWGEFLHLPGKRFFDFSEIRREIQAETNRLAGENKGV  151

Query  626  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVT  805
            SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK PSCLILAVT
Sbjct  152  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKQPSCLILAVT  211

Query  806  PANAD  820
            PAN+D
Sbjct  212  PANSD  216



>ref|XP_010645184.1| PREDICTED: dynamin-related protein 3B isoform X2 [Vitis vinifera]
Length=826

 Score =   305 bits (782),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 177/202 (88%), Gaps = 5/202 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MA E + S+ S     A PL HSVIPIVN+LQ +FA L  +S IELPQVA VG Q SGKS
Sbjct  1    MANETISSTPS-----AVPLSHSVIPIVNRLQSVFAWLSCRSMIELPQVAFVGCQGSGKS  55

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            S++EA+VGRDFL RG D+CTRRPLVLQLLQTK+KPD +DEE+GEFLHLPGKKFFDF +I 
Sbjct  56   SIIEAMVGRDFLLRGKDVCTRRPLVLQLLQTKQKPDGSDEEYGEFLHLPGKKFFDFLEIH  115

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQAETDREAG NKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT
Sbjct  116  REIQAETDREAGENKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  175

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIKLPSCLILAVTPAN+D
Sbjct  176  MIMSYIKLPSCLILAVTPANSD  197



>ref|XP_011658829.1| PREDICTED: dynamin-related protein 3A isoform X2 [Cucumis sativus]
 gb|KGN43774.1| hypothetical protein Csa_7G066310 [Cucumis sativus]
Length=796

 Score =   304 bits (779),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 177/183 (97%), Gaps = 5/183 (3%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+SVIPIVNKLQDIF+QLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC
Sbjct  21   LGNSVIPIVNKLQDIFSQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC  80

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQL+QTK     ++EE+GEFLH+ GKKF+DF++IR+EI+AETDREAGGNKGVSD
Sbjct  81   TRRPLVLQLVQTK-----SEEEYGEFLHITGKKFYDFSEIRREIRAETDREAGGNKGVSD  135

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK+PSCLILAVTPA
Sbjct  136  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKVPSCLILAVTPA  195

Query  812  NAD  820
            N+D
Sbjct  196  NSD  198



>ref|XP_008455130.1| PREDICTED: dynamin-related protein 3A-like isoform X3 [Cucumis 
melo]
Length=780

 Score =   304 bits (778),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 177/183 (97%), Gaps = 5/183 (3%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+SVIPIVNKLQDIF+QLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC
Sbjct  21   LGNSVIPIVNKLQDIFSQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC  80

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQL+QTK     ++EE+GEFLH+ GKKF+DF++IR+EI+AETDREAGGNKGVSD
Sbjct  81   TRRPLVLQLVQTK-----SEEEYGEFLHITGKKFYDFSEIRREIRAETDREAGGNKGVSD  135

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK+PSCLILAVTPA
Sbjct  136  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKVPSCLILAVTPA  195

Query  812  NAD  820
            N+D
Sbjct  196  NSD  198



>ref|XP_011658828.1| PREDICTED: dynamin-related protein 3A isoform X1 [Cucumis sativus]
Length=813

 Score =   304 bits (779),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 177/183 (97%), Gaps = 5/183 (3%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+SVIPIVNKLQDIF+QLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC
Sbjct  21   LGNSVIPIVNKLQDIFSQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC  80

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQL+QTK     ++EE+GEFLH+ GKKF+DF++IR+EI+AETDREAGGNKGVSD
Sbjct  81   TRRPLVLQLVQTK-----SEEEYGEFLHITGKKFYDFSEIRREIRAETDREAGGNKGVSD  135

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK+PSCLILAVTPA
Sbjct  136  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKVPSCLILAVTPA  195

Query  812  NAD  820
            N+D
Sbjct  196  NSD  198



>ref|XP_008455128.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Cucumis 
melo]
Length=812

 Score =   304 bits (778),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 177/183 (97%), Gaps = 5/183 (3%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+SVIPIVNKLQDIF+QLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC
Sbjct  21   LGNSVIPIVNKLQDIFSQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC  80

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQL+QTK     ++EE+GEFLH+ GKKF+DF++IR+EI+AETDREAGGNKGVSD
Sbjct  81   TRRPLVLQLVQTK-----SEEEYGEFLHITGKKFYDFSEIRREIRAETDREAGGNKGVSD  135

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK+PSCLILAVTPA
Sbjct  136  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKVPSCLILAVTPA  195

Query  812  NAD  820
            N+D
Sbjct  196  NSD  198



>ref|XP_008455129.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Cucumis 
melo]
Length=795

 Score =   303 bits (777),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 177/183 (97%), Gaps = 5/183 (3%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+SVIPIVNKLQDIF+QLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC
Sbjct  21   LGNSVIPIVNKLQDIFSQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC  80

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQL+QTK     ++EE+GEFLH+ GKKF+DF++IR+EI+AETDREAGGNKGVSD
Sbjct  81   TRRPLVLQLVQTK-----SEEEYGEFLHITGKKFYDFSEIRREIRAETDREAGGNKGVSD  135

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK+PSCLILAVTPA
Sbjct  136  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKVPSCLILAVTPA  195

Query  812  NAD  820
            N+D
Sbjct  196  NSD  198



>emb|CBI38239.3| unnamed protein product [Vitis vinifera]
Length=923

 Score =   305 bits (781),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 177/202 (88%), Gaps = 5/202 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MA E + S+ S     A PL HSVIPIVN+LQ +FA L  +S IELPQVA VG Q SGKS
Sbjct  94   MANETISSTPS-----AVPLSHSVIPIVNRLQSVFAWLSCRSMIELPQVAFVGCQGSGKS  148

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            S++EA+VGRDFL RG D+CTRRPLVLQLLQTK+KPD +DEE+GEFLHLPGKKFFDF +I 
Sbjct  149  SIIEAMVGRDFLLRGKDVCTRRPLVLQLLQTKQKPDGSDEEYGEFLHLPGKKFFDFLEIH  208

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQAETDREAG NKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT
Sbjct  209  REIQAETDREAGENKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  268

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIKLPSCLILAVTPAN+D
Sbjct  269  MIMSYIKLPSCLILAVTPANSD  290



>ref|XP_008454460.1| PREDICTED: dynamin-related protein 3A-like [Cucumis melo]
Length=822

 Score =   302 bits (773),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 175/183 (96%), Gaps = 5/183 (3%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGS IC
Sbjct  21   LGSSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGSGIC  80

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQLLQT     +TD+E+GEFLHLPGKKF+DF++IR+EIQ+ET+RE GGNKGVSD
Sbjct  81   TRRPLVLQLLQT-----NTDKEYGEFLHLPGKKFYDFSEIRREIQSETEREVGGNKGVSD  135

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK+PSCLILAVTPA
Sbjct  136  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKVPSCLILAVTPA  195

Query  812  NAD  820
            N+D
Sbjct  196  NSD  198



>ref|XP_009120625.1| PREDICTED: dynamin-related protein 3A isoform X2 [Brassica rapa]
Length=807

 Score =   301 bits (771),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 181/203 (89%), Gaps = 1/203 (0%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            M+ E   + TS++   AAPLG SVIPIVNKLQDIFAQLGSQS+IELPQVAVVGSQSSGKS
Sbjct  1    MSSEEATNETSSAASKAAPLGSSVIPIVNKLQDIFAQLGSQSSIELPQVAVVGSQSSGKS  60

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDS-TDEEWGEFLHLPGKKFFDFNDI  571
            SVLEALVGRDFLPRG+DICTRRPLVLQLLQTK K    +D+EWGEFLHLP  + +DF +I
Sbjct  61   SVLEALVGRDFLPRGNDICTRRPLVLQLLQTKSKASGGSDDEWGEFLHLPNNRIYDFAEI  120

Query  572  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  751
            R+EI+AET+R  G NKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQP+DIEARIR
Sbjct  121  RREIEAETNRLVGENKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPTDIEARIR  180

Query  752  TMIMSYIKLPSCLILAVTPANAD  820
            TMI+SYIK PSCLILAVTPAN+D
Sbjct  181  TMILSYIKQPSCLILAVTPANSD  203



>ref|XP_009120554.1| PREDICTED: dynamin-related protein 3A isoform X1 [Brassica rapa]
Length=808

 Score =   301 bits (771),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 181/203 (89%), Gaps = 1/203 (0%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            M+ E   + TS++   AAPLG SVIPIVNKLQDIFAQLGSQS+IELPQVAVVGSQSSGKS
Sbjct  1    MSSEEATNETSSAASKAAPLGSSVIPIVNKLQDIFAQLGSQSSIELPQVAVVGSQSSGKS  60

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDS-TDEEWGEFLHLPGKKFFDFNDI  571
            SVLEALVGRDFLPRG+DICTRRPLVLQLLQTK K    +D+EWGEFLHLP  + +DF +I
Sbjct  61   SVLEALVGRDFLPRGNDICTRRPLVLQLLQTKSKASGGSDDEWGEFLHLPNNRIYDFAEI  120

Query  572  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  751
            R+EI+AET+R  G NKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQP+DIEARIR
Sbjct  121  RREIEAETNRLVGENKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPTDIEARIR  180

Query  752  TMIMSYIKLPSCLILAVTPANAD  820
            TMI+SYIK PSCLILAVTPAN+D
Sbjct  181  TMILSYIKQPSCLILAVTPANSD  203



>ref|XP_010548840.1| PREDICTED: dynamin-related protein 3A-like, partial [Tarenaya 
hassleriana]
Length=840

 Score =   302 bits (773),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 174/185 (94%), Gaps = 1/185 (1%)
 Frame = +2

Query  269  PLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDI  448
            PLG SVIPIVNKLQDIFAQLGS STIELPQVAVVGSQSSGKSSVLEALVGRDFLPRG+DI
Sbjct  32   PLGSSVIPIVNKLQDIFAQLGSHSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDI  91

Query  449  CTRRPLVLQLLQTKRKPDS-TDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGV  625
            CTRRPLVLQLLQTK   D  ++EEWGEFLHLPGK+FFDF +IR+EIQAET+R AG NKGV
Sbjct  92   CTRRPLVLQLLQTKGHADGGSEEEWGEFLHLPGKRFFDFYEIRREIQAETNRLAGENKGV  151

Query  626  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVT  805
            SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQP+DIEARIRTMIMSYIK PSCLILA+T
Sbjct  152  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPTDIEARIRTMIMSYIKQPSCLILALT  211

Query  806  PANAD  820
            PAN+D
Sbjct  212  PANSD  216



>gb|KHN19022.1| Dynamin-related protein 3A [Glycine soja]
Length=828

 Score =   301 bits (771),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 177/184 (96%), Gaps = 1/184 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG SVI +VN+LQDIFA++GSQSTI+LPQVAVVGSQSSGKSSVLEALVGRDFLPRG+DIC
Sbjct  18   LGSSVISLVNRLQDIFARVGSQSTIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDIC  77

Query  452  TRRPLVLQLLQTKRKPD-STDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            TRRPLVLQL+QTKRKP+   ++E+GEFLHLPG+KF DF++IR+EIQAETDREAGGNKGVS
Sbjct  78   TRRPLVLQLVQTKRKPNLDNNDEYGEFLHLPGRKFHDFSEIRREIQAETDREAGGNKGVS  137

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK P+CLILAVTP
Sbjct  138  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKTPTCLILAVTP  197

Query  809  ANAD  820
            AN+D
Sbjct  198  ANSD  201



>ref|XP_003543135.1| PREDICTED: dynamin-related protein 3A-like [Glycine max]
Length=826

 Score =   301 bits (770),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 177/184 (96%), Gaps = 1/184 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG SVI +VN+LQDIFA++GSQSTI+LPQVAVVGSQSSGKSSVLEALVGRDFLPRG+DIC
Sbjct  18   LGSSVISLVNRLQDIFARVGSQSTIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDIC  77

Query  452  TRRPLVLQLLQTKRKPD-STDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            TRRPLVLQL+QTKRKP+   ++E+GEFLHLPG+KF DF++IR+EIQAETDREAGGNKGVS
Sbjct  78   TRRPLVLQLVQTKRKPNLDNNDEYGEFLHLPGRKFHDFSEIRREIQAETDREAGGNKGVS  137

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK P+CLILAVTP
Sbjct  138  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKTPTCLILAVTP  197

Query  809  ANAD  820
            AN+D
Sbjct  198  ANSD  201



>ref|XP_010691383.1| PREDICTED: dynamin-related protein 3A isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=825

 Score =   300 bits (769),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 170/183 (93%), Gaps = 4/183 (2%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LGHSVIPIVNKLQDI AQLGS    +LPQVAVVGSQSSGKSSVLEALVGRDFLPRG DIC
Sbjct  22   LGHSVIPIVNKLQDITAQLGSTPGFDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGCDIC  81

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQLLQTK    ++DEEWGEFLHLPGK+FFDFNDIR+EIQAETD+EAG NKGVSD
Sbjct  82   TRRPLVLQLLQTK----NSDEEWGEFLHLPGKRFFDFNDIRREIQAETDKEAGENKGVSD  137

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIE RIRTMIMSYIK+ SCLILAVTPA
Sbjct  138  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEGRIRTMIMSYIKISSCLILAVTPA  197

Query  812  NAD  820
            N+D
Sbjct  198  NSD  200



>ref|XP_010691382.1| PREDICTED: dynamin-related protein 3A isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=827

 Score =   300 bits (769),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 170/183 (93%), Gaps = 4/183 (2%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LGHSVIPIVNKLQDI AQLGS    +LPQVAVVGSQSSGKSSVLEALVGRDFLPRG DIC
Sbjct  22   LGHSVIPIVNKLQDITAQLGSTPGFDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGCDIC  81

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQLLQTK    ++DEEWGEFLHLPGK+FFDFNDIR+EIQAETD+EAG NKGVSD
Sbjct  82   TRRPLVLQLLQTK----NSDEEWGEFLHLPGKRFFDFNDIRREIQAETDKEAGENKGVSD  137

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIE RIRTMIMSYIK+ SCLILAVTPA
Sbjct  138  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEGRIRTMIMSYIKISSCLILAVTPA  197

Query  812  NAD  820
            N+D
Sbjct  198  NSD  200



>ref|XP_012081387.1| PREDICTED: dynamin-related protein 3A [Jatropha curcas]
 gb|KDP30000.1| hypothetical protein JCGZ_18767 [Jatropha curcas]
Length=829

 Score =   300 bits (768),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 179/203 (88%), Gaps = 3/203 (1%)
 Frame = +2

Query  215  MAEE-AVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgk  391
            MA+E A PS  S S   AAPLG  VIPIVNKLQDI A LG+QS I LPQVAVVGSQSSGK
Sbjct  1    MADEPASPSQASQSQ--AAPLGSPVIPIVNKLQDIIAHLGNQSFISLPQVAVVGSQSSGK  58

Query  392  ssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDI  571
            SSVLEALVGRDFLPRG+DICTRRPLVLQLLQ KRK D ++EEWGEFLHLPGK+F+DF++I
Sbjct  59   SSVLEALVGRDFLPRGNDICTRRPLVLQLLQIKRKGDGSEEEWGEFLHLPGKRFYDFSEI  118

Query  572  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  751
            R+EIQAET +EAG NKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIE RIR
Sbjct  119  RREIQAETSKEAGDNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIETRIR  178

Query  752  TMIMSYIKLPSCLILAVTPANAD  820
            TMI SYIK  SCLILAVT AN+D
Sbjct  179  TMIGSYIKQKSCLILAVTAANSD  201



>emb|CDX75370.1| BnaA01g03320D [Brassica napus]
Length=840

 Score =   300 bits (767),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 180/203 (89%), Gaps = 1/203 (0%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            M+ E   + TS +   AAPLG SVIPIVNKLQDIFAQLGSQS+IELPQVAVVGSQSSGKS
Sbjct  1    MSVEEATNETSPAASKAAPLGSSVIPIVNKLQDIFAQLGSQSSIELPQVAVVGSQSSGKS  60

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDS-TDEEWGEFLHLPGKKFFDFNDI  571
            SVLEALVGRDFLPRG+DICTRRPLVLQLLQTK K    +D+EWGEFLHLP  + +DF +I
Sbjct  61   SVLEALVGRDFLPRGNDICTRRPLVLQLLQTKSKASGGSDDEWGEFLHLPNNRIYDFAEI  120

Query  572  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  751
            R+EI+AET+R  G NKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQP+DIEARIR
Sbjct  121  RREIEAETNRLVGANKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPTDIEARIR  180

Query  752  TMIMSYIKLPSCLILAVTPANAD  820
            TMI+SYIK PSCLILAVTPAN+D
Sbjct  181  TMILSYIKQPSCLILAVTPANSD  203



>ref|XP_006852885.1| PREDICTED: dynamin-related protein 3A [Amborella trichopoda]
 gb|ERN14352.1| hypothetical protein AMTR_s00033p00216190 [Amborella trichopoda]
Length=829

 Score =   298 bits (764),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 180/203 (89%), Gaps = 3/203 (1%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAE   P +  + + +   LGHSVIP+VNKLQDIFAQLGS STI+LPQVAVVGSQSSGKS
Sbjct  1    MAEP--PENAVSDDASGYSLGHSVIPMVNKLQDIFAQLGSSSTIDLPQVAVVGSQSSGKS  58

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTD-EEWGEFLHLPGKKFFDFNDI  571
            SVLE+LVGRDFLPRGSDICTRRPLVLQL+ T RK +  +  EWGEFLHLPGK+FFDF  I
Sbjct  59   SVLESLVGRDFLPRGSDICTRRPLVLQLVNTPRKGEGAEGSEWGEFLHLPGKRFFDFAAI  118

Query  572  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  751
            R+EIQAETDREAGGNKGVSDKQIRLK+FSPNVL+ITLVDLPGITKVPVGDQPSDIEARIR
Sbjct  119  RREIQAETDREAGGNKGVSDKQIRLKVFSPNVLNITLVDLPGITKVPVGDQPSDIEARIR  178

Query  752  TMIMSYIKLPSCLILAVTPANAD  820
            TMI+SYIK  +C+ILAV+PANAD
Sbjct  179  TMILSYIKHETCIILAVSPANAD  201



>ref|XP_003522885.1| PREDICTED: dynamin-related protein 3A-like [Glycine max]
Length=817

 Score =   297 bits (760),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 183/202 (91%), Gaps = 3/202 (1%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAE+   SS   +  + APLG SVI +VN+LQDIFA++GSQSTI+LPQVAVVGSQSSGKS
Sbjct  1    MAEDIPSSSPPIAASDTAPLGSSVISLVNRLQDIFARVGSQSTIDLPQVAVVGSQSSGKS  60

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLEALVGRDFLPRG++ICTRRPLVLQL+QTK  P+  D+E+GEFLH PG+KF DF++IR
Sbjct  61   SVLEALVGRDFLPRGNEICTRRPLVLQLVQTK-APE--DDEYGEFLHFPGRKFHDFSEIR  117

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQ ETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT
Sbjct  118  REIQIETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  177

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIK P+CLILAVTPAN+D
Sbjct  178  MIMSYIKTPTCLILAVTPANSD  199



>ref|XP_008802260.1| PREDICTED: dynamin-related protein 3A-like [Phoenix dactylifera]
Length=828

 Score =   296 bits (758),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 184/205 (90%), Gaps = 3/205 (1%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNA-APLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgk  391
            MAE+AV  S S +   A   +G SVIPIVNKLQDIFAQLGS STI+LPQV+V+GSQSSGK
Sbjct  1    MAEDAVTPSPSPAAAAAAGTIGSSVIPIVNKLQDIFAQLGSSSTIDLPQVSVIGSQSSGK  60

Query  392  ssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTD--EEWGEFLHLPGKKFFDFN  565
            SSVLEALVGRDFLPRGSDICTRRPLVLQL+   R+P++ +  EEWGEFLHLPGK+F DF+
Sbjct  61   SSVLEALVGRDFLPRGSDICTRRPLVLQLVHCPRRPEAAEGAEEWGEFLHLPGKRFCDFS  120

Query  566  DIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEAR  745
            +IR+EI+AETDREAGGNKGVSDKQIRLKIFSPNVL+ITLVDLPGITKVPVGDQPSDIEAR
Sbjct  121  EIRREIKAETDREAGGNKGVSDKQIRLKIFSPNVLNITLVDLPGITKVPVGDQPSDIEAR  180

Query  746  IRTMIMSYIKLPSCLILAVTPANAD  820
            IRTMI+SYIK  +C+ILAV+PANAD
Sbjct  181  IRTMILSYIKHRTCIILAVSPANAD  205



>emb|CDY28314.1| BnaC03g66450D [Brassica napus]
Length=806

 Score =   295 bits (756),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 184/200 (92%), Gaps = 4/200 (2%)
 Frame = +2

Query  233  PSSTS--TSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLE  406
            PSST+  T++ NAAPLG SVIPIVNKLQDIFAQLGSQS+IELPQVAVVGSQSSGKSSVLE
Sbjct  15   PSSTAAGTASSNAAPLGSSVIPIVNKLQDIFAQLGSQSSIELPQVAVVGSQSSGKSSVLE  74

Query  407  ALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDS-TDEEWGEFLHLPG-KKFFDFNDIRKE  580
            ALVGRDFLPRG+DICTRRPLVLQLLQTK K +  +D+EWGEFLHLP   + +DF++IR+E
Sbjct  75   ALVGRDFLPRGNDICTRRPLVLQLLQTKSKSNGGSDDEWGEFLHLPNNHRIYDFSEIRRE  134

Query  581  IQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMI  760
            I+AET+R AG NKGVS KQIRLKI+SPNVLDITLVDLPGITKVPVGDQP+DIEA+IRTMI
Sbjct  135  IEAETNRLAGDNKGVSAKQIRLKIYSPNVLDITLVDLPGITKVPVGDQPTDIEAQIRTMI  194

Query  761  MSYIKLPSCLILAVTPANAD  820
            +SYIK PSCLILAVTPAN+D
Sbjct  195  LSYIKQPSCLILAVTPANSD  214



>gb|KHN34016.1| Dynamin-related protein 3A [Glycine soja]
Length=819

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 182/202 (90%), Gaps = 3/202 (1%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MAE+   SS   +  + APLG SVI +VN+LQDIFA++GSQSTI+LPQVAVVGSQSSGKS
Sbjct  1    MAEDIPSSSPPIAASDTAPLGSSVISLVNRLQDIFARVGSQSTIDLPQVAVVGSQSSGKS  60

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLEALVGRDFLPRG++ICTRRPLVLQL+QTK  P+   +E+GEFLH PG+KF DF++IR
Sbjct  61   SVLEALVGRDFLPRGNEICTRRPLVLQLVQTK-APEH--DEYGEFLHFPGRKFHDFSEIR  117

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQ ETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT
Sbjct  118  REIQIETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  177

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIK P+CLILAVTPAN+D
Sbjct  178  MIMSYIKTPTCLILAVTPANSD  199



>ref|XP_010926713.1| PREDICTED: dynamin-related protein 3A-like [Elaeis guineensis]
Length=828

 Score =   294 bits (753),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 174/185 (94%), Gaps = 2/185 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            +G SVIPIVNKLQDIFAQLGS STI+LPQV+VVGSQSSGKSSVLEALVGRDFLPRGSDIC
Sbjct  21   IGSSVIPIVNKLQDIFAQLGSSSTIDLPQVSVVGSQSSGKSSVLEALVGRDFLPRGSDIC  80

Query  452  TRRPLVLQLLQTKRKPDSTD--EEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGV  625
            TRRPLVLQL+   R+P+  +  +EWGEFLHLPGK+F+DF++IR+EIQAETD+EAGGNKGV
Sbjct  81   TRRPLVLQLVHCPRRPEVAEGADEWGEFLHLPGKRFYDFSEIRREIQAETDKEAGGNKGV  140

Query  626  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVT  805
            SDKQIRLKIFSPNVL+ITLVDLPGITKVPVGDQPSDIEARIRTMI+SYIK  +C+ILAV+
Sbjct  141  SDKQIRLKIFSPNVLNITLVDLPGITKVPVGDQPSDIEARIRTMILSYIKHRTCIILAVS  200

Query  806  PANAD  820
            PANAD
Sbjct  201  PANAD  205



>ref|XP_006412330.1| hypothetical protein EUTSA_v10024438mg [Eutrema salsugineum]
 gb|ESQ53783.1| hypothetical protein EUTSA_v10024438mg [Eutrema salsugineum]
Length=813

 Score =   294 bits (752),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 175/188 (93%), Gaps = 2/188 (1%)
 Frame = +2

Query  263  AAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGS  442
            AAPLG SVIPIVNKLQDIFAQLGSQS+IELPQVAVVGSQSSGKSSVLEALVGRDFLPRG+
Sbjct  25   AAPLGSSVIPIVNKLQDIFAQLGSQSSIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGN  84

Query  443  DICTRRPLVLQLLQTK-RKPDSTDEEWGEFLHLP-GKKFFDFNDIRKEIQAETDREAGGN  616
            DICTRRPLVLQLLQTK R    +D+EWGEFLHLP   + +DF++IR+EI+AET+R AG N
Sbjct  85   DICTRRPLVLQLLQTKSRSNGGSDDEWGEFLHLPKNHRIYDFSEIRREIEAETNRLAGEN  144

Query  617  KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLIL  796
            KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQP+DIEARIRTMI+SYIK PSCLIL
Sbjct  145  KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPTDIEARIRTMILSYIKQPSCLIL  204

Query  797  AVTPANAD  820
            AVTPAN+D
Sbjct  205  AVTPANSD  212



>ref|XP_009411851.1| PREDICTED: dynamin-related protein 3A-like [Musa acuminata subsp. 
malaccensis]
Length=821

 Score =   294 bits (752),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 174/187 (93%), Gaps = 2/187 (1%)
 Frame = +2

Query  266  APLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSD  445
             P+GH+VIPIVNKLQDIFAQLGS STI+LPQVAVVGSQSSGKSSVLEALVGRDFLPRG D
Sbjct  12   GPIGHTVIPIVNKLQDIFAQLGSSSTIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGLD  71

Query  446  ICTRRPLVLQLLQTKRKPDSTD--EEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNK  619
            ICTRRPLVLQL+   R+ D+ +  EEWGEFLHL G+KFFDF++IR+EIQAET+REAGGNK
Sbjct  72   ICTRRPLVLQLVHRPRRTDAAEGGEEWGEFLHLNGQKFFDFSEIRREIQAETEREAGGNK  131

Query  620  GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILA  799
            GVSDKQIRLKIFSPNVL+ITLVDLPGITKVPVGDQPSDIEARIRTMI+SYIK  +C+ILA
Sbjct  132  GVSDKQIRLKIFSPNVLNITLVDLPGITKVPVGDQPSDIEARIRTMILSYIKHKTCIILA  191

Query  800  VTPANAD  820
            V+PANAD
Sbjct  192  VSPANAD  198



>ref|XP_008794571.1| PREDICTED: dynamin-related protein 3A-like [Phoenix dactylifera]
Length=832

 Score =   294 bits (752),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 174/185 (94%), Gaps = 2/185 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            +G SVIPIVNKLQDIFAQLGS STI+LPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC
Sbjct  25   IGSSVIPIVNKLQDIFAQLGSSSTIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC  84

Query  452  TRRPLVLQLLQTKRKPDSTD--EEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGV  625
            TRRPLVLQL+   R+ D+ +  +EWGEFLHLPGK+F+DF++IR+E+QAETDREAGGNKGV
Sbjct  85   TRRPLVLQLVHFPRRQDAGEGMDEWGEFLHLPGKRFYDFSEIRREVQAETDREAGGNKGV  144

Query  626  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVT  805
            SDKQIRLKIFSPNVL+ITLVDLPGITKVPVGDQPSDIEARIRTMI+SYIK  +C+ILAV+
Sbjct  145  SDKQIRLKIFSPNVLNITLVDLPGITKVPVGDQPSDIEARIRTMILSYIKHKTCIILAVS  204

Query  806  PANAD  820
            PANAD
Sbjct  205  PANAD  209



>gb|KFK29987.1| hypothetical protein AALP_AA7G203100 [Arabis alpina]
Length=813

 Score =   293 bits (751),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 176/189 (93%), Gaps = 2/189 (1%)
 Frame = +2

Query  260  NAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            NAAPLG SVIPIVNKLQDIFAQLGSQS+IELPQVAVVGSQSSGKSSVLEALVGRDFLPRG
Sbjct  26   NAAPLGASVIPIVNKLQDIFAQLGSQSSIELPQVAVVGSQSSGKSSVLEALVGRDFLPRG  85

Query  440  SDICTRRPLVLQLLQTKRKPDS-TDEEWGEFLHLP-GKKFFDFNDIRKEIQAETDREAGG  613
            +DICTRRPLVLQLLQTK K +  +D+EWGEFLHLP   + +DF++IR+EI+AET+R AG 
Sbjct  86   NDICTRRPLVLQLLQTKSKSNGGSDDEWGEFLHLPKDHRIYDFSEIRREIEAETNRLAGD  145

Query  614  NKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLI  793
            NKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQP+DIEARIRTMI+SYIK  SCLI
Sbjct  146  NKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPTDIEARIRTMILSYIKQASCLI  205

Query  794  LAVTPANAD  820
            LAVTPAN+D
Sbjct  206  LAVTPANSD  214



>gb|EEE55903.1| hypothetical protein OsJ_04571 [Oryza sativa Japonica Group]
Length=818

 Score =   293 bits (750),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 181/197 (92%), Gaps = 1/197 (1%)
 Frame = +2

Query  233  PSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEAL  412
            P ST+T+   AA +G SVIPIVNKLQDIF+QLGS STI+LPQVAVVGSQSSGKSSVLEAL
Sbjct  11   PPSTATAAAAAAAVGSSVIPIVNKLQDIFSQLGSSSTIDLPQVAVVGSQSSGKSSVLEAL  70

Query  413  VGRDFLPRGSDICTRRPLVLQLLQTKRKP-DSTDEEWGEFLHLPGKKFFDFNDIRKEIQA  589
            VGRDFLPRGSDICTRRPLVLQL+   R+P D+  +EWGEFLHLPG++F+DF +IR+EIQA
Sbjct  71   VGRDFLPRGSDICTRRPLVLQLVHQPRRPADAEADEWGEFLHLPGRRFYDFREIRREIQA  130

Query  590  ETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSY  769
            ETDREAGGNKGVSDKQIRLKI+SPNVL+ITLVDLPGITKVPVGDQP+DIEARIRTMI+SY
Sbjct  131  ETDREAGGNKGVSDKQIRLKIYSPNVLNITLVDLPGITKVPVGDQPTDIEARIRTMILSY  190

Query  770  IKLPSCLILAVTPANAD  820
            IK  +C+ILAV+PANAD
Sbjct  191  IKHKTCIILAVSPANAD  207



>ref|XP_010467215.1| PREDICTED: dynamin-related protein 3B-like [Camelina sativa]
Length=459

 Score =   284 bits (726),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 180/204 (88%), Gaps = 4/204 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            M+ + +P S S S +   PLG SVIPIVNKLQDIFAQLGS+STI+LPQVAVVGSQSSGKS
Sbjct  1    MSVDDLPPSPSASAVT--PLGSSVIPIVNKLQDIFAQLGSKSTIQLPQVAVVGSQSSGKS  58

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTK-RKPDSTDEEWGEFLHL-PGKKFFDFND  568
            SVLEALVGRDFLPRG+DICTRRPLVLQLLQTK R    +DEEWGEFLH  P K+ +DF++
Sbjct  59   SVLEALVGRDFLPRGNDICTRRPLVLQLLQTKPRSEGGSDEEWGEFLHHNPAKRIYDFSE  118

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EI+AET+R +GGNKGVSD  IRLKI SPNVLDI+LVDLPGITKVPVGDQPSDIEARI
Sbjct  119  IRREIEAETNRISGGNKGVSDNPIRLKISSPNVLDISLVDLPGITKVPVGDQPSDIEARI  178

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            RTMI+SYIK PSCLILAVTPAN+D
Sbjct  179  RTMILSYIKNPSCLILAVTPANSD  202



>ref|NP_001045220.1| Os01g0920400 [Oryza sativa Japonica Group]
 dbj|BAD88362.1| putative dynamin like protein 2a [Oryza sativa Japonica Group]
 dbj|BAD87638.1| putative dynamin like protein 2a [Oryza sativa Japonica Group]
 dbj|BAF07134.1| Os01g0920400 [Oryza sativa Japonica Group]
Length=818

 Score =   293 bits (749),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 173/184 (94%), Gaps = 1/184 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            +G SVIPIVNKLQDIF+QLGS STI+LPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC
Sbjct  24   VGSSVIPIVNKLQDIFSQLGSSSTIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC  83

Query  452  TRRPLVLQLLQTKRKP-DSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            TRRPLVLQL+   R+P D+  +EWGEFLHLPG++F+DF +IR+EIQAETDREAGGNKGVS
Sbjct  84   TRRPLVLQLVHQPRRPADAEADEWGEFLHLPGRRFYDFREIRREIQAETDREAGGNKGVS  143

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            DKQIRLKI+SPNVL+ITLVDLPGITKVPVGDQP+DIEARIRTMI+SYIK  +C+ILAV+P
Sbjct  144  DKQIRLKIYSPNVLNITLVDLPGITKVPVGDQPTDIEARIRTMILSYIKHKTCIILAVSP  203

Query  809  ANAD  820
            ANAD
Sbjct  204  ANAD  207



>ref|XP_006645242.1| PREDICTED: dynamin-related protein 3A-like [Oryza brachyantha]
Length=819

 Score =   292 bits (748),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 173/184 (94%), Gaps = 1/184 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            +G SVIPIVNKLQDIF+QLGS STI+LPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC
Sbjct  28   VGSSVIPIVNKLQDIFSQLGSSSTIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC  87

Query  452  TRRPLVLQLLQTKRKP-DSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            TRRPLVLQL+   R+P ++  +EWGEFLHLPG++F+DF DIR+EIQAETDREAGGNKGVS
Sbjct  88   TRRPLVLQLVHQPRRPAEAEADEWGEFLHLPGRRFYDFRDIRREIQAETDREAGGNKGVS  147

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            DKQIRLKI+SPNVL+ITLVDLPGITKVPVGDQP+DIEARIRTMI+SYIK  +C+ILAV+P
Sbjct  148  DKQIRLKIYSPNVLNITLVDLPGITKVPVGDQPTDIEARIRTMILSYIKHKTCIILAVSP  207

Query  809  ANAD  820
            ANAD
Sbjct  208  ANAD  211



>gb|AAK59412.1| putative dynamin protein ADL2 [Arabidopsis thaliana]
 gb|AAL34260.1| putative dynamin protein ADL2 [Arabidopsis thaliana]
Length=480

 Score =   284 bits (726),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 169/188 (90%), Gaps = 1/188 (1%)
 Frame = +2

Query  260  NAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            NAAPLG SVIPIVNKLQDIFAQLGSQSTI LPQV VVGSQSSGKSSVLEALVGRDFLPRG
Sbjct  29   NAAPLGSSVIPIVNKLQDIFAQLGSQSTIALPQVVVVGSQSSGKSSVLEALVGRDFLPRG  88

Query  440  SDICTRRPLVLQLLQTK-RKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGN  616
            +DICTRRPLVLQLLQTK R    +D+EWGEF HLP  +F+DF++IR+EI+AET+R  G N
Sbjct  89   NDICTRRPLVLQLLQTKSRANGGSDDEWGEFRHLPETRFYDFSEIRREIEAETNRLVGEN  148

Query  617  KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLIL  796
            KGV+D QIRLKI SPNVL+ITLVDLPGITKVPVGDQPSDIEARIRTMI+SYIK  +CLIL
Sbjct  149  KGVADTQIRLKISSPNVLNITLVDLPGITKVPVGDQPSDIEARIRTMILSYIKQDTCLIL  208

Query  797  AVTPANAD  820
            AVTPAN D
Sbjct  209  AVTPANTD  216



>gb|EEC72053.1| hypothetical protein OsI_04962 [Oryza sativa Indica Group]
Length=857

 Score =   293 bits (750),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 173/184 (94%), Gaps = 1/184 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            +G SVIPIVNKLQDIF+QLGS STI+LPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC
Sbjct  26   VGSSVIPIVNKLQDIFSQLGSSSTIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC  85

Query  452  TRRPLVLQLLQTKRKP-DSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            TRRPLVLQL+   R+P D+  +EWGEFLHLPG++F+DF +IR+EIQAETDREAGGNKGVS
Sbjct  86   TRRPLVLQLVHQPRRPADAEADEWGEFLHLPGRRFYDFREIRREIQAETDREAGGNKGVS  145

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            DKQIRLKI+SPNVL+ITLVDLPGITKVPVGDQP+DIEARIRTMI+SYIK  +C+ILAV+P
Sbjct  146  DKQIRLKIYSPNVLNITLVDLPGITKVPVGDQPTDIEARIRTMILSYIKHKTCIILAVSP  205

Query  809  ANAD  820
            ANAD
Sbjct  206  ANAD  209



>ref|XP_008654834.1| PREDICTED: uncharacterized protein LOC100279900 isoform X1 [Zea 
mays]
 gb|AFW84147.1| hypothetical protein ZEAMMB73_720282 [Zea mays]
Length=821

 Score =   292 bits (747),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 172/184 (93%), Gaps = 1/184 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            +G SVIPIVNKLQDIFAQLGS STI+LPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC
Sbjct  27   VGSSVIPIVNKLQDIFAQLGSSSTIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC  86

Query  452  TRRPLVLQLLQTKRKP-DSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            TRRPLVLQL+   R+P D+  +EWGEFLHL G++F+DF +IR+EIQAETDREAGGNKGVS
Sbjct  87   TRRPLVLQLVHQPRRPADAEADEWGEFLHLSGRRFYDFREIRREIQAETDREAGGNKGVS  146

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            D+QIRLKIFSPNVL+ITLVDLPGITKVPVGDQP+DIEARIRTMIMSYIK  +C+ILAV+P
Sbjct  147  DRQIRLKIFSPNVLNITLVDLPGITKVPVGDQPTDIEARIRTMIMSYIKHKTCIILAVSP  206

Query  809  ANAD  820
            ANAD
Sbjct  207  ANAD  210



>emb|CDY46101.1| BnaA03g52670D [Brassica napus]
Length=803

 Score =   291 bits (746),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 178/200 (89%), Gaps = 2/200 (1%)
 Frame = +2

Query  227  AVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLE  406
            AV   T  S   A+PLG SVIPIVNKLQDIFAQLG+ S+IELPQVAVVGSQSSGKSSVLE
Sbjct  2    AVEQVTDDSPPKASPLGSSVIPIVNKLQDIFAQLGTHSSIELPQVAVVGSQSSGKSSVLE  61

Query  407  ALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDS-TDEEWGEFLHLP-GKKFFDFNDIRKE  580
            ALVGRDFLPRG+DICTRRPLVLQL+QTK K    +D+EWGEFLHLP   + +DF++IR+E
Sbjct  62   ALVGRDFLPRGNDICTRRPLVLQLVQTKSKSSGGSDDEWGEFLHLPSNHRIYDFSEIRRE  121

Query  581  IQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMI  760
            I+AET+R AGGNKGV DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQP+DIEARIRTMI
Sbjct  122  IEAETNRLAGGNKGVKDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPTDIEARIRTMI  181

Query  761  MSYIKLPSCLILAVTPANAD  820
            +SYIK PSCLILAVTPAN+D
Sbjct  182  LSYIKQPSCLILAVTPANSD  201



>ref|XP_004971078.1| PREDICTED: dynamin-related protein 3A-like [Setaria italica]
Length=823

 Score =   291 bits (746),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 172/184 (93%), Gaps = 1/184 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            +G SVIPIVNKLQDIFAQLGS STI+LPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC
Sbjct  28   VGSSVIPIVNKLQDIFAQLGSSSTIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC  87

Query  452  TRRPLVLQLLQTKRKP-DSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            TRRPLVLQL+   R+P D+  +EWGEFLHL G++F+DF +IR+EIQAETDREAGGNKGVS
Sbjct  88   TRRPLVLQLVHQPRRPTDAEADEWGEFLHLSGRRFYDFREIRREIQAETDREAGGNKGVS  147

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            D+QIRLKIFSPNVL+ITLVDLPGITKVPVGDQP+DIEARIRTMIMSYI+  +C+ILAV+P
Sbjct  148  DRQIRLKIFSPNVLNITLVDLPGITKVPVGDQPTDIEARIRTMIMSYIRHKTCIILAVSP  207

Query  809  ANAD  820
            ANAD
Sbjct  208  ANAD  211



>ref|XP_008673232.1| PREDICTED: uncharacterized protein LOC100383931 isoform X1 [Zea 
mays]
 tpg|DAA56114.1| TPA: hypothetical protein ZEAMMB73_205529 [Zea mays]
Length=817

 Score =   291 bits (745),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 172/184 (93%), Gaps = 1/184 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            +G SVIPIVNKLQDIFAQLGS STI+LPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC
Sbjct  24   VGSSVIPIVNKLQDIFAQLGSSSTIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC  83

Query  452  TRRPLVLQLLQTKRKP-DSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            TRRPLVLQL+   R+P D+  +EWGEFLHL G++F+DF +IR+EIQAETDREAGGNKGVS
Sbjct  84   TRRPLVLQLVHQPRRPADAEADEWGEFLHLSGRRFYDFREIRREIQAETDREAGGNKGVS  143

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            D+QIRLKIFSPNVL+ITLVDLPGITKVPVGDQP+DIEARIRTMIMSYI+  +C+ILAV+P
Sbjct  144  DRQIRLKIFSPNVLNITLVDLPGITKVPVGDQPTDIEARIRTMIMSYIRHKTCIILAVSP  203

Query  809  ANAD  820
            ANAD
Sbjct  204  ANAD  207



>gb|AID60088.1| dynamin-like protein 2 [Brassica napus]
Length=809

 Score =   291 bits (745),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 179/205 (87%), Gaps = 3/205 (1%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            M+ E   + TS +   AAPLG SVIPIVNKLQDIFAQLGSQS+IELPQVAVVGSQSSGKS
Sbjct  1    MSVEEATNETSPAASKAAPLGSSVIPIVNKLQDIFAQLGSQSSIELPQVAVVGSQSSGKS  60

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDS-TDEEWGEFLHLPGKKFFDFNDI  571
            SVLEALVGRDFLPRG+DICTRRPLVLQLLQTK K    +D+EWGEFLHLP  + +DF +I
Sbjct  61   SVLEALVGRDFLPRGNDICTRRPLVLQLLQTKSKASGGSDDEWGEFLHLPNNRIYDFAEI  120

Query  572  RKEIQAETDREAGG--NKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEAR  745
            R+EI+AET+R  G   + GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQP+DIEAR
Sbjct  121  RREIEAETNRLVGAVADTGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPTDIEAR  180

Query  746  IRTMIMSYIKLPSCLILAVTPANAD  820
            IRTMI+SYIK PSCLILAVTPAN+D
Sbjct  181  IRTMILSYIKQPSCLILAVTPANSD  205



>ref|XP_002458996.1| hypothetical protein SORBIDRAFT_03g044010 [Sorghum bicolor]
 gb|EES04116.1| hypothetical protein SORBIDRAFT_03g044010 [Sorghum bicolor]
Length=819

 Score =   291 bits (745),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 172/184 (93%), Gaps = 1/184 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            +G SVIPIVNKLQDIFAQLGS STI+LPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC
Sbjct  27   VGSSVIPIVNKLQDIFAQLGSSSTIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC  86

Query  452  TRRPLVLQLLQTKRKP-DSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            TRRPLVLQL+   R+P D+  +EWGEFLHL G++F+DF +IR+EIQAETDREAGGNKGVS
Sbjct  87   TRRPLVLQLVHQPRRPADAEADEWGEFLHLSGRRFYDFREIRREIQAETDREAGGNKGVS  146

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            D+QIRLKIFSPNVL+ITLVDLPGITKVPVGDQP+DIEARIRTMIMSYI+  +C+ILAV+P
Sbjct  147  DRQIRLKIFSPNVLNITLVDLPGITKVPVGDQPTDIEARIRTMIMSYIRHKTCIILAVSP  206

Query  809  ANAD  820
            ANAD
Sbjct  207  ANAD  210



>ref|XP_009138202.1| PREDICTED: dynamin-related protein 3A-like [Brassica rapa]
Length=807

 Score =   291 bits (744),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 179/202 (89%), Gaps = 2/202 (1%)
 Frame = +2

Query  221  EEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssv  400
            E+    S  +S   A+PLG SVIPIVNKLQDIFAQLG+ S+IELPQVAVVGSQSSGKSSV
Sbjct  4    EQVTDDSPPSSTPKASPLGSSVIPIVNKLQDIFAQLGTHSSIELPQVAVVGSQSSGKSSV  63

Query  401  LEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDS-TDEEWGEFLHLP-GKKFFDFNDIR  574
            LEALVGRDFLPRG+DICTRRPLVLQL+QTK K    +D+EWGEFLHLP   + +DF++IR
Sbjct  64   LEALVGRDFLPRGNDICTRRPLVLQLVQTKSKSSGGSDDEWGEFLHLPSNHRIYDFSEIR  123

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EI+AET+R AGGNKGV DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQP+DIEARIRT
Sbjct  124  REIEAETNRLAGGNKGVKDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPTDIEARIRT  183

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MI+SYIK PSCLILAVTPAN+D
Sbjct  184  MILSYIKQPSCLILAVTPANSD  205



>ref|XP_006583773.1| PREDICTED: dynamin-related protein 3A-like [Glycine max]
Length=812

 Score =   291 bits (744),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 173/187 (93%), Gaps = 3/187 (2%)
 Frame = +2

Query  260  NAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
             AAPLG SVI +VN+LQDIF+++GS S I+LPQVAVVGSQSSGKSSVLEALVGRDFLPRG
Sbjct  6    GAAPLGSSVISLVNRLQDIFSRVGSHSAIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRG  65

Query  440  SDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNK  619
            +DICTRRPLVLQL+QTK  P S  EE+GEFLHLPG+KF DF+ IR EIQAETDREAGGNK
Sbjct  66   NDICTRRPLVLQLVQTK--PPS-QEEFGEFLHLPGRKFHDFSQIRAEIQAETDREAGGNK  122

Query  620  GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILA  799
            GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEA+IRTMIMSYIK P+CLILA
Sbjct  123  GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEAQIRTMIMSYIKTPTCLILA  182

Query  800  VTPANAD  820
            VTPAN+D
Sbjct  183  VTPANSD  189



>gb|ABN05857.1| Dynamin central region; Dynamin [Medicago truncatula]
Length=400

 Score =   279 bits (713),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 174/202 (86%), Gaps = 4/202 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            M ++ V S     +    PLG  VI +VN+LQDIF+++GSQS I LPQVAVVGSQSSGKS
Sbjct  1    MVDDTVTSPPPPPSSAPVPLGSGVISLVNRLQDIFSRVGSQSAINLPQVAVVGSQSSGKS  60

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLEALVGRDFLPRG++ICTRRPLVLQL+++    D    E+GEFLHLPGK+F+DF+DIR
Sbjct  61   SVLEALVGRDFLPRGNEICTRRPLVLQLVRSSEPAD----EYGEFLHLPGKRFYDFSDIR  116

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQAETDREAG NKGVSD+QIRLKI SPNVLD+TLVDLPGITKVPVGDQPSDIEARIRT
Sbjct  117  REIQAETDREAGDNKGVSDRQIRLKIVSPNVLDMTLVDLPGITKVPVGDQPSDIEARIRT  176

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIK PSCLILAVTPAN+D
Sbjct  177  MIMSYIKEPSCLILAVTPANSD  198



>emb|CDX68994.1| BnaC01g04590D [Brassica napus]
Length=813

 Score =   289 bits (740),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 1/184 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG SVIPIVNKLQDIFAQLGSQS+IELPQVAVVGSQSSGKSSVLEALVGRDFLPRG+DIC
Sbjct  28   LGSSVIPIVNKLQDIFAQLGSQSSIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDIC  87

Query  452  TRRPLVLQLLQTKRKPDS-TDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            TRRPLVLQLLQTK K    +D+EWGEFLHLP  + +DF++IR+EI+AET+R  G NKGVS
Sbjct  88   TRRPLVLQLLQTKSKASGGSDDEWGEFLHLPNNRIYDFSEIRREIEAETNRLVGENKGVS  147

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQP+DIEARIRTMI+SYIK PSCLILAVTP
Sbjct  148  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPTDIEARIRTMILSYIKQPSCLILAVTP  207

Query  809  ANAD  820
            AN+D
Sbjct  208  ANSD  211



>ref|XP_003532597.1| PREDICTED: dynamin-related protein 3A-like [Glycine max]
Length=814

 Score =   289 bits (740),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 172/187 (92%), Gaps = 3/187 (2%)
 Frame = +2

Query  260  NAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
             AAPLG SVI +VN+LQDIF+++GS S I+LPQVAVVGSQSSGKSSVLEALVGRDFLPRG
Sbjct  6    GAAPLGSSVISLVNRLQDIFSRVGSHSAIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRG  65

Query  440  SDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNK  619
            +DICTRRPLVLQL+QTK  P S DE +GEFLHLPG+KF DF+ IR EIQ ETDREAGGNK
Sbjct  66   NDICTRRPLVLQLVQTK--PPSQDE-FGEFLHLPGRKFHDFSQIRAEIQVETDREAGGNK  122

Query  620  GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILA  799
            GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK P+C+ILA
Sbjct  123  GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKTPTCVILA  182

Query  800  VTPANAD  820
            VTPAN+D
Sbjct  183  VTPANSD  189



>emb|CDM85737.1| unnamed protein product [Triticum aestivum]
Length=813

 Score =   288 bits (737),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 172/184 (93%), Gaps = 1/184 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            +G SVIPIVNKLQDIF+QLGS STI+LPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC
Sbjct  27   VGSSVIPIVNKLQDIFSQLGSSSTIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC  86

Query  452  TRRPLVLQLLQTKRKP-DSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            TRRPLVLQL+   R+P D+  +EWGEFLH PG++F++F DIR+EIQAETDREAGGNKGVS
Sbjct  87   TRRPLVLQLVHQPRRPADAERDEWGEFLHHPGRRFYEFPDIRREIQAETDREAGGNKGVS  146

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            D+QIRLKI+SPNVL+ITLVDLPGITKVPVGDQP+DIEARIRTMI+SYIK  +C+ILAV+P
Sbjct  147  DRQIRLKIYSPNVLNITLVDLPGITKVPVGDQPTDIEARIRTMILSYIKHKTCIILAVSP  206

Query  809  ANAD  820
            ANAD
Sbjct  207  ANAD  210



>dbj|BAJ99253.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=814

 Score =   288 bits (737),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 172/184 (93%), Gaps = 1/184 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            +G SVIPIVNKLQDIF+QLGS STI+LPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC
Sbjct  28   VGSSVIPIVNKLQDIFSQLGSSSTIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC  87

Query  452  TRRPLVLQLLQTKRKP-DSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            TRRPLVLQL+   R+P D+  +EWGEFLH PG++F++F DIR+EIQAETDREAGGNKGVS
Sbjct  88   TRRPLVLQLVHQPRRPADADKDEWGEFLHHPGRRFYEFPDIRREIQAETDREAGGNKGVS  147

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            D+QIRLKI+SPNVL+ITLVDLPGITKVPVGDQP+DIEARIRTMI+SYIK  +C+ILAV+P
Sbjct  148  DRQIRLKIYSPNVLNITLVDLPGITKVPVGDQPTDIEARIRTMILSYIKHKTCIILAVSP  207

Query  809  ANAD  820
            ANAD
Sbjct  208  ANAD  211



>ref|XP_010927716.1| PREDICTED: dynamin-related protein 3A-like [Elaeis guineensis]
Length=827

 Score =   287 bits (735),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 171/181 (94%), Gaps = 2/181 (1%)
 Frame = +2

Query  284  VIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTRRP  463
            VIPIVNKLQDIFAQLGS STI+LPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDICTRRP
Sbjct  24   VIPIVNKLQDIFAQLGSSSTIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDICTRRP  83

Query  464  LVLQLLQTKRKPDSTD--EEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSDKQ  637
            LVLQL+   R+ ++ +  +EWGEFLHLPGK+F+DF++IR+EIQAETDREAGGN+GVSDKQ
Sbjct  84   LVLQLVHCPRRQEAVEGMDEWGEFLHLPGKRFYDFSEIRREIQAETDREAGGNRGVSDKQ  143

Query  638  IRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPANA  817
            IRLKIFSPNVL+ITLVDLPGITKVPVGDQP+DIEARIRTMI+SYIK  +C+ILAV+PANA
Sbjct  144  IRLKIFSPNVLNITLVDLPGITKVPVGDQPTDIEARIRTMILSYIKHRTCIILAVSPANA  203

Query  818  D  820
            D
Sbjct  204  D  204



>ref|NP_001190906.1| dynamin-related protein 3A [Arabidopsis thaliana]
 gb|AEE86261.1| dynamin-related protein 3A [Arabidopsis thaliana]
Length=809

 Score =   285 bits (729),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 169/188 (90%), Gaps = 1/188 (1%)
 Frame = +2

Query  260  NAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            NAAPLG SVIPIVNKLQDIFAQLGSQSTI LPQV VVGSQSSGKSSVLEALVGRDFLPRG
Sbjct  29   NAAPLGSSVIPIVNKLQDIFAQLGSQSTIALPQVVVVGSQSSGKSSVLEALVGRDFLPRG  88

Query  440  SDICTRRPLVLQLLQTK-RKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGN  616
            +DICTRRPLVLQLLQTK R    +D+EWGEF HLP  +F+DF++IR+EI+AET+R  G N
Sbjct  89   NDICTRRPLVLQLLQTKSRANGGSDDEWGEFRHLPETRFYDFSEIRREIEAETNRLVGEN  148

Query  617  KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLIL  796
            KGV+D QIRLKI SPNVL+ITLVDLPGITKVPVGDQPSDIEARIRTMI+SYIK  +CLIL
Sbjct  149  KGVADTQIRLKISSPNVLNITLVDLPGITKVPVGDQPSDIEARIRTMILSYIKQDTCLIL  208

Query  797  AVTPANAD  820
            AVTPAN D
Sbjct  209  AVTPANTD  216



>gb|KFK39955.1| hypothetical protein AALP_AA3G311000 [Arabis alpina]
Length=780

 Score =   284 bits (727),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 176/197 (89%), Gaps = 5/197 (3%)
 Frame = +2

Query  233  PSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEAL  412
            PSSTS      APLG SVIPIVNKLQDI  QLGSQSTI+LPQVAVVG+QSSGKSSVLEAL
Sbjct  6    PSSTSA----GAPLGSSVIPIVNKLQDIVVQLGSQSTIQLPQVAVVGNQSSGKSSVLEAL  61

Query  413  VGRDFLPRGSDICTRRPLVLQLLQTKRKPDS-TDEEWGEFLHLPGKKFFDFNDIRKEIQA  589
            VGRDFLPRG++ICTRRPL+LQL+QTK + D  +D+EWGEFLH   K+F DF++IR+EI+A
Sbjct  62   VGRDFLPRGNEICTRRPLLLQLIQTKPRSDGGSDDEWGEFLHQGSKRFHDFSEIRREIEA  121

Query  590  ETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSY  769
            ET+R  G NKGVSD+QIRLKIFSPNV+DITLVDLPGITKVPVGDQP+DIEARIRTMI+SY
Sbjct  122  ETNRVVGDNKGVSDQQIRLKIFSPNVVDITLVDLPGITKVPVGDQPTDIEARIRTMILSY  181

Query  770  IKLPSCLILAVTPANAD  820
            IK P+CLILAVTPAN+D
Sbjct  182  IKNPACLILAVTPANSD  198



>dbj|BAB85644.1| dynamin like protein 2a [Arabidopsis thaliana]
Length=808

 Score =   285 bits (728),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 169/188 (90%), Gaps = 1/188 (1%)
 Frame = +2

Query  260  NAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            NAAPLG SVIPIVNKLQDIFAQLGSQSTI LPQV VVGSQSSGKSSVLEALVGRDFLPRG
Sbjct  29   NAAPLGSSVIPIVNKLQDIFAQLGSQSTIALPQVVVVGSQSSGKSSVLEALVGRDFLPRG  88

Query  440  SDICTRRPLVLQLLQTK-RKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGN  616
            +DICTRRPLVLQLLQTK R    +D+EWGEF HLP  +F+DF++IR+EI+AET+R  G N
Sbjct  89   NDICTRRPLVLQLLQTKSRANGGSDDEWGEFRHLPETRFYDFSEIRREIEAETNRLVGEN  148

Query  617  KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLIL  796
            KGV+D QIRLKI SPNVL+ITLVDLPGITKVPVGDQPSDIEARIRTMI+SYIK  +CLIL
Sbjct  149  KGVADTQIRLKISSPNVLNITLVDLPGITKVPVGDQPSDIEARIRTMILSYIKQDTCLIL  208

Query  797  AVTPANAD  820
            AVTPAN D
Sbjct  209  AVTPANTD  216



>gb|AAC61784.1| similar to dynamin-like protein encoded by GenBank Accession 
Number X99669 [Arabidopsis thaliana]
Length=809

 Score =   285 bits (728),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 169/188 (90%), Gaps = 1/188 (1%)
 Frame = +2

Query  260  NAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            NAAPLG SVIPIVNKLQDIFAQLGSQSTI LPQV VVGSQSSGKSSVLEALVGRDFLPRG
Sbjct  29   NAAPLGSSVIPIVNKLQDIFAQLGSQSTIALPQVVVVGSQSSGKSSVLEALVGRDFLPRG  88

Query  440  SDICTRRPLVLQLLQTK-RKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGN  616
            +DICTRRPLVLQLLQTK R    +D+EWGEF HLP  +F+DF++IR+EI+AET+R  G N
Sbjct  89   NDICTRRPLVLQLLQTKSRANGGSDDEWGEFRHLPETRFYDFSEIRREIEAETNRLVGEN  148

Query  617  KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLIL  796
            KGV+D QIRLKI SPNVL+ITLVDLPGITKVPVGDQPSDIEARIRTMI+SYIK  +CLIL
Sbjct  149  KGVADTQIRLKISSPNVLNITLVDLPGITKVPVGDQPSDIEARIRTMILSYIKQDTCLIL  208

Query  797  AVTPANAD  820
            AVTPAN D
Sbjct  209  AVTPANTD  216



>ref|NP_567931.1| dynamin-related protein 3A [Arabidopsis thaliana]
 sp|Q8S944.2|DRP3A_ARATH RecName: Full=Dynamin-related protein 3A; AltName: Full=Dynamin-like 
protein 2; AltName: Full=Dynamin-like protein 2a [Arabidopsis 
thaliana]
 emb|CAA20578.1| Arabidopsis dynamin-like protein ADL2 [Arabidopsis thaliana]
 emb|CAB80082.1| Arabidopsis dynamin-like protein ADL2 [Arabidopsis thaliana]
 dbj|BAB85643.1| dynamin like protein 2a [Arabidopsis thaliana]
 gb|AEE86260.1| dynamin-related protein 3A [Arabidopsis thaliana]
Length=808

 Score =   285 bits (728),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 169/188 (90%), Gaps = 1/188 (1%)
 Frame = +2

Query  260  NAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            NAAPLG SVIPIVNKLQDIFAQLGSQSTI LPQV VVGSQSSGKSSVLEALVGRDFLPRG
Sbjct  29   NAAPLGSSVIPIVNKLQDIFAQLGSQSTIALPQVVVVGSQSSGKSSVLEALVGRDFLPRG  88

Query  440  SDICTRRPLVLQLLQTK-RKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGN  616
            +DICTRRPLVLQLLQTK R    +D+EWGEF HLP  +F+DF++IR+EI+AET+R  G N
Sbjct  89   NDICTRRPLVLQLLQTKSRANGGSDDEWGEFRHLPETRFYDFSEIRREIEAETNRLVGEN  148

Query  617  KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLIL  796
            KGV+D QIRLKI SPNVL+ITLVDLPGITKVPVGDQPSDIEARIRTMI+SYIK  +CLIL
Sbjct  149  KGVADTQIRLKISSPNVLNITLVDLPGITKVPVGDQPSDIEARIRTMILSYIKQDTCLIL  208

Query  797  AVTPANAD  820
            AVTPAN D
Sbjct  209  AVTPANTD  216



>ref|XP_002869201.1| hypothetical protein ARALYDRAFT_491315 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45460.1| hypothetical protein ARALYDRAFT_491315 [Arabidopsis lyrata subsp. 
lyrata]
Length=808

 Score =   285 bits (728),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 173/189 (92%), Gaps = 2/189 (1%)
 Frame = +2

Query  260  NAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            NAAPLG SVIPIVNKLQDIFAQLGSQS+I LPQVAVVGSQSSGKSSVLEALVGRDFLPRG
Sbjct  28   NAAPLGSSVIPIVNKLQDIFAQLGSQSSIALPQVAVVGSQSSGKSSVLEALVGRDFLPRG  87

Query  440  SDICTRRPLVLQLLQTK-RKPDSTDEEWGEFLHLP-GKKFFDFNDIRKEIQAETDREAGG  613
            +DICTRRPLVLQL+QTK R    +D+EWGEFLHLP   +F+DF++IR+EI+AET+R AG 
Sbjct  88   NDICTRRPLVLQLVQTKSRSNGGSDDEWGEFLHLPPDTRFYDFSEIRREIEAETNRLAGE  147

Query  614  NKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLI  793
            NKGV+DKQIRLKI SPNVLDITLVDLPGITKVPVGDQP+DIEARIRTMI+SYIK  +CLI
Sbjct  148  NKGVADKQIRLKISSPNVLDITLVDLPGITKVPVGDQPTDIEARIRTMILSYIKSATCLI  207

Query  794  LAVTPANAD  820
            LAVTPAN D
Sbjct  208  LAVTPANTD  216



>ref|XP_003593277.1| Dynamin-related protein 3A [Medicago truncatula]
Length=507

 Score =   277 bits (708),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 174/202 (86%), Gaps = 4/202 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            M ++ V S     +    PLG  VI +VN+LQDIF+++GSQS I LPQVAVVGSQSSGKS
Sbjct  1    MVDDTVTSPPPPPSSAPVPLGSGVISLVNRLQDIFSRVGSQSAINLPQVAVVGSQSSGKS  60

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLEALVGRDFLPRG++ICTRRPLVLQL+++    D    E+GEFLHLPGK+F+DF+DIR
Sbjct  61   SVLEALVGRDFLPRGNEICTRRPLVLQLVRSSEPAD----EYGEFLHLPGKRFYDFSDIR  116

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQAETDREAG NKGVSD+QIRLKI SPNVLD+TLVDLPGITKVPVGDQPSDIEARIRT
Sbjct  117  REIQAETDREAGDNKGVSDRQIRLKIVSPNVLDMTLVDLPGITKVPVGDQPSDIEARIRT  176

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIK PSCLILAVTPAN+D
Sbjct  177  MIMSYIKEPSCLILAVTPANSD  198



>ref|XP_001761534.1| predicted protein [Physcomitrella patens]
 gb|EDQ73602.1| predicted protein [Physcomitrella patens]
Length=766

 Score =   283 bits (725),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 156/199 (78%), Positives = 177/199 (89%), Gaps = 7/199 (4%)
 Frame = +2

Query  233  PSSTSTSNLNAAP-LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEA  409
            PS TS    +A P LG +VIP+VNKLQDIF+QLGS STI+LPQVAVVGSQSSGKSSVLEA
Sbjct  17   PSPTS----DAFPFLGEAVIPLVNKLQDIFSQLGSASTIDLPQVAVVGSQSSGKSSVLEA  72

Query  410  LVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDE--EWGEFLHLPGKKFFDFNDIRKEI  583
            LVGRDFLPRGSD+CTRRPLVLQL+QT R+P+   E  EWGEFLH+PG++F DF  IRKEI
Sbjct  73   LVGRDFLPRGSDVCTRRPLVLQLVQTSRRPEDRAELVEWGEFLHIPGRRFTDFEAIRKEI  132

Query  584  QAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIM  763
            QAETDRE G NKG+S+KQIRLKIFSPNVL+ITLVDLPGITKVPVGDQP+DIEAR+RTMI+
Sbjct  133  QAETDRELGTNKGISEKQIRLKIFSPNVLNITLVDLPGITKVPVGDQPNDIEARVRTMIL  192

Query  764  SYIKLPSCLILAVTPANAD  820
            SYIK  +C+ILAV+PANAD
Sbjct  193  SYIKHDTCIILAVSPANAD  211



>ref|XP_003564945.1| PREDICTED: dynamin-related protein 3B-like [Brachypodium distachyon]
Length=818

 Score =   284 bits (727),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 168/179 (94%), Gaps = 1/179 (1%)
 Frame = +2

Query  287  IPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTRRPL  466
            IPIVNKLQDIF+QLGS STI+LPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDICTRRPL
Sbjct  28   IPIVNKLQDIFSQLGSSSTIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDICTRRPL  87

Query  467  VLQLLQTKRKP-DSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSDKQIR  643
            VLQL+   R+P D+  +EWGEFLHLPG+++FDF +IR+EIQAETDREAGGNKGVSD+QIR
Sbjct  88   VLQLVHQPRRPADAEADEWGEFLHLPGRRYFDFREIRREIQAETDREAGGNKGVSDRQIR  147

Query  644  LKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPANAD  820
            LKI SPNVL+ITLVDLPGITKVPVGDQP+DIEARIRTMI+SYIK  +C+ILAV+PANAD
Sbjct  148  LKIHSPNVLNITLVDLPGITKVPVGDQPTDIEARIRTMILSYIKHKTCIILAVSPANAD  206



>ref|XP_007159159.1| hypothetical protein PHAVU_002G213900g [Phaseolus vulgaris]
 gb|ESW31153.1| hypothetical protein PHAVU_002G213900g [Phaseolus vulgaris]
Length=798

 Score =   283 bits (724),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 169/186 (91%), Gaps = 4/186 (2%)
 Frame = +2

Query  263  AAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGS  442
            A+PLG SVI +VN+LQDIF+++GS S I+LPQVAVVGSQSSGKSSVLEALVGRDFLPRG+
Sbjct  7    ASPLGSSVISLVNRLQDIFSRVGSHSAIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGN  66

Query  443  DICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKG  622
            DICTRRPLVLQL+Q K   D    E+GEFLHLPG+KF DF+ IR EIQAETDREAGGNK 
Sbjct  67   DICTRRPLVLQLVQVKPSQD----EFGEFLHLPGRKFHDFSQIRYEIQAETDREAGGNKD  122

Query  623  VSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAV  802
            VSDKQIRLKIFSPNVLDITLVDLPG+TKVPVGDQPSDIEARIRTMIMSYIK P+CLILAV
Sbjct  123  VSDKQIRLKIFSPNVLDITLVDLPGLTKVPVGDQPSDIEARIRTMIMSYIKTPTCLILAV  182

Query  803  TPANAD  820
            TPAN+D
Sbjct  183  TPANSD  188



>ref|XP_010518214.1| PREDICTED: dynamin-related protein 3B isoform X1 [Camelina sativa]
 ref|XP_010518222.1| PREDICTED: dynamin-related protein 3B isoform X2 [Camelina sativa]
Length=778

 Score =   282 bits (722),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 179/204 (88%), Gaps = 4/204 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            M+ + +P S S S +   PLG SVIPIVNKLQDIFAQLGS+STI+LPQVAVVGSQSSGKS
Sbjct  1    MSVDDLPPSPSASAV--TPLGSSVIPIVNKLQDIFAQLGSKSTIQLPQVAVVGSQSSGKS  58

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTK-RKPDSTDEEWGEFLHL-PGKKFFDFND  568
            SVLEALVGRDFLPRG+DICTRRPLVLQLLQTK R    +DEEWGEFLH  P K+ +DF++
Sbjct  59   SVLEALVGRDFLPRGNDICTRRPLVLQLLQTKPRSEGGSDEEWGEFLHHNPAKRIYDFSE  118

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EI+AET+R +GGNKGVSD  IRLKI SPNVLDI+LVDLPGITKVPVGDQPS IEARI
Sbjct  119  IRREIEAETNRISGGNKGVSDNPIRLKISSPNVLDISLVDLPGITKVPVGDQPSAIEARI  178

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            RTMI+SYIK PSCLILAVTPAN+D
Sbjct  179  RTMILSYIKNPSCLILAVTPANSD  202



>ref|XP_010488879.1| PREDICTED: dynamin-related protein 3B-like [Camelina sativa]
Length=779

 Score =   282 bits (722),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 179/204 (88%), Gaps = 4/204 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            M+ + +P S S S +   PLG SVIPIVNKLQDIFAQLGS+STI+LPQVAVVGSQSSGKS
Sbjct  1    MSVDDLPPSPSASAV--TPLGSSVIPIVNKLQDIFAQLGSKSTIQLPQVAVVGSQSSGKS  58

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTK-RKPDSTDEEWGEFLHL-PGKKFFDFND  568
            SVLEALVGRDFLPRG+DICTRRPLVLQLLQTK R    +DEEWGEFLH  P K+ +DF++
Sbjct  59   SVLEALVGRDFLPRGNDICTRRPLVLQLLQTKPRSEGGSDEEWGEFLHHNPAKRIYDFSE  118

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EI+AET+R +G NKGVSD  IRLKI SPNVLDI+LVDLPGITKVPVGDQPSDIEARI
Sbjct  119  IRREIEAETNRISGENKGVSDNPIRLKISSPNVLDISLVDLPGITKVPVGDQPSDIEARI  178

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            RTMI+SYIK PSCLILAVTPAN+D
Sbjct  179  RTMILSYIKNPSCLILAVTPANSD  202



>ref|XP_001775158.1| predicted protein [Physcomitrella patens]
 gb|EDQ60019.1| predicted protein [Physcomitrella patens]
Length=766

 Score =   281 bits (720),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 169/185 (91%), Gaps = 2/185 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG +VIP+VNKLQDIF+QLGS S I+LPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC
Sbjct  33   LGEAVIPLVNKLQDIFSQLGSSSNIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDIC  92

Query  452  TRRPLVLQLLQTKRKPDSTDE--EWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGV  625
            TRRPLVLQL+QT R+P+   E  EWGEFLH+PG++F DF  IRKEIQAETDRE G NKG+
Sbjct  93   TRRPLVLQLVQTSRRPEDRTELLEWGEFLHVPGRRFTDFGAIRKEIQAETDRELGTNKGI  152

Query  626  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVT  805
            S+KQIRLKIFSPNVL+ITLVDLPGITKVPVGDQP+DIEARIRTMI++YIK  +C+ILAV+
Sbjct  153  SEKQIRLKIFSPNVLNITLVDLPGITKVPVGDQPTDIEARIRTMILTYIKHETCIILAVS  212

Query  806  PANAD  820
            PANAD
Sbjct  213  PANAD  217



>ref|XP_010436273.1| PREDICTED: dynamin-related protein 3A-like, partial [Camelina 
sativa]
Length=514

 Score =   275 bits (704),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 177/200 (89%), Gaps = 2/200 (1%)
 Frame = +2

Query  227  AVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLE  406
            + PS T+ +   AAPLG SVIPIVNKLQDIFAQLGSQS+I LPQVAVVGSQSSGKSSVLE
Sbjct  13   STPSPTAAATTKAAPLGSSVIPIVNKLQDIFAQLGSQSSIALPQVAVVGSQSSGKSSVLE  72

Query  407  ALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDS-TDEEWGEFLHLPGK-KFFDFNDIRKE  580
            ALVGRDFLPRG+DICTRRPLVLQL+QTKR+ +  +D+EWGEF HLP   + +DF++IR+E
Sbjct  73   ALVGRDFLPRGNDICTRRPLVLQLVQTKRRSNGGSDDEWGEFRHLPEHTRIYDFSEIRRE  132

Query  581  IQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMI  760
            I+AET+R  G NKGV+DKQIRL I+SPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMI
Sbjct  133  IEAETNRLVGENKGVADKQIRLTIYSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMI  192

Query  761  MSYIKLPSCLILAVTPANAD  820
            +SYIK  +CLILAVTPAN D
Sbjct  193  LSYIKSDTCLILAVTPANTD  212



>ref|XP_002984035.1| hypothetical protein SELMODRAFT_119205 [Selaginella moellendorffii]
 gb|EFJ15047.1| hypothetical protein SELMODRAFT_119205 [Selaginella moellendorffii]
Length=748

 Score =   281 bits (718),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 174/198 (88%), Gaps = 2/198 (1%)
 Frame = +2

Query  227  AVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLE  406
            + P S ST+   + PLG +VIP+VNKLQDIF+QLGS STI+LPQVAVVGSQSSGKSSVLE
Sbjct  7    STPPSPSTAA-ASPPLGQNVIPLVNKLQDIFSQLGSASTIDLPQVAVVGSQSSGKSSVLE  65

Query  407  ALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQ  586
            ALVGRDFLPRG DICTRRPLVLQL+QT R+ D    EWGEFLHLP ++F DF+ IRKEIQ
Sbjct  66   ALVGRDFLPRGCDICTRRPLVLQLVQTTRRGDEV-VEWGEFLHLPNRRFTDFSAIRKEIQ  124

Query  587  AETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMS  766
            AETDRE G NKG+SDKQIRLKIFSP VL+ITLVDLPGITKVPVGDQP+DIEARIRTMI+S
Sbjct  125  AETDRELGSNKGISDKQIRLKIFSPKVLNITLVDLPGITKVPVGDQPTDIEARIRTMILS  184

Query  767  YIKLPSCLILAVTPANAD  820
            YIK  +C+ILAV+PANAD
Sbjct  185  YIKHETCIILAVSPANAD  202



>emb|CDY48440.1| BnaA08g11490D [Brassica napus]
Length=807

 Score =   282 bits (721),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 172/185 (93%), Gaps = 2/185 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG SVIPIVNKLQDIFAQLGSQS+IELPQVAVVGSQSSGKSSVLEALVGRDFLPRG+DIC
Sbjct  31   LGSSVIPIVNKLQDIFAQLGSQSSIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDIC  90

Query  452  TRRPLVLQLLQTKRKPDS-TDEEWGEFLHLPG-KKFFDFNDIRKEIQAETDREAGGNKGV  625
            TRRPLVLQLLQTK K +  +D+EWGEFLHLP  ++ +DF++IR+EI+AET+R AG NKGV
Sbjct  91   TRRPLVLQLLQTKSKSNGGSDDEWGEFLHLPNNRRIYDFSEIRREIEAETNRLAGDNKGV  150

Query  626  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVT  805
            S KQIRLKI SPNVLDITLVDLPGITKVPVGDQP+DIEA+IRTMI+SYIK PSCLILAVT
Sbjct  151  SAKQIRLKIHSPNVLDITLVDLPGITKVPVGDQPTDIEAQIRTMILSYIKQPSCLILAVT  210

Query  806  PANAD  820
            PAN+D
Sbjct  211  PANSD  215



>ref|XP_009108779.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Brassica 
rapa]
Length=816

 Score =   282 bits (721),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 172/185 (93%), Gaps = 2/185 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG SVIPIVNKLQDIFAQLGSQS+IELPQVAVVGSQSSGKSSVLEALVGRDFLPRG+DIC
Sbjct  31   LGSSVIPIVNKLQDIFAQLGSQSSIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDIC  90

Query  452  TRRPLVLQLLQTKRKPDS-TDEEWGEFLHLPG-KKFFDFNDIRKEIQAETDREAGGNKGV  625
            TRRPLVLQLLQTK K +  +D+EWGEFLHLP  ++ +DF++IR+EI+AET+R AG NKGV
Sbjct  91   TRRPLVLQLLQTKSKSNGGSDDEWGEFLHLPNNRRIYDFSEIRREIEAETNRLAGDNKGV  150

Query  626  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVT  805
            S KQIRLKI SPNVLDITLVDLPGITKVPVGDQP+DIEA+IRTMI+SYIK PSCLILAVT
Sbjct  151  SAKQIRLKIHSPNVLDITLVDLPGITKVPVGDQPTDIEAQIRTMILSYIKQPSCLILAVT  210

Query  806  PANAD  820
            PAN+D
Sbjct  211  PANSD  215



>ref|XP_009108778.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Brassica 
rapa]
Length=817

 Score =   282 bits (721),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 172/185 (93%), Gaps = 2/185 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG SVIPIVNKLQDIFAQLGSQS+IELPQVAVVGSQSSGKSSVLEALVGRDFLPRG+DIC
Sbjct  31   LGSSVIPIVNKLQDIFAQLGSQSSIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDIC  90

Query  452  TRRPLVLQLLQTKRKPDS-TDEEWGEFLHLPG-KKFFDFNDIRKEIQAETDREAGGNKGV  625
            TRRPLVLQLLQTK K +  +D+EWGEFLHLP  ++ +DF++IR+EI+AET+R AG NKGV
Sbjct  91   TRRPLVLQLLQTKSKSNGGSDDEWGEFLHLPNNRRIYDFSEIRREIEAETNRLAGDNKGV  150

Query  626  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVT  805
            S KQIRLKI SPNVLDITLVDLPGITKVPVGDQP+DIEA+IRTMI+SYIK PSCLILAVT
Sbjct  151  SAKQIRLKIHSPNVLDITLVDLPGITKVPVGDQPTDIEAQIRTMILSYIKQPSCLILAVT  210

Query  806  PANAD  820
            PAN+D
Sbjct  211  PANSD  215



>gb|KHN46250.1| Dynamin-related protein 3A [Glycine soja]
Length=815

 Score =   281 bits (720),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 170/187 (91%), Gaps = 4/187 (2%)
 Frame = +2

Query  260  NAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
             AAPLG SVI +VN+LQDIF++ GS+S I+LPQVAVVGSQSSGKSS LEA VGRDFLPRG
Sbjct  6    GAAPLGSSVISLVNRLQDIFSREGSRSAIDLPQVAVVGSQSSGKSS-LEAFVGRDFLPRG  64

Query  440  SDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNK  619
            +DICTRRPLVLQL+QTK  P S DE +GEFLHLPG+KF DF+ IR EIQ ETDREAGGNK
Sbjct  65   NDICTRRPLVLQLVQTK--PPSQDE-FGEFLHLPGRKFHDFSQIRAEIQVETDREAGGNK  121

Query  620  GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILA  799
            GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK P+C+ILA
Sbjct  122  GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKTPTCVILA  181

Query  800  VTPANAD  820
            VTPAN+D
Sbjct  182  VTPANSD  188



>gb|KEH31202.1| dynamin 3A-like protein [Medicago truncatula]
Length=718

 Score =   280 bits (715),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 169/188 (90%), Gaps = 6/188 (3%)
 Frame = +2

Query  260  NAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            + APLG +VI +VNKLQDIF+++GSQSTI+LPQVAVVG QSSGKSSVLEALVGRDFLPRG
Sbjct  7    DGAPLGSTVISLVNKLQDIFSRVGSQSTIDLPQVAVVGCQSSGKSSVLEALVGRDFLPRG  66

Query  440  SDICTRRPLVLQLLQTK-RKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGN  616
            +DICTRRPLVLQL+     KP+S      EFLHLPG+ F DF+ IR EIQAETDREAGGN
Sbjct  67   NDICTRRPLVLQLVHIPPSKPES-----AEFLHLPGRTFHDFSQIRAEIQAETDREAGGN  121

Query  617  KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLIL  796
            KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIE+RIRTMIMSYIK+P+CLIL
Sbjct  122  KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIESRIRTMIMSYIKVPTCLIL  181

Query  797  AVTPANAD  820
            AVTPAN+D
Sbjct  182  AVTPANSD  189



>emb|CDX72418.1| BnaC07g44400D [Brassica napus]
Length=831

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 176/204 (86%), Gaps = 3/204 (1%)
 Frame = +2

Query  218  AEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkss  397
             E+    S  +S   A+PLG SVIPIVNKLQDIFAQLGS S+IELPQVAVVGSQSSGKSS
Sbjct  3    VEQVTDDSPPSSTPKASPLGSSVIPIVNKLQDIFAQLGSHSSIELPQVAVVGSQSSGKSS  62

Query  398  vLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDE--EWGEFLHLP-GKKFFDFND  568
            VLEALVGRDFLPRG+DICTRRPLVLQL+QTK K        EWGEFLHLP   + +DF++
Sbjct  63   VLEALVGRDFLPRGNDICTRRPLVLQLVQTKSKSSGGSSDDEWGEFLHLPSNHRIYDFSE  122

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EI+AET+R AGGNKGV DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQP+DIEARI
Sbjct  123  IRREIEAETNRLAGGNKGVKDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPTDIEARI  182

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            RTMI+SYIK PSCLILAVTPAN+D
Sbjct  183  RTMILSYIKQPSCLILAVTPANSD  206



>ref|XP_010447212.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Camelina 
sativa]
Length=805

 Score =   281 bits (719),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 177/200 (89%), Gaps = 4/200 (2%)
 Frame = +2

Query  227  AVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLE  406
            + PS T+T+   AAPLG SVIPIVNKLQDIFAQLGSQS+I LPQVAVVGSQSSGKSSVLE
Sbjct  14   STPSPTATTK--AAPLGSSVIPIVNKLQDIFAQLGSQSSIALPQVAVVGSQSSGKSSVLE  71

Query  407  ALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDS-TDEEWGEFLHLPGK-KFFDFNDIRKE  580
            ALVGRDFLPRG+DICTRRPLVLQL+QTKR  +  +D+EWGEF HLP   + +DF++IR+E
Sbjct  72   ALVGRDFLPRGNDICTRRPLVLQLVQTKRPSNGGSDDEWGEFRHLPEHTRIYDFSEIRRE  131

Query  581  IQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMI  760
            I+AET+R  G NKGV+DKQIRL I+SPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMI
Sbjct  132  IEAETNRLVGENKGVADKQIRLTIYSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMI  191

Query  761  MSYIKLPSCLILAVTPANAD  820
            +SYIK  +CLILAVTPAN D
Sbjct  192  LSYIKSDTCLILAVTPANTD  211



>ref|XP_010447213.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Camelina 
sativa]
Length=804

 Score =   281 bits (718),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 177/200 (89%), Gaps = 4/200 (2%)
 Frame = +2

Query  227  AVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLE  406
            + PS T+T+   AAPLG SVIPIVNKLQDIFAQLGSQS+I LPQVAVVGSQSSGKSSVLE
Sbjct  14   STPSPTATTK--AAPLGSSVIPIVNKLQDIFAQLGSQSSIALPQVAVVGSQSSGKSSVLE  71

Query  407  ALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDS-TDEEWGEFLHLPGK-KFFDFNDIRKE  580
            ALVGRDFLPRG+DICTRRPLVLQL+QTKR  +  +D+EWGEF HLP   + +DF++IR+E
Sbjct  72   ALVGRDFLPRGNDICTRRPLVLQLVQTKRPSNGGSDDEWGEFRHLPEHTRIYDFSEIRRE  131

Query  581  IQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMI  760
            I+AET+R  G NKGV+DKQIRL I+SPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMI
Sbjct  132  IEAETNRLVGENKGVADKQIRLTIYSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMI  191

Query  761  MSYIKLPSCLILAVTPANAD  820
            +SYIK  +CLILAVTPAN D
Sbjct  192  LSYIKSDTCLILAVTPANTD  211



>gb|AAM61220.1| dynamin-like protein [Arabidopsis thaliana]
Length=370

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 177/204 (87%), Gaps = 5/204 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            M+ + +P S++++     PLG SVIPIVNKLQDIFAQLGSQSTI LPQVAVVGSQSSGKS
Sbjct  1    MSVDDLPPSSASA---VTPLGSSVIPIVNKLQDIFAQLGSQSTIALPQVAVVGSQSSGKS  57

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDS-TDEEWGEFLHL-PGKKFFDFND  568
            SVLEALVGRDFLPRG+DICTRRPL LQL+QTK   D  +DEEWGEFLH  P ++ +DF++
Sbjct  58   SVLEALVGRDFLPRGNDICTRRPLRLQLVQTKPSSDGGSDEEWGEFLHHDPVRRIYDFSE  117

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EI+AET+R +G NKGVSD  I LKIFSPNVLDI+LVDLPGITKVPVGDQPSDIEARI
Sbjct  118  IRREIEAETNRVSGENKGVSDIPIGLKIFSPNVLDISLVDLPGITKVPVGDQPSDIEARI  177

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            RTMI++YIK PSCLILAV+PAN D
Sbjct  178  RTMILTYIKEPSCLILAVSPANTD  201



>gb|AAD25856.2| dynamin-like protein [Arabidopsis thaliana]
Length=370

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 177/204 (87%), Gaps = 5/204 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            M+ + +P S++++     PLG SVIPIVNKLQDIFAQLGSQSTI LPQVAVVGSQSSGKS
Sbjct  1    MSVDDLPPSSASA---VTPLGSSVIPIVNKLQDIFAQLGSQSTIALPQVAVVGSQSSGKS  57

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDS-TDEEWGEFLHL-PGKKFFDFND  568
            SVLEALVGRDFLPRG+DICTRRPL LQL+QTK   D  +DEEWGEFLH  P ++ +DF++
Sbjct  58   SVLEALVGRDFLPRGNDICTRRPLRLQLVQTKPSSDGGSDEEWGEFLHHDPVRRIYDFSE  117

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EI+AET+R +G NKGVSD  I LKIFSPNVLDI+LVDLPGITKVPVGDQPSDIEARI
Sbjct  118  IRREIEAETNRVSGENKGVSDIPIGLKIFSPNVLDISLVDLPGITKVPVGDQPSDIEARI  177

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            RTMI++YIK PSCLILAV+PAN D
Sbjct  178  RTMILTYIKEPSCLILAVSPANTD  201



>ref|XP_003608404.1| Dynamin-related protein 3A [Medicago truncatula]
Length=759

 Score =   280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 169/188 (90%), Gaps = 6/188 (3%)
 Frame = +2

Query  260  NAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            + APLG +VI +VNKLQDIF+++GSQSTI+LPQVAVVG QSSGKSSVLEALVGRDFLPRG
Sbjct  7    DGAPLGSTVISLVNKLQDIFSRVGSQSTIDLPQVAVVGCQSSGKSSVLEALVGRDFLPRG  66

Query  440  SDICTRRPLVLQLLQTK-RKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGN  616
            +DICTRRPLVLQL+     KP+S      EFLHLPG+ F DF+ IR EIQAETDREAGGN
Sbjct  67   NDICTRRPLVLQLVHIPPSKPES-----AEFLHLPGRTFHDFSQIRAEIQAETDREAGGN  121

Query  617  KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLIL  796
            KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIE+RIRTMIMSYIK+P+CLIL
Sbjct  122  KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIESRIRTMIMSYIKVPTCLIL  181

Query  797  AVTPANAD  820
            AVTPAN+D
Sbjct  182  AVTPANSD  189



>gb|AES90601.2| dynamin 3A-like protein [Medicago truncatula]
Length=760

 Score =   280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 169/188 (90%), Gaps = 6/188 (3%)
 Frame = +2

Query  260  NAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            + APLG +VI +VNKLQDIF+++GSQSTI+LPQVAVVG QSSGKSSVLEALVGRDFLPRG
Sbjct  7    DGAPLGSTVISLVNKLQDIFSRVGSQSTIDLPQVAVVGCQSSGKSSVLEALVGRDFLPRG  66

Query  440  SDICTRRPLVLQLLQTK-RKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGN  616
            +DICTRRPLVLQL+     KP+S      EFLHLPG+ F DF+ IR EIQAETDREAGGN
Sbjct  67   NDICTRRPLVLQLVHIPPSKPES-----AEFLHLPGRTFHDFSQIRAEIQAETDREAGGN  121

Query  617  KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLIL  796
            KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIE+RIRTMIMSYIK+P+CLIL
Sbjct  122  KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIESRIRTMIMSYIKVPTCLIL  181

Query  797  AVTPANAD  820
            AVTPAN+D
Sbjct  182  AVTPANSD  189



>ref|XP_001777446.1| predicted protein [Physcomitrella patens]
 gb|EDQ57733.1| predicted protein [Physcomitrella patens]
Length=872

 Score =   281 bits (720),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 175/200 (88%), Gaps = 7/200 (4%)
 Frame = +2

Query  227  AVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLE  406
            A P+S ST  L     G +VIP+VNKLQDIF+QLGS STI+LPQVAVVGSQSSGKSSVLE
Sbjct  23   AAPTSVSTPFL-----GDAVIPLVNKLQDIFSQLGSASTIDLPQVAVVGSQSSGKSSVLE  77

Query  407  ALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDE--EWGEFLHLPGKKFFDFNDIRKE  580
            ALVGRDFLPRGSDICTRRPLVLQL+QT R+ +   E  EWGEFLH+PG++F DF  IRKE
Sbjct  78   ALVGRDFLPRGSDICTRRPLVLQLVQTSRRAEDQTELVEWGEFLHIPGRRFTDFAAIRKE  137

Query  581  IQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMI  760
            IQAETDRE G NKG+S+KQIRLKIFSPNVL+ITLVDLPGITKVPVGDQP+DIEAR+RTMI
Sbjct  138  IQAETDRELGTNKGISEKQIRLKIFSPNVLNITLVDLPGITKVPVGDQPNDIEARVRTMI  197

Query  761  MSYIKLPSCLILAVTPANAD  820
            +SYIK  +C+ILAV+PANAD
Sbjct  198  LSYIKHETCIILAVSPANAD  217



>ref|XP_006409667.1| hypothetical protein EUTSA_v10022566mg [Eutrema salsugineum]
 gb|ESQ51120.1| hypothetical protein EUTSA_v10022566mg [Eutrema salsugineum]
Length=779

 Score =   280 bits (715),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 163/197 (83%), Positives = 178/197 (90%), Gaps = 5/197 (3%)
 Frame = +2

Query  233  PSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEAL  412
            PSSTS     AAPLG SVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEAL
Sbjct  8    PSSTSA----AAPLGSSVIPIVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEAL  63

Query  413  VGRDFLPRGSDICTRRPLVLQLLQTKRKPDS-TDEEWGEFLHLPGKKFFDFNDIRKEIQA  589
            VGRDFLPRG+DICTRRPL+LQLLQTK   D  +D+EWGEF H  GK+F+DF++IR+EI+A
Sbjct  64   VGRDFLPRGNDICTRRPLLLQLLQTKPSSDGGSDDEWGEFRHHGGKRFYDFSEIRREIEA  123

Query  590  ETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSY  769
            ET+R  G NKGVSD+QI LKIFSPNVLDITLVDLPGITKVPVGDQP+DIEARIRTMI+SY
Sbjct  124  ETNRVVGENKGVSDQQICLKIFSPNVLDITLVDLPGITKVPVGDQPTDIEARIRTMILSY  183

Query  770  IKLPSCLILAVTPANAD  820
            IK PSCLILAVTPAN+D
Sbjct  184  IKNPSCLILAVTPANSD  200



>ref|XP_006283135.1| hypothetical protein CARUB_v10004162mg [Capsella rubella]
 gb|EOA16033.1| hypothetical protein CARUB_v10004162mg [Capsella rubella]
Length=806

 Score =   280 bits (715),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 169/188 (90%), Gaps = 2/188 (1%)
 Frame = +2

Query  263  AAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGS  442
            AAPLG SVIPIVNKLQDIFAQLGSQS+I LPQVAVVGSQSSGKSSVLEALVGRDFLPRG+
Sbjct  27   AAPLGSSVIPIVNKLQDIFAQLGSQSSIALPQVAVVGSQSSGKSSVLEALVGRDFLPRGN  86

Query  443  DICTRRPLVLQLLQTK-RKPDSTDEEWGEFLHLP-GKKFFDFNDIRKEIQAETDREAGGN  616
            DICTRRPLVLQL+QTK R    +D+EWGEF HLP   + +DF++IR+EI+AET+R  GGN
Sbjct  87   DICTRRPLVLQLVQTKSRSNGGSDDEWGEFRHLPENTRIYDFSEIRREIEAETNRLVGGN  146

Query  617  KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLIL  796
            K V+DKQIRL I SPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMI+SYIKL +CLIL
Sbjct  147  KNVADKQIRLTIHSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMILSYIKLDTCLIL  206

Query  797  AVTPANAD  820
            AVTPAN D
Sbjct  207  AVTPANTD  214



>ref|XP_002960102.1| hypothetical protein SELMODRAFT_437242 [Selaginella moellendorffii]
 gb|EFJ37641.1| hypothetical protein SELMODRAFT_437242 [Selaginella moellendorffii]
Length=929

 Score =   281 bits (718),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 173/198 (87%), Gaps = 2/198 (1%)
 Frame = +2

Query  227  AVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLE  406
            + P S ST+   A PLG +VIP+VNKLQDIF+QLGS STI+LPQVAVVGSQSSGKSSVLE
Sbjct  7    STPPSPSTAAA-APPLGQNVIPLVNKLQDIFSQLGSASTIDLPQVAVVGSQSSGKSSVLE  65

Query  407  ALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQ  586
            ALVGRDFLPRG DICTRRPLVLQL+QT R+ D    EWGEFLHLP ++F DF  IRKEIQ
Sbjct  66   ALVGRDFLPRGCDICTRRPLVLQLVQTTRRGDEV-VEWGEFLHLPNRRFTDFTAIRKEIQ  124

Query  587  AETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMS  766
            AETDRE G NKG+SDKQIRLKIFSP VL+ITLVDLPGITKVPVGDQP+DIEARIRTMI+S
Sbjct  125  AETDRELGSNKGISDKQIRLKIFSPKVLNITLVDLPGITKVPVGDQPTDIEARIRTMILS  184

Query  767  YIKLPSCLILAVTPANAD  820
            YIK  +C+ILAV+PANAD
Sbjct  185  YIKHETCIILAVSPANAD  202



>ref|XP_003593276.1| Dynamin-related protein 3A [Medicago truncatula]
 gb|AES63527.1| dynamin 3A-like protein [Medicago truncatula]
Length=824

 Score =   279 bits (713),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 174/202 (86%), Gaps = 4/202 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            M ++ V S     +    PLG  VI +VN+LQDIF+++GSQS I LPQVAVVGSQSSGKS
Sbjct  1    MVDDTVTSPPPPPSSAPVPLGSGVISLVNRLQDIFSRVGSQSAINLPQVAVVGSQSSGKS  60

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLEALVGRDFLPRG++ICTRRPLVLQL+++    D    E+GEFLHLPGK+F+DF+DIR
Sbjct  61   SVLEALVGRDFLPRGNEICTRRPLVLQLVRSSEPAD----EYGEFLHLPGKRFYDFSDIR  116

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQAETDREAG NKGVSD+QIRLKI SPNVLD+TLVDLPGITKVPVGDQPSDIEARIRT
Sbjct  117  REIQAETDREAGDNKGVSDRQIRLKIVSPNVLDMTLVDLPGITKVPVGDQPSDIEARIRT  176

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIK PSCLILAVTPAN+D
Sbjct  177  MIMSYIKEPSCLILAVTPANSD  198



>ref|XP_003593275.1| Dynamin-related protein 3A [Medicago truncatula]
Length=852

 Score =   279 bits (713),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 174/202 (86%), Gaps = 4/202 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            M ++ V S     +    PLG  VI +VN+LQDIF+++GSQS I LPQVAVVGSQSSGKS
Sbjct  1    MVDDTVTSPPPPPSSAPVPLGSGVISLVNRLQDIFSRVGSQSAINLPQVAVVGSQSSGKS  60

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLEALVGRDFLPRG++ICTRRPLVLQL+++    D    E+GEFLHLPGK+F+DF+DIR
Sbjct  61   SVLEALVGRDFLPRGNEICTRRPLVLQLVRSSEPAD----EYGEFLHLPGKRFYDFSDIR  116

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
            +EIQAETDREAG NKGVSD+QIRLKI SPNVLD+TLVDLPGITKVPVGDQPSDIEARIRT
Sbjct  117  REIQAETDREAGDNKGVSDRQIRLKIVSPNVLDMTLVDLPGITKVPVGDQPSDIEARIRT  176

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            MIMSYIK PSCLILAVTPAN+D
Sbjct  177  MIMSYIKEPSCLILAVTPANSD  198



>ref|XP_009381334.1| PREDICTED: LOW QUALITY PROTEIN: dynamin-related protein 3B-like 
[Musa acuminata subsp. malaccensis]
Length=835

 Score =   278 bits (710),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = +2

Query  266  APLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSD  445
             P+GHSVIPIVNKLQDIFAQLGS ST++LPQVAVVGSQSSGKSSVLEALVGRDFLPRG+D
Sbjct  30   GPIGHSVIPIVNKLQDIFAQLGSSSTMDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGTD  89

Query  446  ICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGV  625
            ICTRRPLVLQL+   R+ +    EWGEF HL G++F+DF++IR+EIQAETDREAG NKGV
Sbjct  90   ICTRRPLVLQLIHLPRRSEDGGAEWGEFRHLEGQRFYDFSEIRREIQAETDREAGKNKGV  149

Query  626  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVT  805
            S  QI LKIFSPNVL+ITLVDLPGITKVPVGDQP DIEA IRTMI+SYIK  SC+ILAV+
Sbjct  150  SYNQICLKIFSPNVLNITLVDLPGITKVPVGDQPRDIEASIRTMILSYIKHKSCIILAVS  209

Query  806  PANAD  820
            PANAD
Sbjct  210  PANAD  214



>ref|XP_004485614.1| PREDICTED: dynamin-related protein 3A-like [Cicer arietinum]
Length=824

 Score =   277 bits (708),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 169/183 (92%), Gaps = 4/183 (2%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG  VI +VN+LQDIF+++GSQ+ I LPQVAVVGSQSSGKSSVLEALVGRDFLPRG++IC
Sbjct  22   LGSGVISLVNRLQDIFSRVGSQTAINLPQVAVVGSQSSGKSSVLEALVGRDFLPRGNEIC  81

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQL+   R  +S+DE +GEFLHLPGK+F+DF+DIR+EIQAETDREAG NKGVSD
Sbjct  82   TRRPLVLQLV---RSAESSDE-YGEFLHLPGKRFYDFSDIRREIQAETDREAGDNKGVSD  137

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            +QIRLKI SPNVLD+TLVDLPGITKVPVGDQPSDIEARIRTMIMSYIK PSCLILAVTPA
Sbjct  138  RQIRLKIVSPNVLDMTLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKEPSCLILAVTPA  197

Query  812  NAD  820
            N+D
Sbjct  198  NSD  200



>ref|XP_010437736.1| PREDICTED: dynamin-related protein 3A isoform X1 [Camelina sativa]
 ref|XP_010437737.1| PREDICTED: dynamin-related protein 3A isoform X2 [Camelina sativa]
Length=804

 Score =   276 bits (706),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 169/186 (91%), Gaps = 2/186 (1%)
 Frame = +2

Query  269  PLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDI  448
            PLG SVIPIVNKLQDIFAQLGSQS+I LPQVAVVGSQSSGKSSVLEALVGRDFLPRG+DI
Sbjct  27   PLGSSVIPIVNKLQDIFAQLGSQSSIALPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDI  86

Query  449  CTRRPLVLQLLQTKRKPDS-TDEEWGEFLHLPGK-KFFDFNDIRKEIQAETDREAGGNKG  622
            CTRRPLVLQL+QTKR+ +  +D+EWGEF HLP   + +DF++IR+EI+AET+R  G NKG
Sbjct  87   CTRRPLVLQLVQTKRRSNGGSDDEWGEFRHLPEHTRIYDFSEIRREIEAETNRLVGENKG  146

Query  623  VSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAV  802
            V+DKQIRL I+SPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMI+SYIK  +CLILAV
Sbjct  147  VADKQIRLTIYSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMILSYIKSDTCLILAV  206

Query  803  TPANAD  820
            TPAN D
Sbjct  207  TPANTD  212



>ref|NP_565362.1| dynamin-related protein 3B [Arabidopsis thaliana]
 sp|Q8LFT2.2|DRP3B_ARATH RecName: Full=Dynamin-related protein 3B; AltName: Full=Dynamin-like 
protein 2b [Arabidopsis thaliana]
 gb|AAM15450.1| dynamin-like protein [Arabidopsis thaliana]
 gb|AEC06282.1| dynamin-related protein 3B [Arabidopsis thaliana]
Length=780

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 177/204 (87%), Gaps = 5/204 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            M+ + +P S++++     PLG SVIPIVNKLQDIFAQLGSQSTI LPQVAVVGSQSSGKS
Sbjct  1    MSVDDLPPSSASA---VTPLGSSVIPIVNKLQDIFAQLGSQSTIALPQVAVVGSQSSGKS  57

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDS-TDEEWGEFLHL-PGKKFFDFND  568
            SVLEALVGRDFLPRG+DICTRRPL LQL+QTK   D  +DEEWGEFLH  P ++ +DF++
Sbjct  58   SVLEALVGRDFLPRGNDICTRRPLRLQLVQTKPSSDGGSDEEWGEFLHHDPVRRIYDFSE  117

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EI+AET+R +G NKGVSD  I LKIFSPNVLDI+LVDLPGITKVPVGDQPSDIEARI
Sbjct  118  IRREIEAETNRVSGENKGVSDIPIGLKIFSPNVLDISLVDLPGITKVPVGDQPSDIEARI  177

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            RTMI++YIK PSCLILAV+PAN D
Sbjct  178  RTMILTYIKEPSCLILAVSPANTD  201



>gb|AAM20619.1| dynamin-like protein [Arabidopsis thaliana]
Length=780

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 177/204 (87%), Gaps = 5/204 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            M+ + +P S++++     PLG SVIPIVNKLQDIFAQLGSQSTI LPQVAVVGSQSSGKS
Sbjct  1    MSVDDLPPSSASA---VTPLGSSVIPIVNKLQDIFAQLGSQSTIALPQVAVVGSQSSGKS  57

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDS-TDEEWGEFLHL-PGKKFFDFND  568
            SVLEALVGRDFLPRG+DICTRRPL LQL+QTK   D  +DEEWGEFLH  P ++ +DF++
Sbjct  58   SVLEALVGRDFLPRGNDICTRRPLRLQLVQTKPSSDGGSDEEWGEFLHHDPVRRIYDFSE  117

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EI+AET+R +G NKGVSD  I LKIFSPNVLDI+LVDLPGITKVPVGDQPSDIEARI
Sbjct  118  IRREIEAETNRVSGENKGVSDIPIGLKIFSPNVLDISLVDLPGITKVPVGDQPSDIEARI  177

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            RTMI++YIK PSCLILAV+PAN D
Sbjct  178  RTMILTYIKEPSCLILAVSPANTD  201



>ref|NP_565363.2| dynamin-related protein 3B [Arabidopsis thaliana]
 gb|AEC06283.1| dynamin-related protein 3B [Arabidopsis thaliana]
Length=780

 Score =   272 bits (695),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 177/204 (87%), Gaps = 5/204 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            M+ + +P S++++     PLG SVIPIVNKLQDIFAQLGSQSTI LPQVAVVGSQSSGKS
Sbjct  1    MSVDDLPPSSASA---VTPLGSSVIPIVNKLQDIFAQLGSQSTIALPQVAVVGSQSSGKS  57

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDS-TDEEWGEFLHL-PGKKFFDFND  568
            SVLEALVGRDFLPRG+DICTRRPL LQL+QTK   D  +DEEWGEFLH  P ++ +DF++
Sbjct  58   SVLEALVGRDFLPRGNDICTRRPLRLQLVQTKPSSDGGSDEEWGEFLHHDPVRRIYDFSE  117

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EI+AET+R +G NKGVSD  I LKIFSPNVLDI+LVDLPGITKVPVGDQPSDIEARI
Sbjct  118  IRREIEAETNRVSGENKGVSDIPIGLKIFSPNVLDISLVDLPGITKVPVGDQPSDIEARI  177

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            RTMI++YIK PSCLILAV+PAN D
Sbjct  178  RTMILTYIKEPSCLILAVSPANTD  201



>ref|XP_006845411.1| PREDICTED: dynamin-related protein 3A [Amborella trichopoda]
 gb|ERN07086.1| hypothetical protein AMTR_s00019p00077820 [Amborella trichopoda]
Length=836

 Score =   273 bits (698),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 167/183 (91%), Gaps = 4/183 (2%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG SVIPIVNKLQDIFAQLG  STI+LPQVAVVGSQSSGKSSVLEALVGRDFLPRG++IC
Sbjct  39   LGQSVIPIVNKLQDIFAQLGGNSTIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGNEIC  98

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPLVLQL+   +  DS  +EWGEFLHLP K+F+DF++IR+EI+AETDRE G NKGVSD
Sbjct  99   TRRPLVLQLVHNIK--DS--QEWGEFLHLPKKQFYDFSEIRREIEAETDREVGANKGVSD  154

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            KQIRLK+FSPNVL+ITLVDLPGITKVPVGDQPSDIEA+IRTMI SYIK  +C+ILAV+PA
Sbjct  155  KQIRLKVFSPNVLNITLVDLPGITKVPVGDQPSDIEAQIRTMIQSYIKHETCIILAVSPA  214

Query  812  NAD  820
            N+D
Sbjct  215  NSD  217



>ref|XP_010268467.1| PREDICTED: dynamin-related protein 3A-like isoform X3 [Nelumbo 
nucifera]
Length=766

 Score =   271 bits (694),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 175/207 (85%), Gaps = 5/207 (2%)
 Frame = +2

Query  215  MAEEAVP---SSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLG-SQSTIELPqvavvgsqs  382
            M E+  P   +S+   N   A +G SVIPIVN+LQDIFA LG S   I LPQVAV+GSQS
Sbjct  1    MGEQVNPFDEASSVADNPKTASIGSSVIPIVNRLQDIFAPLGGSFPKINLPQVAVIGSQS  60

Query  383  sgkssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDE-EWGEFLHLPGKKFFD  559
            SGKSSVLEALVGRDFLPRGSDICTRRPLVLQL    R+P++ D+ EWGEFLHLP K+F+D
Sbjct  61   SGKSSVLEALVGRDFLPRGSDICTRRPLVLQLEHRPRRPNTDDDREWGEFLHLPEKRFYD  120

Query  560  FNDIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIE  739
            F+ IR+EIQAET+REAG NKGVSDKQIRLKI SPNVL+ITLVDLPG+TKVPVGDQPSDIE
Sbjct  121  FSAIRREIQAETEREAGTNKGVSDKQIRLKISSPNVLNITLVDLPGMTKVPVGDQPSDIE  180

Query  740  ARIRTMIMSYIKLPSCLILAVTPANAD  820
            ARIRTMIMSYIK  +C+ILAV+PAN+D
Sbjct  181  ARIRTMIMSYIKHETCVILAVSPANSD  207



>ref|XP_006297027.1| hypothetical protein CARUB_v10013019mg [Capsella rubella]
 gb|EOA29925.1| hypothetical protein CARUB_v10013019mg [Capsella rubella]
Length=781

 Score =   272 bits (695),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 169/186 (91%), Gaps = 2/186 (1%)
 Frame = +2

Query  269  PLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDI  448
            PLG SVIPIVNKLQDIFAQLGSQS+I+LPQVAVVGSQSSGKSSVLEALVGRDFLPRG+DI
Sbjct  16   PLGSSVIPIVNKLQDIFAQLGSQSSIKLPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDI  75

Query  449  CTRRPLVLQLLQTK-RKPDSTDEEWGEFLHLP-GKKFFDFNDIRKEIQAETDREAGGNKG  622
            CTRRPL+LQL+QTK R    +DEEWGEFLH   GK+ +DF++IR+EI+AET+R +G NK 
Sbjct  76   CTRRPLLLQLVQTKPRSEGGSDEEWGEFLHHEVGKRIYDFSEIRREIEAETNRVSGVNKD  135

Query  623  VSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAV  802
            V+D  IRLKI+SPNVLDI+LVDLPGITKVPVGDQP+DIEARIRTMI+SYIK  SCLILAV
Sbjct  136  VTDNPIRLKIYSPNVLDISLVDLPGITKVPVGDQPTDIEARIRTMILSYIKESSCLILAV  195

Query  803  TPANAD  820
            TPAN+D
Sbjct  196  TPANSD  201



>ref|XP_010268464.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Nelumbo 
nucifera]
Length=811

 Score =   272 bits (695),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 175/207 (85%), Gaps = 5/207 (2%)
 Frame = +2

Query  215  MAEEAVP---SSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLG-SQSTIELPqvavvgsqs  382
            M E+  P   +S+   N   A +G SVIPIVN+LQDIFA LG S   I LPQVAV+GSQS
Sbjct  1    MGEQVNPFDEASSVADNPKTASIGSSVIPIVNRLQDIFAPLGGSFPKINLPQVAVIGSQS  60

Query  383  sgkssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDE-EWGEFLHLPGKKFFD  559
            SGKSSVLEALVGRDFLPRGSDICTRRPLVLQL    R+P++ D+ EWGEFLHLP K+F+D
Sbjct  61   SGKSSVLEALVGRDFLPRGSDICTRRPLVLQLEHRPRRPNTDDDREWGEFLHLPEKRFYD  120

Query  560  FNDIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIE  739
            F+ IR+EIQAET+REAG NKGVSDKQIRLKI SPNVL+ITLVDLPG+TKVPVGDQPSDIE
Sbjct  121  FSAIRREIQAETEREAGTNKGVSDKQIRLKISSPNVLNITLVDLPGMTKVPVGDQPSDIE  180

Query  740  ARIRTMIMSYIKLPSCLILAVTPANAD  820
            ARIRTMIMSYIK  +C+ILAV+PAN+D
Sbjct  181  ARIRTMIMSYIKHETCVILAVSPANSD  207



>ref|NP_001154516.1| dynamin-related protein 3B [Arabidopsis thaliana]
 gb|AEC06284.1| dynamin-related protein 3B [Arabidopsis thaliana]
Length=809

 Score =   272 bits (695),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 177/204 (87%), Gaps = 5/204 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            M+ + +P S++++     PLG SVIPIVNKLQDIFAQLGSQSTI LPQVAVVGSQSSGKS
Sbjct  1    MSVDDLPPSSASA---VTPLGSSVIPIVNKLQDIFAQLGSQSTIALPQVAVVGSQSSGKS  57

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDS-TDEEWGEFLHL-PGKKFFDFND  568
            SVLEALVGRDFLPRG+DICTRRPL LQL+QTK   D  +DEEWGEFLH  P ++ +DF++
Sbjct  58   SVLEALVGRDFLPRGNDICTRRPLRLQLVQTKPSSDGGSDEEWGEFLHHDPVRRIYDFSE  117

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EI+AET+R +G NKGVSD  I LKIFSPNVLDI+LVDLPGITKVPVGDQPSDIEARI
Sbjct  118  IRREIEAETNRVSGENKGVSDIPIGLKIFSPNVLDISLVDLPGITKVPVGDQPSDIEARI  177

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            RTMI++YIK PSCLILAV+PAN D
Sbjct  178  RTMILTYIKEPSCLILAVSPANTD  201



>ref|XP_002974698.1| hypothetical protein SELMODRAFT_101670 [Selaginella moellendorffii]
 gb|EFJ24218.1| hypothetical protein SELMODRAFT_101670 [Selaginella moellendorffii]
Length=800

 Score =   271 bits (694),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 166/186 (89%), Gaps = 1/186 (1%)
 Frame = +2

Query  266  APLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSD  445
            A LG SVIPI+NKLQDIFAQLGS ST++LPQV+VVGSQSSGKSSV+EALVGRDFLPRG D
Sbjct  28   AFLGQSVIPIMNKLQDIFAQLGSPSTVDLPQVSVVGSQSSGKSSVMEALVGRDFLPRGPD  87

Query  446  ICTRRPLVLQLLQTKRKPDSTD-EEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKG  622
            ICTRRPLVLQL+  +RK D  +  EWGEFLHLPG++F DF+ IRKEIQAET+RE G  KG
Sbjct  88   ICTRRPLVLQLVHVQRKMDDREVSEWGEFLHLPGRRFTDFSHIRKEIQAETERELGDKKG  147

Query  623  VSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAV  802
            VSDKQIRLKIFSPNVL+ITLVDLPG+T+VPVGDQPSDIE+RIR MI+SYIK  +C+ILAV
Sbjct  148  VSDKQIRLKIFSPNVLNITLVDLPGLTRVPVGDQPSDIESRIRAMILSYIKHATCIILAV  207

Query  803  TPANAD  820
            +PAN D
Sbjct  208  SPANTD  213



>ref|XP_010268466.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Nelumbo 
nucifera]
Length=806

 Score =   272 bits (695),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 175/207 (85%), Gaps = 5/207 (2%)
 Frame = +2

Query  215  MAEEAVP---SSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLG-SQSTIELPqvavvgsqs  382
            M E+  P   +S+   N   A +G SVIPIVN+LQDIFA LG S   I LPQVAV+GSQS
Sbjct  1    MGEQVNPFDEASSVADNPKTASIGSSVIPIVNRLQDIFAPLGGSFPKINLPQVAVIGSQS  60

Query  383  sgkssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDE-EWGEFLHLPGKKFFD  559
            SGKSSVLEALVGRDFLPRGSDICTRRPLVLQL    R+P++ D+ EWGEFLHLP K+F+D
Sbjct  61   SGKSSVLEALVGRDFLPRGSDICTRRPLVLQLEHRPRRPNTDDDREWGEFLHLPEKRFYD  120

Query  560  FNDIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIE  739
            F+ IR+EIQAET+REAG NKGVSDKQIRLKI SPNVL+ITLVDLPG+TKVPVGDQPSDIE
Sbjct  121  FSAIRREIQAETEREAGTNKGVSDKQIRLKISSPNVLNITLVDLPGMTKVPVGDQPSDIE  180

Query  740  ARIRTMIMSYIKLPSCLILAVTPANAD  820
            ARIRTMIMSYIK  +C+ILAV+PAN+D
Sbjct  181  ARIRTMIMSYIKHETCVILAVSPANSD  207



>dbj|BAB85645.1| dynamin like protein 2b [Arabidopsis thaliana]
Length=780

 Score =   271 bits (692),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 176/204 (86%), Gaps = 5/204 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            M+ + +P S++++     PLG SVIPIVNKLQDIFAQLGSQSTI LPQVAVVGSQSSGKS
Sbjct  1    MSVDDLPPSSASA---VTPLGSSVIPIVNKLQDIFAQLGSQSTIALPQVAVVGSQSSGKS  57

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDST-DEEWGEFLHL-PGKKFFDFND  568
            SVLEALVGRDFLPRG+DICTRRPL LQL+QTK   D   DEEWGEFLH  P ++ +DF++
Sbjct  58   SVLEALVGRDFLPRGNDICTRRPLRLQLVQTKPSSDGGPDEEWGEFLHHDPVRRIYDFSE  117

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EI+AET+R +G NKGVSD  I LKIFSPNVLDI+LVDLPGITKVPVGDQPSDIEARI
Sbjct  118  IRREIEAETNRVSGENKGVSDIPIGLKIFSPNVLDISLVDLPGITKVPVGDQPSDIEARI  177

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            RTMI++YIK PSCLILAV+PAN D
Sbjct  178  RTMILTYIKEPSCLILAVSPANTD  201



>ref|XP_002885904.1| hypothetical protein ARALYDRAFT_480333 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62163.1| hypothetical protein ARALYDRAFT_480333 [Arabidopsis lyrata subsp. 
lyrata]
Length=776

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 167/186 (90%), Gaps = 2/186 (1%)
 Frame = +2

Query  269  PLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDI  448
            PLG SVIPIVNKLQDIFAQLGSQSTI LPQVAVVGSQSSGKSSVLEALVGRDFLPRG+DI
Sbjct  16   PLGSSVIPIVNKLQDIFAQLGSQSTIALPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDI  75

Query  449  CTRRPLVLQLLQTKRKPDS-TDEEWGEFLHL-PGKKFFDFNDIRKEIQAETDREAGGNKG  622
            CTRRPL LQL+QTK + D  +DEEWGEFLH  P K+ +DF++IR+EI+AET+R +G NKG
Sbjct  76   CTRRPLRLQLVQTKPRSDGGSDEEWGEFLHHDPVKRIYDFSEIRREIEAETNRVSGENKG  135

Query  623  VSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAV  802
            VSD  I LKIFSPNVLDI+LVDLPGITKVPVGDQP+DIEARIRTMI++YIK  SCLILAV
Sbjct  136  VSDIPIGLKIFSPNVLDISLVDLPGITKVPVGDQPTDIEARIRTMILTYIKESSCLILAV  195

Query  803  TPANAD  820
            TPAN D
Sbjct  196  TPANTD  201



>gb|KDP33489.1| hypothetical protein JCGZ_07060 [Jatropha curcas]
Length=306

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 164/206 (80%), Gaps = 10/206 (5%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAP---LGHSVIPIVNKLQDIFAQLGSQST-IELPqvavvgsqs  382
            M EEA P      N N  P   +G SVIPI+NKLQDI A +G + T I LPQVAVVGSQS
Sbjct  1    MGEEANP------NGNVKPVLTIGSSVIPIINKLQDIIAPVGDELTKISLPQVAVVGSQS  54

Query  383  sgkssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDF  562
            SGKSSVLEALVGRDFLPRG DICTRRPLVL L    R PD    EWGEF HLPGK+F+DF
Sbjct  55   SGKSSVLEALVGRDFLPRGCDICTRRPLVLMLENRPRTPDDDGSEWGEFRHLPGKRFYDF  114

Query  563  NDIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEA  742
            + IR+EIQAET+REAG NKGVSDKQIRLKI SPNVLD+TLVDLPGITKVPVGDQP DIE 
Sbjct  115  SRIRREIQAETEREAGLNKGVSDKQIRLKISSPNVLDMTLVDLPGITKVPVGDQPKDIET  174

Query  743  RIRTMIMSYIKLPSCLILAVTPANAD  820
            RIR MIM++I   +C+ILAVTPAN+D
Sbjct  175  RIRKMIMAHITQENCIILAVTPANSD  200



>ref|XP_001766173.1| predicted protein [Physcomitrella patens]
 gb|EDQ69022.1| predicted protein [Physcomitrella patens]
Length=778

 Score =   268 bits (685),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 166/185 (90%), Gaps = 2/185 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG SVIP+VNKLQDI  QLGS STI+LPQVAVVGSQSSGKSSVLEALVG+DFLPR SDIC
Sbjct  26   LGQSVIPLVNKLQDILCQLGSASTIDLPQVAVVGSQSSGKSSVLEALVGKDFLPRSSDIC  85

Query  452  TRRPLVLQLLQTKRKPDSTDE--EWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGV  625
            TRRPLVLQL+QT R+ D   E  EWGEFLH+PG++F +F+ IRKEIQ ET+R+ G NKG+
Sbjct  86   TRRPLVLQLVQTLRRSDEKSELVEWGEFLHIPGRQFTNFSAIRKEIQLETERDMGTNKGI  145

Query  626  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVT  805
            S+KQIRLKIFSP+VL+ITLVDLPGITKVPVGDQP+DIEAR+RTMI+SYIK  +C+ILAV+
Sbjct  146  SEKQIRLKIFSPDVLNITLVDLPGITKVPVGDQPTDIEARVRTMILSYIKHKTCIILAVS  205

Query  806  PANAD  820
            PANAD
Sbjct  206  PANAD  210



>ref|XP_010239800.1| PREDICTED: dynamin-related protein 3A-like isoform X4 [Brachypodium 
distachyon]
Length=449

 Score =   254 bits (650),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 159/185 (86%), Gaps = 7/185 (4%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQST--IELPqvavvgsqssgkssvLEALVGRDFLPRGSD  445
            +G +VIP+VN+LQDI A+L   +   +ELPQVA +G QSSGKSSVLEALVGRDFLPRG D
Sbjct  15   VGQAVIPLVNRLQDIMARLDGDAAAGVELPQVAAIGGQSSGKSSVLEALVGRDFLPRGPD  74

Query  446  ICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGV  625
            ICTRRPLVLQL++      S  EEWGEFLH PG++F DF  I++EIQ+ETD+EAGGNKGV
Sbjct  75   ICTRRPLVLQLVR-----HSAPEEWGEFLHAPGRRFHDFEHIKREIQSETDKEAGGNKGV  129

Query  626  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVT  805
            S+KQIRLKIFSPNV+DITLVDLPGIT+VPVGDQP+DIE+RIRTMIM YIK  SC+ILAV+
Sbjct  130  SEKQIRLKIFSPNVIDITLVDLPGITRVPVGDQPTDIESRIRTMIMQYIKHRSCIILAVS  189

Query  806  PANAD  820
            PANAD
Sbjct  190  PANAD  194



>ref|XP_010680388.1| PREDICTED: dynamin-related protein 3B-like [Beta vulgaris subsp. 
vulgaris]
Length=785

 Score =   263 bits (671),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  263  AAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGS  442
            A+ LGH++IP+VNKLQDI ++ G    I+LPQVAVVGSQSSGKSSV+EALVGRDFLPRG+
Sbjct  19   ASSLGHTLIPVVNKLQDICSKSGVSVPIDLPQVAVVGSQSSGKSSVIEALVGRDFLPRGT  78

Query  443  DICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKG  622
             + TRRPLVLQL++T     ++  E+GEFLHLP KKF+DF++IRKEIQAET+REAG N+G
Sbjct  79   GVVTRRPLVLQLIRTNNSNGNSGLEYGEFLHLPAKKFYDFSEIRKEIQAETEREAGANRG  138

Query  623  VSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAV  802
            +S+  IRLKI+SPNVLDITL+DLPGIT+VPVGDQPSDIEARIRTMIM YI+ PSCLILAV
Sbjct  139  ISETTIRLKIYSPNVLDITLIDLPGITRVPVGDQPSDIEARIRTMIMKYIRHPSCLILAV  198

Query  803  TPANAD  820
            TPAN+D
Sbjct  199  TPANSD  204



>dbj|BAK03569.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=771

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 161/187 (86%), Gaps = 7/187 (4%)
 Frame = +2

Query  266  APLGHSVIPIVNKLQDIFAQLGSQST--IELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            A +G +VIP+VN+LQDI A+L   +   +ELPQVA +G QSSGKSSVLEALVGRDFLPRG
Sbjct  16   ATVGQAVIPLVNRLQDIMARLDGDAAAGVELPQVAAIGGQSSGKSSVLEALVGRDFLPRG  75

Query  440  SDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNK  619
             +ICTRRPLVLQL++      S  EEWGEFLH PG++F DF  I++EIQ+ETD+EAGGNK
Sbjct  76   PEICTRRPLVLQLVR-----HSAPEEWGEFLHAPGRRFDDFEHIKREIQSETDKEAGGNK  130

Query  620  GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILA  799
            GVSDKQIRLKIFSPNV+DITLVDLPGIT+VPVGDQPSDIE+RIRTMIM YIK PSC+ILA
Sbjct  131  GVSDKQIRLKIFSPNVIDITLVDLPGITRVPVGDQPSDIESRIRTMIMQYIKHPSCIILA  190

Query  800  VTPANAD  820
            V+PANAD
Sbjct  191  VSPANAD  197



>ref|XP_012076390.1| PREDICTED: dynamin-related protein 3A-like [Jatropha curcas]
Length=747

 Score =   258 bits (660),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 164/206 (80%), Gaps = 10/206 (5%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAP---LGHSVIPIVNKLQDIFAQLGSQST-IELPqvavvgsqs  382
            M EEA P      N N  P   +G SVIPI+NKLQDI A +G + T I LPQVAVVGSQS
Sbjct  1    MGEEANP------NGNVKPVLTIGSSVIPIINKLQDIIAPVGDELTKISLPQVAVVGSQS  54

Query  383  sgkssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDF  562
            SGKSSVLEALVGRDFLPRG DICTRRPLVL L    R PD    EWGEF HLPGK+F+DF
Sbjct  55   SGKSSVLEALVGRDFLPRGCDICTRRPLVLMLENRPRTPDDDGSEWGEFRHLPGKRFYDF  114

Query  563  NDIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEA  742
            + IR+EIQAET+REAG NKGVSDKQIRLKI SPNVLD+TLVDLPGITKVPVGDQP DIE 
Sbjct  115  SRIRREIQAETEREAGLNKGVSDKQIRLKISSPNVLDMTLVDLPGITKVPVGDQPKDIET  174

Query  743  RIRTMIMSYIKLPSCLILAVTPANAD  820
            RIR MIM++I   +C+ILAVTPAN+D
Sbjct  175  RIRKMIMAHITQENCIILAVTPANSD  200



>emb|CAE02157.2| OSJNBa0072D21.2 [Oryza sativa Japonica Group]
Length=800

 Score =   258 bits (659),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 158/185 (85%), Gaps = 7/185 (4%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQST--IELPqvavvgsqssgkssvLEALVGRDFLPRGSD  445
            +G +VIP+VN+LQDI A+L       +ELPQVA +G QSSGKSSVLEALVGRDFLPRG D
Sbjct  17   VGQAVIPLVNRLQDIVARLDGGGGGGLELPQVAAIGGQSSGKSSVLEALVGRDFLPRGPD  76

Query  446  ICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGV  625
            ICTRRPLVLQL++      S  EEWGEFLH P ++F DF+ I++EIQ ETD+EAGGNKGV
Sbjct  77   ICTRRPLVLQLVR-----HSAPEEWGEFLHAPARRFHDFDQIKREIQLETDKEAGGNKGV  131

Query  626  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVT  805
            S+KQIRLKIFSPNVLDITLVDLPGIT+VPVGDQPSDIE+RIR+MIM YIK PSC+ILAVT
Sbjct  132  SEKQIRLKIFSPNVLDITLVDLPGITRVPVGDQPSDIESRIRSMIMQYIKHPSCIILAVT  191

Query  806  PANAD  820
            PANAD
Sbjct  192  PANAD  196



>ref|NP_001052600.1| Os04g0381000 [Oryza sativa Japonica Group]
 dbj|BAF14514.1| Os04g0381000 [Oryza sativa Japonica Group]
 dbj|BAG97247.1| unnamed protein product [Oryza sativa Japonica Group]
Length=797

 Score =   258 bits (659),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 158/185 (85%), Gaps = 7/185 (4%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQST--IELPqvavvgsqssgkssvLEALVGRDFLPRGSD  445
            +G +VIP+VN+LQDI A+L       +ELPQVA +G QSSGKSSVLEALVGRDFLPRG D
Sbjct  17   VGQAVIPLVNRLQDIVARLDGGGGGGLELPQVAAIGGQSSGKSSVLEALVGRDFLPRGPD  76

Query  446  ICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGV  625
            ICTRRPLVLQL++      S  EEWGEFLH P ++F DF+ I++EIQ ETD+EAGGNKGV
Sbjct  77   ICTRRPLVLQLVR-----HSAPEEWGEFLHAPARRFHDFDQIKREIQLETDKEAGGNKGV  131

Query  626  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVT  805
            S+KQIRLKIFSPNVLDITLVDLPGIT+VPVGDQPSDIE+RIR+MIM YIK PSC+ILAVT
Sbjct  132  SEKQIRLKIFSPNVLDITLVDLPGITRVPVGDQPSDIESRIRSMIMQYIKHPSCIILAVT  191

Query  806  PANAD  820
            PANAD
Sbjct  192  PANAD  196



>ref|XP_010239797.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Brachypodium 
distachyon]
Length=769

 Score =   257 bits (657),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 159/185 (86%), Gaps = 7/185 (4%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQST--IELPqvavvgsqssgkssvLEALVGRDFLPRGSD  445
            +G +VIP+VN+LQDI A+L   +   +ELPQVA +G QSSGKSSVLEALVGRDFLPRG D
Sbjct  15   VGQAVIPLVNRLQDIMARLDGDAAAGVELPQVAAIGGQSSGKSSVLEALVGRDFLPRGPD  74

Query  446  ICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGV  625
            ICTRRPLVLQL++      S  EEWGEFLH PG++F DF  I++EIQ+ETD+EAGGNKGV
Sbjct  75   ICTRRPLVLQLVR-----HSAPEEWGEFLHAPGRRFHDFEHIKREIQSETDKEAGGNKGV  129

Query  626  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVT  805
            S+KQIRLKIFSPNV+DITLVDLPGIT+VPVGDQP+DIE+RIRTMIM YIK  SC+ILAV+
Sbjct  130  SEKQIRLKIFSPNVIDITLVDLPGITRVPVGDQPTDIESRIRTMIMQYIKHRSCIILAVS  189

Query  806  PANAD  820
            PANAD
Sbjct  190  PANAD  194



>ref|XP_010239796.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Brachypodium 
distachyon]
Length=772

 Score =   257 bits (657),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 159/185 (86%), Gaps = 7/185 (4%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQST--IELPqvavvgsqssgkssvLEALVGRDFLPRGSD  445
            +G +VIP+VN+LQDI A+L   +   +ELPQVA +G QSSGKSSVLEALVGRDFLPRG D
Sbjct  15   VGQAVIPLVNRLQDIMARLDGDAAAGVELPQVAAIGGQSSGKSSVLEALVGRDFLPRGPD  74

Query  446  ICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGV  625
            ICTRRPLVLQL++      S  EEWGEFLH PG++F DF  I++EIQ+ETD+EAGGNKGV
Sbjct  75   ICTRRPLVLQLVR-----HSAPEEWGEFLHAPGRRFHDFEHIKREIQSETDKEAGGNKGV  129

Query  626  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVT  805
            S+KQIRLKIFSPNV+DITLVDLPGIT+VPVGDQP+DIE+RIRTMIM YIK  SC+ILAV+
Sbjct  130  SEKQIRLKIFSPNVIDITLVDLPGITRVPVGDQPTDIESRIRTMIMQYIKHRSCIILAVS  189

Query  806  PANAD  820
            PANAD
Sbjct  190  PANAD  194



>ref|XP_004977934.1| PREDICTED: dynamin-related protein 3A-like [Setaria italica]
Length=735

 Score =   256 bits (654),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 157/185 (85%), Gaps = 7/185 (4%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQST--IELPqvavvgsqssgkssvLEALVGRDFLPRGSD  445
            +G +VIP+VN LQDI A+L   +   +ELPQVA +G QSSGKSSVLEALVGRDFLPRG D
Sbjct  15   VGQAVIPLVNSLQDIIARLDGDAAAGLELPQVAAIGGQSSGKSSVLEALVGRDFLPRGPD  74

Query  446  ICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGV  625
            ICTRRPLVLQL++      S  EEWGEFLH PG++F DF  I++EIQ ETD+EAG NKGV
Sbjct  75   ICTRRPLVLQLVR-----HSAPEEWGEFLHAPGRRFHDFEQIKREIQLETDKEAGDNKGV  129

Query  626  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVT  805
            S+KQIRLKIFSPNVLDITLVDLPGIT+VPVGDQPSDIE+RIRTMIM YIK PSC+ILAV+
Sbjct  130  SEKQIRLKIFSPNVLDITLVDLPGITRVPVGDQPSDIESRIRTMIMQYIKHPSCIILAVS  189

Query  806  PANAD  820
            PANAD
Sbjct  190  PANAD  194



>ref|XP_004291982.1| PREDICTED: dynamin-related protein 3A-like [Fragaria vesca subsp. 
vesca]
Length=762

 Score =   254 bits (650),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 164/199 (82%), Gaps = 8/199 (4%)
 Frame = +2

Query  224  EAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvL  403
            EAV    S+S      +G S+IPI+NKLQDI A +   S I LPQVAVVGSQSSGKSSVL
Sbjct  3    EAVDCEASSS----VTIGSSLIPIINKLQDILAPVAVGSEISLPQVAVVGSQSSGKSSVL  58

Query  404  EALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEI  583
            EALVGRDFLPRG DICTRRPLVL L   + +P + D +W EF HLPGK+F+DF  IR+EI
Sbjct  59   EALVGRDFLPRGCDICTRRPLVLML---ENRP-AGDSDWAEFRHLPGKRFYDFTMIRREI  114

Query  584  QAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIM  763
            QAETDREAG NKGVSDKQIRLKI SPNVL++TLVDLPGITKVPVGDQPSDIE+RIR MIM
Sbjct  115  QAETDREAGLNKGVSDKQIRLKISSPNVLNMTLVDLPGITKVPVGDQPSDIESRIRKMIM  174

Query  764  SYIKLPSCLILAVTPANAD  820
            S+I+ P+C+ILAVTPANAD
Sbjct  175  SHIRQPNCIILAVTPANAD  193



>ref|XP_007226406.1| hypothetical protein PRUPE_ppa023178mg, partial [Prunus persica]
 gb|EMJ27605.1| hypothetical protein PRUPE_ppa023178mg, partial [Prunus persica]
Length=709

 Score =   252 bits (643),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 163/202 (81%), Gaps = 0/202 (0%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            M E       S+S+  +  +G S+IP++NKLQDI AQ GS+  + LPQVAVVGSQSSGKS
Sbjct  1    MGELDARHVDSSSSRPSVTIGSSLIPVINKLQDILAQAGSELDVSLPQVAVVGSQSSGKS  60

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLEALVGRDFLPRG DICTRRPLVL L     KP     EWGEF HLP K+F+DF++IR
Sbjct  61   SVLEALVGRDFLPRGCDICTRRPLVLMLENRLPKPGDDRTEWGEFRHLPEKRFYDFSEIR  120

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRT  754
             EIQAET+REAG NKGVSDKQIRLKI SPNVL++TLVDLPGITKVPVGDQP+DIEARIR 
Sbjct  121  AEIQAETEREAGLNKGVSDKQIRLKITSPNVLNMTLVDLPGITKVPVGDQPNDIEARIRK  180

Query  755  MIMSYIKLPSCLILAVTPANAD  820
            M+M++I   +C+ILAVTPAN+D
Sbjct  181  MVMTHISQQNCIILAVTPANSD  202



>ref|XP_008220636.1| PREDICTED: dynamin-related protein 3A-like [Prunus mume]
Length=789

 Score =   253 bits (645),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = +2

Query  242  TSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGR  421
            TS+S+  +  +G S+IP++NKLQDI AQ GS+  + LPQVA VGSQSSGKSSVLEALVGR
Sbjct  14   TSSSSRPSVTIGSSLIPVINKLQDILAQAGSELDVSLPQVAGVGSQSSGKSSVLEALVGR  73

Query  422  DFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDR  601
            DFLPRG DICTRRPLVL L     KP     EWGEF HLP K+F+DF++IR EIQAET+R
Sbjct  74   DFLPRGCDICTRRPLVLMLENRLPKPGDDRTEWGEFRHLPEKRFYDFSEIRAEIQAETER  133

Query  602  EAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLP  781
            EAG NKGVS+KQIRLKI SPNVL++TLVDLPGITKVPVGDQP+DIEARIR M+M++I   
Sbjct  134  EAGLNKGVSEKQIRLKITSPNVLNMTLVDLPGITKVPVGDQPNDIEARIRKMVMTHISQQ  193

Query  782  SCLILAVTPANAD  820
            +C+ILAVTPAN+D
Sbjct  194  NCIILAVTPANSD  206



>ref|XP_007011680.1| Dynamin-related protein 3A isoform 4 [Theobroma cacao]
 gb|EOY29299.1| Dynamin-related protein 3A isoform 4 [Theobroma cacao]
Length=635

 Score =   249 bits (636),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 161/186 (87%), Gaps = 5/186 (3%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQ-STIELPqvavvgsqssgkssvLEALVGRDFLPRGSDI  448
            +G S+IP++NKLQDI A  G++ S I +PQVAVVGSQSSGKSSVLEALVGRDFLPRG DI
Sbjct  23   IGSSLIPVINKLQDILASSGTELSDISVPQVAVVGSQSSGKSSVLEALVGRDFLPRGCDI  82

Query  449  CTRRPLVLQLLQTKRKPDSTDE--EWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKG  622
            CTRRPLVL L    R P+S DE  EWGEF HLPG++F+DF+ IR+EIQAET+REAG NKG
Sbjct  83   CTRRPLVLML--ENRPPNSGDESSEWGEFRHLPGRRFYDFSQIRREIQAETEREAGCNKG  140

Query  623  VSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAV  802
            VS+ QIRLKI+SPNVL++TL+DLPGITKVPVGDQPSDIEARIR M+M+YI   +C+ILAV
Sbjct  141  VSESQIRLKIYSPNVLNMTLIDLPGITKVPVGDQPSDIEARIRKMLMAYITNENCIILAV  200

Query  803  TPANAD  820
            +PAN+D
Sbjct  201  SPANSD  206



>ref|XP_006450243.1| hypothetical protein CICLE_v10010730mg [Citrus clementina]
 gb|ESR63483.1| hypothetical protein CICLE_v10010730mg [Citrus clementina]
Length=617

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 164/206 (80%), Gaps = 9/206 (4%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAP---LGHSVIPIVNKLQDIFAQL-GSQSTIELPqvavvgsqs  382
            M EEA     S SN N A    +G SVIPI+N+LQDIF+ + G  S I LPQVAVVGSQS
Sbjct  1    MGEEA-----SFSNKNVAASTTIGSSVIPIINRLQDIFSPVDGELSKISLPQVAVVGSQS  55

Query  383  sgkssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDF  562
            SGKSSVLEALVGRDFLPRG DICTRRPL L L+   R P     EW EF HLPGK+FFDF
Sbjct  56   SGKSSVLEALVGRDFLPRGCDICTRRPLALMLVNRPRNPGDDGREWAEFRHLPGKRFFDF  115

Query  563  NDIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEA  742
            + +R+EI AET++EAG N+GVS+KQI LKI SPNVL++TLVDLPGITKVPVGDQP+DIEA
Sbjct  116  SKVRQEIMAETNKEAGSNRGVSEKQIGLKISSPNVLNMTLVDLPGITKVPVGDQPTDIEA  175

Query  743  RIRTMIMSYIKLPSCLILAVTPANAD  820
            RIR MIM+YI+  +C+ILAV+PAN+D
Sbjct  176  RIRKMIMAYIRQENCIILAVSPANSD  201



>ref|XP_007011679.1| Dynamin-related protein 3A isoform 3 [Theobroma cacao]
 gb|EOY29298.1| Dynamin-related protein 3A isoform 3 [Theobroma cacao]
Length=683

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 161/186 (87%), Gaps = 5/186 (3%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQ-STIELPqvavvgsqssgkssvLEALVGRDFLPRGSDI  448
            +G S+IP++NKLQDI A  G++ S I +PQVAVVGSQSSGKSSVLEALVGRDFLPRG DI
Sbjct  23   IGSSLIPVINKLQDILASSGTELSDISVPQVAVVGSQSSGKSSVLEALVGRDFLPRGCDI  82

Query  449  CTRRPLVLQLLQTKRKPDSTDE--EWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKG  622
            CTRRPLVL L    R P+S DE  EWGEF HLPG++F+DF+ IR+EIQAET+REAG NKG
Sbjct  83   CTRRPLVLML--ENRPPNSGDESSEWGEFRHLPGRRFYDFSQIRREIQAETEREAGCNKG  140

Query  623  VSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAV  802
            VS+ QIRLKI+SPNVL++TL+DLPGITKVPVGDQPSDIEARIR M+M+YI   +C+ILAV
Sbjct  141  VSESQIRLKIYSPNVLNMTLIDLPGITKVPVGDQPSDIEARIRKMLMAYITNENCIILAV  200

Query  803  TPANAD  820
            +PAN+D
Sbjct  201  SPANSD  206



>gb|KJB55125.1| hypothetical protein B456_009G064100 [Gossypium raimondii]
Length=596

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 168/207 (81%), Gaps = 7/207 (3%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLN--AAPLGHSVIPIVNKLQDIFAQLGSQ-STIELPqvavvgsqss  385
            M +EAV  +   S L    A +G S+IP++NKL DI A  G++ S I +PQVAVVGSQSS
Sbjct  1    MMDEAVNPNNKMSTLTKTVATIGSSLIPVINKLHDILASSGTELSDISVPQVAVVGSQSS  60

Query  386  gkssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDE--EWGEFLHLPGKKFFD  559
            GKSSVLEALVGRDFLPRG DICTRRPLVL L    R P+S D+  EWGEF HLPG++F+D
Sbjct  61   GKSSVLEALVGRDFLPRGCDICTRRPLVLML--ENRSPNSDDDRIEWGEFRHLPGRRFYD  118

Query  560  FNDIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIE  739
            F+ IR+EI+AET+REAG NKGVS+ QIRLKI SPNVL++TL+DLPGITKVPVGDQPSDIE
Sbjct  119  FSQIRREIEAETEREAGCNKGVSENQIRLKISSPNVLNMTLIDLPGITKVPVGDQPSDIE  178

Query  740  ARIRTMIMSYIKLPSCLILAVTPANAD  820
            ARIR MIM++I   +C+ILAV+PAN+D
Sbjct  179  ARIRRMIMAHINNENCIILAVSPANSD  205



>ref|XP_006483516.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Citrus 
sinensis]
Length=706

 Score =   248 bits (633),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 163/206 (79%), Gaps = 9/206 (4%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAP---LGHSVIPIVNKLQDIFAQL-GSQSTIELPqvavvgsqs  382
            M EEA     S SN N A    +G SVIPI+N+LQDIF+ + G  S I LPQVAVVGSQS
Sbjct  1    MGEEA-----SFSNKNVAASTTIGSSVIPIINRLQDIFSPVDGELSKISLPQVAVVGSQS  55

Query  383  sgkssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDF  562
            SGKSSVLEALVGRDFLPRG DICTRRPL L L+   R P     EW EF HLPGK+FFDF
Sbjct  56   SGKSSVLEALVGRDFLPRGCDICTRRPLALMLVNRPRNPGDDGREWAEFRHLPGKRFFDF  115

Query  563  NDIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEA  742
              +R+EI AET++EAG N+GVS+KQI LKI SPNVL++TLVDLPGITKVPVGDQP+DIEA
Sbjct  116  TKVRQEIMAETNKEAGSNRGVSEKQIGLKISSPNVLNMTLVDLPGITKVPVGDQPTDIEA  175

Query  743  RIRTMIMSYIKLPSCLILAVTPANAD  820
            RIR MIM+YI+  +C+ILAV+PAN+D
Sbjct  176  RIRKMIMAYIRQENCIILAVSPANSD  201



>ref|XP_007011678.1| Dynamin-related protein 3A isoform 2 [Theobroma cacao]
 gb|EOY29297.1| Dynamin-related protein 3A isoform 2 [Theobroma cacao]
Length=801

 Score =   249 bits (637),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 161/186 (87%), Gaps = 5/186 (3%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQ-STIELPqvavvgsqssgkssvLEALVGRDFLPRGSDI  448
            +G S+IP++NKLQDI A  G++ S I +PQVAVVGSQSSGKSSVLEALVGRDFLPRG DI
Sbjct  23   IGSSLIPVINKLQDILASSGTELSDISVPQVAVVGSQSSGKSSVLEALVGRDFLPRGCDI  82

Query  449  CTRRPLVLQLLQTKRKPDSTDE--EWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKG  622
            CTRRPLVL L    R P+S DE  EWGEF HLPG++F+DF+ IR+EIQAET+REAG NKG
Sbjct  83   CTRRPLVLML--ENRPPNSGDESSEWGEFRHLPGRRFYDFSQIRREIQAETEREAGCNKG  140

Query  623  VSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAV  802
            VS+ QIRLKI+SPNVL++TL+DLPGITKVPVGDQPSDIEARIR M+M+YI   +C+ILAV
Sbjct  141  VSESQIRLKIYSPNVLNMTLIDLPGITKVPVGDQPSDIEARIRKMLMAYITNENCIILAV  200

Query  803  TPANAD  820
            +PAN+D
Sbjct  201  SPANSD  206



>ref|XP_006483515.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Citrus 
sinensis]
Length=728

 Score =   248 bits (633),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 163/206 (79%), Gaps = 9/206 (4%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAP---LGHSVIPIVNKLQDIFAQL-GSQSTIELPqvavvgsqs  382
            M EEA     S SN N A    +G SVIPI+N+LQDIF+ + G  S I LPQVAVVGSQS
Sbjct  1    MGEEA-----SFSNKNVAASTTIGSSVIPIINRLQDIFSPVDGELSKISLPQVAVVGSQS  55

Query  383  sgkssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDF  562
            SGKSSVLEALVGRDFLPRG DICTRRPL L L+   R P     EW EF HLPGK+FFDF
Sbjct  56   SGKSSVLEALVGRDFLPRGCDICTRRPLALMLVNRPRNPGDDGREWAEFRHLPGKRFFDF  115

Query  563  NDIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEA  742
              +R+EI AET++EAG N+GVS+KQI LKI SPNVL++TLVDLPGITKVPVGDQP+DIEA
Sbjct  116  TKVRQEIMAETNKEAGSNRGVSEKQIGLKISSPNVLNMTLVDLPGITKVPVGDQPTDIEA  175

Query  743  RIRTMIMSYIKLPSCLILAVTPANAD  820
            RIR MIM+YI+  +C+ILAV+PAN+D
Sbjct  176  RIRKMIMAYIRQENCIILAVSPANSD  201



>gb|KDO67387.1| hypothetical protein CISIN_1g045702mg [Citrus sinensis]
Length=728

 Score =   248 bits (633),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 163/206 (79%), Gaps = 9/206 (4%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAP---LGHSVIPIVNKLQDIFAQL-GSQSTIELPqvavvgsqs  382
            M EEA     S SN N A    +G SVIPI+N+LQDIF+ + G  S I LPQVAVVGSQS
Sbjct  1    MGEEA-----SFSNKNVAASTTIGSSVIPIINRLQDIFSPVDGELSKISLPQVAVVGSQS  55

Query  383  sgkssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDF  562
            SGKSSVLEALVGRDFLPRG DICTRRPL L L+   R P     EW EF HLPGK+FFDF
Sbjct  56   SGKSSVLEALVGRDFLPRGCDICTRRPLALMLVNRPRNPGDDGREWAEFRHLPGKRFFDF  115

Query  563  NDIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEA  742
              +R+EI AET++EAG N+GVS+KQI LKI SPNVL++TLVDLPGITKVPVGDQP+DIEA
Sbjct  116  TKVRQEIMAETNKEAGSNRGVSEKQIGLKISSPNVLNMTLVDLPGITKVPVGDQPTDIEA  175

Query  743  RIRTMIMSYIKLPSCLILAVTPANAD  820
            RIR MIM+YI+  +C+ILAV+PAN+D
Sbjct  176  RIRKMIMAYIRQENCIILAVSPANSD  201



>ref|XP_007011677.1| Dynamin-related protein 3A isoform 1 [Theobroma cacao]
 gb|EOY29296.1| Dynamin-related protein 3A isoform 1 [Theobroma cacao]
Length=832

 Score =   249 bits (635),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 161/186 (87%), Gaps = 5/186 (3%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQ-STIELPqvavvgsqssgkssvLEALVGRDFLPRGSDI  448
            +G S+IP++NKLQDI A  G++ S I +PQVAVVGSQSSGKSSVLEALVGRDFLPRG DI
Sbjct  23   IGSSLIPVINKLQDILASSGTELSDISVPQVAVVGSQSSGKSSVLEALVGRDFLPRGCDI  82

Query  449  CTRRPLVLQLLQTKRKPDSTDE--EWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKG  622
            CTRRPLVL L    R P+S DE  EWGEF HLPG++F+DF+ IR+EIQAET+REAG NKG
Sbjct  83   CTRRPLVLML--ENRPPNSGDESSEWGEFRHLPGRRFYDFSQIRREIQAETEREAGCNKG  140

Query  623  VSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAV  802
            VS+ QIRLKI+SPNVL++TL+DLPGITKVPVGDQPSDIEARIR M+M+YI   +C+ILAV
Sbjct  141  VSESQIRLKIYSPNVLNMTLIDLPGITKVPVGDQPSDIEARIRKMLMAYITNENCIILAV  200

Query  803  TPANAD  820
            +PAN+D
Sbjct  201  SPANSD  206



>gb|KHG17659.1| Dynamin-related 3A -like protein [Gossypium arboreum]
Length=811

 Score =   247 bits (631),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 167/205 (81%), Gaps = 7/205 (3%)
 Frame = +2

Query  221  EEAVPSSTSTSNLN--AAPLGHSVIPIVNKLQDIFAQLGSQ-STIELPqvavvgsqssgk  391
            +EAV  +   S L    A +G S+IP++NKL DI A  G++ S I +PQVAVVGSQSSGK
Sbjct  2    DEAVNPNNKMSTLTKTVATIGSSLIPVINKLHDILASSGTELSDISVPQVAVVGSQSSGK  61

Query  392  ssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDE--EWGEFLHLPGKKFFDFN  565
            SSVLEALVGRDFLPRG DICTRRPLVL L    R P+S D+  EWGEF HLPG++F+DF+
Sbjct  62   SSVLEALVGRDFLPRGCDICTRRPLVLML--ENRSPNSDDDRIEWGEFRHLPGRRFYDFS  119

Query  566  DIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEAR  745
             IR+EIQAET+REAG NKGVS+KQIRLKI SP VL++TL+DLPGITKVPVGDQPSDIEAR
Sbjct  120  QIRREIQAETEREAGCNKGVSEKQIRLKISSPKVLNMTLIDLPGITKVPVGDQPSDIEAR  179

Query  746  IRTMIMSYIKLPSCLILAVTPANAD  820
            IR MIM+YI   +C+ILAV+PAN+D
Sbjct  180  IRRMIMAYINNENCIILAVSPANSD  204



>gb|KJB55123.1| hypothetical protein B456_009G064100 [Gossypium raimondii]
Length=754

 Score =   246 bits (629),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 168/207 (81%), Gaps = 7/207 (3%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLN--AAPLGHSVIPIVNKLQDIFAQLGSQ-STIELPqvavvgsqss  385
            M +EAV  +   S L    A +G S+IP++NKL DI A  G++ S I +PQVAVVGSQSS
Sbjct  1    MMDEAVNPNNKMSTLTKTVATIGSSLIPVINKLHDILASSGTELSDISVPQVAVVGSQSS  60

Query  386  gkssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDE--EWGEFLHLPGKKFFD  559
            GKSSVLEALVGRDFLPRG DICTRRPLVL L    R P+S D+  EWGEF HLPG++F+D
Sbjct  61   GKSSVLEALVGRDFLPRGCDICTRRPLVLML--ENRSPNSDDDRIEWGEFRHLPGRRFYD  118

Query  560  FNDIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIE  739
            F+ IR+EI+AET+REAG NKGVS+ QIRLKI SPNVL++TL+DLPGITKVPVGDQPSDIE
Sbjct  119  FSQIRREIEAETEREAGCNKGVSENQIRLKISSPNVLNMTLIDLPGITKVPVGDQPSDIE  178

Query  740  ARIRTMIMSYIKLPSCLILAVTPANAD  820
            ARIR MIM++I   +C+ILAV+PAN+D
Sbjct  179  ARIRRMIMAHINNENCIILAVSPANSD  205



>ref|XP_006357068.1| PREDICTED: dynamin-related protein 3A-like [Solanum tuberosum]
Length=740

 Score =   246 bits (628),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 165/211 (78%), Gaps = 11/211 (5%)
 Frame = +2

Query  221  EEAVPSSTSTSNLNAAP-------LGHSVIPIVNKLQDIFAQLGS----QSTIELPqvav  367
            E+ +  S S SN +  P       +G SVIPI+NKLQDIFA LG      + + LPQVAV
Sbjct  2    EKNLKKSNSDSNDDVPPSTHPSFFIGSSVIPIINKLQDIFAPLGDIDDRLTGLRLPQVAV  61

Query  368  vgsqssgkssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGK  547
            +GSQSSGKSSVLEALVGRDFLPRGSDICTRRPLVLQL +      +   EWGEF HLP K
Sbjct  62   IGSQSSGKSSVLEALVGRDFLPRGSDICTRRPLVLQLEKRSAGIGNDSLEWGEFAHLPEK  121

Query  548  KFFDFNDIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQP  727
            +F+DF+ IR+EI AET++E G NKGVSDKQIRLKI SPNVL+ITLVDLPGITKVPVGDQP
Sbjct  122  RFYDFSAIRREILAETEKEVGVNKGVSDKQIRLKICSPNVLNITLVDLPGITKVPVGDQP  181

Query  728  SDIEARIRTMIMSYIKLPSCLILAVTPANAD  820
            SDIEARIR MIMSYIK  + +ILAV+PANAD
Sbjct  182  SDIEARIRDMIMSYIKQETSIILAVSPANAD  212



>gb|KJB55124.1| hypothetical protein B456_009G064100 [Gossypium raimondii]
Length=800

 Score =   246 bits (629),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 168/207 (81%), Gaps = 7/207 (3%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLN--AAPLGHSVIPIVNKLQDIFAQLGSQ-STIELPqvavvgsqss  385
            M +EAV  +   S L    A +G S+IP++NKL DI A  G++ S I +PQVAVVGSQSS
Sbjct  1    MMDEAVNPNNKMSTLTKTVATIGSSLIPVINKLHDILASSGTELSDISVPQVAVVGSQSS  60

Query  386  gkssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDE--EWGEFLHLPGKKFFD  559
            GKSSVLEALVGRDFLPRG DICTRRPLVL L    R P+S D+  EWGEF HLPG++F+D
Sbjct  61   GKSSVLEALVGRDFLPRGCDICTRRPLVLML--ENRSPNSDDDRIEWGEFRHLPGRRFYD  118

Query  560  FNDIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIE  739
            F+ IR+EI+AET+REAG NKGVS+ QIRLKI SPNVL++TL+DLPGITKVPVGDQPSDIE
Sbjct  119  FSQIRREIEAETEREAGCNKGVSENQIRLKISSPNVLNMTLIDLPGITKVPVGDQPSDIE  178

Query  740  ARIRTMIMSYIKLPSCLILAVTPANAD  820
            ARIR MIM++I   +C+ILAV+PAN+D
Sbjct  179  ARIRRMIMAHINNENCIILAVSPANSD  205



>ref|XP_002515392.1| dynamin, putative [Ricinus communis]
 gb|EEF46841.1| dynamin, putative [Ricinus communis]
Length=797

 Score =   246 bits (628),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 158/184 (86%), Gaps = 1/184 (1%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQST-IELPqvavvgsqssgkssvLEALVGRDFLPRGSDI  448
            +G SVIPI++KLQDI + +  + T + LP+VAV+GSQSSGKSSVLEALVGRDFLPRG DI
Sbjct  18   IGSSVIPIIHKLQDIISPISDELTKLSLPKVAVIGSQSSGKSSVLEALVGRDFLPRGCDI  77

Query  449  CTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            CTRRPLVL L  + + PD +  E+GEF HLPGK+F+DF+ IR EIQAET+REAG NKGVS
Sbjct  78   CTRRPLVLMLENSLKTPDDSIAEFGEFRHLPGKRFYDFSKIRDEIQAETEREAGNNKGVS  137

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            DKQIRLKI+SPNVL++TLVDLPGITKVPVGDQP+DIEARIR MI ++I   +C+ILAVTP
Sbjct  138  DKQIRLKIYSPNVLNMTLVDLPGITKVPVGDQPTDIEARIRKMIAAHISQENCIILAVTP  197

Query  809  ANAD  820
            AN+D
Sbjct  198  ANSD  201



>ref|XP_009359080.1| PREDICTED: dynamin-related protein 3A-like isoform X4 [Pyrus 
x bretschneideri]
 ref|XP_009359155.1| PREDICTED: dynamin-related protein 3A-like isoform X4 [Pyrus 
x bretschneideri]
Length=779

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 162/204 (79%), Gaps = 2/204 (1%)
 Frame = +2

Query  215  MAEEAVP-SSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGS-QSTIELPqvavvgsqssg  388
            M EEA    S++TS   +  +G S+I ++NKLQDI A + S +  I LPQVAVVGSQSSG
Sbjct  1    MGEEAREVDSSATSPRPSVTIGSSLISMINKLQDILAPVVSDKPQISLPQVAVVGSQSSG  60

Query  389  kssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFND  568
            KSSVLEALVGRDFLPRG DICTRRPLVL L     +P     EWGEF HLPGK+F+DF+ 
Sbjct  61   KSSVLEALVGRDFLPRGRDICTRRPLVLMLEYRAEEPGDEHTEWGEFRHLPGKRFYDFSA  120

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EIQAETDREAG NKGVSDKQIRLKI SPNVL++TLVDLPGITKVPVGDQP DIEA I
Sbjct  121  IRREIQAETDREAGLNKGVSDKQIRLKITSPNVLNMTLVDLPGITKVPVGDQPRDIEAMI  180

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            R MIM YI   +C+ILAV+PAN+D
Sbjct  181  RKMIMDYITQQNCIILAVSPANSD  204



>ref|XP_009359081.1| PREDICTED: dynamin-related protein 3A-like isoform X5 [Pyrus 
x bretschneideri]
 ref|XP_009359156.1| PREDICTED: dynamin-related protein 3A-like isoform X5 [Pyrus 
x bretschneideri]
Length=774

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 162/204 (79%), Gaps = 2/204 (1%)
 Frame = +2

Query  215  MAEEAVP-SSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGS-QSTIELPqvavvgsqssg  388
            M EEA    S++TS   +  +G S+I ++NKLQDI A + S +  I LPQVAVVGSQSSG
Sbjct  1    MGEEAREVDSSATSPRPSVTIGSSLISMINKLQDILAPVVSDKPQISLPQVAVVGSQSSG  60

Query  389  kssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFND  568
            KSSVLEALVGRDFLPRG DICTRRPLVL L     +P     EWGEF HLPGK+F+DF+ 
Sbjct  61   KSSVLEALVGRDFLPRGRDICTRRPLVLMLEYRAEEPGDEHTEWGEFRHLPGKRFYDFSA  120

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EIQAETDREAG NKGVSDKQIRLKI SPNVL++TLVDLPGITKVPVGDQP DIEA I
Sbjct  121  IRREIQAETDREAGLNKGVSDKQIRLKITSPNVLNMTLVDLPGITKVPVGDQPRDIEAMI  180

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            R MIM YI   +C+ILAV+PAN+D
Sbjct  181  RKMIMDYITQQNCIILAVSPANSD  204



>gb|KDO44156.1| hypothetical protein CISIN_1g003355mg [Citrus sinensis]
Length=799

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 154/168 (92%), Gaps = 6/168 (4%)
 Frame = +2

Query  215  MAEE-AVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgk  391
            MA+E A  ++ + S  +A PLG SVIP+VNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK
Sbjct  1    MADEPATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK  60

Query  392  ssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDI  571
            SSVLEALVGRDFLPRG+DICTRRPLVLQLLQTK     TDEE+GEFLHLPGK+F+DF++I
Sbjct  61   SSVLEALVGRDFLPRGNDICTRRPLVLQLLQTK-----TDEEYGEFLHLPGKRFYDFSEI  115

Query  572  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPV  715
            R+EIQA+TD+EAGGNKGVSDKQIRLKIFSP+VLDITLVDLPGITKVPV
Sbjct  116  RREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPV  163



>ref|XP_009359082.1| PREDICTED: dynamin-related protein 3A-like isoform X6 [Pyrus 
x bretschneideri]
 ref|XP_009359157.1| PREDICTED: dynamin-related protein 3A-like isoform X6 [Pyrus 
x bretschneideri]
Length=765

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 162/204 (79%), Gaps = 2/204 (1%)
 Frame = +2

Query  215  MAEEAVP-SSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGS-QSTIELPqvavvgsqssg  388
            M EEA    S++TS   +  +G S+I ++NKLQDI A + S +  I LPQVAVVGSQSSG
Sbjct  1    MGEEAREVDSSATSPRPSVTIGSSLISMINKLQDILAPVVSDKPQISLPQVAVVGSQSSG  60

Query  389  kssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFND  568
            KSSVLEALVGRDFLPRG DICTRRPLVL L     +P     EWGEF HLPGK+F+DF+ 
Sbjct  61   KSSVLEALVGRDFLPRGRDICTRRPLVLMLEYRAEEPGDEHTEWGEFRHLPGKRFYDFSA  120

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EIQAETDREAG NKGVSDKQIRLKI SPNVL++TLVDLPGITKVPVGDQP DIEA I
Sbjct  121  IRREIQAETDREAGLNKGVSDKQIRLKITSPNVLNMTLVDLPGITKVPVGDQPRDIEAMI  180

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            R MIM YI   +C+ILAV+PAN+D
Sbjct  181  RKMIMDYITQQNCIILAVSPANSD  204



>ref|XP_009359079.1| PREDICTED: dynamin-related protein 3A-like isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009359154.1| PREDICTED: dynamin-related protein 3A-like isoform X3 [Pyrus 
x bretschneideri]
Length=788

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 162/204 (79%), Gaps = 2/204 (1%)
 Frame = +2

Query  215  MAEEAVP-SSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGS-QSTIELPqvavvgsqssg  388
            M EEA    S++TS   +  +G S+I ++NKLQDI A + S +  I LPQVAVVGSQSSG
Sbjct  1    MGEEAREVDSSATSPRPSVTIGSSLISMINKLQDILAPVVSDKPQISLPQVAVVGSQSSG  60

Query  389  kssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFND  568
            KSSVLEALVGRDFLPRG DICTRRPLVL L     +P     EWGEF HLPGK+F+DF+ 
Sbjct  61   KSSVLEALVGRDFLPRGRDICTRRPLVLMLEYRAEEPGDEHTEWGEFRHLPGKRFYDFSA  120

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EIQAETDREAG NKGVSDKQIRLKI SPNVL++TLVDLPGITKVPVGDQP DIEA I
Sbjct  121  IRREIQAETDREAGLNKGVSDKQIRLKITSPNVLNMTLVDLPGITKVPVGDQPRDIEAMI  180

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            R MIM YI   +C+ILAV+PAN+D
Sbjct  181  RKMIMDYITQQNCIILAVSPANSD  204



>ref|XP_009359077.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009359152.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Pyrus 
x bretschneideri]
Length=840

 Score =   245 bits (626),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 162/204 (79%), Gaps = 2/204 (1%)
 Frame = +2

Query  215  MAEEAVP-SSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGS-QSTIELPqvavvgsqssg  388
            M EEA    S++TS   +  +G S+I ++NKLQDI A + S +  I LPQVAVVGSQSSG
Sbjct  1    MGEEAREVDSSATSPRPSVTIGSSLISMINKLQDILAPVVSDKPQISLPQVAVVGSQSSG  60

Query  389  kssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFND  568
            KSSVLEALVGRDFLPRG DICTRRPLVL L     +P     EWGEF HLPGK+F+DF+ 
Sbjct  61   KSSVLEALVGRDFLPRGRDICTRRPLVLMLEYRAEEPGDEHTEWGEFRHLPGKRFYDFSA  120

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EIQAETDREAG NKGVSDKQIRLKI SPNVL++TLVDLPGITKVPVGDQP DIEA I
Sbjct  121  IRREIQAETDREAGLNKGVSDKQIRLKITSPNVLNMTLVDLPGITKVPVGDQPRDIEAMI  180

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            R MIM YI   +C+ILAV+PAN+D
Sbjct  181  RKMIMDYITQQNCIILAVSPANSD  204



>ref|XP_008379402.1| PREDICTED: dynamin-related protein 3A-like [Malus domestica]
Length=703

 Score =   243 bits (620),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 161/204 (79%), Gaps = 2/204 (1%)
 Frame = +2

Query  215  MAEEAVP-SSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGS-QSTIELPqvavvgsqssg  388
            M E+A+   S++T+   +   G S+IP++NKLQDI A +GS +  I LPQVAVVGSQSSG
Sbjct  1    MGEKAMEVHSSATTPRPSMTFGSSLIPMINKLQDILAPVGSDRPQISLPQVAVVGSQSSG  60

Query  389  kssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFND  568
            KSSVLEALVGRDFLPRG DICTRRPLVL L      P     EWGEF HLPGK+F+DF+ 
Sbjct  61   KSSVLEALVGRDFLPRGRDICTRRPLVLMLENRAAVPGDEHTEWGEFRHLPGKRFYDFSA  120

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR EIQAETDREAG NK VSDKQIRLKI SPNVL++TLVDLPGITKVPVGDQP DIEA +
Sbjct  121  IRHEIQAETDREAGLNKRVSDKQIRLKIISPNVLNMTLVDLPGITKVPVGDQPRDIEAMV  180

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            R MIM YI   +C+ILAV+PAN+D
Sbjct  181  RKMIMGYIIQQNCIILAVSPANSD  204



>ref|XP_009359078.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009359153.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Pyrus 
x bretschneideri]
Length=826

 Score =   245 bits (625),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 162/204 (79%), Gaps = 2/204 (1%)
 Frame = +2

Query  215  MAEEAVP-SSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGS-QSTIELPqvavvgsqssg  388
            M EEA    S++TS   +  +G S+I ++NKLQDI A + S +  I LPQVAVVGSQSSG
Sbjct  1    MGEEAREVDSSATSPRPSVTIGSSLISMINKLQDILAPVVSDKPQISLPQVAVVGSQSSG  60

Query  389  kssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFND  568
            KSSVLEALVGRDFLPRG DICTRRPLVL L     +P     EWGEF HLPGK+F+DF+ 
Sbjct  61   KSSVLEALVGRDFLPRGRDICTRRPLVLMLEYRAEEPGDEHTEWGEFRHLPGKRFYDFSA  120

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EIQAETDREAG NKGVSDKQIRLKI SPNVL++TLVDLPGITKVPVGDQP DIEA I
Sbjct  121  IRREIQAETDREAGLNKGVSDKQIRLKITSPNVLNMTLVDLPGITKVPVGDQPRDIEAMI  180

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            R MIM YI   +C+ILAV+PAN+D
Sbjct  181  RKMIMDYITQQNCIILAVSPANSD  204



>ref|XP_010108286.1| Dynamin-related protein 3A [Morus notabilis]
 gb|EXC18766.1| Dynamin-related protein 3A [Morus notabilis]
Length=575

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 159/204 (78%), Gaps = 2/204 (1%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPL-GHSVIPIVNKLQDIFAQLGSQST-IELPqvavvgsqssg  388
            M EE  P  +   N   +P+ G S+IPI+NKLQDI A +G + T I LPQVAV+GSQSSG
Sbjct  1    MGEETSPLDSLRVNSRTSPVVGSSLIPIINKLQDILAPVGRELTNISLPQVAVIGSQSSG  60

Query  389  kssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFND  568
            KSSVLEALVGRDFLPRG DICTRRPLVL L     KP    +EWGEF HLPGK F+DF+ 
Sbjct  61   KSSVLEALVGRDFLPRGCDICTRRPLVLMLENRPEKPGDDGKEWGEFRHLPGKCFYDFSK  120

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EIQAET+R  G NK VSDKQI LKI SPNVL++TLVDLPGITKVPVGDQP DIEA I
Sbjct  121  IRREIQAETERGVGLNKRVSDKQIFLKISSPNVLNMTLVDLPGITKVPVGDQPIDIEAMI  180

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            R MIM YI+  SC+ILAV+PAN+D
Sbjct  181  RNMIMVYIQQESCIILAVSPANSD  204



>ref|XP_008377478.1| PREDICTED: dynamin-related protein 3A-like isoform X4 [Malus 
domestica]
Length=779

 Score =   244 bits (622),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 161/204 (79%), Gaps = 2/204 (1%)
 Frame = +2

Query  215  MAEEAVP-SSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGS-QSTIELPqvavvgsqssg  388
            M EEA    S++TS   +  +G S+I ++NKLQDI A + S +  I LPQVAVVGSQSSG
Sbjct  1    MGEEAREVGSSATSPRPSVTIGSSLISMINKLQDILAPVVSDKPQISLPQVAVVGSQSSG  60

Query  389  kssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFND  568
            KSSVLE LVGRDFLPRG DICTRRPLVL L     +P     EWGEF HLPGK+F+DF+ 
Sbjct  61   KSSVLEXLVGRDFLPRGRDICTRRPLVLMLEYRAEEPGDEHTEWGEFRHLPGKRFYDFSA  120

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EIQAETDREAG NKGVSDKQIRLKI SPNVL++TLVDLPGITKVPVGDQP DIEA I
Sbjct  121  IRREIQAETDREAGLNKGVSDKQIRLKITSPNVLNMTLVDLPGITKVPVGDQPRDIEAMI  180

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            R MIM YI   +C+ILAV+PAN+D
Sbjct  181  RKMIMDYITQQNCIILAVSPANSD  204



>ref|XP_008377481.1| PREDICTED: dynamin-related protein 3A-like isoform X6 [Malus 
domestica]
Length=765

 Score =   243 bits (621),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 161/204 (79%), Gaps = 2/204 (1%)
 Frame = +2

Query  215  MAEEAVP-SSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGS-QSTIELPqvavvgsqssg  388
            M EEA    S++TS   +  +G S+I ++NKLQDI A + S +  I LPQVAVVGSQSSG
Sbjct  1    MGEEAREVGSSATSPRPSVTIGSSLISMINKLQDILAPVVSDKPQISLPQVAVVGSQSSG  60

Query  389  kssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFND  568
            KSSVLE LVGRDFLPRG DICTRRPLVL L     +P     EWGEF HLPGK+F+DF+ 
Sbjct  61   KSSVLEXLVGRDFLPRGRDICTRRPLVLMLEYRAEEPGDEHTEWGEFRHLPGKRFYDFSA  120

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EIQAETDREAG NKGVSDKQIRLKI SPNVL++TLVDLPGITKVPVGDQP DIEA I
Sbjct  121  IRREIQAETDREAGLNKGVSDKQIRLKITSPNVLNMTLVDLPGITKVPVGDQPRDIEAMI  180

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            R MIM YI   +C+ILAV+PAN+D
Sbjct  181  RKMIMDYITQQNCIILAVSPANSD  204



>ref|XP_008377480.1| PREDICTED: dynamin-related protein 3A-like isoform X5 [Malus 
domestica]
Length=774

 Score =   243 bits (621),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 161/204 (79%), Gaps = 2/204 (1%)
 Frame = +2

Query  215  MAEEAVP-SSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGS-QSTIELPqvavvgsqssg  388
            M EEA    S++TS   +  +G S+I ++NKLQDI A + S +  I LPQVAVVGSQSSG
Sbjct  1    MGEEAREVGSSATSPRPSVTIGSSLISMINKLQDILAPVVSDKPQISLPQVAVVGSQSSG  60

Query  389  kssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFND  568
            KSSVLE LVGRDFLPRG DICTRRPLVL L     +P     EWGEF HLPGK+F+DF+ 
Sbjct  61   KSSVLEXLVGRDFLPRGRDICTRRPLVLMLEYRAEEPGDEHTEWGEFRHLPGKRFYDFSA  120

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EIQAETDREAG NKGVSDKQIRLKI SPNVL++TLVDLPGITKVPVGDQP DIEA I
Sbjct  121  IRREIQAETDREAGLNKGVSDKQIRLKITSPNVLNMTLVDLPGITKVPVGDQPRDIEAMI  180

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            R MIM YI   +C+ILAV+PAN+D
Sbjct  181  RKMIMDYITQQNCIILAVSPANSD  204



>ref|XP_008377477.1| PREDICTED: dynamin-related protein 3A-like isoform X3 [Malus 
domestica]
Length=788

 Score =   243 bits (621),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 161/204 (79%), Gaps = 2/204 (1%)
 Frame = +2

Query  215  MAEEAVP-SSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGS-QSTIELPqvavvgsqssg  388
            M EEA    S++TS   +  +G S+I ++NKLQDI A + S +  I LPQVAVVGSQSSG
Sbjct  1    MGEEAREVGSSATSPRPSVTIGSSLISMINKLQDILAPVVSDKPQISLPQVAVVGSQSSG  60

Query  389  kssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFND  568
            KSSVLE LVGRDFLPRG DICTRRPLVL L     +P     EWGEF HLPGK+F+DF+ 
Sbjct  61   KSSVLEXLVGRDFLPRGRDICTRRPLVLMLEYRAEEPGDEHTEWGEFRHLPGKRFYDFSA  120

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EIQAETDREAG NKGVSDKQIRLKI SPNVL++TLVDLPGITKVPVGDQP DIEA I
Sbjct  121  IRREIQAETDREAGLNKGVSDKQIRLKITSPNVLNMTLVDLPGITKVPVGDQPRDIEAMI  180

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            R MIM YI   +C+ILAV+PAN+D
Sbjct  181  RKMIMDYITQQNCIILAVSPANSD  204



>ref|XP_008377475.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Malus 
domestica]
Length=840

 Score =   244 bits (622),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 161/204 (79%), Gaps = 2/204 (1%)
 Frame = +2

Query  215  MAEEAVP-SSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGS-QSTIELPqvavvgsqssg  388
            M EEA    S++TS   +  +G S+I ++NKLQDI A + S +  I LPQVAVVGSQSSG
Sbjct  1    MGEEAREVGSSATSPRPSVTIGSSLISMINKLQDILAPVVSDKPQISLPQVAVVGSQSSG  60

Query  389  kssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFND  568
            KSSVLE LVGRDFLPRG DICTRRPLVL L     +P     EWGEF HLPGK+F+DF+ 
Sbjct  61   KSSVLEXLVGRDFLPRGRDICTRRPLVLMLEYRAEEPGDEHTEWGEFRHLPGKRFYDFSA  120

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EIQAETDREAG NKGVSDKQIRLKI SPNVL++TLVDLPGITKVPVGDQP DIEA I
Sbjct  121  IRREIQAETDREAGLNKGVSDKQIRLKITSPNVLNMTLVDLPGITKVPVGDQPRDIEAMI  180

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            R MIM YI   +C+ILAV+PAN+D
Sbjct  181  RKMIMDYITQQNCIILAVSPANSD  204



>ref|XP_008377476.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Malus 
domestica]
Length=826

 Score =   243 bits (621),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 161/204 (79%), Gaps = 2/204 (1%)
 Frame = +2

Query  215  MAEEAVP-SSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGS-QSTIELPqvavvgsqssg  388
            M EEA    S++TS   +  +G S+I ++NKLQDI A + S +  I LPQVAVVGSQSSG
Sbjct  1    MGEEAREVGSSATSPRPSVTIGSSLISMINKLQDILAPVVSDKPQISLPQVAVVGSQSSG  60

Query  389  kssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFND  568
            KSSVLE LVGRDFLPRG DICTRRPLVL L     +P     EWGEF HLPGK+F+DF+ 
Sbjct  61   KSSVLEXLVGRDFLPRGRDICTRRPLVLMLEYRAEEPGDEHTEWGEFRHLPGKRFYDFSA  120

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EIQAETDREAG NKGVSDKQIRLKI SPNVL++TLVDLPGITKVPVGDQP DIEA I
Sbjct  121  IRREIQAETDREAGLNKGVSDKQIRLKITSPNVLNMTLVDLPGITKVPVGDQPRDIEAMI  180

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            R MIM YI   +C+ILAV+PAN+D
Sbjct  181  RKMIMDYITQQNCIILAVSPANSD  204



>gb|KHN33568.1| Dynamin-related protein 3A [Glycine soja]
Length=720

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 158/173 (91%), Gaps = 4/173 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            MA+E VPS ++ S   A PLG SVI +VN+LQDIFA++GSQSTI+LPQVAVVGSQSSGKS
Sbjct  1    MADE-VPSPSAASTATA-PLGSSVISLVNRLQDIFARVGSQSTIDLPQVAVVGSQSSGKS  58

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIR  574
            SVLEALVGRDFLPRG+DICTRRPLVLQL+QTKRKPD  ++E+GEFLHLPG+KF DF++IR
Sbjct  59   SVLEALVGRDFLPRGNDICTRRPLVLQLVQTKRKPD--NDEYGEFLHLPGRKFHDFSEIR  116

Query  575  KEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSD  733
            +EIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITK+ + D+ +D
Sbjct  117  REIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKLDIMDRGTD  169



>ref|XP_005845253.1| hypothetical protein CHLNCDRAFT_136923 [Chlorella variabilis]
 gb|EFN53151.1| hypothetical protein CHLNCDRAFT_136923 [Chlorella variabilis]
Length=846

 Score =   242 bits (618),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 164/204 (80%), Gaps = 5/204 (2%)
 Frame = +2

Query  215  MAEEAVPSSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgks  394
            M  +  P  T+ + L +  LG S+IP +NKLQD+F+QL S   ++LPQ+AVVGSQSSGKS
Sbjct  1    MELQTTPRGTNMAFLASGALGESIIPAINKLQDVFSQLSSDVKLDLPQIAVVGSQSSGKS  60

Query  395  svLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDE--EWGEFLHLPGKKFFDFND  568
            SVLEALVGRDFLPRGS+I TRRPL+LQL++T   P  T +  EWGEFLHL GK+ +DF+ 
Sbjct  61   SVLEALVGRDFLPRGSNIVTRRPLILQLVKT---PPVTGQYAEWGEFLHLQGKRIYDFDR  117

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EI  ET+R  GGNKG+S+K IRLKIFSPNVL +TLVDLPGIT+VPVGDQP+DIE R+
Sbjct  118  IRQEILMETERLVGGNKGISEKPIRLKIFSPNVLTMTLVDLPGITRVPVGDQPTDIEGRL  177

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            R +I+ YIK P+CLILAV+PAN D
Sbjct  178  RALILDYIKAPTCLILAVSPANQD  201



>ref|XP_009610154.1| PREDICTED: dynamin-related protein 3A-like [Nicotiana tomentosiformis]
Length=550

 Score =   236 bits (602),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGS----QSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            +G SVIP++NKLQDIFA LG      + + LPQVAV+GSQSSGKSSVLEALVGRDFLPRG
Sbjct  21   IGSSVIPLINKLQDIFAPLGDIDDRLTGLRLPQVAVIGSQSSGKSSVLEALVGRDFLPRG  80

Query  440  SDICTRRPLVLQLLQ-TKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGN  616
            +DICTRRPL+LQL + T    D+   E+GEF HLP K+F+DF+DIR EI  ET +E G N
Sbjct  81   TDICTRRPLLLQLEKRTIGVGDNDSREYGEFGHLPDKRFYDFSDIRCEILVETAKEVGVN  140

Query  617  KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLIL  796
            KGVSDKQIRLKI SPNVL+ITLVDLPGITKVPVGDQPSDIEARIR MIMSYIK  + +IL
Sbjct  141  KGVSDKQIRLKICSPNVLNITLVDLPGITKVPVGDQPSDIEARIRNMIMSYIKQETSIIL  200

Query  797  AVTPANAD  820
            AV+PANAD
Sbjct  201  AVSPANAD  208



>ref|XP_009363360.1| PREDICTED: dynamin-related protein 3A-like [Pyrus x bretschneideri]
Length=703

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 161/204 (79%), Gaps = 2/204 (1%)
 Frame = +2

Query  215  MAEEAVP-SSTSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQS-TIELPqvavvgsqssg  388
            M E+A+   S++T+   +  +G S+IP++NKLQDI A +GS    I LPQVAVVGSQSSG
Sbjct  1    MGEKAMEVHSSATAPRPSVTIGTSLIPMINKLQDILAPVGSDMPQISLPQVAVVGSQSSG  60

Query  389  kssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFND  568
            KSSVLEALVGRDFLPRG DICTRRPLVL L      P     E GEF HLPGK F+DF+ 
Sbjct  61   KSSVLEALVGRDFLPRGRDICTRRPLVLMLENRAAMPGDEHTERGEFRHLPGKHFYDFSA  120

Query  569  IRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARI  748
            IR+EIQAETDREAG NKGVSDKQIRLKI SPNVL++TLVDLPGITKVPVGDQP +IEA +
Sbjct  121  IRREIQAETDREAGLNKGVSDKQIRLKITSPNVLNMTLVDLPGITKVPVGDQPRNIEAMV  180

Query  749  RTMIMSYIKLPSCLILAVTPANAD  820
            R MIM YI   +C+ILAV+PAN+D
Sbjct  181  RKMIMDYIIQQNCIILAVSPANSD  204



>emb|CDP18852.1| unnamed protein product [Coffea canephora]
Length=774

 Score =   239 bits (611),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 156/190 (82%), Gaps = 7/190 (4%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQ-----STIELPqvavvgsqssgkssvLEALVGRDFLPR  436
            +G SVIPIVNKLQDIFA LG       S ++LPQVAVVG QSSGKSSVLEALV RDFLPR
Sbjct  35   IGGSVIPIVNKLQDIFASLGKDQHEQLSKLKLPQVAVVGGQSSGKSSVLEALVRRDFLPR  94

Query  437  GSDICTRRPLVLQLLQTKRKPDSTDE--EWGEFLHLPGKKFFDFNDIRKEIQAETDREAG  610
            G DICTR PLVLQL      P   D+  EWGEF HLPG+KF+DF++I +EIQ ET+REAG
Sbjct  95   GCDICTRCPLVLQLENRPALPGDEDDGLEWGEFRHLPGRKFYDFSEICREIQVETEREAG  154

Query  611  GNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCL  790
             NKGVSDK+IRLK+ SPNVL+ITLVDLPGITKVPVGDQP+DIEARIR +I SYI+  +C+
Sbjct  155  LNKGVSDKEIRLKVSSPNVLNITLVDLPGITKVPVGDQPNDIEARIREIINSYIRQETCI  214

Query  791  ILAVTPANAD  820
            ILAVTPAN+D
Sbjct  215  ILAVTPANSD  224



>ref|XP_010324551.1| PREDICTED: dynamin-related protein 3A-like isoform X3 [Solanum 
lycopersicum]
Length=688

 Score =   238 bits (606),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 155/187 (83%), Gaps = 4/187 (2%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQ----STIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            +G SVIPI+NKLQDIF+ LG      + + LPQVAV+GSQSSGKSSVLEALVGRDFLPRG
Sbjct  26   IGSSVIPIINKLQDIFSPLGDIDDRFTGLRLPQVAVIGSQSSGKSSVLEALVGRDFLPRG  85

Query  440  SDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNK  619
             DICTRRPLVLQL +   +  +   EWGEF HL  K+F+DF+ IR+EI AET++E G NK
Sbjct  86   CDICTRRPLVLQLEKRSAEIGNDSLEWGEFGHLSEKRFYDFSAIRREILAETEKEVGVNK  145

Query  620  GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILA  799
            GVSDKQIRLKI SPNVL+ITLVDLPGITKVPVGDQPSDIEARIR MIMSYIK  + +ILA
Sbjct  146  GVSDKQIRLKICSPNVLNITLVDLPGITKVPVGDQPSDIEARIRDMIMSYIKQETSIILA  205

Query  800  VTPANAD  820
            V+PANAD
Sbjct  206  VSPANAD  212



>ref|XP_004244503.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Solanum 
lycopersicum]
Length=740

 Score =   238 bits (608),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 155/187 (83%), Gaps = 4/187 (2%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQ----STIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            +G SVIPI+NKLQDIF+ LG      + + LPQVAV+GSQSSGKSSVLEALVGRDFLPRG
Sbjct  26   IGSSVIPIINKLQDIFSPLGDIDDRFTGLRLPQVAVIGSQSSGKSSVLEALVGRDFLPRG  85

Query  440  SDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNK  619
             DICTRRPLVLQL +   +  +   EWGEF HL  K+F+DF+ IR+EI AET++E G NK
Sbjct  86   CDICTRRPLVLQLEKRSAEIGNDSLEWGEFGHLSEKRFYDFSAIRREILAETEKEVGVNK  145

Query  620  GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILA  799
            GVSDKQIRLKI SPNVL+ITLVDLPGITKVPVGDQPSDIEARIR MIMSYIK  + +ILA
Sbjct  146  GVSDKQIRLKICSPNVLNITLVDLPGITKVPVGDQPSDIEARIRDMIMSYIKQETSIILA  205

Query  800  VTPANAD  820
            V+PANAD
Sbjct  206  VSPANAD  212



>ref|XP_009768871.1| PREDICTED: dynamin-related protein 3A-like isoform X4 [Nicotiana 
sylvestris]
Length=586

 Score =   235 bits (599),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGS----QSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            +G SVIP++NKLQDIFA LG      + + LPQVAV+GSQSSGKSSVLEALVGRDFLPRG
Sbjct  21   IGSSVIPLINKLQDIFAPLGDIDDRLTGLRLPQVAVIGSQSSGKSSVLEALVGRDFLPRG  80

Query  440  SDICTRRPLVLQLLQ-TKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGN  616
            +DICTRRPL+LQL + T    D+   E+GEF HLP K+F+DF+DIR EI  ET +E G N
Sbjct  81   TDICTRRPLLLQLEKRTIGVGDNDSREYGEFGHLPDKRFYDFSDIRCEILVETAKEVGVN  140

Query  617  KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLIL  796
            KGVSDKQIRLKI SPNVL+ITLVDLPGI+KVPVGDQPSDIEARIR MIMSYIK  + +IL
Sbjct  141  KGVSDKQIRLKICSPNVLNITLVDLPGISKVPVGDQPSDIEARIRNMIMSYIKQETSIIL  200

Query  797  AVTPANAD  820
            AV+PANAD
Sbjct  201  AVSPANAD  208



>ref|XP_010324550.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Solanum 
lycopersicum]
Length=772

 Score =   238 bits (607),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 155/187 (83%), Gaps = 4/187 (2%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQ----STIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            +G SVIPI+NKLQDIF+ LG      + + LPQVAV+GSQSSGKSSVLEALVGRDFLPRG
Sbjct  26   IGSSVIPIINKLQDIFSPLGDIDDRFTGLRLPQVAVIGSQSSGKSSVLEALVGRDFLPRG  85

Query  440  SDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNK  619
             DICTRRPLVLQL +   +  +   EWGEF HL  K+F+DF+ IR+EI AET++E G NK
Sbjct  86   CDICTRRPLVLQLEKRSAEIGNDSLEWGEFGHLSEKRFYDFSAIRREILAETEKEVGVNK  145

Query  620  GVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILA  799
            GVSDKQIRLKI SPNVL+ITLVDLPGITKVPVGDQPSDIEARIR MIMSYIK  + +ILA
Sbjct  146  GVSDKQIRLKICSPNVLNITLVDLPGITKVPVGDQPSDIEARIRDMIMSYIKQETSIILA  205

Query  800  VTPANAD  820
            V+PANAD
Sbjct  206  VSPANAD  212



>ref|XP_010692951.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=807

 Score =   238 bits (607),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 163/207 (79%), Gaps = 17/207 (8%)
 Frame = +2

Query  242  TSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQ--STIELPqvavvgsqssgkssvLEALV  415
            +ST++ +   +G SVIPI+NKLQDI + LGS   S I LP VAVVGSQSSGKSSVLEALV
Sbjct  40   SSTTSHSHPTIGSSVIPIINKLQDILSPLGSDELSKIPLPHVAVVGSQSSGKSSVLEALV  99

Query  416  GRDFLPRGSDICTRRPLVLQLLQTKRKPDST------------DEEWGEFLHLPGKKFFD  559
            GRDFLPRG +ICTR PL+LQL   +R+P +             D EWGEFLHLP  +F+D
Sbjct  100  GRDFLPRGCEICTRCPLILQL---ERRPTAKSSDEHGGVVVDDDREWGEFLHLPHSRFYD  156

Query  560  FNDIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIE  739
            F+ IRKEIQ ET+REAG NKGVS+K IRLKI SPNVL+ITL+DLPGITKVPVGDQP+DIE
Sbjct  157  FSRIRKEIQTETEREAGKNKGVSEKPIRLKISSPNVLNITLIDLPGITKVPVGDQPTDIE  216

Query  740  ARIRTMIMSYIKLPSCLILAVTPANAD  820
            ARIR MIM +I+  +C+ILAV+PAN+D
Sbjct  217  ARIRKMIMDHIRQENCIILAVSPANSD  243



>ref|XP_010692952.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=797

 Score =   238 bits (606),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 163/207 (79%), Gaps = 17/207 (8%)
 Frame = +2

Query  242  TSTSNLNAAPLGHSVIPIVNKLQDIFAQLGSQ--STIELPqvavvgsqssgkssvLEALV  415
            +ST++ +   +G SVIPI+NKLQDI + LGS   S I LP VAVVGSQSSGKSSVLEALV
Sbjct  40   SSTTSHSHPTIGSSVIPIINKLQDILSPLGSDELSKIPLPHVAVVGSQSSGKSSVLEALV  99

Query  416  GRDFLPRGSDICTRRPLVLQLLQTKRKPDST------------DEEWGEFLHLPGKKFFD  559
            GRDFLPRG +ICTR PL+LQL   +R+P +             D EWGEFLHLP  +F+D
Sbjct  100  GRDFLPRGCEICTRCPLILQL---ERRPTAKSSDEHGGVVVDDDREWGEFLHLPHSRFYD  156

Query  560  FNDIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIE  739
            F+ IRKEIQ ET+REAG NKGVS+K IRLKI SPNVL+ITL+DLPGITKVPVGDQP+DIE
Sbjct  157  FSRIRKEIQTETEREAGKNKGVSEKPIRLKISSPNVLNITLIDLPGITKVPVGDQPTDIE  216

Query  740  ARIRTMIMSYIKLPSCLILAVTPANAD  820
            ARIR MIM +I+  +C+ILAV+PAN+D
Sbjct  217  ARIRKMIMDHIRQENCIILAVSPANSD  243



>ref|XP_002945702.1| dynamin-related GTPase [Volvox carteri f. nagariensis]
 gb|EFJ52697.1| dynamin-related GTPase [Volvox carteri f. nagariensis]
Length=924

 Score =   239 bits (609),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 151/183 (83%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+S+IPIVNKLQDIF Q+     ++LPQVAVVGSQSSGKSSVLEALVGRDFLPRG+DI 
Sbjct  11   LGNSLIPIVNKLQDIFTQVTVDLKLDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDIV  70

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPL+LQL++T   P     EWGEFLH PGK F+DF+ IR+EIQ ETDR  G NK VSD
Sbjct  71   TRRPLLLQLIKTAPGPSGRPSEWGEFLHAPGKMFYDFDRIRQEIQQETDRLVGANKNVSD  130

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            K IRLKIFSP VL +TLVDLPG+T++PVGDQP DIEARIR M + Y++ P+C+ILAV+PA
Sbjct  131  KPIRLKIFSPRVLTMTLVDLPGLTRIPVGDQPGDIEARIREMALEYVRRPNCVILAVSPA  190

Query  812  NAD  820
            N D
Sbjct  191  NVD  193



>ref|XP_009768868.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Nicotiana 
sylvestris]
Length=736

 Score =   236 bits (602),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGS----QSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            +G SVIP++NKLQDIFA LG      + + LPQVAV+GSQSSGKSSVLEALVGRDFLPRG
Sbjct  21   IGSSVIPLINKLQDIFAPLGDIDDRLTGLRLPQVAVIGSQSSGKSSVLEALVGRDFLPRG  80

Query  440  SDICTRRPLVLQL-LQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGN  616
            +DICTRRPL+LQL  +T    D+   E+GEF HLP K+F+DF+DIR EI  ET +E G N
Sbjct  81   TDICTRRPLLLQLEKRTIGVGDNDSREYGEFGHLPDKRFYDFSDIRCEILVETAKEVGVN  140

Query  617  KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLIL  796
            KGVSDKQIRLKI SPNVL+ITLVDLPGI+KVPVGDQPSDIEARIR MIMSYIK  + +IL
Sbjct  141  KGVSDKQIRLKICSPNVLNITLVDLPGISKVPVGDQPSDIEARIRNMIMSYIKQETSIIL  200

Query  797  AVTPANAD  820
            AV+PANAD
Sbjct  201  AVSPANAD  208



>ref|XP_009768869.1| PREDICTED: dynamin-related protein 3A-like isoform X3 [Nicotiana 
sylvestris]
Length=683

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGS----QSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            +G SVIP++NKLQDIFA LG      + + LPQVAV+GSQSSGKSSVLEALVGRDFLPRG
Sbjct  21   IGSSVIPLINKLQDIFAPLGDIDDRLTGLRLPQVAVIGSQSSGKSSVLEALVGRDFLPRG  80

Query  440  SDICTRRPLVLQLLQ-TKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGN  616
            +DICTRRPL+LQL + T    D+   E+GEF HLP K+F+DF+DIR EI  ET +E G N
Sbjct  81   TDICTRRPLLLQLEKRTIGVGDNDSREYGEFGHLPDKRFYDFSDIRCEILVETAKEVGVN  140

Query  617  KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLIL  796
            KGVSDKQIRLKI SPNVL+ITLVDLPGI+KVPVGDQPSDIEARIR MIMSYIK  + +IL
Sbjct  141  KGVSDKQIRLKICSPNVLNITLVDLPGISKVPVGDQPSDIEARIRNMIMSYIKQETSIIL  200

Query  797  AVTPANAD  820
            AV+PANAD
Sbjct  201  AVSPANAD  208



>ref|XP_001415897.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94189.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=703

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 154/188 (82%), Gaps = 9/188 (5%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQST--IELPqvavvgsqssgkssvLEALVGRDFLPRGSD  445
            LG  ++P+VN+LQDIFA  G + +  ++LP +AVVGSQSSGKSSVLEALVGRDFLPRG D
Sbjct  11   LGAGLVPLVNRLQDIFASAGVRGSKLVDLPCIAVVGSQSSGKSSVLEALVGRDFLPRGPD  70

Query  446  ICTRRPLVLQLLQT---KRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGN  616
            ICTRRPL+LQL+ T   + +P    EEWGEFLH PG+ + DF +IR+EIQAETDR  G N
Sbjct  71   ICTRRPLLLQLVHTPAVRGEP----EEWGEFLHQPGRTYTDFEEIREEIQAETDRTTGNN  126

Query  617  KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLIL  796
            KGVS+KQIRLKI SPNVL +TLVDLPGIT+V VGDQP DIE +IR MI+SYIK  +CLIL
Sbjct  127  KGVSNKQIRLKICSPNVLTMTLVDLPGITRVAVGDQPEDIETQIRNMILSYIKKETCLIL  186

Query  797  AVTPANAD  820
            AVTPAN+D
Sbjct  187  AVTPANSD  194



>ref|XP_009768867.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Nicotiana 
sylvestris]
Length=767

 Score =   236 bits (601),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGS----QSTIELPqvavvgsqssgkssvLEALVGRDFLPRG  439
            +G SVIP++NKLQDIFA LG      + + LPQVAV+GSQSSGKSSVLEALVGRDFLPRG
Sbjct  21   IGSSVIPLINKLQDIFAPLGDIDDRLTGLRLPQVAVIGSQSSGKSSVLEALVGRDFLPRG  80

Query  440  SDICTRRPLVLQLLQ-TKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGN  616
            +DICTRRPL+LQL + T    D+   E+GEF HLP K+F+DF+DIR EI  ET +E G N
Sbjct  81   TDICTRRPLLLQLEKRTIGVGDNDSREYGEFGHLPDKRFYDFSDIRCEILVETAKEVGVN  140

Query  617  KGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLIL  796
            KGVSDKQIRLKI SPNVL+ITLVDLPGI+KVPVGDQPSDIEARIR MIMSYIK  + +IL
Sbjct  141  KGVSDKQIRLKICSPNVLNITLVDLPGISKVPVGDQPSDIEARIRNMIMSYIKQETSIIL  200

Query  797  AVTPANAD  820
            AV+PANAD
Sbjct  201  AVSPANAD  208



>gb|KDD74598.1| dynamin, partial [Helicosporidium sp. ATCC 50920]
Length=241

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 154/190 (81%), Gaps = 7/190 (4%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LGH++IPI+NKLQDIFAQL  +  ++LPQVAV+GSQSSGKSSVLE+LVGRDFLPRG ++ 
Sbjct  11   LGHALIPIINKLQDIFAQLLPEMKLDLPQVAVIGSQSSGKSSVLESLVGRDFLPRGCNVV  70

Query  452  TRRPLVLQLLQTKRKPDSTD-------EEWGEFLHLPGKKFFDFNDIRKEIQAETDREAG  610
            TRRPL+LQL++     ++ +       +EWGEFLHLPGK+F DF  IR EIQ+ETDR AG
Sbjct  71   TRRPLILQLVRVPAVGEADEGGSRSSLQEWGEFLHLPGKRFHDFERIRGEIQSETDRLAG  130

Query  611  GNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCL  790
             NKGV +  IRL+I SP+VL +TLVDLPGIT+V VGDQP+DIE+RIR +  ++I+  SCL
Sbjct  131  TNKGVCEAPIRLRICSPHVLTMTLVDLPGITRVAVGDQPADIESRIRALNRAFIEPASCL  190

Query  791  ILAVTPANAD  820
            ILAV+PANAD
Sbjct  191  ILAVSPANAD  200



>ref|XP_006653321.1| PREDICTED: dynamin-related protein 3A-like, partial [Oryza brachyantha]
Length=730

 Score =   233 bits (594),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 120/138 (87%), Gaps = 5/138 (4%)
 Frame = +2

Query  407  ALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQ  586
            ALVGRDFLPRG DICTRRPLVLQL++      S  EEWGEFLH PG++F DF  I++EIQ
Sbjct  1    ALVGRDFLPRGPDICTRRPLVLQLVR-----HSAAEEWGEFLHAPGRRFHDFEQIKREIQ  55

Query  587  AETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMS  766
             ETD EAGGNKGVS+KQIRLKIFSPNVLDITLVDLPGIT+VPVGDQPSDIE+RIR MIM 
Sbjct  56   LETDNEAGGNKGVSEKQIRLKIFSPNVLDITLVDLPGITRVPVGDQPSDIESRIRAMIMQ  115

Query  767  YIKLPSCLILAVTPANAD  820
            YIK PSC+ILAVTPANAD
Sbjct  116  YIKHPSCIILAVTPANAD  133



>ref|XP_011400707.1| Dynamin-1-like protein [Auxenochlorella protothecoides]
 gb|KFM27720.1| Dynamin-1-like protein [Auxenochlorella protothecoides]
Length=604

 Score =   229 bits (585),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 150/183 (82%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG ++IP++NKLQD+FAQ+     ++LPQVAV+GSQSSGKSSVLEALVGRDFLPRGS+I 
Sbjct  18   LGQTLIPVINKLQDVFAQVSPDVRLDLPQVAVIGSQSSGKSSVLEALVGRDFLPRGSNIV  77

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPL+LQL++    P     +WGEFLH  GK+F DF+ IR+EI AETDR  G NKGVSD
Sbjct  78   TRRPLILQLIKIPPSPAGPAGDWGEFLHCHGKRFHDFDRIRQEILAETDRLVGTNKGVSD  137

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            K IRLKI+S +VL +TLVDLPGIT+VPVGDQP+DIEAR+R M++ YI   SC+ILAVTPA
Sbjct  138  KPIRLKIYSSSVLTMTLVDLPGITRVPVGDQPNDIEARVRAMVLDYIAAESCIILAVTPA  197

Query  812  NAD  820
            N D
Sbjct  198  NQD  200



>ref|XP_001697229.1| dynamin-related GTPase [Chlamydomonas reinhardtii]
 gb|EDP00484.1| dynamin-related GTPase [Chlamydomonas reinhardtii]
Length=898

 Score =   234 bits (596),  Expect = 9e-67, Method: Composition-based stats.
 Identities = 129/183 (70%), Positives = 149/183 (81%), Gaps = 0/183 (0%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG+S+IPIVNKLQDIFAQ+     ++LPQVAVVGSQSSGKSSVLEALVGRDFLPRG+DI 
Sbjct  11   LGNSLIPIVNKLQDIFAQVTVDLKLDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDIV  70

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSD  631
            TRRPL+LQL++T   P     EWGEFLH PGK F+DF+ IR EI  ET+R  G NK VSD
Sbjct  71   TRRPLLLQLVKTTPGPTGRPSEWGEFLHAPGKMFYDFDRIRDEIHQETERLVGYNKNVSD  130

Query  632  KQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPA  811
            K IRLKIFSP VL +TLVDLPG+T+VPVGDQP DIE RIR M + YI+ P+C+ILAV+PA
Sbjct  131  KPIRLKIFSPRVLTMTLVDLPGLTRVPVGDQPGDIEQRIREMALEYIRRPNCIILAVSPA  190

Query  812  NAD  820
            N D
Sbjct  191  NVD  193



>gb|KDO44155.1| hypothetical protein CISIN_1g003355mg [Citrus sinensis]
Length=792

 Score =   231 bits (590),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 147/161 (91%), Gaps = 6/161 (4%)
 Frame = +2

Query  215  MAEEAVPSSTST-SNLNAAPLGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgk  391
            MA+E   ++T+  S  +A PLG SVIP+VNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK
Sbjct  1    MADEPATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGK  60

Query  392  ssvLEALVGRDFLPRGSDICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDI  571
            SSVLEALVGRDFLPRG+DICTRRPLVLQLLQTK     TDEE+GEFLHLPGK+F+DF++I
Sbjct  61   SSVLEALVGRDFLPRGNDICTRRPLVLQLLQTK-----TDEEYGEFLHLPGKRFYDFSEI  115

Query  572  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLP  694
            R+EIQA+TD+EAGGNKGVSDKQIRLKIFSP+VLDITLVDLP
Sbjct  116  RREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLP  156



>ref|XP_002506618.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67876.1| predicted protein [Micromonas sp. RCC299]
Length=742

 Score =   231 bits (588),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 155/197 (79%), Gaps = 7/197 (4%)
 Frame = +2

Query  251  SNLNAAPLGHSVIPIVNKLQDIFAQLGSQST---IELPqvavvgsqssgkssvLEALVGR  421
            ++++   LG  ++P++NKLQDIF Q G  +    +ELPQ+AVVGSQSSGKSSVLEALVGR
Sbjct  4    AHIHQNTLGDGLVPLINKLQDIFTQAGVDNVGGDLELPQIAVVGSQSSGKSSVLEALVGR  63

Query  422  DFLPRGSDICTRRPLVLQLLQTKRKPDSTDE----EWGEFLHLPGKKFFDFNDIRKEIQA  589
            DFLPRG DICTRRPLVLQL+ T  +  S       EWGEFLH PG+ F +F  IR+EI+ 
Sbjct  64   DFLPRGPDICTRRPLVLQLVHTPYQHASHHNQAPMEWGEFLHRPGEIFTEFEAIREEIEC  123

Query  590  ETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSY  769
            ET+R  G NKGVSDKQIRLKI SP+VL +TLVDLPGIT+VPVGDQP+DIE RIR MI+SY
Sbjct  124  ETNRGTGTNKGVSDKQIRLKICSPHVLTMTLVDLPGITRVPVGDQPADIEKRIRDMILSY  183

Query  770  IKLPSCLILAVTPANAD  820
            IK  SCLILAV+PAN D
Sbjct  184  IKRESCLILAVSPANTD  200



>ref|XP_003063165.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52301.1| predicted protein [Micromonas pusilla CCMP1545]
Length=757

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 153/199 (77%), Gaps = 12/199 (6%)
 Frame = +2

Query  260  NAAPLGHSVIPIVNKLQDIFAQLGSQ-STIELPqvavvgsqssgkssvLEALVGRDFLPR  436
            +A  LG  ++P++N+LQDIF+Q G   + +ELPQ+AVVGSQSSGKSSVLEALVGRDFLPR
Sbjct  7    HAHTLGDGLVPLINRLQDIFSQAGGGIADLELPQIAVVGSQSSGKSSVLEALVGRDFLPR  66

Query  437  GSDICTRRPLVLQLLQT-----------KRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEI  583
            G DICTRRPLVLQL+ T                    EWGEFLH PG+ F DF  IR+EI
Sbjct  67   GPDICTRRPLVLQLVHTPYGAHHAHAAAHHGGHGPPAEWGEFLHRPGEIFTDFEAIREEI  126

Query  584  QAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIM  763
            + ET+R  G NKGVSDKQIRLKI SP+VL +TLVDLPG+T+VPVGDQP+DIE +IR MI+
Sbjct  127  ECETNRGVGSNKGVSDKQIRLKINSPHVLTMTLVDLPGVTRVPVGDQPADIEKQIRNMIL  186

Query  764  SYIKLPSCLILAVTPANAD  820
            SYIK  SCLILAV+PAN+D
Sbjct  187  SYIKRDSCLILAVSPANSD  205



>gb|ABN14947.1| dynamin 1 [Taenia asiatica]
Length=196

 Score =   213 bits (542),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 143/181 (79%), Gaps = 7/181 (4%)
 Frame = +2

Query  278  HSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTR  457
              +IP+VNKLQD F+ LG    ++LPQ+AVVGSQS+GKSSVLE  VGRDFLPRGS I TR
Sbjct  8    EQLIPLVNKLQDAFSSLGVPLNLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTR  67

Query  458  RPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSDKQ  637
            RPLVLQL+       ++D E+ EFLHL G K  DF+D+RKEI+AETDRE G NKG+S+K 
Sbjct  68   RPLVLQLI-------TSDAEYAEFLHLNGVKLTDFDDVRKEIEAETDRETGTNKGISNKP  120

Query  638  IRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPANA  817
            I LKI+SPNVL++TL+DLPG+TKVPVGDQPSDI A I  MI+ YI    CLILAV+PAN+
Sbjct  121  INLKIYSPNVLNLTLIDLPGMTKVPVGDQPSDISALIEEMILQYINCDYCLILAVSPANS  180

Query  818  D  820
            D
Sbjct  181  D  181



>ref|XP_005646215.1| hypothetical protein COCSUDRAFT_37405 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21671.1| hypothetical protein COCSUDRAFT_37405 [Coccomyxa subellipsoidea 
C-169]
Length=738

 Score =   223 bits (567),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 150/191 (79%), Gaps = 9/191 (5%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDIC  451
            LG ++IP +NKLQDIF+Q+     ++LPQVAVVGSQSSGKSSVLEALVGRDFLPRG +IC
Sbjct  6    LGETLIPAINKLQDIFSQVTIDFRLDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGPEIC  65

Query  452  TRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGK--------KFFDFNDIRKEIQAETDREA  607
            TRRPL+LQL++ +        EWGEFLH PGK        +F+DF  IR+EI  ET+R  
Sbjct  66   TRRPLLLQLVK-QAAGSGKAAEWGEFLHCPGKHPPIGNFTRFYDFERIRQEILTETERTV  124

Query  608  GGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSC  787
            G NKG+SDK IRLKI+SPNVL +TLVDLPGI KVPVGDQPSDIE RIR M++ YI+ P+C
Sbjct  125  GHNKGISDKPIRLKIYSPNVLTMTLVDLPGIAKVPVGDQPSDIEKRIRKMVLEYIRHPTC  184

Query  788  LILAVTPANAD  820
            +ILAV+ ANAD
Sbjct  185  VILAVSAANAD  195



>ref|XP_004348308.1| dynamin central region family protein [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE93730.1| dynamin central region family protein [Capsaspora owczarzaki 
ATCC 30864]
Length=823

 Score =   219 bits (557),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 153/203 (75%), Gaps = 26/203 (13%)
 Frame = +2

Query  281  SVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTRR  460
            ++IP++NKLQD+F  +G+++ I+LPQ+AVVGSQSSGKSSVLE +VG+DFLPRG  I TRR
Sbjct  3    NLIPVINKLQDVFTTVGAEA-IQLPQIAVVGSQSSGKSSVLENIVGKDFLPRGHGIVTRR  61

Query  461  PLVLQLLQTKRKPDS---------------TD--------EEWGEFLHLPGKKFFDFNDI  571
            PL+LQL+   RKP S               TD        EEWGEFLH PGK+F  F +I
Sbjct  62   PLILQLVH--RKPGSPRPALPDDPSSSGGHTDDGIDGEDVEEWGEFLHAPGKRFISFAEI  119

Query  572  RKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIR  751
            RKEI+AETDR  G NKG+S K I L+I+SPNVL++TLVDLPGITKVPVGDQP DIE +IR
Sbjct  120  RKEIEAETDRVTGSNKGISSKPINLRIYSPNVLNLTLVDLPGITKVPVGDQPEDIEKQIR  179

Query  752  TMIMSYIKLPSCLILAVTPANAD  820
            T++ SYI  P+C+ILAVTPAN D
Sbjct  180  TLVRSYISNPNCIILAVTPANVD  202



>ref|XP_002683124.1| dynamin [Naegleria gruberi]
 gb|EFC50380.1| dynamin [Naegleria gruberi]
Length=826

 Score =   218 bits (555),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 144/181 (80%), Gaps = 7/181 (4%)
 Frame = +2

Query  284  VIPIVNKLQDIFAQLGSQ--STIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTR  457
            +IP++N+LQD+F+ +G    + I+LPQ+AVVGSQSSGKSSVLE +VGRDFLPRGS I TR
Sbjct  4    LIPVINRLQDVFSNIGLNDLAQIDLPQIAVVGSQSSGKSSVLETIVGRDFLPRGSGIVTR  63

Query  458  RPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSDKQ  637
            RPLVLQL+  K      +EEWGEFLH+P KKF DF +I+ EI  ETDR  G NK +S+K 
Sbjct  64   RPLVLQLINVK-----NEEEWGEFLHVPNKKFNDFAEIKNEIVRETDRLTGSNKNISEKP  118

Query  638  IRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPANA  817
            I LKIFSPNVLD+TLVDLPGITKV +GDQP DIE +IR MIM+YI  P+CLILAVT AN 
Sbjct  119  INLKIFSPNVLDLTLVDLPGITKVAIGDQPKDIEIQIRNMIMNYINKPNCLILAVTAANT  178

Query  818  D  820
            D
Sbjct  179  D  179



>ref|XP_010795744.1| PREDICTED: dynamin-1-like [Notothenia coriiceps]
Length=399

 Score =   209 bits (532),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 140/181 (77%), Gaps = 7/181 (4%)
 Frame = +2

Query  278  HSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTR  457
              +IP+VNKLQD F+ +G    ++LPQ+AVVG QS+GKSSVLE  VGRDFLPRGS I TR
Sbjct  7    EDLIPLVNKLQDAFSYIGQACNLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTR  66

Query  458  RPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSDKQ  637
            RPLVLQL+       S   EW EFLH  GKKF DF+++R+EI+AETDR  G NKG+S   
Sbjct  67   RPLVLQLI-------SATAEWAEFLHCKGKKFTDFDEVRQEIEAETDRAVGANKGISPIP  119

Query  638  IRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPANA  817
            I L+++SP+VL++TL+DLPGITKVPVGDQP DIE +IR MIM +I   SCLILAVTPAN+
Sbjct  120  INLRVYSPHVLNLTLIDLPGITKVPVGDQPVDIEQQIRDMIMQFITRESCLILAVTPANS  179

Query  818  D  820
            D
Sbjct  180  D  180



>gb|AAX27772.2| SJCHGC03526 protein [Schistosoma japonicum]
Length=232

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 143/181 (79%), Gaps = 7/181 (4%)
 Frame = +2

Query  278  HSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTR  457
              +IP+VN+LQD F+ LG    ++LPQ+AVVGSQS+GKSSVLE  VGRDFLPRGS I TR
Sbjct  2    EQLIPLVNRLQDAFSSLGVPLNLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTR  61

Query  458  RPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSDKQ  637
            RPLVLQL+ ++        E+ EFLH   K+F DF+++RKEI+AETDR  G NKG+S+  
Sbjct  62   RPLVLQLINSR-------NEYAEFLHCKNKQFTDFDEVRKEIEAETDRLTGSNKGISNAP  114

Query  638  IRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPANA  817
            I L+++SPNVL++TL+DLPG+TKVPVGDQP DIE +IR+MI+ +I   +CLILAV+PAN+
Sbjct  115  INLRVYSPNVLNLTLIDLPGMTKVPVGDQPQDIEVQIRSMILEFITQENCLILAVSPANS  174

Query  818  D  820
            D
Sbjct  175  D  175



>ref|XP_005706938.1| dynamin GTPase [Galdieria sulphuraria]
 gb|EME30418.1| dynamin GTPase [Galdieria sulphuraria]
Length=779

 Score =   215 bits (548),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 149/205 (73%), Gaps = 26/205 (13%)
 Frame = +2

Query  284  VIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTRRP  463
            +IP VNKLQD+F QLG  S ++LPQ+ VVGSQSSGKSSVLEA VGRDFLPRGS I TRRP
Sbjct  4    LIPAVNKLQDVFGQLGLDSPVDLPQIMVVGSQSSGKSSVLEAFVGRDFLPRGSGIVTRRP  63

Query  464  LVLQLLQTK--------------------RKPDSTD------EEWGEFLHLPGKKFFDFN  565
             ++Q++QTK                    ++ D T       +EW EFLH+P K+F+DF 
Sbjct  64   TIVQMIQTKPDKLKGEQEEVDKTVEKKGKQQEDETGKDTKYGDEWVEFLHIPNKRFYDFE  123

Query  566  DIRKEIQAETDREAGGNKGVSDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEAR  745
             +R+EI+AETDR  G NKG+S K I LK++SPNV+D+T+VDLPG+TKVPVGDQP DIE  
Sbjct  124  QVRQEIEAETDRTTGKNKGISPKPINLKVYSPNVVDLTVVDLPGLTKVPVGDQPDDIEKL  183

Query  746  IRTMIMSYIKLPSCLILAVTPANAD  820
            IR MIMSYI+ P+ ++LAV PANAD
Sbjct  184  IRAMIMSYIERPNAIVLAVHPANAD  208



>gb|ETP37688.1| hypothetical protein F442_14526 [Phytophthora parasitica P10297]
Length=705

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 145/184 (79%), Gaps = 6/184 (3%)
 Frame = +2

Query  284  VIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTRRP  463
            +IPI+NKLQD+F+ +G QS I LPQ+ V+GSQSSGKSSVLE +VG+DFLPRGS I TRRP
Sbjct  4    LIPIINKLQDVFSAIG-QSPINLPQIVVIGSQSSGKSSVLENIVGKDFLPRGSGIVTRRP  62

Query  464  LVLQLLQTK-----RKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            LVLQL  +         D T EEWGEFLHLPG+KF DFN+IR+EI+ ETDR  G NKG+S
Sbjct  63   LVLQLYNSSATIPVEGADETVEEWGEFLHLPGQKFTDFNEIRREIEKETDRMTGKNKGIS  122

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            +K I LK++SP+VL++TLVDLPGITKVPVGDQP +IE +IR M   +I  P+ +ILAVT 
Sbjct  123  NKSINLKVYSPHVLNLTLVDLPGITKVPVGDQPVNIEEQIRDMCTEFISNPNSIILAVTS  182

Query  809  ANAD  820
            AN D
Sbjct  183  ANTD  186



>gb|ETM39716.1| hypothetical protein L914_14151 [Phytophthora parasitica]
Length=705

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 145/184 (79%), Gaps = 6/184 (3%)
 Frame = +2

Query  284  VIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTRRP  463
            +IPI+NKLQD+F+ +G QS I LPQ+ V+GSQSSGKSSVLE +VG+DFLPRGS I TRRP
Sbjct  4    LIPIINKLQDVFSAIG-QSPINLPQIVVIGSQSSGKSSVLENIVGKDFLPRGSGIVTRRP  62

Query  464  LVLQLLQTK-----RKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            LVLQL  +         D T EEWGEFLHLPG+KF DFN+IR+EI+ ETDR  G NKG+S
Sbjct  63   LVLQLYNSSATIPVEGADETVEEWGEFLHLPGQKFTDFNEIRREIEKETDRMTGKNKGIS  122

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            +K I LK++SP+VL++TLVDLPGITKVPVGDQP +IE +IR M   +I  P+ +ILAVT 
Sbjct  123  NKSINLKVYSPHVLNLTLVDLPGITKVPVGDQPVNIEEQIRDMCTEFISNPNSIILAVTS  182

Query  809  ANAD  820
            AN D
Sbjct  183  ANTD  186



>ref|XP_011215127.1| PREDICTED: LOW QUALITY PROTEIN: dynamin-3-like [Ailuropoda melanoleuca]
Length=197

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 138/181 (76%), Gaps = 7/181 (4%)
 Frame = +2

Query  278  HSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTR  457
              +IP+VN+LQD F+  G    ++LPQ+AVVG QS+GKSSVLE  VGRDFLPRGS I TR
Sbjct  7    EELIPLVNRLQDAFSAXGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTR  66

Query  458  RPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSDKQ  637
            RPLVLQL+ +K        E+ EFLH  GKKF DF+++R EI+AETDR  G NKG+S   
Sbjct  67   RPLVLQLVTSK-------AEYAEFLHCKGKKFTDFDEVRHEIEAETDRVTGMNKGISSIP  119

Query  638  IRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPANA  817
            I L+++SP+VL++TL+DLPGITKVPVGDQP DIE +IR MIM +I   +CLILAVTPAN 
Sbjct  120  INLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANT  179

Query  818  D  820
            D
Sbjct  180  D  180



>ref|XP_008910420.1| hypothetical protein PPTG_15137 [Phytophthora parasitica INRA-310]
 gb|ETI39730.1| hypothetical protein F443_14709 [Phytophthora parasitica P1569]
 gb|ETK79845.1| hypothetical protein L915_14329 [Phytophthora parasitica]
 gb|ETL33264.1| hypothetical protein L916_14234 [Phytophthora parasitica]
 gb|ETL86551.1| hypothetical protein L917_14025 [Phytophthora parasitica]
 gb|ETN04493.1| hypothetical protein PPTG_15137 [Phytophthora parasitica INRA-310]
 gb|ETO68459.1| hypothetical protein F444_14714 [Phytophthora parasitica P1976]
 gb|ETP09590.1| hypothetical protein F441_14568 [Phytophthora parasitica CJ01A1]
Length=705

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 145/184 (79%), Gaps = 6/184 (3%)
 Frame = +2

Query  284  VIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTRRP  463
            +IPI+NKLQD+F+ +G QS I LPQ+ V+GSQSSGKSSVLE +VG+DFLPRGS I TRRP
Sbjct  4    LIPIINKLQDVFSAIG-QSPINLPQIVVIGSQSSGKSSVLENIVGKDFLPRGSGIVTRRP  62

Query  464  LVLQLLQTK-----RKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVS  628
            LVLQL  +         D T EEWGEFLHLPG+KF DFN+IR+EI+ ETDR  G NKG+S
Sbjct  63   LVLQLYNSSATIPVEGADETVEEWGEFLHLPGQKFTDFNEIRREIEKETDRMTGKNKGIS  122

Query  629  DKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTP  808
            +K I LK++SP+VL++TLVDLPGITKVPVGDQP +IE +IR M   +I  P+ +ILAVT 
Sbjct  123  NKSINLKVYSPHVLNLTLVDLPGITKVPVGDQPVNIEEQIRDMCTEFISNPNSIILAVTS  182

Query  809  ANAD  820
            AN D
Sbjct  183  ANTD  186



>ref|XP_007118793.1| PREDICTED: dynamin-3-like, partial [Physeter catodon]
Length=283

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 138/181 (76%), Gaps = 7/181 (4%)
 Frame = +2

Query  278  HSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTR  457
              +IP+VN+LQD F+ LG    +ELPQ+AVVG QS+GKSSVLE  VGRDFLPRGS I TR
Sbjct  7    EELIPLVNRLQDAFSSLGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTR  66

Query  458  RPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSDKQ  637
            RPLVLQL+ +K        E+ EFLH  GKK  DF+++R EI+AETDR  G NKG+S   
Sbjct  67   RPLVLQLVTSK-------AEYAEFLHCKGKKITDFDEVRHEIEAETDRVTGMNKGISSIP  119

Query  638  IRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPANA  817
            I L+++SP+VL++TL+DLPGITKVPVGDQP DIE +IR MIM +I   SCLILAVTPAN 
Sbjct  120  INLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRESCLILAVTPANT  179

Query  818  D  820
            D
Sbjct  180  D  180



>pdb|3L43|A Chain A, Crystal Structure Of The Dynamin 3 Gtpase Domain Bound 
With Gdp
 pdb|3L43|B Chain B, Crystal Structure Of The Dynamin 3 Gtpase Domain Bound 
With Gdp
 pdb|3L43|C Chain C, Crystal Structure Of The Dynamin 3 Gtpase Domain Bound 
With Gdp
 pdb|3L43|D Chain D, Crystal Structure Of The Dynamin 3 Gtpase Domain Bound 
With Gdp
Length=319

 Score =   204 bits (520),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 139/181 (77%), Gaps = 7/181 (4%)
 Frame = +2

Query  278  HSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTR  457
              +IP+VN+LQD F+ LG    +ELPQ+AVVG QS+GKSSVLE  VGRDFLPRGS I TR
Sbjct  20   EELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTR  79

Query  458  RPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSDKQ  637
            RPLVLQL+ +K        E+ EFLH  GKKF DF+++R EI+AETDR  G NKG+S   
Sbjct  80   RPLVLQLITSK-------AEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIP  132

Query  638  IRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPANA  817
            I L+++SP+VL++TL+DLPGITKVPVGDQP DIE +IR MIM +I   +CLILAVTPAN 
Sbjct  133  INLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANT  192

Query  818  D  820
            D
Sbjct  193  D  193



>gb|EHJ70760.1| putative dynamin [Danaus plexippus]
Length=464

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 141/181 (78%), Gaps = 7/181 (4%)
 Frame = +2

Query  278  HSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTR  457
              +IPIVNKLQD F QLG    ++LPQ+AVVG QS+GKSSVLE  VGRDFLPRGS I TR
Sbjct  2    EQLIPIVNKLQDAFTQLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTR  61

Query  458  RPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSDKQ  637
            RPL+LQL+       +++ E+ EFLH  GKKF DFN++R EI+AETDR  G NKG+S   
Sbjct  62   RPLILQLI-------NSNAEYAEFLHCKGKKFTDFNEVRGEIEAETDRITGSNKGISPVP  114

Query  638  IRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPANA  817
            I L+++SPNVL++TL+DLPG+TKVP+GDQP+DIE +I+ MI  +I+  SCLILAVTPAN 
Sbjct  115  INLRVYSPNVLNLTLIDLPGLTKVPIGDQPADIEQQIKAMIFQFIRRESCLILAVTPANT  174

Query  818  D  820
            D
Sbjct  175  D  175



>ref|XP_011563057.1| PREDICTED: dynamin [Plutella xylostella]
Length=861

 Score =   214 bits (544),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 140/179 (78%), Gaps = 7/179 (4%)
 Frame = +2

Query  284  VIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTRRP  463
            +IPIVNKLQD F QLG    ++LPQ+AVVG QS+GKSSVLE  VGRDFLPRGS I TRRP
Sbjct  10   LIPIVNKLQDAFTQLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRP  69

Query  464  LVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSDKQIR  643
            L+LQL+       + + E+ EFLH  GKKF DFN++R EI+ ETDR  G NKG+S   I 
Sbjct  70   LILQLI-------NANAEYAEFLHCKGKKFVDFNEVRAEIEGETDRMTGSNKGISPVPIN  122

Query  644  LKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPANAD  820
            L+++SPNVL++TL+DLPG+TKVP+GDQP DIEA+IR MIM +IK  SCLILAVTPAN D
Sbjct  123  LRVYSPNVLNLTLIDLPGLTKVPIGDQPVDIEAQIRGMIMQFIKRESCLILAVTPANTD  181



>gb|ENN73805.1| hypothetical protein YQE_09583, partial [Dendroctonus ponderosae]
Length=897

 Score =   213 bits (543),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 142/181 (78%), Gaps = 7/181 (4%)
 Frame = +2

Query  278  HSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTR  457
              +IPIVNKLQD F QLG   T++LPQ+AVVG QS+GKSSVLE  VG+DFLPRGS I TR
Sbjct  8    EQLIPIVNKLQDAFTQLGVHMTLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTR  67

Query  458  RPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSDKQ  637
            RPL+LQL+         + E+GEFLH  GKKF DF++IR+EI+ ETDR  GGNKG+S+  
Sbjct  68   RPLILQLIHG-------NAEYGEFLHCKGKKFVDFDEIRREIEGETDRVTGGNKGISNIP  120

Query  638  IRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPANA  817
            I L+++SPNVL++TL+DLPG+TKVP+GDQP DIE +IR MI  +IK  SCLILAVTPAN 
Sbjct  121  INLRVYSPNVLNLTLIDLPGLTKVPIGDQPIDIEQQIRNMINQFIKRDSCLILAVTPANT  180

Query  818  D  820
            D
Sbjct  181  D  181



>emb|CEF96728.1| P-loop containing nucleoside triphosphate hydrolase [Ostreococcus 
tauri]
Length=705

 Score =   212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 151/185 (82%), Gaps = 4/185 (2%)
 Frame = +2

Query  272  LGHSVIPIVNKLQDIFAQLGSQST--IELPqvavvgsqssgkssvLEALVGRDFLPRGSD  445
            LG  ++P+VN+LQDIFA  G + +  ++LP +AVVGSQSSGKSSVLEALVGRDFLPRG D
Sbjct  11   LGQGLVPLVNRLQDIFASAGLRGSKAVDLPCIAVVGSQSSGKSSVLEALVGRDFLPRGPD  70

Query  446  ICTRRPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGV  625
            ICTRRPL+LQL+ T  +     EEWGEFLHLPGK + +F +IR EI+AETDR  G NK V
Sbjct  71   ICTRRPLLLQLVHTPAR-RGEPEEWGEFLHLPGKIYTNFEEIRAEIEAETDRTCG-NKAV  128

Query  626  SDKQIRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVT  805
            S+KQIRLKI SPNVL +TLVDLPGIT+V VGDQP DIE +IR MI+SYIK  +CLILAVT
Sbjct  129  SNKQIRLKICSPNVLTMTLVDLPGITRVAVGDQPEDIEIQIRNMILSYIKRETCLILAVT  188

Query  806  PANAD  820
            PAN+D
Sbjct  189  PANSD  193



>gb|EDM09408.1| dynamin 3, isoform CRA_c [Rattus norvegicus]
Length=384

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 139/180 (77%), Gaps = 7/180 (4%)
 Frame = +2

Query  281  SVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTRR  460
             +IP+VN+LQD F+ LG    +ELPQ+AVVG QS+GKSSVLE  VGRDFLPRGS I TRR
Sbjct  8    ELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRR  67

Query  461  PLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSDKQI  640
            PLVLQL+ +K        E+ EFLH  GKKF DF+++R EI+AETDR  G NKG+S   I
Sbjct  68   PLVLQLVTSK-------AEYAEFLHCKGKKFTDFDEVRHEIEAETDRVTGMNKGISSVPI  120

Query  641  RLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPANAD  820
             L+++SP+VL++TL+DLPGITKVPVGDQP DIE +IR MIM +I   +CLILAVTPAN D
Sbjct  121  NLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIRDMIMQFITRENCLILAVTPANTD  180



>gb|EPQ08653.1| Dynamin-3 [Myotis brandtii]
Length=407

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 139/180 (77%), Gaps = 7/180 (4%)
 Frame = +2

Query  281  SVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTRR  460
             +IP+VN+LQD F+ LG    +ELPQ+AVVG QS+GKSSVLE  VGRDFLPRGS I TRR
Sbjct  3    ELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRR  62

Query  461  PLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSDKQI  640
            PLVLQL+ +K        E+ EFLH  GKKF DF+++R EI+AETDR  G NKG+S   I
Sbjct  63   PLVLQLVTSK-------TEYAEFLHCKGKKFTDFDEVRHEIEAETDRVTGMNKGISSIPI  115

Query  641  RLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPANAD  820
             L+++SP+VL++TL+DLPGITKVPVGDQP DIE +IR MIM +I   +CLILAVTPAN D
Sbjct  116  NLRVYSPHVLNLTLIDLPGITKVPVGDQPVDIEHQIREMIMQFITRENCLILAVTPANTD  175



>gb|KFM63981.1| Dynamin, partial [Stegodyphus mimosarum]
Length=457

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 145/181 (80%), Gaps = 7/181 (4%)
 Frame = +2

Query  278  HSVIPIVNKLQDIFAQLGSQSTIELPqvavvgsqssgkssvLEALVGRDFLPRGSDICTR  457
             ++IPIVN+LQD F +LG   +++LPQ+AV+G QS+GKSSVLE  VG+DFLPRGS I TR
Sbjct  8    ENLIPIVNRLQDAFTKLGVNLSLDLPQIAVIGGQSAGKSSVLENFVGKDFLPRGSGIVTR  67

Query  458  RPLVLQLLQTKRKPDSTDEEWGEFLHLPGKKFFDFNDIRKEIQAETDREAGGNKGVSDKQ  637
            RPLVLQL+       ++++E+GEFLH  GKKF DF+ IRKEI+ ETDR  G NKG+S+  
Sbjct  68   RPLVLQLI-------NSNQEYGEFLHARGKKFTDFDAIRKEIEDETDRMTGSNKGISNAP  120

Query  638  IRLKIFSPNVLDITLVDLPGITKVPVGDQPSDIEARIRTMIMSYIKLPSCLILAVTPANA  817
            I L+++SPNVL++TL+DLPG+T+VPVGDQP DIE +IR M+++YIK  +CLILAVT AN 
Sbjct  121  INLRVYSPNVLNLTLIDLPGMTRVPVGDQPPDIEQQIRDMLLTYIKRETCLILAVTAANQ  180

Query  818  D  820
            D
Sbjct  181  D  181



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1738401790104