BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10804

Length=698
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009798365.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    255   3e-76   Nicotiana sylvestris
ref|XP_011072176.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    254   3e-76   
ref|XP_009613740.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    254   6e-76   Nicotiana tomentosiformis
ref|XP_006344463.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    254   7e-76   Solanum tuberosum [potatoes]
ref|XP_009798366.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    252   1e-75   Nicotiana sylvestris
ref|XP_009613741.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    251   3e-75   
ref|XP_009798364.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    252   3e-75   Nicotiana sylvestris
ref|XP_004236257.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    251   6e-75   Solanum lycopersicum
ref|XP_009613739.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    251   6e-75   Nicotiana tomentosiformis
gb|KHG18909.1|  Ferric reduction oxidase 8, mitochondrial -like p...    238   8e-70   Gossypium arboreum [tree cotton]
emb|CDP12742.1|  unnamed protein product                                238   1e-69   Coffea canephora [robusta coffee]
ref|XP_010037521.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    235   8e-69   Eucalyptus grandis [rose gum]
ref|XP_010037520.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    233   9e-68   Eucalyptus grandis [rose gum]
gb|KJB59689.1|  hypothetical protein B456_009G267500                    231   3e-67   Gossypium raimondii
gb|KJB59688.1|  hypothetical protein B456_009G267500                    231   4e-67   Gossypium raimondii
ref|XP_007036321.1|  Ferric reduction oxidase 8 isoform 1               229   2e-66   
ref|XP_007210738.1|  hypothetical protein PRUPE_ppa021696mg             228   4e-66   
ref|XP_011464152.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    224   1e-64   Fragaria vesca subsp. vesca
ref|XP_011046222.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    224   2e-64   Populus euphratica
gb|KDO69496.1|  hypothetical protein CISIN_1g005126mg                   223   3e-64   Citrus sinensis [apfelsine]
ref|XP_006439912.1|  hypothetical protein CICLE_v10019061mg             223   4e-64   Citrus clementina [clementine]
gb|KDO69497.1|  hypothetical protein CISIN_1g005126mg                   223   5e-64   Citrus sinensis [apfelsine]
ref|XP_006476874.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    222   7e-64   Citrus sinensis [apfelsine]
gb|ADR70889.1|  ferric reductase oxidase                                221   2e-63   Manihot esculenta [manioc]
ref|XP_002321628.1|  ferric reductase-like transmembrane componen...    220   3e-63   Populus trichocarpa [western balsam poplar]
ref|XP_004515872.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    219   1e-62   
gb|EYU22175.1|  hypothetical protein MIMGU_mgv1a002211mg                218   2e-62   Erythranthe guttata [common monkey flower]
ref|XP_002511330.1|  ferric-chelate reductase, putative                 218   2e-62   
gb|KEH31789.1|  oxidoreductase/ferric-chelate reductase                 218   2e-62   Medicago truncatula
ref|XP_012079987.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    215   4e-61   Jatropha curcas
ref|XP_010248638.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    214   4e-61   Nelumbo nucifera [Indian lotus]
ref|XP_008459874.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    214   5e-61   
ref|XP_011656797.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    213   2e-60   Cucumis sativus [cucumbers]
emb|CBI14963.3|  unnamed protein product                                213   2e-60   Vitis vinifera
ref|XP_010102484.1|  Ferric reduction oxidase 8                         213   2e-60   Morus notabilis
ref|XP_008373357.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    209   3e-59   
ref|XP_008373358.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    209   3e-59   
ref|XP_003549599.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    209   6e-59   Glycine max [soybeans]
ref|XP_010663103.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    207   1e-58   Vitis vinifera
ref|XP_002318065.1|  ferric reductase-like transmembrane componen...    201   5e-56   
ref|XP_011047810.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    198   5e-55   Populus euphratica
ref|XP_007155475.1|  hypothetical protein PHAVU_003G204400g             197   6e-55   Phaseolus vulgaris [French bean]
ref|XP_010678862.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    193   3e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009406362.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    188   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009114915.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    188   2e-51   Brassica rapa
ref|XP_009114914.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    188   2e-51   Brassica rapa
gb|KFK26648.1|  hypothetical protein AALP_AA8G275500                    187   4e-51   Arabis alpina [alpine rockcress]
emb|CDY22585.1|  BnaC05g24230D                                          186   8e-51   Brassica napus [oilseed rape]
gb|KGN46442.1|  hypothetical protein Csa_6G093620                       181   4e-49   Cucumis sativus [cucumbers]
ref|XP_010906716.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    179   2e-48   Elaeis guineensis
ref|XP_010533458.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    178   4e-48   Tarenaya hassleriana [spider flower]
ref|XP_010533455.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    178   4e-48   Tarenaya hassleriana [spider flower]
ref|XP_008777197.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    178   4e-48   Phoenix dactylifera
ref|XP_008238075.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    174   7e-48   
ref|XP_008239582.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    175   3e-47   
ref|NP_199827.2|  ferric reduction oxidase 8                            174   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482319.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    174   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010482321.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    173   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010442495.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    173   2e-46   Camelina sativa [gold-of-pleasure]
dbj|BAB09387.1|  FRO1 and FRO2-like protein                             173   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442496.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    173   3e-46   Camelina sativa [gold-of-pleasure]
ref|XP_002864039.1|  ATFRO8/FRO8                                        173   3e-46   Arabidopsis lyrata subsp. lyrata
ref|XP_006280084.1|  hypothetical protein CARUB_v10025968mg             170   2e-45   
ref|XP_006280085.1|  hypothetical protein CARUB_v10025968mg             170   5e-45   Capsella rubella
ref|XP_006852345.2|  PREDICTED: ferric reduction oxidase 8, mitoc...    169   9e-45   Amborella trichopoda
ref|XP_010472423.1|  PREDICTED: LOW QUALITY PROTEIN: ferric reduc...    166   6e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006402177.1|  hypothetical protein EUTSA_v10012790mg             164   8e-43   Eutrema salsugineum [saltwater cress]
ref|XP_010678863.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    149   6e-38   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY12264.1|  BnaA09g24640D                                          149   8e-38   Brassica napus [oilseed rape]
emb|CAN79355.1|  hypothetical protein VITISV_010064                     125   1e-29   Vitis vinifera
ref|XP_007215241.1|  hypothetical protein PRUPE_ppa014585mg             124   3e-29   
gb|KHN34351.1|  Ferric reduction oxidase 8, mitochondrial               115   1e-26   Glycine soja [wild soybean]
ref|XP_009363039.1|  PREDICTED: LOW QUALITY PROTEIN: ferric reduc...    116   2e-26   
ref|XP_011629093.1|  PREDICTED: ferric reduction oxidase 2              111   4e-24   
ref|XP_002320814.1|  ferric-chelate reductase family protein            110   9e-24   Populus trichocarpa [western balsam poplar]
ref|XP_010255644.1|  PREDICTED: uncharacterized protein LOC104596257    111   9e-24   
gb|AES62463.2|  oxidoreductase/ferric-chelate reductase                 108   5e-23   Medicago truncatula
ref|XP_003592212.1|  NADPH oxidase                                      107   6e-23   
ref|XP_011468990.1|  PREDICTED: ferric reduction oxidase 2-like i...    106   1e-22   Fragaria vesca subsp. vesca
ref|XP_008803959.1|  PREDICTED: ferric reduction oxidase 2-like         106   2e-22   Phoenix dactylifera
ref|XP_004308349.1|  PREDICTED: ferric reduction oxidase 2-like i...    105   2e-22   Fragaria vesca subsp. vesca
emb|CDY07230.1|  BnaCnng02450D                                          105   5e-22   
ref|XP_010112949.1|  Ferric reduction oxidase 2                         105   5e-22   Morus notabilis
ref|XP_009111537.1|  PREDICTED: ferric reduction oxidase 2-like         104   6e-22   Brassica rapa
ref|XP_002511897.1|  ferric-chelate reductase, putative                 104   8e-22   Ricinus communis
gb|KHM99348.1|  Ferric reduction oxidase 3, mitochondrial               103   1e-21   Glycine soja [wild soybean]
ref|XP_012083332.1|  PREDICTED: ferric reduction oxidase 2-like i...    103   1e-21   
ref|XP_010669978.1|  PREDICTED: ferric reduction oxidase 2-like         103   1e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007051741.1|  Ferric reduction oxidase 2, putative               103   2e-21   
ref|XP_006602816.1|  PREDICTED: ferric reduction oxidase 2-like i...    103   2e-21   
ref|XP_003552408.1|  PREDICTED: ferric reduction oxidase 2-like i...    103   2e-21   
emb|CDY38012.1|  BnaCnng08730D                                          100   2e-21   Brassica napus [oilseed rape]
ref|XP_012083333.1|  PREDICTED: ferric reduction oxidase 2-like i...    102   3e-21   
gb|KFK42543.1|  hypothetical protein AALP_AA1G008100                    102   4e-21   Arabis alpina [alpine rockcress]
ref|XP_010556561.1|  PREDICTED: ferric reduction oxidase 2              102   5e-21   Tarenaya hassleriana [spider flower]
gb|ADR70886.1|  ferric reductase oxidase                                102   6e-21   Manihot esculenta [manioc]
ref|XP_003548660.1|  PREDICTED: ferric reduction oxidase 2-like i...    101   1e-20   
ref|XP_006287152.1|  hypothetical protein CARUB_v10000325mg             101   1e-20   
ref|XP_007143462.1|  hypothetical protein PHAVU_007G073900g             100   1e-20   Phaseolus vulgaris [French bean]
ref|XP_011036851.1|  PREDICTED: ferric reduction oxidase 2              100   1e-20   Populus euphratica
gb|AHW49458.1|  ferric reductase                                        100   1e-20   Phaseolus vulgaris [French bean]
gb|AHW49440.1|  ferric reductase                                        100   2e-20   Phaseolus vulgaris [French bean]
gb|AHW49435.1|  ferric reductase                                        100   2e-20   Phaseolus vulgaris [French bean]
gb|ADL59931.1|  ferric reductase                                        100   2e-20   Phaseolus vulgaris [French bean]
ref|XP_003528842.1|  PREDICTED: ferric reduction oxidase 2-like i...    100   2e-20   
ref|XP_009367867.1|  PREDICTED: ferric reduction oxidase 2-like         100   2e-20   Pyrus x bretschneideri [bai li]
ref|XP_012083331.1|  PREDICTED: ferric reduction oxidase 2-like i...    100   2e-20   Jatropha curcas
ref|XP_006598945.1|  PREDICTED: ferric reduction oxidase 2-like i...    100   3e-20   Glycine max [soybeans]
ref|XP_002875038.1|  hypothetical protein ARALYDRAFT_912220             100   3e-20   
ref|XP_009118816.1|  PREDICTED: ferric reduction oxidase 2            99.8    3e-20   Brassica rapa
ref|XP_010426833.1|  PREDICTED: ferric reduction oxidase 2-like       99.8    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_012083335.1|  PREDICTED: ferric reduction oxidase 2-like i...  99.8    4e-20   Jatropha curcas
ref|XP_004510756.1|  PREDICTED: ferric reduction oxidase 2-like       99.4    4e-20   Cicer arietinum [garbanzo]
gb|AED02589.1|  ferric reductase                                      99.0    6e-20   Lotus japonicus
gb|AED02590.1|  ferric reductase                                      99.0    6e-20   Lotus japonicus
ref|XP_004510757.1|  PREDICTED: ferric reduction oxidase 2-like       98.6    8e-20   Cicer arietinum [garbanzo]
gb|KHN26943.1|  Ferric reduction oxidase 2                            98.6    8e-20   Glycine soja [wild soybean]
ref|XP_003528841.1|  PREDICTED: ferric reduction oxidase 2-like i...  98.6    8e-20   Glycine max [soybeans]
gb|AES62461.2|  oxidoreductase/ferric-chelate reductase               98.2    1e-19   Medicago truncatula
ref|XP_010270349.1|  PREDICTED: probable ferric reduction oxidase 1   98.2    1e-19   Nelumbo nucifera [Indian lotus]
ref|XP_003592210.1|  Ferric-chelate reductase                         98.2    1e-19   
ref|XP_012083336.1|  PREDICTED: ferric reduction oxidase 2-like i...  97.4    1e-19   
ref|XP_010477584.1|  PREDICTED: ferric reduction oxidase 3, mitoc...  97.8    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_009367868.1|  PREDICTED: ferric reduction oxidase 2-like       97.4    2e-19   
ref|XP_002272836.2|  PREDICTED: ferric reduction oxidase 4            97.4    2e-19   Vitis vinifera
ref|XP_009119709.1|  PREDICTED: ferric reduction oxidase 2            97.4    2e-19   Brassica rapa
ref|XP_012083334.1|  PREDICTED: ferric reduction oxidase 2-like i...  97.4    2e-19   Jatropha curcas
ref|XP_002975964.1|  hypothetical protein SELMODRAFT_51485            97.1    2e-19   
ref|XP_007139803.1|  hypothetical protein PHAVU_008G060100g           97.4    2e-19   Phaseolus vulgaris [French bean]
ref|XP_002968520.1|  hypothetical protein SELMODRAFT_145556           96.7    3e-19   
gb|AAK95654.2|AF405422_1  ferric-chelate reductase                    96.7    4e-19   Pisum sativum [garden pea]
emb|CBI22668.3|  unnamed protein product                              97.1    4e-19   Vitis vinifera
ref|XP_010456303.1|  PREDICTED: ferric reduction oxidase 2-like       96.3    5e-19   
ref|XP_006418435.1|  hypothetical protein EUTSA_v10006930mg           96.3    5e-19   Eutrema salsugineum [saltwater cress]
gb|ERN13812.1|  hypothetical protein AMTR_s00049p00212370             95.9    6e-19   Amborella trichopoda
gb|ADR70891.1|  ferric reductase oxidase                              95.9    7e-19   Manihot esculenta [manioc]
emb|CAN74772.1|  hypothetical protein VITISV_024875                   96.3    8e-19   Vitis vinifera
ref|XP_007143461.1|  hypothetical protein PHAVU_007G073800g           95.5    8e-19   Phaseolus vulgaris [French bean]
ref|XP_002892053.1|  hypothetical protein ARALYDRAFT_470119           95.5    1e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_003622505.1|  Ferric-chelate reductase                         95.5    1e-18   
ref|XP_010424035.1|  PREDICTED: ferric reduction oxidase 2-like       95.1    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_002272804.1|  PREDICTED: ferric reduction oxidase 2            95.1    1e-18   Vitis vinifera
emb|CBI22669.3|  unnamed protein product                              95.1    1e-18   Vitis vinifera
emb|CAN76960.1|  hypothetical protein VITISV_029500                   95.1    1e-18   Vitis vinifera
gb|EMT07839.1|  Superoxide-generating NADPH oxidase heavy chain s...  94.7    1e-18   
gb|KJB41380.1|  hypothetical protein B456_007G101800                  94.7    1e-18   Gossypium raimondii
gb|AAF81316.1|AC061957_12  Identical to FRO2 protein from Arabido...  94.7    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KJB41381.1|  hypothetical protein B456_007G101800                  94.7    2e-18   Gossypium raimondii
ref|XP_010460078.1|  PREDICTED: ferric reduction oxidase 3, mitoc...  94.7    2e-18   
emb|CAN74771.1|  hypothetical protein VITISV_024874                   94.7    2e-18   Vitis vinifera
ref|NP_171664.1|  ferric reduction oxidase 2                          94.7    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006490654.1|  PREDICTED: ferric reduction oxidase 4-like       94.4    2e-18   Citrus sinensis [apfelsine]
gb|KDO86264.1|  hypothetical protein CISIN_1g005553mg                 94.4    2e-18   Citrus sinensis [apfelsine]
ref|XP_006444982.1|  hypothetical protein CICLE_v10019053mg           94.4    2e-18   Citrus clementina [clementine]
ref|XP_010661833.1|  PREDICTED: ferric reduction oxidase 2 isofor...  94.4    3e-18   Vitis vinifera
ref|XP_010474762.1|  PREDICTED: ferric reduction oxidase 2-like i...  94.4    3e-18   Camelina sativa [gold-of-pleasure]
gb|AAB72168.1|  unknown                                               94.0    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009411425.1|  PREDICTED: ferric reduction oxidase 2-like       94.0    3e-18   
gb|KHN21778.1|  Ferric reduction oxidase 4                            93.6    4e-18   Glycine soja [wild soybean]
ref|NP_173715.2|  ferric reduction oxidase 3                          93.6    4e-18   Arabidopsis thaliana [mouse-ear cress]
gb|ABJ16556.1|  Fe(III)-chelate reductase                             93.6    4e-18   Citrus junos [kuzu]
emb|CDY38014.1|  BnaCnng08750D                                        93.6    5e-18   Brassica napus [oilseed rape]
emb|CBI40432.3|  unnamed protein product                              93.2    5e-18   Vitis vinifera
ref|XP_010498794.1|  PREDICTED: ferric reduction oxidase 3, mitoc...  93.2    6e-18   Camelina sativa [gold-of-pleasure]
ref|XP_002275993.1|  PREDICTED: ferric reduction oxidase 2 isofor...  93.2    6e-18   Vitis vinifera
ref|XP_010480116.1|  PREDICTED: ferric reduction oxidase 2-like       92.8    7e-18   Camelina sativa [gold-of-pleasure]
gb|EYU32157.1|  hypothetical protein MIMGU_mgv1a019436mg              92.8    8e-18   Erythranthe guttata [common monkey flower]
ref|XP_008233004.1|  PREDICTED: ferric reduction oxidase 2 isofor...  92.4    9e-18   
gb|AAU94355.1|  iron reductase                                        92.4    9e-18   Pisum sativum [garden pea]
gb|KEH31790.1|  oxidoreductase/ferric-chelate reductase               92.0    1e-17   Medicago truncatula
ref|XP_008233005.1|  PREDICTED: ferric reduction oxidase 2 isofor...  92.4    1e-17   
ref|XP_012090199.1|  PREDICTED: ferric reduction oxidase 4-like i...  92.0    1e-17   
ref|XP_007220622.1|  hypothetical protein PRUPE_ppa002203mg           91.7    2e-17   
gb|KDP22239.1|  hypothetical protein JCGZ_26070                       91.7    2e-17   Jatropha curcas
ref|XP_002511896.1|  ferric-chelate reductase, putative               91.7    2e-17   
ref|XP_006418436.1|  hypothetical protein EUTSA_v10006972mg           91.7    2e-17   Eutrema salsugineum [saltwater cress]
ref|XP_006362676.1|  PREDICTED: ferric reduction oxidase 4-like       91.7    2e-17   Solanum tuberosum [potatoes]
ref|XP_009118820.1|  PREDICTED: probable ferric reduction oxidase...  91.3    2e-17   Brassica rapa
ref|XP_011043854.1|  PREDICTED: ferric reduction oxidase 4-like i...  91.3    2e-17   Populus euphratica
ref|XP_011043852.1|  PREDICTED: ferric reduction oxidase 4-like i...  91.3    2e-17   Populus euphratica
ref|XP_009118817.1|  PREDICTED: probable ferric reduction oxidase...  91.3    2e-17   Brassica rapa
ref|XP_009118818.1|  PREDICTED: probable ferric reduction oxidase...  91.3    2e-17   Brassica rapa
ref|XP_002893257.1|  ATFRO3/FRO3                                      91.3    2e-17   
ref|XP_006306887.1|  hypothetical protein CARUB_v10008441mg           91.3    3e-17   Capsella rubella
ref|XP_003622477.1|  Ferric reductase                                 89.4    3e-17   
gb|KJB34152.1|  hypothetical protein B456_006G050400                  90.9    3e-17   Gossypium raimondii
ref|XP_010055096.1|  PREDICTED: ferric reduction oxidase 2-like i...  90.9    4e-17   
ref|XP_008803960.1|  PREDICTED: ferric reduction oxidase 2-like       90.5    4e-17   
ref|NP_001185067.1|  ferric reduction oxidase 3                       90.5    4e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CDP08775.1|  unnamed protein product                              90.5    4e-17   Coffea canephora [robusta coffee]
ref|XP_010472415.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  84.3    5e-17   
ref|XP_010457106.1|  PREDICTED: ferric reduction oxidase 2            90.5    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010060545.1|  PREDICTED: ferric reduction oxidase 4-like       90.1    5e-17   
ref|XP_009411423.1|  PREDICTED: ferric reduction oxidase 2-like       90.1    6e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011043855.1|  PREDICTED: ferric reduction oxidase 4-like i...  89.7    7e-17   Populus euphratica
ref|XP_007038788.1|  Ferric reduction oxidase 2                       90.1    7e-17   
gb|EMS45573.1|  Superoxide-generating NADPH oxidase heavy chain s...  90.5    7e-17   Triticum urartu
ref|XP_010045373.1|  PREDICTED: ferric reduction oxidase 7, chlor...  90.1    7e-17   Eucalyptus grandis [rose gum]
gb|KEH18825.1|  oxidoreductase/ferric-chelate reductase               89.7    9e-17   Medicago truncatula
ref|XP_009757787.1|  PREDICTED: ferric reduction oxidase 2-like       89.7    9e-17   Nicotiana sylvestris
gb|KEH18826.1|  oxidoreductase/ferric-chelate reductase               89.7    9e-17   Medicago truncatula
ref|XP_011043857.1|  PREDICTED: ferric reduction oxidase 2-like i...  89.4    9e-17   Populus euphratica
ref|XP_010055097.1|  PREDICTED: ferric reduction oxidase 2-like       89.4    1e-16   Eucalyptus grandis [rose gum]
ref|XP_011043858.1|  PREDICTED: ferric reduction oxidase 2-like i...  89.4    1e-16   Populus euphratica
gb|KCW71571.1|  hypothetical protein EUGRSUZ_E00107                   89.4    1e-16   Eucalyptus grandis [rose gum]
gb|KCW71572.1|  hypothetical protein EUGRSUZ_E00107                   89.4    1e-16   Eucalyptus grandis [rose gum]
gb|AAR15416.1|  ferric reductase                                      89.4    1e-16   Medicago truncatula
gb|EYU20558.1|  hypothetical protein MIMGU_mgv1a002085mg              89.4    1e-16   Erythranthe guttata [common monkey flower]
ref|XP_004253309.1|  PREDICTED: ferric reduction oxidase 4-like       85.5    1e-16   
gb|KCW90645.1|  hypothetical protein EUGRSUZ_A02749                   89.4    1e-16   Eucalyptus grandis [rose gum]
gb|EYU34160.1|  hypothetical protein MIMGU_mgv1a023886mg              89.0    1e-16   Erythranthe guttata [common monkey flower]
gb|AAT01415.1|  ferric reductase                                      88.6    2e-16   Cucumis sativus [cucumbers]
ref|XP_002513661.1|  ferric-chelate reductase, putative               89.0    2e-16   
ref|XP_004143614.1|  PREDICTED: ferric reduction oxidase 2-like       88.2    2e-16   Cucumis sativus [cucumbers]
ref|XP_006339613.1|  PREDICTED: ferric reduction oxidase 2-like       88.2    3e-16   Solanum tuberosum [potatoes]
ref|XP_002305246.1|  hypothetical protein POPTR_0004s07730g           87.8    3e-16   Populus trichocarpa [western balsam poplar]
ref|XP_011038370.1|  PREDICTED: LOW QUALITY PROTEIN: ferric reduc...  87.8    3e-16   Populus euphratica
ref|XP_008445871.1|  PREDICTED: ferric reduction oxidase 2-like       87.8    4e-16   Cucumis melo [Oriental melon]
ref|XP_004496531.1|  PREDICTED: ferric reduction oxidase 2-like       87.8    4e-16   
gb|EYU25131.1|  hypothetical protein MIMGU_mgv1a023728mg              87.4    4e-16   Erythranthe guttata [common monkey flower]
ref|XP_009609066.1|  PREDICTED: ferric reduction oxidase 2-like       87.4    5e-16   Nicotiana tomentosiformis
ref|XP_009368746.1|  PREDICTED: ferric reduction oxidase 4-like i...  87.4    5e-16   Pyrus x bretschneideri [bai li]
gb|KHN46714.1|  Ferric reduction oxidase 2                            87.0    7e-16   Glycine soja [wild soybean]
ref|XP_002305245.2|  ferric-chelate reductase family protein          86.7    7e-16   
ref|XP_008234849.1|  PREDICTED: ferric reduction oxidase 4-like       86.7    7e-16   Prunus mume [ume]
ref|XP_010919103.1|  PREDICTED: ferric reduction oxidase 2-like       86.7    9e-16   
ref|NP_001234329.1|  ferric-chelate reductase                         86.7    9e-16   
ref|XP_011093123.1|  PREDICTED: LOW QUALITY PROTEIN: ferric reduc...  86.3    1e-15   
ref|XP_010661832.1|  PREDICTED: ferric reduction oxidase 2 isofor...  86.3    1e-15   
ref|XP_009368744.1|  PREDICTED: ferric reduction oxidase 2-like       86.7    1e-15   
ref|XP_010055095.1|  PREDICTED: ferric reduction oxidase 2-like i...  86.3    1e-15   
ref|XP_002275942.2|  PREDICTED: ferric reduction oxidase 2 isofor...  86.3    1e-15   
emb|CAA70769.1|  FRO1                                                 86.3    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171665.1|  ferric reduction oxidase 1                          86.3    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892052.1|  predicted protein                                85.9    1e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_007038790.1|  Ferric reduction oxidase 4 isoform 2             85.9    1e-15   
emb|CAN82573.1|  hypothetical protein VITISV_034719                   86.3    1e-15   Vitis vinifera
ref|XP_007135107.1|  hypothetical protein PHAVU_010G101500g           85.9    1e-15   Phaseolus vulgaris [French bean]
ref|XP_007038789.1|  Ferric reduction oxidase 4 isoform 1             85.9    2e-15   
gb|KCW87545.1|  hypothetical protein EUGRSUZ_B03992                   85.5    2e-15   Eucalyptus grandis [rose gum]
ref|XP_007220890.1|  hypothetical protein PRUPE_ppa014767mg           85.5    2e-15   
ref|XP_012090201.1|  PREDICTED: ferric reduction oxidase 4-like i...  85.5    2e-15   
gb|EYU32154.1|  hypothetical protein MIMGU_mgv1a002115mg              85.5    2e-15   Erythranthe guttata [common monkey flower]
ref|XP_008376640.1|  PREDICTED: ferric reduction oxidase 4-like i...  85.1    3e-15   
ref|XP_009800600.1|  PREDICTED: ferric reduction oxidase 2-like       85.1    3e-15   Nicotiana sylvestris
ref|XP_012090729.1|  PREDICTED: probable ferric reduction oxidase 1   82.8    3e-15   
gb|ABU54827.1|  ferric reductase                                      84.7    4e-15   Malus baccata var. xiaojinensis
ref|XP_011470323.1|  PREDICTED: ferric reduction oxidase 2-like       84.7    4e-15   Fragaria vesca subsp. vesca
ref|XP_004253331.2|  PREDICTED: ferric reduction oxidase 4            84.3    4e-15   Solanum lycopersicum
ref|XP_009800599.1|  PREDICTED: ferric reduction oxidase 2-like i...  84.7    4e-15   Nicotiana sylvestris
ref|XP_009621943.1|  PREDICTED: ferric reduction oxidase 2-like i...  84.3    4e-15   Nicotiana tomentosiformis
ref|XP_009800598.1|  PREDICTED: ferric reduction oxidase 2-like i...  84.3    4e-15   Nicotiana sylvestris
ref|XP_009621944.1|  PREDICTED: ferric reduction oxidase 2-like i...  84.3    4e-15   Nicotiana tomentosiformis
ref|XP_010462520.1|  PREDICTED: probable ferric reduction oxidase 1   84.3    5e-15   
ref|XP_010240299.1|  PREDICTED: ferric reduction oxidase 2-like       84.3    5e-15   
ref|XP_006372444.1|  ferric-chelate reductase family protein          84.3    5e-15   
ref|XP_008234904.1|  PREDICTED: ferric reduction oxidase 2-like       84.3    5e-15   
ref|XP_009368745.1|  PREDICTED: ferric reduction oxidase 4-like i...  84.0    6e-15   Pyrus x bretschneideri [bai li]
ref|XP_007036322.1|  Ferric reduction oxidase 8 isoform 2             84.0    6e-15   
gb|EPS59492.1|  ferric-chelate reductase                              84.0    6e-15   Genlisea aurea
ref|XP_009798642.1|  PREDICTED: ferric reduction oxidase 4-like       84.0    7e-15   Nicotiana sylvestris
ref|XP_010474764.1|  PREDICTED: probable ferric reduction oxidase 1   83.6    8e-15   
gb|EYU25132.1|  hypothetical protein MIMGU_mgv1a019178mg              83.2    1e-14   Erythranthe guttata [common monkey flower]
ref|XP_007221102.1|  hypothetical protein PRUPE_ppa017732mg           83.2    1e-14   
ref|XP_009375512.1|  PREDICTED: ferric reduction oxidase 4-like i...  83.2    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_008376639.1|  PREDICTED: ferric reduction oxidase 2-like       83.2    1e-14   
ref|XP_006579584.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  80.5    1e-14   
ref|XP_011470324.1|  PREDICTED: ferric reduction oxidase 4-like i...  82.8    2e-14   Fragaria vesca subsp. vesca
ref|XP_009612091.1|  PREDICTED: ferric reduction oxidase 2-like       82.8    2e-14   Nicotiana tomentosiformis
ref|XP_008343838.1|  PREDICTED: ferric reduction oxidase 4-like       80.1    2e-14   
ref|XP_006396230.1|  hypothetical protein EUTSA_v10028469mg           82.0    3e-14   Eutrema salsugineum [saltwater cress]
ref|XP_006353911.1|  PREDICTED: ferric reduction oxidase 4-like       82.0    3e-14   Solanum tuberosum [potatoes]
ref|XP_011092747.1|  PREDICTED: ferric reduction oxidase 2-like i...  82.0    3e-14   Sesamum indicum [beniseed]
gb|KDO69498.1|  hypothetical protein CISIN_1g005126mg                 81.6    3e-14   Citrus sinensis [apfelsine]
gb|KCW71573.1|  hypothetical protein EUGRSUZ_E00108                   81.6    3e-14   Eucalyptus grandis [rose gum]
gb|KCW90647.1|  hypothetical protein EUGRSUZ_A02751                   81.6    3e-14   Eucalyptus grandis [rose gum]
ref|XP_011651177.1|  PREDICTED: ferric reduction oxidase 4-like       81.6    4e-14   Cucumis sativus [cucumbers]
ref|XP_006422002.1|  hypothetical protein CICLE_v10006989mg           81.6    4e-14   
ref|XP_006360210.1|  PREDICTED: ferric reduction oxidase 2-like       81.3    5e-14   Solanum tuberosum [potatoes]
ref|XP_012090200.1|  PREDICTED: ferric reduction oxidase 4-like i...  80.9    6e-14   
ref|XP_006372445.1|  hypothetical protein POPTR_0017s01700g           80.9    6e-14   
ref|XP_002986459.1|  hypothetical protein SELMODRAFT_425399           80.1    6e-14   
gb|EPS59494.1|  hypothetical protein M569_15313                       77.8    7e-14   
ref|XP_010671643.1|  PREDICTED: ferric reduction oxidase 4-like       80.5    9e-14   
ref|XP_009377542.1|  PREDICTED: ferric reduction oxidase 4-like       80.5    9e-14   
gb|KJB34155.1|  hypothetical protein B456_006G050700                  80.5    1e-13   
ref|XP_009798669.1|  PREDICTED: ferric reduction oxidase 4-like       80.1    1e-13   
ref|XP_011038373.1|  PREDICTED: ferric reduction oxidase 2-like i...  80.1    1e-13   
ref|XP_010545917.1|  PREDICTED: ferric reduction oxidase 4            80.1    1e-13   
ref|XP_011092755.1|  PREDICTED: ferric reduction oxidase 2-like i...  80.1    1e-13   
ref|XP_011038371.1|  PREDICTED: ferric reduction oxidase 2-like i...  80.1    1e-13   
ref|XP_009355418.1|  PREDICTED: ferric reduction oxidase 6            80.1    1e-13   
emb|CBI29608.3|  unnamed protein product                              79.7    1e-13   
ref|XP_011092779.1|  PREDICTED: ferric reduction oxidase 2-like       79.7    2e-13   
ref|XP_008365332.1|  PREDICTED: ferric reduction oxidase 6-like       79.7    2e-13   
gb|EYU25134.1|  hypothetical protein MIMGU_mgv1a024649mg              79.3    2e-13   
ref|XP_002266723.2|  PREDICTED: ferric reduction oxidase 7, chlor...  79.0    3e-13   
gb|KHN21777.1|  Ferric reduction oxidase 2                            79.0    3e-13   
ref|XP_003536451.2|  PREDICTED: ferric reduction oxidase 2-like       78.6    3e-13   
ref|XP_010024990.1|  PREDICTED: ferric reduction oxidase 2-like       78.6    3e-13   
emb|CAN83907.1|  hypothetical protein VITISV_035329                   78.2    5e-13   
ref|XP_011076479.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  78.6    5e-13   
ref|XP_009411424.1|  PREDICTED: ferric reduction oxidase 2-like       77.8    6e-13   
ref|XP_006306803.1|  hypothetical protein CARUB_v10008345mg           77.8    6e-13   
ref|XP_010028464.1|  PREDICTED: ferric reduction oxidase 7, chlor...  77.8    7e-13   
ref|XP_011093124.1|  PREDICTED: ferric reduction oxidase 2-like       77.4    8e-13   
ref|XP_006388819.1|  hypothetical protein POPTR_0096s00200g           74.3    9e-13   
gb|EYU32156.1|  hypothetical protein MIMGU_mgv1a024360mg              77.4    1e-12   
ref|XP_009375511.1|  PREDICTED: ferric reduction oxidase 4-like i...  77.0    1e-12   
ref|XP_006422008.1|  hypothetical protein CICLE_v10007201mg           73.6    1e-12   
ref|XP_010028458.1|  PREDICTED: ferric reduction oxidase 6-like       77.0    1e-12   
ref|XP_002975965.1|  hypothetical protein SELMODRAFT_416159           77.0    1e-12   
ref|XP_010028459.1|  PREDICTED: ferric reduction oxidase 7, chlor...  77.0    1e-12   
ref|XP_002968519.1|  hypothetical protein SELMODRAFT_440376           77.0    1e-12   
ref|XP_002515792.1|  ferric-chelate reductase, putative               76.3    2e-12   
gb|ADR70887.1|  ferric reductase oxidase                              76.3    2e-12   
ref|XP_009602843.1|  PREDICTED: ferric reduction oxidase 4-like       73.2    2e-12   
ref|XP_008439292.1|  PREDICTED: ferric reduction oxidase 4-like i...  76.3    2e-12   
ref|XP_001767136.1|  ferric reductase-like transmembrane component    75.5    3e-12   
gb|EYU32155.1|  hypothetical protein MIMGU_mgv1a019951mg              75.5    4e-12   
emb|CDP08776.1|  unnamed protein product                              75.5    4e-12   
ref|XP_010105755.1|  Ferric reduction oxidase 4                       75.5    5e-12   
ref|XP_003579831.1|  PREDICTED: ferric reduction oxidase 7, chlor...  75.1    5e-12   
ref|XP_009375514.1|  PREDICTED: ferric reduction oxidase 4-like       74.7    6e-12   
ref|XP_004229896.2|  PREDICTED: ferric reduction oxidase 2            74.7    7e-12   
ref|XP_011464975.1|  PREDICTED: ferric reduction oxidase 7, chlor...  74.3    8e-12   
gb|ACX54451.1|  hypothetical protein F156                             71.6    1e-11   
ref|XP_006422009.1|  hypothetical protein CICLE_v10007201mg           69.7    2e-11   
gb|EYU33250.1|  hypothetical protein MIMGU_mgv1a001927mg              73.6    2e-11   
gb|KJB73649.1|  hypothetical protein B456_011G242100                  73.2    2e-11   
ref|XP_006339609.1|  PREDICTED: ferric reduction oxidase 2-like       73.2    2e-11   
ref|XP_002874156.1|  predicted protein                                73.2    2e-11   
gb|KHG27220.1|  Ferric reduction oxidase 7, chloroplastic -like p...  73.2    2e-11   
gb|KCW55200.1|  hypothetical protein EUGRSUZ_I01139                   72.0    3e-11   
gb|KCW55199.1|  hypothetical protein EUGRSUZ_I01139                   72.0    4e-11   
ref|XP_010265600.1|  PREDICTED: ferric reduction oxidase 7, chlor...  72.4    4e-11   
gb|EEE61072.1|  hypothetical protein OsJ_14936                        72.0    4e-11   
dbj|BAD18962.1|  ferric reductase                                     72.0    5e-11   
emb|CAD40972.2|  OSJNBa0027P08.6                                      72.0    5e-11   
gb|EEC77356.1|  hypothetical protein OsI_16048                        72.0    5e-11   
ref|NP_001052896.1|  Os04g0444800                                     72.0    5e-11   
ref|XP_010028461.1|  PREDICTED: ferric reduction oxidase 7, chlor...  72.0    6e-11   
gb|KCW55197.1|  hypothetical protein EUGRSUZ_I01139                   71.6    6e-11   
ref|XP_009375513.1|  PREDICTED: ferric reduction oxidase 4-like i...  71.6    7e-11   
ref|XP_006431349.1|  hypothetical protein CICLE_v10000235mg           71.6    7e-11   
ref|XP_006339610.1|  PREDICTED: ferric reduction oxidase 2-like       71.2    8e-11   
ref|NP_197786.2|  ferric reduction oxidase 4                          71.2    8e-11   
ref|XP_010682185.1|  PREDICTED: ferric reduction oxidase 7, chlor...  70.9    1e-10   
ref|XP_009150921.1|  PREDICTED: ferric reduction oxidase 4-like       70.5    1e-10   
ref|XP_009589301.1|  PREDICTED: ferric reduction oxidase 6-like i...  70.9    1e-10   
ref|XP_002519390.1|  ferric-chelate reductase, putative               70.5    2e-10   
ref|XP_010028466.1|  PREDICTED: ferric reduction oxidase 7, chlor...  70.5    2e-10   
emb|CDP17766.1|  unnamed protein product                              70.5    2e-10   
ref|XP_007009660.1|  Ferric reduction oxidase 7 isoform 2             70.5    2e-10   
ref|XP_006653450.1|  PREDICTED: ferric reduction oxidase 7, chlor...  70.5    2e-10   
ref|XP_008218605.1|  PREDICTED: ferric reduction oxidase 7, chlor...  70.5    2e-10   
ref|XP_010101613.1|  Ferric reduction oxidase 7                       70.1    2e-10   
ref|XP_004301589.1|  PREDICTED: ferric reduction oxidase 7, chlor...  70.1    2e-10   
ref|XP_006282058.1|  hypothetical protein CARUB_v10028303mg           70.1    2e-10   
ref|XP_007225171.1|  hypothetical protein PRUPE_ppa002259mg           70.1    2e-10   
ref|XP_007009659.1|  Ferric reduction oxidase 7 isoform 1             70.1    2e-10   
gb|KFK26610.1|  hypothetical protein AALP_AA8G271300                  69.3    3e-10   
ref|XP_002874157.1|  predicted protein                                69.3    3e-10   
ref|NP_001147916.1|  ferric reductase-like transmembrane component    69.3    3e-10   
ref|XP_010442443.1|  PREDICTED: ferric reduction oxidase 7, chlor...  69.3    4e-10   
ref|XP_010682186.1|  PREDICTED: ferric reduction oxidase 7, chlor...  68.9    4e-10   
gb|KFK22243.1|  hypothetical protein AALP_AAs62663U000200             67.4    5e-10   
ref|XP_006470777.1|  PREDICTED: ferric reduction oxidase 7, chlor...  68.9    5e-10   
gb|KFK22245.1|  hypothetical protein AALP_AAs62663U000200             67.4    5e-10   
gb|ERM96456.1|  hypothetical protein AMTR_s00001p00254670             68.2    7e-10   
ref|XP_002967602.1|  hypothetical protein SELMODRAFT_10731            68.6    7e-10   
gb|KFK27689.1|  hypothetical protein AALP_AA8G415800                  68.6    7e-10   
gb|KFK22246.1|  hypothetical protein AALP_AAs62663U000200             67.0    7e-10   
ref|XP_011026718.1|  PREDICTED: ferric reduction oxidase 6-like       68.2    8e-10   
gb|KFK22244.1|  hypothetical protein AALP_AAs62663U000200             67.4    9e-10   
dbj|BAB08721.1|  FRO2 homolog                                         68.2    9e-10   
ref|XP_002446539.1|  hypothetical protein SORBIDRAFT_06g017800        68.2    9e-10   
ref|XP_012083337.1|  PREDICTED: ferric reduction oxidase 2-like i...  67.8    1e-09   
gb|ACL54664.1|  unknown                                               67.8    1e-09   
ref|XP_006394658.1|  hypothetical protein EUTSA_v10003544mg           68.2    1e-09   
ref|XP_006368815.1|  hypothetical protein POPTR_0001s11860g           67.4    1e-09   
ref|XP_006368818.1|  hypothetical protein POPTR_0001s11860g           67.4    1e-09   
ref|XP_009589295.1|  PREDICTED: ferric reduction oxidase 6-like i...  67.8    1e-09   
ref|XP_004975731.1|  PREDICTED: ferric reduction oxidase 7, chlor...  67.8    1e-09   
ref|XP_010441063.1|  PREDICTED: ferric reduction oxidase 7, chlor...  67.8    1e-09   
ref|XP_006368813.1|  hypothetical protein POPTR_0001s11860g           67.4    1e-09   
ref|XP_002299406.2|  ferric reductase-like transmembrane componen...  67.4    1e-09   
ref|XP_006368816.1|  hypothetical protein POPTR_0001s11860g           67.4    1e-09   
ref|XP_006368814.1|  hypothetical protein POPTR_0001s11860g           67.0    2e-09   
gb|KEH18874.1|  oxidoreductase/ferric-chelate reductase               67.4    2e-09   
ref|XP_011470325.1|  PREDICTED: ferric reduction oxidase 5-like i...  67.0    2e-09   
ref|XP_011087588.1|  PREDICTED: ferric reduction oxidase 7, chlor...  67.0    2e-09   
ref|XP_006402243.1|  hypothetical protein EUTSA_v10012839mg           67.0    2e-09   
ref|XP_009368747.1|  PREDICTED: ferric reduction oxidase 4-like i...  66.6    2e-09   
ref|XP_007147544.1|  hypothetical protein PHAVU_006G133600g           66.6    3e-09   
ref|XP_010482265.1|  PREDICTED: ferric reduction oxidase 7, chlor...  66.6    3e-09   
gb|EEC77843.1|  hypothetical protein OsI_17084                        66.2    3e-09   
gb|EYU25133.1|  hypothetical protein MIMGU_mgv1a025470mg              66.2    3e-09   
ref|XP_008452185.1|  PREDICTED: ferric reduction oxidase 7, chlor...  66.2    4e-09   
ref|XP_010454684.1|  PREDICTED: ferric reduction oxidase 4-like i...  65.9    4e-09   
gb|ERM99798.1|  hypothetical protein AMTR_s00099p00157080             65.9    5e-09   
gb|ADR70888.1|  ferric reductase oxidase                              65.9    5e-09   
ref|XP_009782893.1|  PREDICTED: ferric reduction oxidase 7, chlor...  65.9    5e-09   
ref|XP_004133744.1|  PREDICTED: ferric reduction oxidase 7, chlor...  65.9    5e-09   
ref|NP_199785.2|  ferric reduction oxidase 7                          65.9    5e-09   
ref|XP_010482264.1|  PREDICTED: ferric reduction oxidase 7, chlor...  65.9    5e-09   
ref|XP_011621022.1|  PREDICTED: LOW QUALITY PROTEIN: ferric reduc...  65.9    5e-09   
ref|XP_006368817.1|  hypothetical protein POPTR_0001s11860g           65.5    6e-09   
ref|XP_010441037.1|  PREDICTED: ferric reduction oxidase 7, chlor...  65.5    6e-09   
ref|XP_002865755.1|  ATFRO7/FRO7                                      65.5    6e-09   
ref|XP_012081586.1|  PREDICTED: ferric reduction oxidase 7, chlor...  65.5    7e-09   
ref|XP_010028467.1|  PREDICTED: ferric reduction oxidase 7, chlor...  65.1    8e-09   
ref|XP_009130092.1|  PREDICTED: ferric reduction oxidase 5 isofor...  65.1    9e-09   
emb|CDY46972.1|  BnaA02g32740D                                        65.1    9e-09   
ref|XP_010442442.1|  PREDICTED: ferric reduction oxidase 7, chlor...  64.7    1e-08   
ref|XP_010421206.1|  PREDICTED: ferric reduction oxidase 4 isofor...  64.3    1e-08   
gb|KHN14381.1|  Ferric reduction oxidase 7, chloroplastic             63.9    2e-08   
ref|XP_003546231.1|  PREDICTED: ferric reduction oxidase 7, chlor...  63.9    2e-08   
emb|CDX71600.1|  BnaC09g26410D                                        63.9    2e-08   
ref|XP_009109991.1|  PREDICTED: ferric reduction oxidase 4-like       62.8    2e-08   
ref|XP_006289602.1|  hypothetical protein CARUB_v10003155mg           63.9    2e-08   
dbj|BAK01705.1|  predicted protein                                    63.5    3e-08   
ref|XP_009589290.1|  PREDICTED: ferric reduction oxidase 6-like i...  63.5    3e-08   
ref|XP_002981744.1|  hypothetical protein SELMODRAFT_10830            63.5    3e-08   
emb|CAH66739.1|  H0404F02.15                                          63.2    3e-08   
ref|XP_009383442.1|  PREDICTED: ferric reduction oxidase 7, chlor...  63.2    3e-08   
ref|XP_012078863.1|  PREDICTED: ferric reduction oxidase 7, chlor...  63.2    4e-08   
sp|Q9FLW2.1|FRO5_ARATH  RecName: Full=Ferric reduction oxidase 5;...  62.8    5e-08   
dbj|BAA98162.1|  FRO1-like protein; NADPH oxidase-like                62.8    6e-08   
dbj|BAJ09028.1|  ferric reductase oxidase                             62.4    6e-08   
ref|XP_010493527.1|  PREDICTED: ferric reduction oxidase 4-like i...  62.4    6e-08   
emb|CDX90043.1|  BnaA10g00390D                                        62.4    7e-08   
ref|XP_002865754.1|  ATFRO6/FRO6                                      62.4    7e-08   
ref|XP_002980762.1|  hypothetical protein SELMODRAFT_113141           62.0    7e-08   
ref|XP_002989049.1|  hypothetical protein SELMODRAFT_159917           62.0    8e-08   
ref|NP_199784.2|  ferric reduction oxidase 6                          61.6    1e-07   
emb|CDY44266.1|  BnaC02g41510D                                        61.6    1e-07   
dbj|BAA98161.1|  FRO2-like protein; NADPH oxidase-like                61.6    1e-07   
ref|XP_003535028.1|  PREDICTED: ferric reduction oxidase 7, chlor...  61.6    1e-07   
ref|XP_003594430.1|  NADPH oxidase                                    61.2    1e-07   
emb|CDY65711.1|  BnaAnng20940D                                        61.2    1e-07   
ref|XP_009118912.1|  PREDICTED: ferric reduction oxidase 7, chlor...  61.2    2e-07   
ref|XP_002983719.1|  hypothetical protein SELMODRAFT_445683           60.8    2e-07   
ref|XP_010028465.1|  PREDICTED: ferric reduction oxidase 6-like i...  60.5    2e-07   
ref|XP_004230384.1|  PREDICTED: ferric reduction oxidase 6-like       58.9    8e-07   
ref|XP_009763020.1|  PREDICTED: ferric reduction oxidase 6-like       58.9    1e-06   
ref|XP_008801600.1|  PREDICTED: ferric reduction oxidase 7, chlor...  58.2    2e-06   
ref|XP_001759875.1|  ferric reductase like transmembrane component    58.2    2e-06   
ref|XP_010930349.1|  PREDICTED: ferric reduction oxidase 7, chlor...  57.8    2e-06   
ref|XP_008439293.1|  PREDICTED: ferric reduction oxidase 4-like i...  57.4    3e-06   
ref|XP_008376642.1|  PREDICTED: ferric reduction oxidase 4-like i...  57.0    4e-06   
emb|CDX88061.1|  BnaA06g26520D                                        57.0    4e-06   
ref|XP_006358487.1|  PREDICTED: ferric reduction oxidase 6-like       56.6    6e-06   
emb|CAP74553.1|  putative TdLFC71 protein                             56.2    6e-06   
ref|XP_001786093.1|  ferric reductase-like transmembrane component    56.2    7e-06   
ref|XP_001768701.1|  ferric reductase-like transmembrane componen...  55.5    1e-05   
ref|XP_001754578.1|  ferric reductase like transmembrane component    55.5    1e-05   
gb|KHN40744.1|  Ferric reduction oxidase 7, chloroplastic             54.3    4e-05   
ref|XP_004486416.1|  PREDICTED: ferric reduction oxidase 7, chlor...  53.9    4e-05   
ref|XP_008376641.1|  PREDICTED: ferric reduction oxidase 4-like i...  53.5    6e-05   
ref|XP_010521417.1|  PREDICTED: ferric reduction oxidase 7, chlor...  53.1    8e-05   
ref|XP_008351781.1|  PREDICTED: L-type lectin-domain containing r...  52.0    2e-04   
ref|XP_012065459.1|  PREDICTED: ferric reduction oxidase 7, chlor...  50.1    7e-04   
gb|KEH43676.1|  oxidoreductase/ferric-chelate reductase               50.1    8e-04   
ref|XP_001762405.1|  ferric reductase-like transmembrane component    50.1    8e-04   



>ref|XP_009798365.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Nicotiana sylvestris]
Length=700

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 161/200 (81%), Gaps = 3/200 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GWVSLW+LKPTQ+WT+TWK AE KAS S     GL FAVYTFPVIA AIVGF+YLE K  
Sbjct  19   GWVSLWLLKPTQLWTKTWKIAEAKASTSFLTQTGLNFAVYTFPVIAIAIVGFMYLELK--  76

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
             QKE  SR+ R  L+ LSNPL+V   +G+LSG EIL VSLF+IFLAWTFY+RIS+DF+K 
Sbjct  77   -QKEPTSRKGRSSLSVLSNPLVVSRYIGMLSGFEILAVSLFVIFLAWTFYSRISSDFKKM  135

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +  K F L VWQYR+ RVATR GLL EACLALLLLP+LR M++FRL+G+QFE SVRYH W
Sbjct  136  IPIKSFALHVWQYRIFRVATRCGLLAEACLALLLLPILRGMSIFRLIGIQFEASVRYHIW  195

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGTAMI+FATLHG GTF IW
Sbjct  196  LGTAMILFATLHGGGTFLIW  215



>ref|XP_011072176.1| PREDICTED: ferric reduction oxidase 8, mitochondrial, partial 
[Sesamum indicum]
Length=688

 Score =   254 bits (650),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 161/202 (80%), Gaps = 5/202 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+SLW+LKPT+ WTR WK AEEK++ASVFGYNGL F VYTFPVIA AI+GF+YLE K  
Sbjct  19   GWLSLWVLKPTEFWTRKWKKAEEKSTASVFGYNGLDFVVYTFPVIAMAIIGFIYLELK--  76

Query  278  KQKEGISRQERRCLAF--LSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
             QKE  +RQ RR   F   S+PL V   +GILSG  IL  SLFIIFL WTFY R+SNDF+
Sbjct  77   -QKEPRTRQRRRSSIFTSFSSPLFVNQYVGILSGAHILASSLFIIFLVWTFYARVSNDFK  135

Query  452  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
            K    K FKL++WQY++ R+ATR GLL EACLALLLLPVLR M+VFRLLG+QFE SVRYH
Sbjct  136  KMTPVKSFKLSLWQYKLFRMATRCGLLAEACLALLLLPVLRGMSVFRLLGIQFEGSVRYH  195

Query  632  TWLGTAMIVFATLHGAGTFFIW  697
            TWLGTAM+ FATLHG GTFFIW
Sbjct  196  TWLGTAMVFFATLHGVGTFFIW  217



>ref|XP_009613740.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Nicotiana tomentosiformis]
Length=700

 Score =   254 bits (649),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 160/200 (80%), Gaps = 3/200 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GWVSLW+LKPTQ+WT++WK AE KAS S     GL FAVYTFPVIA AIVGF+YLE K  
Sbjct  19   GWVSLWLLKPTQLWTKSWKIAEAKASTSFLTQAGLNFAVYTFPVIAIAIVGFMYLELK--  76

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
             QKE  SR+ R  L+ LSNPL+V   +GILSG EIL VSLF+IFLAWTFY RIS+DF+K 
Sbjct  77   -QKEPTSRKGRSSLSVLSNPLVVNRYIGILSGFEILVVSLFVIFLAWTFYARISSDFKKM  135

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +  K F L VWQYR+ RVATR GLL EACLALLLLP+LR M++FRLLG+QFE SVRYH W
Sbjct  136  IPIKSFTLPVWQYRIFRVATRCGLLAEACLALLLLPILRGMSIFRLLGIQFEASVRYHIW  195

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGTAMI+FATLHG GTF IW
Sbjct  196  LGTAMILFATLHGGGTFLIW  215



>ref|XP_006344463.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Solanum 
tuberosum]
Length=699

 Score =   254 bits (648),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 161/200 (81%), Gaps = 3/200 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+S+W+LKPTQ+WT+TWK AE+KASAS    +GL FAVYTFPVIA AIVGFVYL  K  
Sbjct  18   GWLSVWLLKPTQLWTKTWKLAEKKASASFLTQSGLNFAVYTFPVIAIAIVGFVYLALK--  75

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
             QKE ISR+ R  L+ LSNP++V   +GILSG EIL V LF+IFLAWTFY RISNDF+K 
Sbjct  76   -QKEPISRKGRSSLSVLSNPVVVNKYIGILSGFEILAVCLFVIFLAWTFYVRISNDFKKM  134

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            V  K F L+VWQYR+ RVATR GLL EACLALLLLP+LR M+VFR+LG+QFE SVRYH W
Sbjct  135  VPMKSFTLSVWQYRVFRVATRSGLLAEACLALLLLPILRGMSVFRILGIQFEASVRYHVW  194

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGTAMI+F TLHG GT  IW
Sbjct  195  LGTAMILFGTLHGGGTLLIW  214



>ref|XP_009798366.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X3 [Nicotiana sylvestris]
Length=645

 Score =   252 bits (644),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 162/203 (80%), Gaps = 6/203 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVF---GYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            GWVSLW+LKPTQ+WT+TWK AE KAS S     G  GL FAVYTFPVIA AIVGF+YLE 
Sbjct  19   GWVSLWLLKPTQLWTKTWKIAEAKASTSFLTQTGPTGLNFAVYTFPVIAIAIVGFMYLEL  78

Query  269  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            K   QKE  SR+ R  L+ LSNPL+V   +G+LSG EIL VSLF+IFLAWTFY+RIS+DF
Sbjct  79   K---QKEPTSRKGRSSLSVLSNPLVVSRYIGMLSGFEILAVSLFVIFLAWTFYSRISSDF  135

Query  449  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
            +K +  K F L VWQYR+ RVATR GLL EACLALLLLP+LR M++FRL+G+QFE SVRY
Sbjct  136  KKMIPIKSFALHVWQYRIFRVATRCGLLAEACLALLLLPILRGMSIFRLIGIQFEASVRY  195

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLGTAMI+FATLHG GTF IW
Sbjct  196  HIWLGTAMILFATLHGGGTFLIW  218



>ref|XP_009613741.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X3 [Nicotiana tomentosiformis]
Length=645

 Score =   251 bits (641),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 161/203 (79%), Gaps = 6/203 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVF---GYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            GWVSLW+LKPTQ+WT++WK AE KAS S     G  GL FAVYTFPVIA AIVGF+YLE 
Sbjct  19   GWVSLWLLKPTQLWTKSWKIAEAKASTSFLTQAGPAGLNFAVYTFPVIAIAIVGFMYLEL  78

Query  269  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            K   QKE  SR+ R  L+ LSNPL+V   +GILSG EIL VSLF+IFLAWTFY RIS+DF
Sbjct  79   K---QKEPTSRKGRSSLSVLSNPLVVNRYIGILSGFEILVVSLFVIFLAWTFYARISSDF  135

Query  449  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
            +K +  K F L VWQYR+ RVATR GLL EACLALLLLP+LR M++FRLLG+QFE SVRY
Sbjct  136  KKMIPIKSFTLPVWQYRIFRVATRCGLLAEACLALLLLPILRGMSIFRLLGIQFEASVRY  195

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLGTAMI+FATLHG GTF IW
Sbjct  196  HIWLGTAMILFATLHGGGTFLIW  218



>ref|XP_009798364.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Nicotiana sylvestris]
Length=703

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 162/203 (80%), Gaps = 6/203 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVF---GYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            GWVSLW+LKPTQ+WT+TWK AE KAS S     G  GL FAVYTFPVIA AIVGF+YLE 
Sbjct  19   GWVSLWLLKPTQLWTKTWKIAEAKASTSFLTQTGPTGLNFAVYTFPVIAIAIVGFMYLEL  78

Query  269  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            K   QKE  SR+ R  L+ LSNPL+V   +G+LSG EIL VSLF+IFLAWTFY+RIS+DF
Sbjct  79   K---QKEPTSRKGRSSLSVLSNPLVVSRYIGMLSGFEILAVSLFVIFLAWTFYSRISSDF  135

Query  449  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
            +K +  K F L VWQYR+ RVATR GLL EACLALLLLP+LR M++FRL+G+QFE SVRY
Sbjct  136  KKMIPIKSFALHVWQYRIFRVATRCGLLAEACLALLLLPILRGMSIFRLIGIQFEASVRY  195

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLGTAMI+FATLHG GTF IW
Sbjct  196  HIWLGTAMILFATLHGGGTFLIW  218



>ref|XP_004236257.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Solanum 
lycopersicum]
Length=699

 Score =   251 bits (642),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 160/200 (80%), Gaps = 3/200 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+S+W+LKPTQ+WT+TWK AE+KASAS    +GL FAVYTFPVIA AIVGFVYL  K  
Sbjct  18   GWLSVWLLKPTQLWTKTWKLAEKKASASFLTQSGLNFAVYTFPVIAIAIVGFVYLSLK--  75

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
             QKE ISR+ R  L+ LSNP++V   +GILSG EIL V LF+IFLAWTFY RISNDF+K 
Sbjct  76   -QKEAISRKGRSSLSVLSNPVVVNKYIGILSGFEILAVCLFVIFLAWTFYVRISNDFKKM  134

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            V  K F L+VWQYR+ RVATR GLL EACLALLLLP+LR M+VF++LG+QFE SVRYH W
Sbjct  135  VPMKSFTLSVWQYRVFRVATRSGLLAEACLALLLLPILRGMSVFQILGIQFEASVRYHVW  194

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGT MI+F TLHG GT  IW
Sbjct  195  LGTTMILFGTLHGGGTLLIW  214



>ref|XP_009613739.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Nicotiana tomentosiformis]
Length=703

 Score =   251 bits (642),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 161/203 (79%), Gaps = 6/203 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVF---GYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            GWVSLW+LKPTQ+WT++WK AE KAS S     G  GL FAVYTFPVIA AIVGF+YLE 
Sbjct  19   GWVSLWLLKPTQLWTKSWKIAEAKASTSFLTQAGPAGLNFAVYTFPVIAIAIVGFMYLEL  78

Query  269  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            K   QKE  SR+ R  L+ LSNPL+V   +GILSG EIL VSLF+IFLAWTFY RIS+DF
Sbjct  79   K---QKEPTSRKGRSSLSVLSNPLVVNRYIGILSGFEILVVSLFVIFLAWTFYARISSDF  135

Query  449  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
            +K +  K F L VWQYR+ RVATR GLL EACLALLLLP+LR M++FRLLG+QFE SVRY
Sbjct  136  KKMIPIKSFTLPVWQYRIFRVATRCGLLAEACLALLLLPILRGMSIFRLLGIQFEASVRY  195

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLGTAMI+FATLHG GTF IW
Sbjct  196  HIWLGTAMILFATLHGGGTFLIW  218



>gb|KHG18909.1| Ferric reduction oxidase 8, mitochondrial -like protein [Gossypium 
arboreum]
Length=727

 Score =   238 bits (608),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 153/203 (75%), Gaps = 2/203 (1%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            +ST W+SLW+LKPT +WTR WKAAE  A  +VFGY GL F VYTFPVIA A++G VYL  
Sbjct  17   ISTAWLSLWLLKPTNLWTRKWKAAESSARNTVFGYYGLDFTVYTFPVIAVAMIGLVYLNL  76

Query  269  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            +   Q+   SRQ R   A  SNPL+  + +GILSG+EIL V LFI+FLAWTFYTRIS+DF
Sbjct  77   QSWGQRN--SRQIRSSTAAFSNPLVTSNLVGILSGVEILSVFLFILFLAWTFYTRISHDF  134

Query  449  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
             K    +  KL +WQ + LRVATRFGLL EACLA LLLP+LR +AVFR+LG+QFE SVRY
Sbjct  135  TKLTPMESLKLDLWQLKFLRVATRFGLLAEACLAFLLLPILRELAVFRILGIQFEASVRY  194

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLGTAMI FAT HGA T FIW
Sbjct  195  HIWLGTAMICFATFHGASTLFIW  217



>emb|CDP12742.1| unnamed protein product [Coffea canephora]
Length=704

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 172/218 (79%), Gaps = 3/218 (1%)
 Frame = +2

Query  44   MAKASllilklllilVSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTF  223
            MAKASLLILK+LL ++ + W+SLW+L+P++ W + W+ AEEKA  +VF YNGL FAVYTF
Sbjct  1    MAKASLLILKVLLTILFSVWLSLWLLQPSRTWEKKWREAEEKAMKTVFNYNGLSFAVYTF  60

Query  224  PVIAFAIVGFVYLEQKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFI  403
            P +A A+VGF+YLE K +  +    R E + ++ LSNP++V   LGIL+G EIL V LF+
Sbjct  61   PFLALAMVGFIYLELKLRTNR---MRPESKLISALSNPIVVNRYLGILTGTEILLVFLFV  117

Query  404  IFLAWTFYTRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMA  583
             FL WTFY  ISNDF+K + TK  KL++WQY++L+VATR GLL EACLALLLLP+LR MA
Sbjct  118  TFLFWTFYAHISNDFKKMMPTKSLKLSMWQYKVLKVATRCGLLAEACLALLLLPILRGMA  177

Query  584  VFRLLGLQFEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            +FR+LG+QFEVSVRYH WLGT MI FATLHGAGTFF W
Sbjct  178  IFRILGVQFEVSVRYHIWLGTTMITFATLHGAGTFFTW  215



>ref|XP_010037521.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Eucalyptus grandis]
Length=716

 Score =   235 bits (600),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 152/200 (76%), Gaps = 3/200 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GWV+LWILKPT++WT+ WK AEE A  +VFGY GL FAVYTFP+IA AI+G +YL     
Sbjct  23   GWVALWILKPTEMWTKKWKGAEESAGGTVFGYYGLNFAVYTFPIIALAIIGSLYLNDTAS  82

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
                 ISRQ +  L+ LS P+IV S +GI+S +EIL + +F+IFLAWTFY RISNDF K 
Sbjct  83   G---AISRQRKTSLSSLSYPIIVNSLVGIISVVEILAILVFVIFLAWTFYCRISNDFEKL  139

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
               K  KL++WQ + L+VATRFGLL EACLALLLLP+LR M V RLLG+QFE SVRYHTW
Sbjct  140  TPAKSLKLSIWQLKYLKVATRFGLLAEACLALLLLPILRVMPVLRLLGIQFEASVRYHTW  199

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGT MI+FAT HGA T FIW
Sbjct  200  LGTGMILFATFHGASTLFIW  219



>ref|XP_010037520.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Eucalyptus grandis]
 gb|KCW49230.1| hypothetical protein EUGRSUZ_K02803 [Eucalyptus grandis]
Length=717

 Score =   233 bits (593),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 151/200 (76%), Gaps = 2/200 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GWV+LWILKPT++WT+ WK AEE A  +VFGY GL FAVYTFP+IA AI+G +YL     
Sbjct  23   GWVALWILKPTEMWTKKWKGAEESAGGTVFGYYGLNFAVYTFPIIALAIIGSLYLNDTAS  82

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
                  SRQ +  L+ LS P+IV S +GI+S +EIL + +F+IFLAWTFY RISNDF K 
Sbjct  83   GAIS--SRQRKTSLSSLSYPIIVNSLVGIISVVEILAILVFVIFLAWTFYCRISNDFEKL  140

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
               K  KL++WQ + L+VATRFGLL EACLALLLLP+LR M V RLLG+QFE SVRYHTW
Sbjct  141  TPAKSLKLSIWQLKYLKVATRFGLLAEACLALLLLPILRVMPVLRLLGIQFEASVRYHTW  200

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGT MI+FAT HGA T FIW
Sbjct  201  LGTGMILFATFHGASTLFIW  220



>gb|KJB59689.1| hypothetical protein B456_009G267500 [Gossypium raimondii]
Length=726

 Score =   231 bits (590),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 155/203 (76%), Gaps = 3/203 (1%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            +ST W+SLW+LKPT +WT+ WKAAE  A  +VFGY GL F VYTFPVIA A++G VYL+ 
Sbjct  17   ISTAWLSLWLLKPTNLWTKKWKAAESSARNTVFGYYGLDFTVYTFPVIAVAMIGLVYLKL  76

Query  269  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            +   Q+   +RQ R   A  SNPL+  S +GILSG+EIL V LFI+FLAWTFYTRIS+DF
Sbjct  77   QSWGQR---NRQIRSSTAAFSNPLVTSSLVGILSGVEILSVFLFILFLAWTFYTRISHDF  133

Query  449  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
             K    +  KL +WQ + LRVATRFGLL EACLALLLLP+LR +AVFR+LG+QFE SVRY
Sbjct  134  TKLTPMESLKLDLWQLKFLRVATRFGLLAEACLALLLLPILRELAVFRILGIQFEASVRY  193

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLGTAMI FAT HGA T FIW
Sbjct  194  HIWLGTAMICFATFHGASTLFIW  216



>gb|KJB59688.1| hypothetical protein B456_009G267500 [Gossypium raimondii]
Length=727

 Score =   231 bits (589),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 154/203 (76%), Gaps = 2/203 (1%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            +ST W+SLW+LKPT +WT+ WKAAE  A  +VFGY GL F VYTFPVIA A++G VYL+ 
Sbjct  17   ISTAWLSLWLLKPTNLWTKKWKAAESSARNTVFGYYGLDFTVYTFPVIAVAMIGLVYLKL  76

Query  269  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            +   Q+    RQ R   A  SNPL+  S +GILSG+EIL V LFI+FLAWTFYTRIS+DF
Sbjct  77   QSWGQRN--RRQIRSSTAAFSNPLVTSSLVGILSGVEILSVFLFILFLAWTFYTRISHDF  134

Query  449  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
             K    +  KL +WQ + LRVATRFGLL EACLALLLLP+LR +AVFR+LG+QFE SVRY
Sbjct  135  TKLTPMESLKLDLWQLKFLRVATRFGLLAEACLALLLLPILRELAVFRILGIQFEASVRY  194

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLGTAMI FAT HGA T FIW
Sbjct  195  HIWLGTAMICFATFHGASTLFIW  217



>ref|XP_007036321.1| Ferric reduction oxidase 8 isoform 1 [Theobroma cacao]
 gb|EOY20822.1| Ferric reduction oxidase 8 isoform 1 [Theobroma cacao]
Length=720

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 150/203 (74%), Gaps = 3/203 (1%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            +STGW+SLW+LKPT  WTR WK AE  A  +VFGY GL FAVYTFPVIA A++G VYL  
Sbjct  17   ISTGWISLWLLKPTNFWTRKWKGAEASAQDTVFGYYGLDFAVYTFPVIALAMIGLVYLNL  76

Query  269  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            +  + +   SRQ R   A  SNPL++   +GILS +EIL V LF +FLAWTFY RIS DF
Sbjct  77   QPWEHR---SRQVRSSAAAFSNPLVISKLIGILSSVEILAVFLFTLFLAWTFYKRISQDF  133

Query  449  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
            +K    +  KL +WQ + LRVATRFGLL EACL LLLLP+LR +AVFR+LG++FE SVRY
Sbjct  134  KKLTPVESLKLDLWQLKYLRVATRFGLLAEACLTLLLLPILRGLAVFRILGIRFEASVRY  193

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLGTAMI FAT HGA T FIW
Sbjct  194  HIWLGTAMICFATFHGASTLFIW  216



>ref|XP_007210738.1| hypothetical protein PRUPE_ppa021696mg [Prunus persica]
 gb|EMJ11937.1| hypothetical protein PRUPE_ppa021696mg [Prunus persica]
Length=687

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 147/200 (74%), Gaps = 6/200 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
             WVSLW+LKPTQ+WTR WKAAE+KA A+VFGY GL FAVYTFP IA AI+G  YL  K  
Sbjct  20   AWVSLWLLKPTQLWTRKWKAAEDKARATVFGYYGLNFAVYTFPPIALAIIGSFYLNLKP-  78

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              +E I R+ R+  A  SNPL+V + LG+ S +EIL V LFI+FLAW FY RISNDF+  
Sbjct  79   --RESIRRKGRKLTAGFSNPLVVNTLLGVFSTLEILAVFLFILFLAWNFYARISNDFKNL  136

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
               K     +WQ + L+VATRFGLL E CLA LL P+LR +A+FRLLG+QFE SVRYH W
Sbjct  137  KAAKSL---IWQLKYLKVATRFGLLAEVCLAFLLFPILRGLALFRLLGIQFEASVRYHIW  193

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGTAMI FAT HGA T FIW
Sbjct  194  LGTAMIFFATFHGASTLFIW  213



>ref|XP_011464152.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=703

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 148/200 (74%), Gaps = 3/200 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
             WVSLW++KPTQ WTR WKAAE+ A  ++FGY GL FAVY FP+ A AI+G +YL  K  
Sbjct  20   AWVSLWLIKPTQFWTREWKAAEDLARPTLFGYYGLNFAVYIFPLFALAILGSIYLNLKP-  78

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              +E I R+ RR  A  SNPL+V S LGILS IEI+ V LF++FLAWTFY RIS+DF+K 
Sbjct  79   --REPIRRKGRRVFAGFSNPLVVNSLLGILSSIEIVAVFLFMLFLAWTFYVRISSDFKKL  136

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
               K  KL +WQ + LRVATRFGLL EACLA LLLPVLR +AVFR+LG+QFE S+RYH W
Sbjct  137  KPDKALKLNLWQLKYLRVATRFGLLAEACLAFLLLPVLRGLAVFRILGIQFEASIRYHIW  196

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGT M+  AT HG  T FIW
Sbjct  197  LGTTMLFCATFHGVSTLFIW  216



>ref|XP_011046222.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Populus 
euphratica]
Length=722

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 151/200 (76%), Gaps = 2/200 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+++WI KPT +WTR WK AE+ +  +VFGY GL FAVYTFP+I+  I+G VYL    +
Sbjct  20   GWITVWIQKPTNMWTRKWKGAEDSSRYTVFGYYGLNFAVYTFPLISLTIIGLVYLNLVSR  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
            +     SR  R      SNP++V S LGILS IEIL V LF++FLAWT+Y RISNDF+K 
Sbjct  80   EPPR--SRPARSATIGFSNPVLVNSFLGILSSIEILAVFLFVLFLAWTYYARISNDFKKL  137

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +  K  KL +WQ + LRVATRFGLL EACLALLLLP+LR MA+F++LG+QFE SVRYH W
Sbjct  138  MPIKSLKLDLWQLKYLRVATRFGLLAEACLALLLLPILRGMALFQILGIQFEASVRYHIW  197

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGT+MI+FAT+HGA T FIW
Sbjct  198  LGTSMILFATIHGASTLFIW  217



>gb|KDO69496.1| hypothetical protein CISIN_1g005126mg [Citrus sinensis]
Length=672

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 150/203 (74%), Gaps = 3/203 (1%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            +   W++LWILKPT +WT+ W  AE++A  ++FGY GL FAV TFPVIA AI+GFVYL  
Sbjct  16   ICAAWIALWILKPTNLWTKIWHEAEDRARPTLFGYYGLNFAVSTFPVIALAIIGFVYLHL  75

Query  269  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
              +K +    RQ R     LSNPL+V S +GILS  EIL V LF+IFL WT+Y RISNDF
Sbjct  76   LPRKPR---IRQARSSATALSNPLVVNSIVGILSSFEILLVFLFVIFLVWTYYARISNDF  132

Query  449  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
            +K +  K  KL  WQ + LRVATRFGLL EACLALLLLP+LR +++FRLLG+QFE SVRY
Sbjct  133  KKLMPVKSLKLDTWQLKYLRVATRFGLLAEACLALLLLPILRGLSLFRLLGIQFEASVRY  192

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLGTAMI FAT+HG  T F+W
Sbjct  193  HIWLGTAMIFFATIHGGSTLFVW  215



>ref|XP_006439912.1| hypothetical protein CICLE_v10019061mg [Citrus clementina]
 gb|ESR53152.1| hypothetical protein CICLE_v10019061mg [Citrus clementina]
Length=713

 Score =   223 bits (567),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 150/203 (74%), Gaps = 3/203 (1%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            +   W++LWILKPT +WT+ W  AE++A  ++FGY GL FAV TFPVIA AI+GFVYL  
Sbjct  16   ICAAWIALWILKPTNLWTKIWHEAEDRARPTLFGYYGLNFAVSTFPVIALAIIGFVYLHL  75

Query  269  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
              +K +    RQ R     LSNPL+V S +GILS  EIL V LF+IFL WT+Y RISNDF
Sbjct  76   LPRKPR---IRQARSSATALSNPLVVNSIVGILSSFEILLVFLFVIFLVWTYYARISNDF  132

Query  449  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
            +K +  K  KL  WQ + LRVATRFGLL EACLALLLLP+LR +++FRLLG+QFE SVRY
Sbjct  133  KKLMPVKSLKLDTWQLKYLRVATRFGLLAEACLALLLLPILRGLSLFRLLGIQFEASVRY  192

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLGTAMI FAT+HG  T F+W
Sbjct  193  HIWLGTAMIFFATIHGGSTLFVW  215



>gb|KDO69497.1| hypothetical protein CISIN_1g005126mg [Citrus sinensis]
Length=713

 Score =   223 bits (567),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 150/203 (74%), Gaps = 3/203 (1%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            +   W++LWILKPT +WT+ W  AE++A  ++FGY GL FAV TFPVIA AI+GFVYL  
Sbjct  16   ICAAWIALWILKPTNLWTKIWHEAEDRARPTLFGYYGLNFAVSTFPVIALAIIGFVYLHL  75

Query  269  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
              +K +    RQ R     LSNPL+V S +GILS  EIL V LF+IFL WT+Y RISNDF
Sbjct  76   LPRKPR---IRQARSSATALSNPLVVNSIVGILSSFEILLVFLFVIFLVWTYYARISNDF  132

Query  449  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
            +K +  K  KL  WQ + LRVATRFGLL EACLALLLLP+LR +++FRLLG+QFE SVRY
Sbjct  133  KKLMPVKSLKLDTWQLKYLRVATRFGLLAEACLALLLLPILRGLSLFRLLGIQFEASVRY  192

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLGTAMI FAT+HG  T F+W
Sbjct  193  HIWLGTAMIFFATIHGGSTLFVW  215



>ref|XP_006476874.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Citrus 
sinensis]
Length=713

 Score =   222 bits (566),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 150/203 (74%), Gaps = 3/203 (1%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            +   W++LWILKPT +WT+ W  AE++A  ++FGY GL FAV TFPVIA AI+GF+YL  
Sbjct  16   ICAAWIALWILKPTNLWTKIWHEAEDRARPTLFGYYGLNFAVSTFPVIALAIIGFIYLHL  75

Query  269  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
              +K +    RQ R     LSNPL+V S +GILS  EIL V LF+IFL WT+Y RISNDF
Sbjct  76   LPRKPR---IRQARSSATALSNPLVVNSIVGILSSFEILLVFLFVIFLVWTYYARISNDF  132

Query  449  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
            +K +  K  KL  WQ + LRVATRFGLL EACLALLLLP+LR +++FRLLG+QFE SVRY
Sbjct  133  KKLMPVKSLKLNTWQLKYLRVATRFGLLAEACLALLLLPILRGLSLFRLLGIQFEASVRY  192

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLGTAMI FAT+HG  T F+W
Sbjct  193  HIWLGTAMIFFATIHGGSTLFVW  215



>gb|ADR70889.1| ferric reductase oxidase [Manihot esculenta]
Length=722

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 150/200 (75%), Gaps = 3/200 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GWVSLW+LKPT +WTR WK  E+ A  ++FGY GL FAVYTFPVI+ AI+G VYL     
Sbjct  20   GWVSLWLLKPTNLWTRKWKGVEDSARPTIFGYYGLDFAVYTFPVISLAIIGLVYLNLL--  77

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              KE + R+        SNP+IV S +GILSGIEIL V LFI+ L WT+YTRISNDF+K 
Sbjct  78   -SKETLRRKASSSTTGFSNPVIVNSFIGILSGIEILWVFLFILLLGWTYYTRISNDFKKL  136

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +  K  KL +WQ + LRVATRFGLL EACLALLLLP+LR +A+F+LLG+QFE SV+YH W
Sbjct  137  MPIKLLKLNLWQLKYLRVATRFGLLAEACLALLLLPILRGLALFQLLGIQFEASVKYHIW  196

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGT+MI FAT+HG  T FIW
Sbjct  197  LGTSMIFFATVHGGSTLFIW  216



>ref|XP_002321628.1| ferric reductase-like transmembrane component family protein 
[Populus trichocarpa]
 gb|EEF05755.1| ferric reductase-like transmembrane component family protein 
[Populus trichocarpa]
Length=722

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 151/200 (76%), Gaps = 2/200 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+++WI KPT +WTR WK AE+ +S +VFGY GL FAVYTFP+I+  I+G VYL    +
Sbjct  20   GWIAVWIQKPTNMWTRKWKGAEDSSSYTVFGYYGLNFAVYTFPLISLTIIGLVYLNLVSR  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
            +     SR  R      SNP++V S LGILS IEIL V LF++FLAWT+Y RISNDF+K 
Sbjct  80   EPPR--SRPARSATIGFSNPVLVNSFLGILSSIEILAVFLFVLFLAWTYYARISNDFKKL  137

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +  K   L +WQ + LRVATRFGLL EACLALLLLP+LR +A+F++LG+QFE SVRYH W
Sbjct  138  MPIKSLNLDLWQLKYLRVATRFGLLAEACLALLLLPILRGLALFQILGIQFEASVRYHIW  197

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGT+MI+FAT+HGA T FIW
Sbjct  198  LGTSMILFATIHGASTLFIW  217



>ref|XP_004515872.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Cicer 
arietinum]
Length=714

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 151/202 (75%), Gaps = 2/202 (1%)
 Frame = +2

Query  92   STGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            S GW+SLW+LKPTQVWT TWK AE+ A+ ++FGY GL F VYTFPVIA AI+G + L+  
Sbjct  18   SAGWISLWLLKPTQVWTTTWKHAEQSANNTIFGYYGLNFVVYTFPVIAIAIIGLLLLDFS  77

Query  272  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
              +      R  RR     SN L+V S  GILS +EIL   LF++FLAWTFY RISNDF+
Sbjct  78   SIEIIN--CRSARRSSIVFSNQLVVNSVFGILSSVEILIAFLFMVFLAWTFYARISNDFK  135

Query  452  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
            K +  K  KL +WQ + LRVATRFGLL EACLALLLLP+LR +++FR+LG+QFE SV+YH
Sbjct  136  KLMPDKSLKLNIWQLKYLRVATRFGLLAEACLALLLLPILRGLSLFRILGIQFEASVKYH  195

Query  632  TWLGTAMIVFATLHGAGTFFIW  697
            TW+GTAMI+FAT+HG  T F+W
Sbjct  196  TWVGTAMILFATIHGISTLFVW  217



>gb|EYU22175.1| hypothetical protein MIMGU_mgv1a002211mg [Erythranthe guttata]
Length=701

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 153/202 (76%), Gaps = 5/202 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASAS-VFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+S+W+LKPT+ WT+ WKAAEEKA+AS +F YNGL F VY FP+IA AI+G++YLE K 
Sbjct  16   GWLSIWVLKPTEFWTQKWKAAEEKANASSIFRYNGLDFVVYAFPLIALAIIGYIYLELK-  74

Query  275  QKQKEGISRQERR-CLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
              Q E I+R+ RR  L   S+ + V   LG+LSG +IL  SLFI+FL WTFY R+S DF+
Sbjct  75   --QTERINRRGRRNALTCFSSRIYVNGYLGVLSGAQILASSLFIVFLVWTFYARVSADFK  132

Query  452  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
            K    K FKL+ WQY+  R+ATR GLL+E CLALLLLPVLR M++FRLL ++FE SV YH
Sbjct  133  KMTPGKTFKLSPWQYKFFRMATRCGLLSEVCLALLLLPVLRGMSIFRLLKIEFEASVMYH  192

Query  632  TWLGTAMIVFATLHGAGTFFIW  697
              LG AMI FATLHGAGTFFIW
Sbjct  193  ICLGNAMIFFATLHGAGTFFIW  214



>ref|XP_002511330.1| ferric-chelate reductase, putative [Ricinus communis]
 gb|EEF51932.1| ferric-chelate reductase, putative [Ricinus communis]
Length=726

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 154/201 (77%), Gaps = 4/201 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GWV++WILKPT +WTR WK AE+ A ++VFGY GL FAVYTFP+IA AI G VYL     
Sbjct  20   GWVAIWILKPTNLWTRKWKEAEDSARSTVFGYYGLDFAVYTFPIIALAITGLVYLSFL--  77

Query  278  KQKEGISRQERRC-LAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
              KE ++R++ R   + +SNP+IV S +G+LS +EIL V  FI+FLAWT+Y RI+NDF+K
Sbjct  78   -SKEPVTRRQARIPTSGISNPVIVNSFVGVLSTLEILVVLFFILFLAWTYYVRIANDFKK  136

Query  455  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  634
             +  K   L +WQ + LRVATRFGLL EACLALLLLP+LR +A+F+L G+QFE +VRYH 
Sbjct  137  LMPAKSLNLNLWQLKYLRVATRFGLLAEACLALLLLPILRGLALFQLFGIQFEATVRYHV  196

Query  635  WLGTAMIVFATLHGAGTFFIW  697
            WLGT+MI FATLHGA T FIW
Sbjct  197  WLGTSMIFFATLHGASTLFIW  217



>gb|KEH31789.1| oxidoreductase/ferric-chelate reductase [Medicago truncatula]
Length=714

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 157/203 (77%), Gaps = 1/203 (0%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            +   W+SLWILKPTQVWT+ WK  E+ A+ ++FGY GL FAVYTFP+IA AI+G ++L+ 
Sbjct  17   ICAAWISLWILKPTQVWTKKWKHVEQSANNTIFGYYGLNFAVYTFPIIAIAIIGLLFLDL  76

Query  269  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            K   Q+    R     + F SNPL+V S +GILS IEIL V LFI+FLAWT+Y RISNDF
Sbjct  77   KAGYQRSRNGRSSSSSIVF-SNPLVVNSVVGILSSIEILVVFLFIVFLAWTYYARISNDF  135

Query  449  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
            +K +Q K  KL +WQ + LR+ATRFGLL EACLALLLLP+LR +A+FR+ G+QFE SV+Y
Sbjct  136  KKLMQDKSLKLNIWQLKSLRIATRFGLLAEACLALLLLPILRGLAIFRIFGIQFEASVKY  195

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            HTW+GTAMI+FAT+HGA T F+W
Sbjct  196  HTWIGTAMILFATIHGASTLFVW  218



>ref|XP_012079987.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Jatropha 
curcas]
 gb|KDP31036.1| hypothetical protein JCGZ_11412 [Jatropha curcas]
Length=724

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GWVSLW+LKPT +WTR WK AE+ A  ++FGY GL FA YTFP+IA AI+G VYL     
Sbjct  20   GWVSLWLLKPTNLWTRKWKEAEDSARPTIFGYYGLNFAAYTFPIIALAIIGLVYLNFL--  77

Query  278  KQKEGISRQERRCLAF-LSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
              KE I R++ R      SNP+IV S +GILS  EIL V LFI+FL WT+YTRISND +K
Sbjct  78   -SKELIRRRQARTPTIGFSNPVIVNSFVGILSSKEILTVLLFILFLVWTYYTRISNDLKK  136

Query  455  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  634
             +  K   L +WQ + LRVATRFGLL EACL LLLLP+LR +++F+LLG+QFE SVRYH 
Sbjct  137  LMPIKSLNLNLWQLKYLRVATRFGLLAEACLVLLLLPILRGLSLFQLLGIQFEASVRYHI  196

Query  635  WLGTAMIVFATLHGAGTFFIW  697
            WLGT+MI FAT+HG  T  +W
Sbjct  197  WLGTSMIFFATIHGGSTLLVW  217



>ref|XP_010248638.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Nelumbo 
nucifera]
Length=720

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 145/200 (73%), Gaps = 3/200 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
             WV LW+LKPT++WT++W  AE+ A  + FGYNGL F+VY+FP+IA AI+GF+Y+  +  
Sbjct  34   SWVCLWLLKPTELWTKSWHKAEDSARNTFFGYNGLDFSVYSFPIIAVAIIGFIYMHLRA-  92

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              +E   RQ+R  +  LSNP+IV S LGI+S  E+L  +LF++FL WT Y  IS DF+K 
Sbjct  93   --REPTRRQKRFPITTLSNPVIVHSPLGIISTWELLIAALFVLFLLWTIYVHISKDFKKL  150

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
               K  KL VWQ + +RV  RFGLL EACLALLL P+LR MA+FRL GLQFE SVRYH W
Sbjct  151  TPPKSLKLEVWQIKFMRVGIRFGLLAEACLALLLFPILRGMALFRLFGLQFEASVRYHVW  210

Query  638  LGTAMIVFATLHGAGTFFIW  697
             GTAMI FATLHG+ + FIW
Sbjct  211  FGTAMIFFATLHGSSSLFIW  230



>ref|XP_008459874.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Cucumis 
melo]
 ref|XP_008459875.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Cucumis 
melo]
 ref|XP_008459876.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Cucumis 
melo]
 ref|XP_008459877.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Cucumis 
melo]
Length=718

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 143/200 (72%), Gaps = 0/200 (0%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+SLW+LKPT +WT+ W  AE  A AS FGY GL F VYTFPVI   I+G VYL  K  
Sbjct  25   GWISLWLLKPTDLWTKKWHLAENSARASPFGYYGLNFVVYTFPVIVLVIIGLVYLNNKPS  84

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              +     +       LSNPL+V + LGILSGIE+LG++LF++FLAWTFY RIS DFRK 
Sbjct  85   NPQTFRQTKFSTFSNALSNPLVVNNYLGILSGIELLGIALFLLFLAWTFYARISKDFRKL  144

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +  +   L +W+ + LR+ATRFGLL EACL LLLLP+LR +A F+L+G+QFE SV+YH W
Sbjct  145  LPVESLNLKIWELKYLRIATRFGLLAEACLGLLLLPILRGLAPFQLIGIQFEASVKYHVW  204

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGTAM++F T HG  T FIW
Sbjct  205  LGTAMVLFGTFHGISTLFIW  224



>ref|XP_011656797.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Cucumis 
sativus]
 ref|XP_011656798.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Cucumis 
sativus]
Length=718

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 145/200 (73%), Gaps = 0/200 (0%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+SLW+LKPT +WT+ W  AE  A AS+FGY GL F VYTFPVI   ++G V+L  K  
Sbjct  25   GWISLWLLKPTDLWTKKWHLAENSARASLFGYYGLNFVVYTFPVIVLVMIGLVHLNNKPS  84

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              +     +       LSNPL+V + LGILSGIE+LGV+LF++FLAWTFY RIS DFRK 
Sbjct  85   SPQTFRQTKFSTFSNALSNPLVVNNYLGILSGIELLGVALFLLFLAWTFYARISKDFRKL  144

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +  +   L +W+ + LR+ATRFGLL EACL+LLLLP+LR +A F+L+G+QFE SV+YH W
Sbjct  145  LPVESLNLKIWELKYLRIATRFGLLAEACLSLLLLPILRGLAPFQLIGIQFEASVKYHVW  204

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGTAM++F T HG  T FIW
Sbjct  205  LGTAMVLFGTFHGISTLFIW  224



>emb|CBI14963.3| unnamed protein product [Vitis vinifera]
Length=703

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 164/218 (75%), Gaps = 6/218 (3%)
 Frame = +2

Query  44   MAKASllilklllilVSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTF  223
            MAKA+LLILKLL+IL+  GW++LWILKPTQ+WT+ W  AE+ A  +VFGY GL F VYTF
Sbjct  1    MAKATLLILKLLMILICAGWITLWILKPTQLWTKKWHTAEDSARTTVFGYYGLNFVVYTF  60

Query  224  PVIAFAIVGFVYLEQKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFI  403
            PVIA A +GFVYL+ + ++ +   +R+     + LSNPL+V + LG+LS +EIL VSLF 
Sbjct  61   PVIALAAIGFVYLDLQSRESRRRQARRS---ASVLSNPLVVNNYLGVLSALEILAVSLFF  117

Query  404  IFLAWTFYTRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMA  583
            ++LAWTFY  ISNDF K V  K  K    Q++ LRVATRFGLL EACLALLLLPVLR MA
Sbjct  118  LYLAWTFYVHISNDFEKMVPAKSLKR---QFKFLRVATRFGLLAEACLALLLLPVLRGMA  174

Query  584  VFRLLGLQFEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            +FR +G+QFE SVRYH WLGTAMI FAT HG  T  +W
Sbjct  175  LFRFVGVQFEASVRYHVWLGTAMIFFATFHGVSTLIVW  212



>ref|XP_010102484.1| Ferric reduction oxidase 8 [Morus notabilis]
 gb|EXB93548.1| Ferric reduction oxidase 8 [Morus notabilis]
Length=711

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 145/200 (73%), Gaps = 3/200 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+SLW+LKPTQ+WTR WK  EE+   ++ GY G+ F V+TFPVIA AI+G +Y+  + +
Sbjct  20   GWISLWLLKPTQIWTRKWKEVEERLRPTILGYYGINFVVFTFPVIALAIIGSIYMNLQLR  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
            K +    +   +  + +SNP++V + LG  S +EIL +SLF +FLAWTFY RISNDF+  
Sbjct  80   KTRRSYGK---KVFSGISNPVVVNTLLGTFSALEILSISLFALFLAWTFYARISNDFKDL  136

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +  K  KL  WQ + LRVATRFGLL EACLALLLLP+LR +A FRL G+QFE SVRYH W
Sbjct  137  MPVKSLKLKTWQLKYLRVATRFGLLAEACLALLLLPILRGLAFFRLFGIQFEASVRYHVW  196

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGTAM+ FAT HG  T FIW
Sbjct  197  LGTAMVCFATFHGGSTLFIW  216



>ref|XP_008373357.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Malus domestica]
Length=706

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 149/201 (74%), Gaps = 4/201 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
             W+SLW+LKPTQ+WT+ WK AE+ A  +VFGY GL FAVYTFP IA AI+G +YL  K  
Sbjct  20   AWISLWLLKPTQLWTKKWKGAEDAARNTVFGYYGLNFAVYTFPPIALAIIGSLYLNWKP-  78

Query  278  KQKEGISRQERRCLAF-LSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
              KE I R+ R  +A   SNPL+V + +G+LS +EIL V LF++FLAW FY RISNDF+ 
Sbjct  79   --KEPIRRKGRGLIAAGFSNPLVVNALVGVLSTLEILAVFLFLLFLAWNFYARISNDFKN  136

Query  455  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  634
               +K   L  WQ + LRVATRFGLL EACLA LL P+LR +A+FR+LG+QFE S++YHT
Sbjct  137  LKPSKSIVLNSWQLKYLRVATRFGLLAEACLAFLLFPILRGLALFRVLGIQFEASIKYHT  196

Query  635  WLGTAMIVFATLHGAGTFFIW  697
            WLGTAM+ FAT HGA T FIW
Sbjct  197  WLGTAMLFFATFHGASTLFIW  217



>ref|XP_008373358.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Malus domestica]
Length=699

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 149/201 (74%), Gaps = 4/201 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
             W+SLW+LKPTQ+WT+ WK AE+ A  +VFGY GL FAVYTFP IA AI+G +YL  K  
Sbjct  20   AWISLWLLKPTQLWTKKWKGAEDAARNTVFGYYGLNFAVYTFPPIALAIIGSLYLNWKP-  78

Query  278  KQKEGISRQERRCLAF-LSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
              KE I R+ R  +A   SNPL+V + +G+LS +EIL V LF++FLAW FY RISNDF+ 
Sbjct  79   --KEPIRRKGRGLIAAGFSNPLVVNALVGVLSTLEILAVFLFLLFLAWNFYARISNDFKN  136

Query  455  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  634
               +K   L  WQ + LRVATRFGLL EACLA LL P+LR +A+FR+LG+QFE S++YHT
Sbjct  137  LKPSKSIVLNSWQLKYLRVATRFGLLAEACLAFLLFPILRGLALFRVLGIQFEASIKYHT  196

Query  635  WLGTAMIVFATLHGAGTFFIW  697
            WLGTAM+ FAT HGA T FIW
Sbjct  197  WLGTAMLFFATFHGASTLFIW  217



>ref|XP_003549599.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Glycine 
max]
 gb|KHN18418.1| Ferric reduction oxidase 8, mitochondrial [Glycine soja]
Length=711

 Score =   209 bits (531),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 152/200 (76%), Gaps = 0/200 (0%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GWVSLW+LKPTQ+WTR WK AE+ A+ ++FGY GL FAVY FP+IA AI+G + L+ K  
Sbjct  22   GWVSLWLLKPTQIWTRKWKQAEDSANDTIFGYYGLSFAVYAFPIIAIAIIGLLLLDLKAG  81

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
             Q+   +R       F SNPL+V ++LGILS IEIL   LFI+FLAWT+Y+RI  DF+K 
Sbjct  82   YQRSRSARSTPSKSNFFSNPLVVNTTLGILSSIEILIAFLFIVFLAWTYYSRIYTDFKKL  141

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +  K  KL  WQ +  R+ATRFGLL EAC+ALLLLP+LR +AVFR+LG+QFE SVRYHTW
Sbjct  142  MPYKSLKLNTWQLKYHRIATRFGLLAEACMALLLLPILRGLAVFRILGIQFEASVRYHTW  201

Query  638  LGTAMIVFATLHGAGTFFIW  697
            +GTAMI+FAT+HGA T  +W
Sbjct  202  IGTAMILFATIHGASTLLVW  221



>ref|XP_010663103.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Vitis vinifera]
Length=725

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 165/237 (70%), Gaps = 22/237 (9%)
 Frame = +2

Query  44   MAKASllilklllilVSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTF  223
            MAKA+LLILKLL+IL+  GW++LWILKPTQ+WT+ W  AE+ A  +VFGY GL F VYTF
Sbjct  1    MAKATLLILKLLMILICAGWITLWILKPTQLWTKKWHTAEDSARTTVFGYYGLNFVVYTF  60

Query  224  PVIAFAIVGFVYLEQKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFI  403
            PVIA A +GFVYL+ + ++ +   +R+     + LSNPL+V + LG+LS +EIL VSLF 
Sbjct  61   PVIALAAIGFVYLDLQSRESRRRQARRS---ASVLSNPLVVNNYLGVLSALEILAVSLFF  117

Query  404  IFLAWTFYTRISNDFRKTVQTK-------------------DFKLAVWQYRMLRVATRFG  526
            ++LAWTFY  ISNDF K V  K                     KL   Q++ LRVATRFG
Sbjct  118  LYLAWTFYVHISNDFEKMVPAKSLKSYSTISNAGKKMTPAESLKLNTRQFKFLRVATRFG  177

Query  527  llteaclallllpvlRRMAVFRLLGLQFEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            LL EACLALLLLPVLR MA+FR +G+QFE SVRYH WLGTAMI FAT HG  T  +W
Sbjct  178  LLAEACLALLLLPVLRGMALFRFVGVQFEASVRYHVWLGTAMIFFATFHGVSTLIVW  234



>ref|XP_002318065.1| ferric reductase-like transmembrane component family protein 
[Populus trichocarpa]
 gb|EEE96285.1| ferric reductase-like transmembrane component family protein 
[Populus trichocarpa]
Length=743

 Score =   201 bits (510),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 148/200 (74%), Gaps = 2/200 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW++LW+LKPT +WTR WK AE+ A  +VFGY GL FAV+TFP IA  I+G VYL+   +
Sbjct  20   GWIALWLLKPTNLWTRKWKGAEDSARHTVFGYYGLNFAVFTFPPIAVTIIGLVYLDLVTK  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
            +     SR  R      SNP++V S +GILS +EIL V LF +FLAWT+Y RISNDF+K 
Sbjct  80   EPPR--SRPARSATVGFSNPVVVNSFVGILSSLEILAVFLFFLFLAWTYYARISNDFKKL  137

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +  K  KL +WQ + LRVATRFGLL E CLALLLLPVLR +A+F+L+G+QFE SVRYH  
Sbjct  138  MPVKSLKLDLWQIKYLRVATRFGLLAEVCLALLLLPVLRGLAIFQLIGIQFEASVRYHIL  197

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGT+MI F+T+HGA T FIW
Sbjct  198  LGTSMIFFSTIHGASTLFIW  217



>ref|XP_011047810.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Populus 
euphratica]
 ref|XP_011047811.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Populus 
euphratica]
Length=733

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 146/200 (73%), Gaps = 2/200 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW++LW+LKPT +WT  WK AE+ A  +VFGY GL F V+TFP IA  I+G VYL+   +
Sbjct  29   GWIALWLLKPTDLWTSKWKGAEDSARHAVFGYYGLNFGVFTFPPIALTIIGLVYLDLVTK  88

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
            +     SR  R      SNP++V S +GILS +EIL V LF +FLAWT+Y RISNDF+  
Sbjct  89   EPPR--SRPARSATVGFSNPVVVNSFVGILSSLEILAVFLFFLFLAWTYYARISNDFKNL  146

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +  K  KL +WQ + LRVATRFGLL E CLALLLLPVLR +A+F+L+G+QFE SVRYH  
Sbjct  147  MPIKSLKLDLWQIKYLRVATRFGLLAEVCLALLLLPVLRGLAIFQLIGIQFEASVRYHIL  206

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGT+MI F+T+HGAGT FIW
Sbjct  207  LGTSMIFFSTIHGAGTLFIW  226



>ref|XP_007155475.1| hypothetical protein PHAVU_003G204400g [Phaseolus vulgaris]
 gb|ESW27469.1| hypothetical protein PHAVU_003G204400g [Phaseolus vulgaris]
Length=709

 Score =   197 bits (502),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 146/200 (73%), Gaps = 2/200 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
             WVSLW LKPTQ+WTR WK  E  A  ++FGY GL FAVYTFP+IA AI+G + L+ K  
Sbjct  22   AWVSLWFLKPTQIWTRKWKQLENSADNTIFGYYGLSFAVYTFPIIAIAIIGLLLLDLKSG  81

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
             Q        +    F S PL+V S++GILS IE+L   LFI+FL WT+Y+RIS DF+K 
Sbjct  82   YQSRSARSPSKS--NFFSKPLVVNSTVGILSIIEVLVAFLFIVFLVWTYYSRISADFKKL  139

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            V  K  KL  WQ +  RVATRFGLL+EACLALLLLP+LR +AVFR+LG+QFE SVRYHTW
Sbjct  140  VPYKSLKLNTWQLKYHRVATRFGLLSEACLALLLLPILRGLAVFRILGIQFEASVRYHTW  199

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGTAMI+FAT+HGA T  IW
Sbjct  200  LGTAMILFATIHGASTLLIW  219



>ref|XP_010678862.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=726

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 136/199 (68%), Gaps = 3/199 (2%)
 Frame = +2

Query  101  WVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQK  280
            W+ +W LKPT+ WT+ W+  E+    ++  YNG  F VYTF +I   +VG VYL  + + 
Sbjct  34   WIIIWFLKPTKFWTKKWRIVEDSMQITILKYNGADFVVYTFLIILLVMVGLVYLYLQPRI  93

Query  281  QKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKTV  460
              +   R+    L    NPLIVKS LG+LSGI++L +SL +  L WTFY RISND++K V
Sbjct  94   LIKRRIRRYITALY---NPLIVKSPLGMLSGIDVLVISLVLTLLVWTFYVRISNDYKKLV  150

Query  461  QTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTWL  640
              K  KL +WQ + LR++TRFGL+ E CLA LL P+LR ++VFRLLG+QFE SVRYH WL
Sbjct  151  PVKQLKLEIWQLKFLRMSTRFGLMGEICLAFLLFPILRGLSVFRLLGIQFEASVRYHMWL  210

Query  641  GTAMIVFATLHGAGTFFIW  697
            GT +I FA LHGAGT FIW
Sbjct  211  GTMLIFFAILHGAGTLFIW  229



>ref|XP_009406362.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=709

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 133/200 (67%), Gaps = 3/200 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
             W  +WI++PTQ W R+W  AE++A+A+  G  GL   VY  PV+A A +G++ L    +
Sbjct  23   AWACIWIIRPTQSWKRSWHVAEDRANATFLGDYGLTVVVYCLPVLAVATLGYISLHIAAK  82

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
            K      R+ R  +   +NPLIV S +G+LS  E+LGV+LFI+FLAWT+Y+ +S+DF+K 
Sbjct  83   KDD---LRKRRPLMPAFTNPLIVSSPVGVLSAAELLGVALFIVFLAWTYYSNVSSDFKKM  139

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
               K  KL  WQ +M+ +  R G L+EACL LL LP+LR MAVFR+LG+Q+E SVRYH W
Sbjct  140  TPYKSLKLNRWQLKMMHMGVRIGSLSEACLLLLFLPILRGMAVFRILGVQYEASVRYHIW  199

Query  638  LGTAMIVFATLHGAGTFFIW  697
            +G  MI+ + LHG    FIW
Sbjct  200  IGNTMILLSVLHGISIMFIW  219



>ref|XP_009114915.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Brassica rapa]
Length=727

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 138/200 (69%), Gaps = 2/200 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
             W+SLWI+KPT VW ++W+ AE+    + FGY GL FAV++FP IA +I+G +YL    Q
Sbjct  20   SWISLWIIKPTTVWIQSWRQAEDTFKHTFFGYYGLSFAVFSFPPIALSIIGLIYLSLLPQ  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              +  ++R  R     +S P I+ S +GI+S  EI+ V LF++FLAWTFY R++ND +K 
Sbjct  80   HHR--LTRGGRSAAISVSRPAIINSFIGIVSCFEIIAVILFLVFLAWTFYVRVNNDLKKL  137

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +  K   L +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL +QF  SV+YH W
Sbjct  138  MPVKTMNLDLWQLQYFRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIQFAASVKYHVW  197

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGT ++ F+ +HG  T FIW
Sbjct  198  LGTGLVFFSLVHGGSTLFIW  217



>ref|XP_009114914.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Brassica rapa]
Length=728

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 138/200 (69%), Gaps = 2/200 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
             W+SLWI+KPT VW ++W+ AE+    + FGY GL FAV++FP IA +I+G +YL    Q
Sbjct  20   SWISLWIIKPTTVWIQSWRQAEDTFKHTFFGYYGLSFAVFSFPPIALSIIGLIYLSLLPQ  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              +  ++R  R     +S P I+ S +GI+S  EI+ V LF++FLAWTFY R++ND +K 
Sbjct  80   HHR--LTRGGRSAAISVSRPAIINSFIGIVSCFEIIAVILFLVFLAWTFYVRVNNDLKKL  137

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +  K   L +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL +QF  SV+YH W
Sbjct  138  MPVKTMNLDLWQLQYFRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIQFAASVKYHVW  197

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGT ++ F+ +HG  T FIW
Sbjct  198  LGTGLVFFSLVHGGSTLFIW  217



>gb|KFK26648.1| hypothetical protein AALP_AA8G275500 [Arabis alpina]
Length=728

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 138/201 (69%), Gaps = 2/201 (1%)
 Frame = +2

Query  95   TGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            TGWVSLWI+KPT +W ++W+ AE+    +  GY GL FAV++FP IA +I+G +YL    
Sbjct  19   TGWVSLWIIKPTTLWIQSWRQAEDTIKHTFIGYYGLNFAVFSFPPIALSIIGLIYLSLLS  78

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
                   +R  R+    +S P ++ S +GI+S  EIL + LF++FLAWTFY+R+SND +K
Sbjct  79   HHHHP--ARGGRKRALSVSRPAVINSVIGIVSCFEILALVLFMLFLAWTFYSRVSNDLKK  136

Query  455  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  634
             +  K   L +WQ +  RVATRFGLL EACLALLL PVLR +++FRLL +QF  +V+YH 
Sbjct  137  LMPVKTMNLDLWQLKYFRVATRFGLLAEACLALLLFPVLRGLSMFRLLNIQFAATVKYHV  196

Query  635  WLGTAMIVFATLHGAGTFFIW  697
            WLGT +I FA +HG  T FIW
Sbjct  197  WLGTGLIFFAFVHGGSTLFIW  217



>emb|CDY22585.1| BnaC05g24230D [Brassica napus]
Length=725

 Score =   186 bits (472),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 137/200 (69%), Gaps = 2/200 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
             W+SLWI+KPT VW ++W+ AE+    + FGY G+ FAV+TFP IA +I+G +YL    Q
Sbjct  20   SWISLWIIKPTTVWIQSWRQAEDTFQHTFFGYYGVSFAVFTFPPIALSIIGLIYLSLLPQ  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              +  ++R  R     +S P I+ S +GI+S  EI+ V LF++FLAWTFY R++ND +K 
Sbjct  80   HHR--LTRGGRSAAITVSRPAIISSFIGIVSCFEIVAVILFLVFLAWTFYVRVNNDLKKL  137

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +  K     +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL +QF  SV+YH W
Sbjct  138  MPVKTMNFDLWQLKYFRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIQFAASVKYHVW  197

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGT ++ F+ +HG  T FIW
Sbjct  198  LGTGLVFFSLVHGGSTLFIW  217



>gb|KGN46442.1| hypothetical protein Csa_6G093620 [Cucumis sativus]
Length=703

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 136/201 (68%), Gaps = 17/201 (8%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAI-VGFVYLEQKK  274
            GW+SLW+LKPT +WT+ W  AE  A AS+FGY          P I + I + F++  Q K
Sbjct  25   GWISLWLLKPTDLWTKKWHLAENSARASLFGYYD------PTPAIHYIIDMNFMFFRQTK  78

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
                             LSNPL+V + LGILSGIE+LGV+LF++FLAWTFY RIS DFRK
Sbjct  79   FSTFSNA----------LSNPLVVNNYLGILSGIELLGVALFLLFLAWTFYARISKDFRK  128

Query  455  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  634
             +  +   L +W+ + LR+ATRFGLL EACL+LLLLP+LR +A F+L+G+QFE SV+YH 
Sbjct  129  LLPVESLNLKIWELKYLRIATRFGLLAEACLSLLLLPILRGLAPFQLIGIQFEASVKYHV  188

Query  635  WLGTAMIVFATLHGAGTFFIW  697
            WLGTAM++F T HG  T FIW
Sbjct  189  WLGTAMVLFGTFHGISTLFIW  209



>ref|XP_010906716.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Elaeis 
guineensis]
Length=703

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 138/203 (68%), Gaps = 3/203 (1%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            V + W+ +WIL+PTQ+W ++W  AE+ A+A++ G  GL   V+ FPV+A A +G++YL  
Sbjct  18   VLSAWICIWILRPTQLWKKSWHVAEDLANATILGDYGLNVVVFCFPVLAVATLGYIYLHL  77

Query  269  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
               K   G  RQ    +   S+PLI+ S +GILSG E+L ++LF++FL WT+Y+ +S DF
Sbjct  78   CVNK---GRLRQRISWMTHFSSPLIISSPVGILSGGELLFIALFVLFLVWTYYSNVSGDF  134

Query  449  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
            +K    K  +L  WQ +M+R+  R G L+EACLALLLLP+LR MAVFR+ G+QFE SVRY
Sbjct  135  KKMPPYKPLQLNRWQQKMMRMGIRIGSLSEACLALLLLPILRGMAVFRIPGIQFEASVRY  194

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H W+G AMI+ + LHG     +W
Sbjct  195  HVWIGNAMILLSVLHGVTIMSVW  217



>ref|XP_010533458.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Tarenaya hassleriana]
Length=725

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 139/200 (70%), Gaps = 3/200 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+SLWIL+PT +WTR W+ AEE    + FGY GL F V +FPV+A +++G +YL    Q
Sbjct  20   GWISLWILRPTNLWTRAWRQAEEAMKHTFFGYYGLNFVVLSFPVVAISMIGLIYLSFPPQ  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              +   +R        +SNP+I+   +GI+S  E++ + LF++ LAWTFY RISNDF+K 
Sbjct  80   NLR---NRGNVEPQISVSNPIIISQFIGIVSCFELVALLLFLLLLAWTFYARISNDFKKL  136

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +  K  KL +WQ + LRVATRFGLL EACLALLLLPVLR ++VFRL  +QFE SV+YH W
Sbjct  137  MPVKSMKLDLWQLKYLRVATRFGLLAEACLALLLLPVLRGLSVFRLWNIQFEASVKYHIW  196

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGTAMI FA  HG    FIW
Sbjct  197  LGTAMIFFAMFHGGSILFIW  216



>ref|XP_010533455.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010533456.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010533457.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Tarenaya hassleriana]
Length=729

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 139/200 (70%), Gaps = 3/200 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+SLWIL+PT +WTR W+ AEE    + FGY GL F V +FPV+A +++G +YL    Q
Sbjct  20   GWISLWILRPTNLWTRAWRQAEEAMKHTFFGYYGLNFVVLSFPVVAISMIGLIYLSFPPQ  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              +   +R        +SNP+I+   +GI+S  E++ + LF++ LAWTFY RISNDF+K 
Sbjct  80   NLR---NRGNVEPQISVSNPIIISQFIGIVSCFELVALLLFLLLLAWTFYARISNDFKKL  136

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +  K  KL +WQ + LRVATRFGLL EACLALLLLPVLR ++VFRL  +QFE SV+YH W
Sbjct  137  MPVKSMKLDLWQLKYLRVATRFGLLAEACLALLLLPVLRGLSVFRLWNIQFEASVKYHIW  196

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGTAMI FA  HG    FIW
Sbjct  197  LGTAMIFFAMFHGGSILFIW  216



>ref|XP_008777197.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Phoenix 
dactylifera]
Length=707

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 137/203 (67%), Gaps = 3/203 (1%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            V   W+ +WIL+PTQ+W ++W  AE++A+A++ G  GL   V+ FPV+A A +G+ YL  
Sbjct  18   VLAAWICMWILRPTQLWKKSWHVAEDRANATILGDYGLNVVVFCFPVLAVATLGYTYLHL  77

Query  269  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
               K   G  RQ    +   S+PLI+   +GILSG+E+L  ++F++FL WT+Y+ +S DF
Sbjct  78   CVSK---GRLRQRISLMTNFSSPLIISRPVGILSGLELLFAAVFVLFLVWTYYSNVSGDF  134

Query  449  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
            +K    K  +L  WQ +M+R+  R G L+EACLALLLLP+LR MAVFR++G+QFE SVRY
Sbjct  135  KKMPPYKPLQLNRWQLKMMRMGVRIGSLSEACLALLLLPILRGMAVFRIVGIQFEASVRY  194

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H W+G AMI+ + LHG     +W
Sbjct  195  HMWIGNAMILLSVLHGITIMSVW  217



>ref|XP_008238075.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Prunus 
mume]
Length=440

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 131/187 (70%), Gaps = 2/187 (1%)
 Frame = +2

Query  134  VWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQKQKEGISRQERR  313
            +WTR WKAAE+KA A++FGY GL  AV+TFP IA AI+   YL  K ++     SR+ R+
Sbjct  45   LWTRKWKAAEDKARATLFGYYGLNLAVHTFPPIALAIIRSFYLNLKPRESIR--SRKGRK  102

Query  314  CLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKTVQTKDFKLAVWQ  493
              A  SNPL+V + LG+LS +EIL V LFI+FLAW FY  ISNDF+     K   L  WQ
Sbjct  103  LTAGFSNPLVVNTLLGVLSTLEILAVFLFILFLAWNFYAHISNDFKNLKPAKSLMLNSWQ  162

Query  494  YRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTWLGTAMIVFATLH  673
             + L+V TRFGLL E CLA LL P+LR + +FRLLG+QFE SVRYH WLGTAMI FAT H
Sbjct  163  LKYLKVETRFGLLAEVCLAFLLFPILRGLGLFRLLGIQFEASVRYHIWLGTAMIFFATFH  222

Query  674  GAGTFFI  694
            GA T FI
Sbjct  223  GASTLFI  229



>ref|XP_008239582.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Prunus 
mume]
Length=630

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 120/169 (71%), Gaps = 3/169 (2%)
 Frame = +2

Query  191  YNGLCFAVYTFPVIAFAIVGFVYLEQKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILS  370
            + GL FAVYTFP IA AI+G  YL  K    +E I R+ R+  A  SNPL+V + +G+LS
Sbjct  30   FAGLNFAVYTFPPIALAIIGSFYLNLKP---RESIRRKGRKLTAGFSNPLLVNTLVGVLS  86

Query  371  GIEILGVSLFIIFLAWTFYTRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteacla  550
             +EIL V LFI+FLAW FY RISNDF+     K   L  WQ + L+VATRFGLL E CLA
Sbjct  87   TLEILAVFLFILFLAWNFYARISNDFKNLKPAKSLMLNSWQLKYLKVATRFGLLAEVCLA  146

Query  551  llllpvlRRMAVFRLLGLQFEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
             LL P+LR +A+FRLLG+QFE SVRYH WLGTA+I FAT HGA T F+W
Sbjct  147  FLLFPILRGLALFRLLGIQFEASVRYHIWLGTALIFFATFHGASTLFVW  195



>ref|NP_199827.2| ferric reduction oxidase 8 [Arabidopsis thaliana]
 sp|Q8VY13.1|FRO8_ARATH RecName: Full=Ferric reduction oxidase 8, mitochondrial; Short=AtFRO8; 
AltName: Full=Ferric-chelate reductase 8; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL66984.1| putative FRO1 and FRO2 protein [Arabidopsis thaliana]
 gb|AAO22815.1| putative FRO1 and FRO2 protein [Arabidopsis thaliana]
 gb|AED95905.1| ferric reduction oxidase 8 [Arabidopsis thaliana]
Length=728

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 137/200 (69%), Gaps = 2/200 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+SLWI+KPT +W ++W+ AE+ A  + FGY GL FAV++FP IA +IVG +YL    Q
Sbjct  20   GWISLWIIKPTTIWIQSWRQAEDTARHTFFGYYGLNFAVFSFPPIALSIVGLIYLSLLPQ  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
                  +R  R     +S P I+ S +GI+S  EIL + LF++FLAW FY R+SNDF+K 
Sbjct  80   HHHP--TRGGRGAAITVSRPAIINSFIGIVSCFEILALLLFLLFLAWNFYARVSNDFKKL  137

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +  K   L +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL ++F  SV+YH W
Sbjct  138  MPVKTMNLNLWQLKYYRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIEFAASVKYHVW  197

Query  638  LGTAMIVFATLHGAGTFFIW  697
             GT +I F+ +HG  T FIW
Sbjct  198  FGTGLIFFSLVHGGSTLFIW  217



>ref|XP_010482319.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like isoform 
X1 [Camelina sativa]
Length=730

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 134/200 (67%), Gaps = 2/200 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+SLWI+KPT +W ++W  AE+    + FGY GL FAV++FP IA +I+G +YL    Q
Sbjct  20   GWISLWIIKPTTLWIQSWHQAEDTIKHTFFGYYGLNFAVFSFPPIALSIIGLIYLSLLPQ  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              +   +R  R      S P I+ S +GI+   EI+ + LF++FLAWTFY R+++DF+K 
Sbjct  80   HHRP--TRGGRSASITTSRPAIINSFIGIMPCFEIIALFLFLLFLAWTFYVRVTSDFKKL  137

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
               K     +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL +QF  SV+YH W
Sbjct  138  TPVKTMNFNLWQLKYFRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIQFAASVKYHVW  197

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGT +I F+ LHG  T FIW
Sbjct  198  LGTGLIFFSLLHGGSTLFIW  217



>ref|XP_010482321.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=726

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 134/200 (67%), Gaps = 2/200 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+SLWI+KPT +W ++W  AE+    + FGY GL FAV++FP IA +I+G +YL    Q
Sbjct  20   GWISLWIIKPTTLWIQSWHQAEDTIKHTFFGYYGLNFAVFSFPPIALSIIGLIYLSLLPQ  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              +   +R  R      S P I+ S +GI+   EI+ + LF++FLAWTFY R+++DF+K 
Sbjct  80   HHRP--TRGGRSASITTSRPAIINSFIGIMPCFEIIALFLFLLFLAWTFYVRVTSDFKKL  137

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
               K     +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL +QF  SV+YH W
Sbjct  138  TPVKTMNFNLWQLKYFRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIQFAASVKYHVW  197

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGT +I F+ LHG  T FIW
Sbjct  198  LGTGLIFFSLLHGGSTLFIW  217



>ref|XP_010442495.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like isoform 
X1 [Camelina sativa]
Length=743

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 135/200 (68%), Gaps = 2/200 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+SLWI+KPT +W ++W  AE+    + FGY GL FAV++FP IA +I+G +YL    Q
Sbjct  20   GWISLWIIKPTTLWIQSWHQAEDTIKHTFFGYYGLNFAVFSFPPIALSIIGLIYLSLLPQ  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              +   +R  R     +S P I+ S +GI+   EI+ + LF++FLAWTFY R+++DF+K 
Sbjct  80   HHRP--TRGGRSASITISRPAIINSFIGIMPCFEIIALFLFLLFLAWTFYVRVTSDFKKL  137

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
               K     +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL +QF  SV+YH W
Sbjct  138  TPVKTMNFNLWQLKYFRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIQFAASVKYHVW  197

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGT +I F+ +HG  T FIW
Sbjct  198  LGTGLIFFSLVHGGSTLFIW  217



>dbj|BAB09387.1| FRO1 and FRO2-like protein [Arabidopsis thaliana]
Length=713

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 137/200 (69%), Gaps = 2/200 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+SLWI+KPT +W ++W+ AE+ A  + FGY GL FAV++FP IA +IVG +YL    Q
Sbjct  20   GWISLWIIKPTTIWIQSWRQAEDTARHTFFGYYGLNFAVFSFPPIALSIVGLIYLSLLPQ  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
                  +R  R     +S P I+ S +GI+S  EIL + LF++FLAW FY R+SNDF+K 
Sbjct  80   HHHP--TRGGRGAAITVSRPAIINSFIGIVSCFEILALLLFLLFLAWNFYARVSNDFKKL  137

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +  K   L +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL ++F  SV+YH W
Sbjct  138  MPVKTMNLNLWQLKYYRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIEFAASVKYHVW  197

Query  638  LGTAMIVFATLHGAGTFFIW  697
             GT +I F+ +HG  T FIW
Sbjct  198  FGTGLIFFSLVHGGSTLFIW  217



>ref|XP_010442496.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=737

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 135/200 (68%), Gaps = 2/200 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+SLWI+KPT +W ++W  AE+    + FGY GL FAV++FP IA +I+G +YL    Q
Sbjct  20   GWISLWIIKPTTLWIQSWHQAEDTIKHTFFGYYGLNFAVFSFPPIALSIIGLIYLSLLPQ  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              +   +R  R     +S P I+ S +GI+   EI+ + LF++FLAWTFY R+++DF+K 
Sbjct  80   HHRP--TRGGRSASITISRPAIINSFIGIMPCFEIIALFLFLLFLAWTFYVRVTSDFKKL  137

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
               K     +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL +QF  SV+YH W
Sbjct  138  TPVKTMNFNLWQLKYFRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIQFAASVKYHVW  197

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGT +I F+ +HG  T FIW
Sbjct  198  LGTGLIFFSLVHGGSTLFIW  217



>ref|XP_002864039.1| ATFRO8/FRO8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40298.1| ATFRO8/FRO8 [Arabidopsis lyrata subsp. lyrata]
Length=728

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 137/200 (69%), Gaps = 2/200 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+SLWI+KPT +W ++W+ AE+ A  + FGY GL FAV++FP IA +IVG +YL    Q
Sbjct  20   GWISLWIIKPTTLWIQSWRQAEDTAKHTFFGYYGLNFAVFSFPPIALSIVGLIYLSLLPQ  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
                  +R  R     +S P I+ S +GI+S  EIL + LF++FLAW FY R+SNDF+K 
Sbjct  80   HHHP--TRGGRSAAITVSRPAIINSFIGIVSCFEILALLLFLVFLAWNFYARVSNDFKKL  137

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +  K   L +WQ +  RVATRFGLL EACLALLL PVLR +++FRLL ++F  SV+YH W
Sbjct  138  MPVKTLNLNLWQLKYYRVATRFGLLAEACLALLLFPVLRGLSMFRLLNIEFAASVKYHVW  197

Query  638  LGTAMIVFATLHGAGTFFIW  697
             GT +I F+ +HG  T FIW
Sbjct  198  FGTGLIFFSLVHGGSTLFIW  217



>ref|XP_006280084.1| hypothetical protein CARUB_v10025968mg [Capsella rubella]
 gb|EOA12982.1| hypothetical protein CARUB_v10025968mg [Capsella rubella]
Length=682

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 2/200 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
             W++LWI KPT +WT++W  AE+    + FGY GL FAV++FP IA +I+G VYL    Q
Sbjct  20   SWIALWIFKPTTLWTQSWHQAEDTIKHTFFGYYGLNFAVFSFPPIALSIIGLVYLSLLPQ  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              +   +R  R     +S P I+ S +GI+S  EI+ + LF++FLAWTFY R++NDF+K 
Sbjct  80   HHRP--TRGGRSASIPVSRPAIINSFIGIVSCFEIIALLLFLLFLAWTFYVRVTNDFKKL  137

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
               K+    +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL +QF  SV+YH W
Sbjct  138  TPVKNMDFNLWQLKYYRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIQFAASVKYHVW  197

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGT +I F+ +HG  T FIW
Sbjct  198  LGTGLIFFSLVHGGSTLFIW  217



>ref|XP_006280085.1| hypothetical protein CARUB_v10025968mg [Capsella rubella]
 gb|EOA12983.1| hypothetical protein CARUB_v10025968mg [Capsella rubella]
Length=723

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 2/200 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
             W++LWI KPT +WT++W  AE+    + FGY GL FAV++FP IA +I+G VYL    Q
Sbjct  20   SWIALWIFKPTTLWTQSWHQAEDTIKHTFFGYYGLNFAVFSFPPIALSIIGLVYLSLLPQ  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              +   +R  R     +S P I+ S +GI+S  EI+ + LF++FLAWTFY R++NDF+K 
Sbjct  80   HHRP--TRGGRSASIPVSRPAIINSFIGIVSCFEIIALLLFLLFLAWTFYVRVTNDFKKL  137

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
               K+    +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL +QF  SV+YH W
Sbjct  138  TPVKNMDFNLWQLKYYRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIQFAASVKYHVW  197

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGT +I F+ +HG  T FIW
Sbjct  198  LGTGLIFFSLVHGGSTLFIW  217



>ref|XP_006852345.2| PREDICTED: ferric reduction oxidase 8, mitochondrial [Amborella 
trichopoda]
Length=701

 Score =   169 bits (427),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 135/203 (67%), Gaps = 3/203 (1%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            +S  W  LW+L+PT++W R+W+ AE++ + S++G +GL    ++ P+I  AI+GF+YL+ 
Sbjct  17   ISVSWACLWLLRPTELWKRSWREAEQRTTNSLYGISGLDILAFSTPMIVVAIIGFIYLQL  76

Query  269  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
               K K   SR  R     LSNP+I++S +GI+S  E+L  S+FIIFL WTFY+   N F
Sbjct  77   GVSKSK---SRCRRTLNRNLSNPIIIRSPMGIVSMKEVLTTSVFIIFLGWTFYSNTYNGF  133

Query  449  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
            +K   ++      W ++ +++  +FG + EACLALLL P+LR +A+ +LLGLQ+EVSVRY
Sbjct  134  KKMKHSESENWQPWYFKTMKIGVKFGFVAEACLALLLFPILRVLALPQLLGLQYEVSVRY  193

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLG  M++F+ LHG    F W
Sbjct  194  HIWLGNTMMLFSVLHGFTIMFAW  216



>ref|XP_010472423.1| PREDICTED: LOW QUALITY PROTEIN: ferric reduction oxidase 8, mitochondrial-like 
[Camelina sativa]
Length=614

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 134/200 (67%), Gaps = 2/200 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+ LWI+KPT +W ++W  AE+    + FGY GL FAV++FP IA +I+G +YL    Q
Sbjct  20   GWIFLWIIKPTTLWIQSWHQAEDTIKHTFFGYYGLNFAVFSFPPIALSIIGLIYLSLLPQ  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              +   +R  R     +S P I+ S +GI+S  EI+ + LF++FLAWTFY R+++DF+K 
Sbjct  80   HHRP--TRGGRSASITISRPAIINSFIGIVSCFEIIALLLFLLFLAWTFYVRVTSDFKKL  137

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
               K     +WQ +  RVATRFGLL EACL+LLL PV R +++FRLL +QF  SV+YH W
Sbjct  138  TPVKTMDFNLWQLKYFRVATRFGLLAEACLSLLLFPVSRGLSMFRLLNIQFAASVKYHVW  197

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LGT +I F+ +HG  T FIW
Sbjct  198  LGTGLIFFSLVHGGSTLFIW  217



>ref|XP_006402177.1| hypothetical protein EUTSA_v10012790mg [Eutrema salsugineum]
 gb|ESQ43630.1| hypothetical protein EUTSA_v10012790mg [Eutrema salsugineum]
Length=727

 Score =   164 bits (414),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 134/200 (67%), Gaps = 2/200 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+SLWI+KPT +W ++W+ AE+    + F Y GL FAV++FP IA +I+G +YL     
Sbjct  20   GWISLWIIKPTTLWIQSWRQAEDIIRHTFFSYYGLSFAVFSFPPIALSIIGLIYLSLLPL  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              +   +R  +     +S P I+ S +GI+S  EI+ + LF++FLAWTFY R+SNDF K 
Sbjct  80   YNRS--TRGGKSVDFNVSRPAIINSFIGIVSCFEIIALLLFLLFLAWTFYARVSNDFNKL  137

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
               K   L +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL +QF  SVRYH W
Sbjct  138  TPIKTMNLELWQLKYFRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIQFAASVRYHVW  197

Query  638  LGTAMIVFATLHGAGTFFIW  697
            LG  +I F+ +HG  T FIW
Sbjct  198  LGNGLIFFSLVHGGSTLFIW  217



>ref|XP_010678863.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=646

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = +2

Query  326  LSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKTVQTKDFKLAVWQYRML  505
            L NPLIVKS LG+LSGI++L +SL +  L WTFY RISND++K V  K  KL +WQ + L
Sbjct  26   LYNPLIVKSPLGMLSGIDVLVISLVLTLLVWTFYVRISNDYKKLVPVKQLKLEIWQLKFL  85

Query  506  RVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTWLGTAMIVFATLHGAGT  685
            R++TRFGL+ E CLA LL P+LR ++VFRLLG+QFE SVRYH WLGT +I FA LHGAGT
Sbjct  86   RMSTRFGLMGEICLAFLLFPILRGLSVFRLLGIQFEASVRYHMWLGTMLIFFAILHGAGT  145

Query  686  FFIW  697
             FIW
Sbjct  146  LFIW  149



>emb|CDY12264.1| BnaA09g24640D [Brassica napus]
Length=706

 Score =   149 bits (377),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 123/200 (62%), Gaps = 23/200 (12%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
             W+SLWI+KPT VW ++W+ AE+    + FGY GL FAV++FP IA +I+G +YL    Q
Sbjct  20   SWISLWIIKPTTVWIQSWRQAEDTFKHTFFGYYGLSFAVFSFPPIALSIIGLIYLSLLPQ  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              +  ++R  R     +S P I+ S +GI+S  EI+ V LF++FLAWTFY R++ND +K 
Sbjct  80   HHR--LTRGGRSAAITVSRPAIINSFIGIVSCFEIIAVILFLVFLAWTFYVRVNNDLKKL  137

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +  K   L +WQ +  RVATRFGLL EACL+LLL PVLR +++FRL              
Sbjct  138  MPVKTINLDLWQLKYFRVATRFGLLAEACLSLLLFPVLRGLSMFRL--------------  183

Query  638  LGTAMIVFATLHGAGTFFIW  697
                   F+ +HG  T FIW
Sbjct  184  -------FSLVHGGSTLFIW  196



>emb|CAN79355.1| hypothetical protein VITISV_010064 [Vitis vinifera]
Length=497

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 104/237 (44%), Positives = 124/237 (52%), Gaps = 77/237 (32%)
 Frame = +2

Query  44   MAKASllilklllilVSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTF  223
            MAKA+LLILKLL+IL+  GW++LWILKPTQ+WT+ W  AE+ A  +VFGY       Y  
Sbjct  1    MAKATLLILKLLMILICAGWITLWILKPTQLWTKKWHTAEDSARTTVFGY-------YAL  53

Query  224  PVIAFAIVGFVYLEQKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFI  403
             ++A ++  F+YL                                               
Sbjct  54   EILAVSLF-FLYL-----------------------------------------------  65

Query  404  IFLAWTFYTRISNDFRKTVQTK-------------------DFKLAVWQYRMLRVATRFG  526
               AWTFY  ISNDF K V  K                     KL   Q++ LRVATRFG
Sbjct  66   ---AWTFYVHISNDFEKMVPAKSLKSYSTISNAGKKMTPAESLKLNTRQFKFLRVATRFG  122

Query  527  llteaclallllpvlRRMAVFRLLGLQFEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            LL EACLALLLLPVLR MA+FR +G+QFE SVRYH WLGTAMI FAT HG  T  +W
Sbjct  123  LLAEACLALLLLPVLRGMALFRFVGVQFEASVRYHVWLGTAMIFFATFHGVSTLIVW  179



>ref|XP_007215241.1| hypothetical protein PRUPE_ppa014585mg, partial [Prunus persica]
 gb|EMJ16440.1| hypothetical protein PRUPE_ppa014585mg, partial [Prunus persica]
Length=526

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 104/164 (63%), Gaps = 20/164 (12%)
 Frame = +2

Query  131  QVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQKQKEGISRQER  310
            Q+WTR WKAAE+KA A++FGY GL FAVYTFP IA AI+G  YL  K ++    + R E 
Sbjct  4    QLWTRKWKAAEDKARATLFGYYGLNFAVYTFPPIALAIIGSFYLNLKPRE----LIRSEH  59

Query  311  RCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKTVQTKDFKLAVW  490
                F       KS+L      EIL + LFI FLAW FY  ISNDF+     K  K  +W
Sbjct  60   PSGCF-------KSTL------EILAIFLFIPFLAWNFYACISNDFK---NLKPAKSLIW  103

Query  491  QYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
            Q + L VATRFGLL E CLA LL P+LR +A+FRLLG+QF  S+
Sbjct  104  QLKYLNVATRFGLLVEVCLAFLLFPILRGLALFRLLGIQFVASI  147



>gb|KHN34351.1| Ferric reduction oxidase 8, mitochondrial [Glycine soja]
Length=442

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 101/167 (60%), Gaps = 25/167 (15%)
 Frame = +2

Query  197  GLCFAVYTFPVIAFAIVGFVYLEQKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGI  376
            GL FAVYTFP++A AI+G + ++ K   Q+   +R   +   F SNPL+   +       
Sbjct  9    GLSFAVYTFPIVAIAILGLLLMDLKAGYQRSRSARSPSKS-NFFSNPLVHGPT-------  60

Query  377  EILGVSLFIIFLAWTFYTRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclall  556
                             TRIS DF+K +  K  KL  WQ +  ++A RFGLL E C+ALL
Sbjct  61   -----------------TRISADFKKLMPYKSLKLNTWQLKYHKIAIRFGLLAEPCMALL  103

Query  557  llpvlRRMAVFRLLGLQFEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            LLP+LR +AVFR+LG+QFE SVRY TW+GTAMI+FAT+H A T  +W
Sbjct  104  LLPILRGLAVFRILGIQFEASVRYPTWVGTAMIIFATIHCASTLLVW  150



>ref|XP_009363039.1| PREDICTED: LOW QUALITY PROTEIN: ferric reduction oxidase 8, mitochondrial, 
partial [Pyrus x bretschneideri]
Length=491

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 88/125 (70%), Gaps = 2/125 (2%)
 Frame = +2

Query  329  SNPLIVKSSLGILSGIEILGVSLFIIFL--AWTFYTRISNDFRKTVQTKDFKLAVWQYRM  502
            SNP++V + +G+ S +E+L V  FI+ L   W FY RI N F+    +K   L+ WQ + 
Sbjct  1    SNPIVVNTLVGVXSTLEMLAVFFFILVLVLTWNFYARILNGFKNLKPSKSLALSSWQLKY  60

Query  503  LRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTWLGTAMIVFATLHGAG  682
            L+VATRF LL E CLA LL P++R +A+F++LG+ FE S++YHTWLGTAM+ FAT HGA 
Sbjct  61   LKVATRFSLLAEVCLAFLLFPIVRGLALFQVLGIHFEASIKYHTWLGTAMLFFATFHGAS  120

Query  683  TFFIW  697
            T FIW
Sbjct  121  TLFIW  125



>ref|XP_011629093.1| PREDICTED: ferric reduction oxidase 2 [Amborella trichopoda]
Length=692

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 111/195 (57%), Gaps = 6/195 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G++ +W++ PT++W   W  K +    S + FG+ G    ++TFP++  A++G +YL  +
Sbjct  7    GYMMIWVVMPTKLWMPNWWVKISAHTLSTN-FGFQGPTLLIFTFPILLLAVLGCIYLHLR  65

Query  272  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
            ++  KE   R E++ L   S P+IVK  LGI+S +E+  + +F+  L ++F T +S  F 
Sbjct  66   EKHLKETFKRGEKQRLEAWSRPVIVKGPLGIVSAMELACLLMFVALLVYSFSTYLSISFS  125

Query  452  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
            K    K  +  +WQ ++  VA RFGL+   C A L +PV R   + ++LG+  E  V+YH
Sbjct  126  K---LKPGQNPMWQAKLSSVALRFGLVGNVCAAFLFIPVARGSVLLQVLGIGNEAGVKYH  182

Query  632  TWLGTAMIVFATLHG  676
             WLG   +   T HG
Sbjct  183  IWLGHITMTLFTAHG  197



>ref|XP_002320814.1| ferric-chelate reductase family protein [Populus trichocarpa]
 gb|EEE99129.1| ferric-chelate reductase family protein [Populus trichocarpa]
Length=702

 Score =   110 bits (274),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 115/205 (56%), Gaps = 5/205 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKA--SASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-Q  268
            G+  +WI++PT+ +   W     K   S++ FG  G  F V++FP++  A+VG VYL  +
Sbjct  18   GYAMVWIMRPTKTFKEIWLPNIRKKLNSSTYFGTQGTGFLVFSFPILFVAVVGCVYLHFR  77

Query  269  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            K+ K ++  S  ++  L  L  P++VK  LGI+SG E+  + +F+  L W+F   + N F
Sbjct  78   KRSKDRKLESNGKKNRLVTLKKPMLVKGPLGIVSGTELAFLIMFVALLIWSFSVYLLNGF  137

Query  449  RK-TVQTKDFK-LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
               T Q+   K L  WQ ++   +   GLL   CLALL LPV R  ++  L GL  E S+
Sbjct  138  ATITPQSAAKKGLKEWQAKLASASLSLGLLGNICLALLFLPVARGSSLLPLFGLPSEASI  197

Query  623  RYHTWLGTAMIVFATLHGAGTFFIW  697
            +YH WLG  ++VF T HG G   +W
Sbjct  198  KYHIWLGHTVLVFFTAHGLGYITLW  222



>ref|XP_010255644.1| PREDICTED: uncharacterized protein LOC104596257 [Nelumbo nucifera]
Length=1446

 Score =   111 bits (277),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 121/224 (54%), Gaps = 6/224 (3%)
 Frame = +2

Query  44   MAKASllilklllilVSTGWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYT  220
            M KA    L L ++++S G++ +WI+ PT  + + W  +   KA+++ FG  G    VYT
Sbjct  743  MMKAVRAALMLFILVISLGFLIIWIMMPTSTYKQKWLPSIRAKANSTYFGVQGATLLVYT  802

Query  221  FPVIAFAIVGFVYLE-QKKQKQKEGISRQ--ERRCLAFLSNPLIVKSSLGILSGIEILGV  391
            FPV++ A++G  YL   KK    + I R   E   LA    P++VK  LGI++GIE+   
Sbjct  803  FPVLSIAVLGCFYLHLGKKYGDHQYIQRNPAESSRLALWKRPVLVKGPLGIVTGIELAFF  862

Query  392  SLFIIFLAWTFYTRISNDFRK-TVQTKDFK-LAVWQYRMLRVATRFGllteaclallllp  565
            ++FI  L W+F T +   F K T Q  + K   +WQ ++   A R GL+   CLA L  P
Sbjct  863  AMFIALLVWSFSTYLHVSFAKLTPQAAEKKGEHLWQAKLDSAALRLGLVGNVCLAFLFFP  922

Query  566  vlRRMAVFRLLGLQFEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            V R  +V  LLGL  E S++YH WLG  ++   T HG      W
Sbjct  923  VTRGSSVLPLLGLTSESSIKYHIWLGHMVMTLFTSHGLCYIIFW  966


 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 102/204 (50%), Gaps = 7/204 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  271
            GW+ LWI+ PT ++   W    + KA+++ FG  G    V+TFP++  A++G VYL   K
Sbjct  43   GWLMLWIVLPTNIYKSQWTPQLKAKANSTYFGGQGTNLLVFTFPIMLIAVLGCVYLHFLK  102

Query  272  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTF--YTRISND  445
            K       S      L     P +VK  LGI++ +E+   ++FI  + W+   Y  IS  
Sbjct  103  KSDNYYNKSWSASHGLFSWKRPFLVKPPLGIVTAMELAFSAMFIALIIWSLAIYLHISFG  162

Query  446  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
                 +T +    VWQ +   V+ R G +   CLALL  PV R  ++  LLGL  E S++
Sbjct  163  HLHMHKTGE---KVWQAKFRSVSLRLGYVGNICLALLFFPVTRASSILPLLGLTSESSIK  219

Query  626  YHTWLGTAMIVFATLHGAGTFFIW  697
            YH WLG   ++  T H  G    W
Sbjct  220  YHIWLGHLSMILFTAHSIGFIIYW  243



>gb|AES62463.2| oxidoreductase/ferric-chelate reductase [Medicago truncatula]
Length=702

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 108/205 (53%), Gaps = 6/205 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEE-KASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+++WIL PT+V+  TW    E K +++ F   G+   ++TFP++    +G +YL   +
Sbjct  19   GWLTVWILLPTKVYKNTWTPKLEIKLNSTYFREQGVNILLFTFPIMFIGALGCIYLHLHR  78

Query  275  QKQKEGISRQE----RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
            +K  + +        ++CL FL  P +V  ++GI+S +E++   +F+  L W+ Y  +S 
Sbjct  79   EKTTQKLPSTSTGALKKCLCFLRRPFLVMPTIGIVSAMELIFAIMFVALLIWSLYNYLSI  138

Query  443  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
             F      K+ +  VW+ +   V  R G +   C A L  PV R  ++ RL+GL  E S+
Sbjct  139  SFAHLHMHKEGE-KVWEAKFRSVFLRLGYIGNICWAFLFFPVTRGSSILRLVGLTSESSI  197

Query  623  RYHTWLGTAMIVFATLHGAGTFFIW  697
            +YH WLG   +V    H  G F  W
Sbjct  198  KYHIWLGQLSMVLFAAHTIGFFIYW  222



>ref|XP_003592212.1| NADPH oxidase [Medicago truncatula]
Length=700

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 108/205 (53%), Gaps = 6/205 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEE-KASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+++WIL PT+V+  TW    E K +++ F   G+   ++TFP++    +G +YL   +
Sbjct  17   GWLTVWILLPTKVYKNTWTPKLEIKLNSTYFREQGVNILLFTFPIMFIGALGCIYLHLHR  76

Query  275  QKQKEGISRQE----RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
            +K  + +        ++CL FL  P +V  ++GI+S +E++   +F+  L W+ Y  +S 
Sbjct  77   EKTTQKLPSTSTGALKKCLCFLRRPFLVMPTIGIVSAMELIFAIMFVALLIWSLYNYLSI  136

Query  443  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
             F      K+ +  VW+ +   V  R G +   C A L  PV R  ++ RL+GL  E S+
Sbjct  137  SFAHLHMHKEGE-KVWEAKFRSVFLRLGYIGNICWAFLFFPVTRGSSILRLVGLTSESSI  195

Query  623  RYHTWLGTAMIVFATLHGAGTFFIW  697
            +YH WLG   +V    H  G F  W
Sbjct  196  KYHIWLGQLSMVLFAAHTIGFFIYW  220



>ref|XP_011468990.1| PREDICTED: ferric reduction oxidase 2-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=719

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/206 (35%), Positives = 109/206 (53%), Gaps = 6/206 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G V L+++ PT  + + W+     +  S++ FG  G    V+TFP++  A++G VYL   
Sbjct  36   GCVLLYVMMPTNTYKQIWQPRIRAKTNSSTYFGSQGASLLVFTFPIMFIALMGCVYLHLG  95

Query  272  KQKQKEGISRQERRC--LAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            K+     IS  + +   L+    P++VK  LGI+SGIE+    +FI  L W+F T ++N 
Sbjct  96   KKMNDYTISCSDGKTKRLSVWKQPMLVKGPLGIVSGIELTFFIMFIALLIWSFSTYLTNG  155

Query  446  FRKTVQTKDFKL--AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
            F+K       K    VW+ ++   + R GL+   CLALL  PV R  ++  L GL  E S
Sbjct  156  FQKITPQSAAKSHEKVWEVKLESASLRLGLVGNICLALLFFPVARGSSILPLFGLTSEAS  215

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG   +V  T HG G    W
Sbjct  216  IKYHIWLGHIAMVLFTAHGIGYIIYW  241



>ref|XP_008803959.1| PREDICTED: ferric reduction oxidase 2-like [Phoenix dactylifera]
Length=704

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 110/201 (55%), Gaps = 5/201 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAE-EKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+ +W++ PT  + +TW+     K  ++ FG  G    ++TFP++  A+VG +YL   +
Sbjct  30   GWLMMWVMVPTSTYRKTWRPKLLSKTRSTYFGRQGGSMLIFTFPILFIAVVGCIYL-HLE  88

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
            QK     S   RR L   S P++VK  LGI+S  E+    +F+  L W+F + +S  F K
Sbjct  89   QKIGNTDSGSLRRRLEAWSKPVLVKGPLGIVSATELAFCLMFLALLIWSFSSYLSVGFAK  148

Query  455  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  634
                K   +  WQ ++  VA R GL+ + C A L  PV+RR ++  L+GL+   S+R H 
Sbjct  149  L---KAQGVESWQAKLATVALRLGLVGKICCAFLFFPVMRRSSLLPLVGLKSGSSIRRHV  205

Query  635  WLGTAMIVFATLHGAGTFFIW  697
            WLG  ++V  T HG G   +W
Sbjct  206  WLGHIVMVLFTAHGVGFIVLW  226



>ref|XP_004308349.1| PREDICTED: ferric reduction oxidase 2-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=718

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 109/205 (53%), Gaps = 5/205 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G V L+++ PT  + + W+     +  S++ FG  G    V+TFP++  A++G VYL   
Sbjct  36   GCVLLYVMMPTNTYKQIWQPRIRAKTNSSTYFGSQGASLLVFTFPIMFIALMGCVYLHLG  95

Query  272  KQKQKEGISRQER-RCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            K+     IS   + + L+    P++VK  LGI+SGIE+    +FI  L W+F T ++N F
Sbjct  96   KKMNDYTISCDGKTKRLSVWKQPMLVKGPLGIVSGIELTFFIMFIALLIWSFSTYLTNGF  155

Query  449  RKTVQTKDFKL--AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
            +K       K    VW+ ++   + R GL+   CLALL  PV R  ++  L GL  E S+
Sbjct  156  QKITPQSAAKSHEKVWEVKLESASLRLGLVGNICLALLFFPVARGSSILPLFGLTSEASI  215

Query  623  RYHTWLGTAMIVFATLHGAGTFFIW  697
            +YH WLG   +V  T HG G    W
Sbjct  216  KYHIWLGHIAMVLFTAHGIGYIIYW  240



>emb|CDY07230.1| BnaCnng02450D [Brassica napus]
Length=710

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 111/200 (56%), Gaps = 7/200 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G+V +WIL PT ++   W      E   ++ FG  GL   +  FP++  A +G +YL  K
Sbjct  37   GYVFIWILMPTLIYRTKWLPVMRTEFGFSTYFGLAGLTLFMLMFPMLLLACLGCLYLHLK  96

Query  272  KQKQKEGISRQE---RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
            KQK    + R++   R  LA +  P++VK  LGI+S  E++ +++F+  L W F+  + N
Sbjct  97   KQKTNNHLIREKATGRGVLAAMRRPMLVKGPLGIVSATELIFLAMFVALLLWNFFIYLRN  156

Query  443  DFRKTVQTKDFKL--AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  616
             F         KL   +WQ ++  +A R GL+  ACLA L +PV+R  ++  +LGL  E 
Sbjct  157  AFPMITPQSAAKLHQKIWQAKLEAMAIRIGLVGNACLAFLFIPVVRGSSLLPVLGLTSES  216

Query  617  SVRYHTWLGTAMIVFATLHG  676
            S++YH WLG  ++   T+HG
Sbjct  217  SIKYHIWLGHLLMTIFTVHG  236



>ref|XP_010112949.1| Ferric reduction oxidase 2 [Morus notabilis]
 gb|EXC35108.1| Ferric reduction oxidase 2 [Morus notabilis]
Length=717

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 70/206 (34%), Positives = 104/206 (50%), Gaps = 6/206 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKA--AEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE--  265
            G+V +WI+ PT  + +TW+     +  +++ FG  GL   +YTFPV+ FA++G VY+   
Sbjct  29   GFVFIWIIVPTNTYKQTWQPRIKAKVNNSTYFGSQGLTLLLYTFPVLLFAVLGCVYIHLG  88

Query  266  QKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            +K       +   +    A    P++VK   GI+S IE+    +FI  L W+F T + N 
Sbjct  89   RKLDGHDHNVQSGKNHRFAVWKRPILVKGPQGIVSSIELTFFVMFIALLVWSFSTYLHNS  148

Query  446  FRKTVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
            F K       K    VW+ ++   A R GL+   CLA L  PV R  +V  L GL  E S
Sbjct  149  FAKITPKSAAKDGEKVWESKLDSAALRLGLIGNICLAFLFFPVARGSSVLPLFGLTSEAS  208

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG  ++   T HG      W
Sbjct  209  IKYHIWLGHLVLTLFTAHGLCYIIFW  234



>ref|XP_009111537.1| PREDICTED: ferric reduction oxidase 2-like [Brassica rapa]
Length=722

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 111/200 (56%), Gaps = 7/200 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G+V +WIL PT ++   W      E   ++ FG  GL   +  FP++  A +G +YL  K
Sbjct  37   GYVFIWILMPTLIYRTKWLPVMRTEFGFSTYFGLAGLTLFMLMFPMLLLACLGCLYLHLK  96

Query  272  KQKQKEGISRQE---RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
            KQK    + R++   R  LA +  P++VK  LGI+S  E++ +++F+  L W F+  + N
Sbjct  97   KQKTNNHLIREKATGRGVLAAMRRPMLVKGPLGIVSATELIFLAMFVALLLWNFFIYLRN  156

Query  443  DFRKTVQTKDFKL--AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  616
             F         KL   +WQ ++  +A R GL+  ACLA L +PV+R  ++  +LGL  E 
Sbjct  157  AFPMITPQSAAKLHQKIWQAKLEAMAIRIGLVGNACLAFLFIPVVRGSSLLPVLGLTSES  216

Query  617  SVRYHTWLGTAMIVFATLHG  676
            S++YH WLG  ++   T+HG
Sbjct  217  SIKYHIWLGHLLMTIFTVHG  236



>ref|XP_002511897.1| ferric-chelate reductase, putative [Ricinus communis]
 gb|EEF50566.1| ferric-chelate reductase, putative [Ricinus communis]
Length=716

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 102/204 (50%), Gaps = 4/204 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASV-FGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G++ +W++ PT  + R W     K   SV FG  G     ++FPV+  A++G VYL   K
Sbjct  33   GYLMMWVMTPTTTYRRIWLPNIRKNVNSVYFGVQGATILTFSFPVLFIAVLGCVYLHLGK  92

Query  275  QKQKEGI-SRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
            +       S   +  LA    P++VK  LGI+SGIE+  +++F+  L W+  T + N F 
Sbjct  93   RSGHNNFRSNGRKHPLATWKKPMLVKGPLGIVSGIELAFLTMFVALLTWSLSTYLHNGFA  152

Query  452  KTVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
                    K    VW+ ++   A R G++   CL  L  PV R  +V  L GL  E S++
Sbjct  153  TITPHSAAKSGERVWEAKLESSAIRLGVVGNICLTFLFFPVARGSSVLPLFGLTSEGSIK  212

Query  626  YHTWLGTAMIVFATLHGAGTFFIW  697
            YH WLG  ++VF T HG      W
Sbjct  213  YHIWLGHLVMVFFTAHGLSYISYW  236



>gb|KHM99348.1| Ferric reduction oxidase 3, mitochondrial [Glycine soja]
Length=590

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/206 (33%), Positives = 107/206 (52%), Gaps = 6/206 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+ +WI+ PT  + + W+   +  + S+FG  G    VYTFP++  A++G VY+   K+
Sbjct  32   GWIFVWIVTPTNTYQQKWQPRLQAKTNSIFGAQGAMLLVYTFPILFIAVLGCVYVHIAKK  91

Query  278  KQ---KEGISRQ-ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
                 KE  S   ++R ++     ++V+  LGI+SG E++ + +FI+ L W+F   + N 
Sbjct  92   GNGFGKESCSSYGKKREVSIWKRLVLVRGPLGIVSGTEMVFLLMFIVLLVWSFSIYLHNG  151

Query  446  FRKTVQTK--DFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
            F K       +  L VW+ ++   + R  L+   CLA L  PV R  +V  LLGL  E  
Sbjct  152  FAKITHKSAAEHGLKVWEKKLDIASVRLALVGNICLAFLFFPVARGSSVLPLLGLTPESC  211

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG   +   T HG      W
Sbjct  212  IKYHIWLGNVAMTLFTAHGICFIIYW  237



>ref|XP_012083332.1| PREDICTED: ferric reduction oxidase 2-like isoform X2 [Jatropha 
curcas]
Length=710

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 106/207 (51%), Gaps = 4/207 (2%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAAEE-KASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  265
            V  G+V +WI+ PT  + + W      K +++ FGY G    V+ FP+I  A++G VYL 
Sbjct  27   VLVGYVIMWIMMPTNTYRQIWLPYLRFKFNSTYFGYQGATLLVFFFPIIFVAVLGCVYLH  86

Query  266  QKKQKQKEGISRQERR-CLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
              K++     S + R+  L     P++VK+ LGI+SGIE+  + +FI  L W+  T + N
Sbjct  87   LLKKRPINKFSNKGRKHILGAWKKPMLVKAPLGIVSGIELAFLIMFIALLIWSLATYLHN  146

Query  443  DFRKTVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  616
             F         K    VW+ ++   A R GL+   CL  L  PV R  +V  + GL  E 
Sbjct  147  SFATITPQSAAKNGQKVWEMKLENSALRLGLVGNICLTFLFFPVARGSSVLPVFGLTSEG  206

Query  617  SVRYHTWLGTAMIVFATLHGAGTFFIW  697
            S++YH WLG  ++ F T HG      W
Sbjct  207  SIKYHIWLGHMVMAFFTAHGLAYIIYW  233



>ref|XP_010669978.1| PREDICTED: ferric reduction oxidase 2-like [Beta vulgaris subsp. 
vulgaris]
Length=722

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/206 (34%), Positives = 108/206 (52%), Gaps = 7/206 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G++ +W + PT ++   WK       S++ FG  GL   ++TFPV+  A++G VYL   K
Sbjct  39   GYLFMWFIMPTNMYKTNWKTKLTANLSSTYFGTQGLPLLIFTFPVLFIAVLGSVYLHLGK  98

Query  275  QKQKEGISRQERRC-----LAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  439
            +     + R+E +      LA    P++VK  LGI+SGIE+  + +FI FLAW+    + 
Sbjct  99   KCPDYELRRKEEKSSTTRWLATWRRPVLVKGPLGIVSGIELSFLMMFIAFLAWSLTVYLH  158

Query  440  NDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
              + K ++ + +    W Y+      R GL    CL+LL  PV R  ++  LLGL  E S
Sbjct  159  VGYSK-IKVQGYGGGRWLYKWEATVFRLGLTGNICLSLLFYPVTRGSSILPLLGLTSEGS  217

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG   +   T HG G   +W
Sbjct  218  IKYHIWLGHLTMALFTAHGLGYIPLW  243



>ref|XP_007051741.1| Ferric reduction oxidase 2, putative [Theobroma cacao]
 gb|EOX95898.1| Ferric reduction oxidase 2, putative [Theobroma cacao]
Length=703

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 108/208 (52%), Gaps = 6/208 (3%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  265
            +  G   +WI+ PT  + + W+A+  ++  ++ FG  G    ++TFPV+  A +G +YL 
Sbjct  17   ICLGICMMWIMLPTNTYRQKWRASITKRVLSTYFGTQGSNILIWTFPVLLVAALGSLYLH  76

Query  266  QKKQKQKEGISRQER-RCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
              K   +  +   ER R LA    PL+VK  LGI+SGIE+  + +FI  L WT  T + N
Sbjct  77   LGKNLNENVLHSNERKRRLALWKRPLLVKGPLGIVSGIELAFLIMFISLLIWTLATYLHN  136

Query  443  DFRKTVQTK---DFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFE  613
                T+  K    + + VWQ ++  +A     +   CL+ L  PV R  +V  LLGL  E
Sbjct  137  GL-PTITPKVAAKYGVEVWQMKLFDIALWIAFVGNVCLSFLFYPVARGSSVLPLLGLTSE  195

Query  614  VSVRYHTWLGTAMIVFATLHGAGTFFIW  697
             S++YH WLG   +V  T+HG      W
Sbjct  196  GSIKYHIWLGHMTMVLFTVHGVCYIVYW  223



>ref|XP_006602816.1| PREDICTED: ferric reduction oxidase 2-like isoform X2 [Glycine 
max]
 ref|XP_006602817.1| PREDICTED: ferric reduction oxidase 2-like isoform X3 [Glycine 
max]
 ref|XP_006602818.1| PREDICTED: ferric reduction oxidase 2-like isoform X4 [Glycine 
max]
Length=717

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/206 (33%), Positives = 107/206 (52%), Gaps = 6/206 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+ +WI+ PT  + + W+   +  + S+FG  G    VYTFP++  A++G VY+   K+
Sbjct  32   GWIFVWIVTPTNTYQQKWQPRLQAKTNSIFGAQGAMLLVYTFPILFIAVLGCVYVHIAKK  91

Query  278  KQ---KEGISRQ-ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
                 KE  S   ++R ++     ++V+  LGI+SG E++ + +FI+ L W+F   + N 
Sbjct  92   GNGFGKESCSSYGKKREVSIWKRLVLVRGPLGIVSGTEMVFLLMFIVLLVWSFSIYLHNG  151

Query  446  FRKTVQTK--DFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
            F K       +  L VW+ ++   + R  L+   CLA L  PV R  +V  LLGL  E  
Sbjct  152  FAKITHKSAAEHGLKVWEKKLDIASVRLALVGNICLAFLFFPVARGSSVLPLLGLTPESC  211

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG   +   T HG      W
Sbjct  212  IKYHIWLGNVAMTLFTAHGICFIIYW  237



>ref|XP_003552408.1| PREDICTED: ferric reduction oxidase 2-like isoform X1 [Glycine 
max]
Length=715

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 106/204 (52%), Gaps = 4/204 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+ +WI+ PT  + + W+   +  + S+FG  G    VYTFP++  A++G VY+   K+
Sbjct  32   GWIFVWIVTPTNTYQQKWQPRLQAKTNSIFGAQGAMLLVYTFPILFIAVLGCVYVHIAKK  91

Query  278  KQKEG--ISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
                G   S  ++R ++     ++V+  LGI+SG E++ + +FI+ L W+F   + N F 
Sbjct  92   GNGFGKESSYGKKREVSIWKRLVLVRGPLGIVSGTEMVFLLMFIVLLVWSFSIYLHNGFA  151

Query  452  KTVQTK--DFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
            K       +  L VW+ ++   + R  L+   CLA L  PV R  +V  LLGL  E  ++
Sbjct  152  KITHKSAAEHGLKVWEKKLDIASVRLALVGNICLAFLFFPVARGSSVLPLLGLTPESCIK  211

Query  626  YHTWLGTAMIVFATLHGAGTFFIW  697
            YH WLG   +   T HG      W
Sbjct  212  YHIWLGNVAMTLFTAHGICFIIYW  235



>emb|CDY38012.1| BnaCnng08730D [Brassica napus]
Length=303

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 109/206 (53%), Gaps = 7/206 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEK--ASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + LWI+ PT  +   W         +++ FG +G    +Y FP++  A +G VYL  K
Sbjct  37   GTIMLWIMMPTLTYRNKWLPYMRLKFGASTYFGSSGTTLFMYMFPMVVVACLGCVYLHFK  96

Query  272  KQKQKEGISRQERR-CLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            K+K    I R+     L+ L  P++VK  LGI+S  EI+ +++F+  L W+F T + N+F
Sbjct  97   KRKNPHHIVRETNGGVLSALRKPMLVKGPLGIVSATEIMFLAMFVALLLWSFITYLRNNF  156

Query  449  RKTVQTKD---FKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
              T+  +       ++WQ ++   A R GL+   CLA L LPV R  ++   +GL  E S
Sbjct  157  -ATITPRSAAAHGESLWQAKLESAALRIGLIGNICLAFLFLPVARGSSLLPAVGLTSESS  215

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG  ++   T+HG      W
Sbjct  216  IKYHIWLGHMVLAIFTVHGLCYVIYW  241



>ref|XP_012083333.1| PREDICTED: ferric reduction oxidase 2-like isoform X3 [Jatropha 
curcas]
Length=708

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 105/206 (51%), Gaps = 4/206 (2%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAAEE-KASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  265
            V  G+V +WI+ PT  + + W      K +++ FGY G    V+ FP+I  A++G VYL 
Sbjct  27   VLVGYVIMWIMMPTNTYRQIWLPYLRFKFNSTYFGYQGATLLVFFFPIIFVAVLGCVYLH  86

Query  266  QKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
              K K+   I+   +  L     P++VK+ LGI+SGIE+  + +FI  L W+  T + N 
Sbjct  87   LLK-KRPININFSRKHILGAWKKPMLVKAPLGIVSGIELAFLIMFIALLIWSLATYLHNS  145

Query  446  FRKTVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
            F         K    VW+ ++   A R GL+   CL  L  PV R  +V  + GL  E S
Sbjct  146  FATITPQSAAKNGQKVWEMKLENSALRLGLVGNICLTFLFFPVARGSSVLPVFGLTSEGS  205

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG  ++ F T HG      W
Sbjct  206  IKYHIWLGHMVMAFFTAHGLAYIIYW  231



>gb|KFK42543.1| hypothetical protein AALP_AA1G008100 [Arabis alpina]
Length=659

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 72/206 (35%), Positives = 110/206 (53%), Gaps = 7/206 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEK--ASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + LWI+ PT  +   W         +++ FG  G    ++ FP+IA A +G VYL  K
Sbjct  37   GTIMLWIMMPTLTYRNKWLPLMRIKFGASTYFGATGTTLFMFMFPMIALACLGCVYLHFK  96

Query  272  KQKQKEGISRQERR-CLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            K+K      R+ +   L+ L  P++VK  LGI+S  EI+ +++F+  L W+F T + N+F
Sbjct  97   KRKSMHHNDRETKGGVLSALRRPMLVKGPLGIVSVTEIMFLAMFVALLLWSFITYLRNNF  156

Query  449  RKTVQTKDFKL---AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
              T+  K       ++WQ ++   A R GL+   CLA L LPV R  ++   LGL  E S
Sbjct  157  -ATITPKTAAAHGESLWQAKLASAALRIGLMGNICLAFLFLPVARGSSLLPALGLTSESS  215

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG  ++   TLHG     +W
Sbjct  216  IKYHIWLGHMVMAIFTLHGLCYIILW  241



>ref|XP_010556561.1| PREDICTED: ferric reduction oxidase 2 [Tarenaya hassleriana]
Length=720

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 110/204 (54%), Gaps = 4/204 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + +WI+ PTQ + + W      +  +++ FG  G    ++TFP+I  A +G VYL  K
Sbjct  35   GIIMIWIMVPTQTYRKIWLPTLRAKLGNSTYFGAAGTTLLLFTFPMILMACMGGVYLHLK  94

Query  272  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
            K+K  +  +R+ +  +  L  P++VK  LGI+S  E   + +F+  L W+F T + N F 
Sbjct  95   KRKNVDQFNREMKGEMEVLRRPMLVKGPLGIVSVTEFGFLLMFVALLLWSFCTYLYNGFL  154

Query  452  K-TVQT-KDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
              T Q+  +    VWQ ++  VA RFG++   CLA L LPV R  ++  L+GL  E S++
Sbjct  155  TITPQSAAEDGHQVWQAKLETVALRFGVVGNICLAFLFLPVARGSSLLPLVGLTSESSIK  214

Query  626  YHTWLGTAMIVFATLHGAGTFFIW  697
            YH WLG   +   + HG      W
Sbjct  215  YHIWLGHLAMTLFSAHGLSYILFW  238



>gb|ADR70886.1| ferric reductase oxidase [Manihot esculenta]
Length=707

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 104/198 (53%), Gaps = 5/198 (3%)
 Frame = +2

Query  113  WILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQKQKE  289
            W + PT  +   W +    K +++ FG  G    +Y+FP++  A++G VYL   K+  + 
Sbjct  31   WFMMPTNTYRHIWLRHVRNKFNSAYFGLQGATLVLYSFPILLIAVLGCVYLHLGKRSDQN  90

Query  290  GISRQ--ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKTVQ  463
                   +R  L+   NP+IVK  LGI+SGIE+  + +F+  L W+  T + N F     
Sbjct  91   DFQSDGRKRSKLSKWKNPMIVKGPLGIVSGIELGFLFMFVALLIWSLSTYLHNGFATI--  148

Query  464  TKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTWLG  643
            T +    VW+ ++   + R GL+   CLA+L  PV R  +V  L GL  E S+++H W+G
Sbjct  149  TPEGGEQVWEAKLDNASLRLGLIGNICLAVLFFPVTRGSSVLPLFGLTSESSIKHHIWVG  208

Query  644  TAMIVFATLHGAGTFFIW  697
              +++F T HG G    W
Sbjct  209  HMVMMFFTAHGVGYIIYW  226



>ref|XP_003548660.1| PREDICTED: ferric reduction oxidase 2-like isoform X1 [Glycine 
max]
Length=714

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 104/205 (51%), Gaps = 8/205 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            GW+ + I+ PT  + +TW  +   +  + +  G  G    +YTFP++  A +G VYL   
Sbjct  33   GWIFIRIMSPTNTFRQTWLPRYKAKTNNTTYIGSKGAYLLLYTFPILLLATLGCVYLHIG  92

Query  272  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
            K+  K  I   ++  +     P+++K  LGI+SG EI  + LFI  LAW F T + N F 
Sbjct  93   KKSSK--ICNAKKCGVTIWKRPVLIKGPLGIVSGTEIAFLFLFIALLAWVFSTSVQNSFA  150

Query  452  KTVQ---TKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
                    KD +  +W+ ++ RVA R G++   CLA +  PV R  +V  LL L  E  +
Sbjct  151  TITPQFAAKDGQ-KIWEEKLDRVAKRLGVVGNICLAFMFFPVARGSSVLPLLDLTSESCI  209

Query  623  RYHTWLGTAMIVFATLHGAGTFFIW  697
            +YH WLG   +   T HG     +W
Sbjct  210  KYHIWLGNIAMTLFTSHGLCYIILW  234



>ref|XP_006287152.1| hypothetical protein CARUB_v10000325mg [Capsella rubella]
 gb|EOA20050.1| hypothetical protein CARUB_v10000325mg [Capsella rubella]
Length=720

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 110/200 (55%), Gaps = 7/200 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + +W++ PT V+   W      E ++++ FG  GL F ++ FP++  A +G +YL  K
Sbjct  36   GVLFIWVVMPTMVYRTKWLPVMRTEFSTSTYFGAIGLTFFMFMFPMVLLACLGCLYLHLK  95

Query  272  KQKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
            K K    + R+   E   LA +  P++VK  LGI+S  E++  ++F++ L W F+  + N
Sbjct  96   KPKTTNHLVREKMTEGGVLAAMRRPMLVKGPLGIVSATELVLFAMFVVLLLWEFFMYMRN  155

Query  443  DFRKTVQTKDFKL--AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  616
             F         K    +WQ R+  +A R GL+   CLA + +PV+R  ++  ++GL  E 
Sbjct  156  AFPTITPQSAAKHHQKLWQARLEAMAIRIGLVGNCCLAFIFIPVVRGSSLLPVIGLTSES  215

Query  617  SVRYHTWLGTAMIVFATLHG  676
            S++YH WLG  ++ F T HG
Sbjct  216  SIKYHIWLGHLLMTFLTAHG  235



>ref|XP_007143462.1| hypothetical protein PHAVU_007G073900g [Phaseolus vulgaris]
 gb|ESW15456.1| hypothetical protein PHAVU_007G073900g [Phaseolus vulgaris]
Length=697

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/207 (33%), Positives = 104/207 (50%), Gaps = 5/207 (2%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  265
            V  GW+ +WIL PT+V+  TW    E K +++ F   G    ++TFPV+    +G VYL 
Sbjct  14   VFVGWIMVWILLPTKVYKNTWNPKLENKLNSTYFREQGTNLLLFTFPVVFMGALGCVYLH  73

Query  266  QKKQKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRI  436
             + QK +   S+      R L+FL  P +V S +GIL+ +E++   +F   L W+    +
Sbjct  74   LRLQKPENLSSKSGGTANRRLSFLRRPFVVMSPIGILTSMELVFALMFAALLIWSLSNYL  133

Query  437  SNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  616
               F       + +  VWQ ++  V+ R G +   C A L  PV R  ++  L GL  E 
Sbjct  134  HISFGHLHMHMEGE-KVWQAKLRSVSLRAGYIGNICWAFLFFPVTRASSILPLFGLTSES  192

Query  617  SVRYHTWLGTAMIVFATLHGAGTFFIW  697
            S++YH WLG   +V   +H  G F  W
Sbjct  193  SIKYHIWLGHVSMVLFAVHTIGFFMYW  219



>ref|XP_011036851.1| PREDICTED: ferric reduction oxidase 2 [Populus euphratica]
Length=702

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 111/205 (54%), Gaps = 5/205 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKA--SASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G+  +WI+ PT+ +   W     K   S++ FG  G  F V++FP++  A+VG VYL  +
Sbjct  18   GYAMVWIMMPTKTFRGKWLPNIRKKLNSSTYFGKQGTGFLVFSFPILFVAVVGCVYLHFR  77

Query  272  KQKQKEGI-SRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            K+     + S  ++  L  L  P++VK  LGI+S  E+  + +F+  L W+F   + N F
Sbjct  78   KRSNDSKLESNGKKNRLVTLKQPMLVKGPLGIVSATELAFLIMFVALLIWSFSVYLLNGF  137

Query  449  RK-TVQTKDFK-LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
               T Q+   K L  W+ ++   +   GLL   CLALL LPV R  ++  L GL  E S+
Sbjct  138  ATITPQSAAKKGLKEWEAKLATASLSLGLLGNICLALLFLPVARGSSLLPLFGLPSEASI  197

Query  623  RYHTWLGTAMIVFATLHGAGTFFIW  697
            +YH W+G  ++VF T HG G   +W
Sbjct  198  KYHIWIGHTVMVFFTAHGLGYITLW  222



>gb|AHW49458.1| ferric reductase [Phaseolus vulgaris]
Length=697

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/207 (33%), Positives = 104/207 (50%), Gaps = 5/207 (2%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  265
            V  GW+ +WIL PT+V+  TW    E K +++ F   G    ++TFPV+    +G VYL 
Sbjct  14   VFVGWIMVWILLPTKVYKNTWNPKLENKLNSTYFREQGTNLLLFTFPVVFMGALGCVYLH  73

Query  266  QKKQKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRI  436
             + QK +   S+      R L+FL  P +V S +GIL+ +E++   +F   L W+    +
Sbjct  74   LRLQKPENLSSKSGGTANRRLSFLRRPFVVMSPIGILTSMELVFALMFAALLIWSLSNYL  133

Query  437  SNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  616
               F       + +  VWQ ++  V+ R G +   C A L  PV R  ++  L GL  E 
Sbjct  134  HISFGHLHMHMEGE-KVWQAKLRSVSLRAGYIGNICWAFLFFPVTRASSILPLFGLTSES  192

Query  617  SVRYHTWLGTAMIVFATLHGAGTFFIW  697
            S++YH WLG   +V   +H  G F  W
Sbjct  193  SIKYHIWLGRVSMVLFAVHTIGFFIYW  219



>gb|AHW49440.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49447.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49450.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49462.1| ferric reductase [Phaseolus vulgaris]
Length=697

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 103/204 (50%), Gaps = 5/204 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+ +WIL PT+V+  TW    E K +++ F   G    ++TFPV+    +G VYL  + 
Sbjct  17   GWIMVWILLPTKVYKNTWNPKLENKLNSTYFREQGTNLLLFTFPVVFMGALGCVYLHLRL  76

Query  275  QKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            QK +   S+      R L+FL  P +V S +GIL+ +E++   +F   L W+    +   
Sbjct  77   QKPENLSSKSGGSANRRLSFLRRPFVVMSPIGILTSMELVFALMFAALLIWSLSNYLHIS  136

Query  446  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
            F       + +  VWQ ++  V+ R G +   C A L  PV R  ++  L GL  E S++
Sbjct  137  FGHLHMHMEGE-KVWQAKLRSVSLRAGYIGNICWAFLFFPVTRASSILPLFGLTSESSIK  195

Query  626  YHTWLGTAMIVFATLHGAGTFFIW  697
            YH WLG   +V   +H  G F  W
Sbjct  196  YHIWLGRVSMVLFAVHTIGFFIYW  219



>gb|AHW49435.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49436.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49437.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49438.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49439.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49441.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49442.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49443.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49444.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49445.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49446.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49448.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49449.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49451.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49452.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49453.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49454.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49455.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49456.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49457.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49459.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49460.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49461.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49463.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49464.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49465.1| ferric reductase [Phaseolus vulgaris]
Length=697

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 103/204 (50%), Gaps = 5/204 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+ +WIL PT+V+  TW    E K +++ F   G    ++TFPV+    +G VYL  + 
Sbjct  17   GWIMVWILLPTKVYKNTWNPKLENKLNSTYFREQGTNLLLFTFPVVFMGALGCVYLHLRL  76

Query  275  QKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            QK +   S+      R L+FL  P +V S +GIL+ +E++   +F   L W+    +   
Sbjct  77   QKPENLSSKSGGTANRRLSFLRRPFVVMSPIGILTSMELVFALMFAALLIWSLSNYLHIS  136

Query  446  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
            F       + +  VWQ ++  V+ R G +   C A L  PV R  ++  L GL  E S++
Sbjct  137  FGHLHMHMEGE-KVWQAKLRSVSLRAGYIGNICWAFLFFPVTRASSILPLFGLTSESSIK  195

Query  626  YHTWLGTAMIVFATLHGAGTFFIW  697
            YH WLG   +V   +H  G F  W
Sbjct  196  YHIWLGRVSMVLFAVHTIGFFIYW  219



>gb|ADL59931.1| ferric reductase [Phaseolus vulgaris]
Length=697

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/207 (33%), Positives = 104/207 (50%), Gaps = 5/207 (2%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  265
            V  GW+ +WIL PT+V+  TW    E K +++ F   G    ++TFPV+    +G VYL 
Sbjct  14   VFVGWIMVWILLPTKVYKNTWNPKLENKLNSAYFREQGTNLLLFTFPVVFMGALGCVYLH  73

Query  266  QKKQKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRI  436
             + QK +   S+      R L+FL  P +V S +GIL+ +E++   +F   L W+    +
Sbjct  74   LRLQKPENLSSKSGGTANRRLSFLRRPFVVMSPIGILTSMELVFALMFAALLIWSLSNYL  133

Query  437  SNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  616
               F       + +  VWQ ++  V+ R G +   C A L  PV R  ++  L GL  E 
Sbjct  134  HISFGHLHMHMEGE-KVWQAKLRSVSLRAGYIGNICWAFLFFPVTRASSILPLFGLTSES  192

Query  617  SVRYHTWLGTAMIVFATLHGAGTFFIW  697
            S++YH WLG   +V   +H  G F  W
Sbjct  193  SIKYHIWLGRVSMVLFAVHTIGFFIYW  219



>ref|XP_003528842.1| PREDICTED: ferric reduction oxidase 2-like isoform 2 [Glycine 
max]
Length=706

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/205 (33%), Positives = 106/205 (52%), Gaps = 16/205 (8%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            GW+ +WI+ PT  + + W  +   +  + + FG  G    +YTFP++  A +G VYL   
Sbjct  33   GWIFIWIMSPTNTFRQAWLPRYKAKTNNTTYFGSKGAYLLLYTFPILLIATLGCVYLHIG  92

Query  272  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF-  448
            K+K K  I ++          P+++K  LGI+SG E+  + +FI+ L W F T + N F 
Sbjct  93   KKKFKATIWKR----------PVLIKGPLGIVSGTELAFLFMFILLLIWVFATSVHNSFA  142

Query  449  --RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
                 +  KD +  +W+ ++  VA R G++   CLA +  PV R   V  LLGL  E  +
Sbjct  143  TITPQLAAKDGE-KMWEEKLDSVALRLGVVGNICLAFMFFPVARGSCVLPLLGLTSESCI  201

Query  623  RYHTWLGTAMIVFATLHGAGTFFIW  697
            +YH WLG   ++  T HG     +W
Sbjct  202  KYHIWLGHIAMLLFTSHGICYIILW  226



>ref|XP_009367867.1| PREDICTED: ferric reduction oxidase 2-like [Pyrus x bretschneideri]
Length=720

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/206 (34%), Positives = 105/206 (51%), Gaps = 7/206 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVF-GYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + +W + PT  + +TW+     KA++S F G  G    VYTFP++  A++G VYL   
Sbjct  36   GTLFIWFMMPTNTFKQTWRPQIRRKANSSTFLGSAGANLLVYTFPILFIAVLGCVYLHLG  95

Query  272  KQ----KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  439
             Q    K +    R+++R  A    P++VK  LGI+SGIE+   ++F+  L W+F   + 
Sbjct  96   NQLNDRKMERSNDRKKKRS-AVWKQPILVKGPLGIVSGIELAFFAMFVALLIWSFSMYLQ  154

Query  440  NDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
            N F K    +     +W+ ++   A   GL+   CLA L  PV R  +V  L GL  E S
Sbjct  155  NSFAKISAARHPDEQIWKPKLESAALMLGLVGNICLAFLFFPVARGSSVLALFGLTSEGS  214

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG   +   T HG      W
Sbjct  215  IKYHIWLGHIGMTLFTAHGLCYIIYW  240



>ref|XP_012083331.1| PREDICTED: ferric reduction oxidase 2-like isoform X1 [Jatropha 
curcas]
 gb|KDP28592.1| hypothetical protein JCGZ_14363 [Jatropha curcas]
Length=712

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 105/209 (50%), Gaps = 6/209 (3%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAAEE-KASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  265
            V  G+V +WI+ PT  + + W      K +++ FGY G    V+ FP+I  A++G VYL 
Sbjct  27   VLVGYVIMWIMMPTNTYRQIWLPYLRFKFNSTYFGYQGATLLVFFFPIIFVAVLGCVYLH  86

Query  266  QKKQKQKE---GISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRI  436
              K++        ++  +  L     P++VK+ LGI+SGIE+  + +FI  L W+  T +
Sbjct  87   LLKKRPININFSSNKGRKHILGAWKKPMLVKAPLGIVSGIELAFLIMFIALLIWSLATYL  146

Query  437  SNDFRKTVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQF  610
             N F         K    VW+ ++   A R GL+   CL  L  PV R  +V  + GL  
Sbjct  147  HNSFATITPQSAAKNGQKVWEMKLENSALRLGLVGNICLTFLFFPVARGSSVLPVFGLTS  206

Query  611  EVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            E S++YH WLG  ++ F T HG      W
Sbjct  207  EGSIKYHIWLGHMVMAFFTAHGLAYIIYW  235



>ref|XP_006598945.1| PREDICTED: ferric reduction oxidase 2-like isoform X2 [Glycine 
max]
Length=718

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 104/207 (50%), Gaps = 8/207 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-Q  268
            GW+ + I+ PT  + +TW  +   +  + +  G  G    +YTFP++  A +G VYL   
Sbjct  33   GWIFIRIMSPTNTFRQTWLPRYKAKTNNTTYIGSKGAYLLLYTFPILLLATLGCVYLHIG  92

Query  269  KKQKQKEGISRQERRC-LAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            KK       S   ++C +     P+++K  LGI+SG EI  + LFI  LAW F T + N 
Sbjct  93   KKVIHSNTESCNAKKCGVTIWKRPVLIKGPLGIVSGTEIAFLFLFIALLAWVFSTSVQNS  152

Query  446  FRKTVQ---TKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  616
            F         KD +  +W+ ++ RVA R G++   CLA +  PV R  +V  LL L  E 
Sbjct  153  FATITPQFAAKDGQ-KIWEEKLDRVAKRLGVVGNICLAFMFFPVARGSSVLPLLDLTSES  211

Query  617  SVRYHTWLGTAMIVFATLHGAGTFFIW  697
             ++YH WLG   +   T HG     +W
Sbjct  212  CIKYHIWLGNIAMTLFTSHGLCYIILW  238



>ref|XP_002875038.1| hypothetical protein ARALYDRAFT_912220 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51297.1| hypothetical protein ARALYDRAFT_912220 [Arabidopsis lyrata subsp. 
lyrata]
Length=720

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/201 (33%), Positives = 108/201 (54%), Gaps = 8/201 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA---EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            G + +W L PT V+   W       E  +++ FG  GL F ++ FP++  A +G +YL  
Sbjct  36   GIIFIWALMPTMVYRTKWLNPVMRTEFGTSTYFGAIGLTFFMFMFPMVLMACLGCLYLHL  95

Query  269  KKQKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  439
            KKQK    ++R+   +    A +  P++VK  LGI+S  E++ +++F+  L W F+  + 
Sbjct  96   KKQKNTNHLAREKITDGGVFAAMKRPMLVKGPLGIVSATELILLAMFVALLLWNFFMYMR  155

Query  440  NDFRKTVQTKDFK--LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFE  613
            N F         K    +WQ R+  +A R GL+   CLA L +PV+R  ++  ++GL  E
Sbjct  156  NAFPTITPQSAAKHHQKLWQARLEAMAVRIGLVGNCCLAFLFIPVVRGSSLLPVVGLTSE  215

Query  614  VSVRYHTWLGTAMIVFATLHG  676
             S++YH WLG  ++   T HG
Sbjct  216  SSIKYHIWLGHMLMTLFTAHG  236



>ref|XP_009118816.1| PREDICTED: ferric reduction oxidase 2 [Brassica rapa]
Length=725

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 109/206 (53%), Gaps = 7/206 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEK--ASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + LWI+ PT  +   W         +++ FG +G    +Y FP++  A +G VYL  K
Sbjct  37   GTIMLWIMMPTLTYRNKWLPYMRLKFGASTYFGSSGTTLFMYMFPMVVVACLGCVYLHFK  96

Query  272  KQKQKEGISRQERR-CLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            K+K    I R+     L+ L  P++VK  LGI+S  EI+ +++F+  L W+F T + N+F
Sbjct  97   KRKNPHHIVRETNGGVLSALRKPMLVKGPLGIVSATEIMFLAMFVALLLWSFITYLRNNF  156

Query  449  RKTVQTKD---FKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
              T+  +       ++WQ ++   A R GL+   CLA L LPV R  ++   +GL  E S
Sbjct  157  -ATITPRSAAAHGESLWQAKLESAALRIGLIGNMCLAFLFLPVARGSSLLPAVGLTSESS  215

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG  ++   T+HG      W
Sbjct  216  IKYHIWLGHMVLAIFTVHGLCYVIYW  241



>ref|XP_010426833.1| PREDICTED: ferric reduction oxidase 2-like [Camelina sativa]
Length=720

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 108/201 (54%), Gaps = 8/201 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA---EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            G++ +WI+ PT V+   W       E  +++ FG  GL F ++ FP++  A +G +YL  
Sbjct  36   GFIFIWIVMPTMVYRTQWLNPVMRTEFGTSTFFGAIGLTFFMFMFPMVLLACLGCLYLHL  95

Query  269  KKQKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  439
            KK K    + R+   E   LA +  P++VK  LGI+S  E++  ++F+  L W F+  + 
Sbjct  96   KKPKTTNHLVREKITEGGVLAAMKRPMLVKGPLGIVSATELILFAMFVALLLWEFFMYMR  155

Query  440  NDFRKTVQTKDFKL--AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFE  613
            N F         K    +WQ R+  +A R GL+   CLA L +PV+R  ++  ++GL  E
Sbjct  156  NAFPTITPQSAAKHHQKLWQARLEAMAIRIGLVGNCCLAFLFIPVVRGSSLLPVIGLTSE  215

Query  614  VSVRYHTWLGTAMIVFATLHG  676
             S++YH WLG  ++   T HG
Sbjct  216  SSIKYHIWLGHMLMTLFTAHG  236



>ref|XP_012083335.1| PREDICTED: ferric reduction oxidase 2-like isoform X2 [Jatropha 
curcas]
Length=714

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 107/206 (52%), Gaps = 6/206 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVW-TRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ-K  271
            G++ LW+L PT+++  + +     K  ++ FG  G+   +Y FP++  A++G VYL   K
Sbjct  31   GYLILWVLMPTKIYRHQLFPRVRNKLDSAFFGIQGIMLLLYFFPILFVAVLGCVYLHLLK  90

Query  272  KQKQKEGISRQERRCLAFLS--NPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            K+   E       R  A  +   P+IVK  LGI+SGIE+  + +F   + W+F T + N 
Sbjct  91   KRSSNEQFESGNGRKHAVGAWKKPMIVKDPLGIVSGIELAFLIMFTALVIWSFATYLRNS  150

Query  446  FRK-TVQTK-DFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
            F   T Q+  +    VW+ ++   A R  L    CL  L  PV R  +V  L GL FE S
Sbjct  151  FATITPQSAAENGQKVWEAKLESSALRLALAGNMCLTFLFFPVARGSSVLPLFGLTFEGS  210

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG  ++ F T HG G    W
Sbjct  211  IKYHIWLGHMVMAFFTAHGLGYIIYW  236



>ref|XP_004510756.1| PREDICTED: ferric reduction oxidase 2-like [Cicer arietinum]
Length=716

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/207 (33%), Positives = 108/207 (52%), Gaps = 8/207 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G + ++I+ PT  + + W    + K +++ FG  G    ++TFPV+    +G VYL   K
Sbjct  31   GLILIFIMMPTNTFKKIWFPQFQAKTNSTYFGAQGSRILMFTFPVLLMGTLGCVYLHIAK  90

Query  275  QKQKEGI---SRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
               +  I   + ++   ++   NP+IVK  LGI+SGIEI  + +FI  L W+F T + N+
Sbjct  91   ISNESNIEVYNGKKHEAISIWKNPMIVKGPLGIVSGIEITFLVMFIALLVWSFGTPLYNN  150

Query  446  FRKTVQTK---DFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  616
            F  T+ +K   +    VWQ ++  V  RFGL+   CL  L  PV R  ++  + GL  E 
Sbjct  151  F-ATITSKSAAEDGDKVWQEKLEAVGLRFGLVGNICLTFLFFPVTRGSSLLPIFGLTSEG  209

Query  617  SVRYHTWLGTAMIVFATLHGAGTFFIW  697
             ++YH WLG  ++   T HG      W
Sbjct  210  CIKYHIWLGHVLMTLFTSHGICYIIYW  236



>gb|AED02589.1| ferric reductase [Lotus japonicus]
Length=702

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 100/203 (49%), Gaps = 10/203 (5%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+  WI+ PT  + + W+   + K S++ FG  G     +TFPV+  A++G VYL   K
Sbjct  32   GWILQWIVIPTNTYRQIWRPQIQAKTSSTYFGAQGPVILTFTFPVLFIAVLGCVYLHTAK  91

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
            +      +   +R       P++VK  LGI+S  E+  + +FI  L W+F T + N F K
Sbjct  92   KSSNGPEATIWKR-------PVLVKGPLGIVSSTELAFLLMFIALLVWSFATYLHNGFAK  144

Query  455  TVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
              Q         VW+ ++   A R GL+   CLA L  PV R   V  LLGL  E  ++Y
Sbjct  145  ITQKSAAADGEKVWEEKLEXAALRLGLIGNICLAFLYFPVARGSTVLPLLGLTSESCIKY  204

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLG  ++   T HG      W
Sbjct  205  HIWLGHVVMTLFTSHGICYIIYW  227



>gb|AED02590.1| ferric reductase [Lotus japonicus]
Length=706

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 100/203 (49%), Gaps = 10/203 (5%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+  WI+ PT  + + W+   + K S++ FG  G     +TFPV+  A++G VYL   K
Sbjct  32   GWILQWIVIPTNTYRQIWRPQIQAKTSSTYFGAQGPVILTFTFPVLFIAVLGCVYLHTAK  91

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
            +      +   +R       P++VK  LGI+S  E+  + +FI  L W+F T + N F K
Sbjct  92   KSSNGPEATIWKR-------PVLVKGPLGIVSSTELAFLLMFIALLVWSFATYLHNGFAK  144

Query  455  TVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
              Q         VW+ ++   A R GL+   CLA L  PV R   V  LLGL  E  ++Y
Sbjct  145  ITQKSAAADGEKVWEEKLETAALRLGLIGNICLAFLYFPVARGSTVLPLLGLTSESCIKY  204

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLG  ++   T HG      W
Sbjct  205  HIWLGHVVMTLFTSHGICYIIYW  227



>ref|XP_004510757.1| PREDICTED: ferric reduction oxidase 2-like [Cicer arietinum]
Length=716

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 107/209 (51%), Gaps = 12/209 (6%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G + ++I+ PT  + + W    + K +++ FG  G    ++TFPV+    +G VYL   K
Sbjct  31   GLIFIFIMMPTNTFKKIWIPQFQAKTNSTYFGAQGSRILMFTFPVLLMGTLGCVYLHIAK  90

Query  275  QKQKEGI---SRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
               +  I   + ++   ++   NP++VK  LGI+SGIE+  + +FI  L W+F T + N+
Sbjct  91   ISNESNIEVYNGKKHEAISIWKNPMVVKGPLGIVSGIEMTFLVMFIALLVWSFGTPLYNN  150

Query  446  F-----RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQF  610
            F     +   Q  D    VWQ +++ V +R G +   CLA L  PV R  ++  L GL  
Sbjct  151  FATITSKSAAQDGD---KVWQEKLVVVGSRAGAVGNICLAFLFFPVTRGSSLLPLFGLTS  207

Query  611  EVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            E  ++YH WLG  ++   T HG      W
Sbjct  208  EGCIKYHIWLGHVLMTLFTSHGICYIIYW  236



>gb|KHN26943.1| Ferric reduction oxidase 2 [Glycine soja]
Length=718

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 106/207 (51%), Gaps = 8/207 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-Q  268
            GW+ +WI+ PT  + + W  +   +  + + FG  G    +YTFP++  A +G VYL   
Sbjct  33   GWIFIWIMSPTNTFRQAWLPRYKAKTNNTTYFGSKGAYLLLYTFPILLIATLGCVYLHIG  92

Query  269  KKQKQKEGISRQERRCLAFL-SNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            KK       S   ++  A +   P+++K  LGI+SG E+  + +FI+ L W F T + N 
Sbjct  93   KKVNDSNTESCNAKKFKATIWKRPVLIKGPLGIVSGTELAFLFMFILLLIWVFATSVHNS  152

Query  446  F---RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  616
            F      +  KD +  +W+ ++  VA R G++   CLA +  PV R   V  LLGL  E 
Sbjct  153  FATITPQLAAKDGE-KMWEEKLDSVALRLGVVGNICLAFMFFPVARGSCVLPLLGLTSES  211

Query  617  SVRYHTWLGTAMIVFATLHGAGTFFIW  697
             ++YH WLG   ++  T HG     +W
Sbjct  212  CIKYHIWLGHIAMLLFTSHGICYIILW  238



>ref|XP_003528841.1| PREDICTED: ferric reduction oxidase 2-like isoform 1 [Glycine 
max]
Length=718

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 106/207 (51%), Gaps = 8/207 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-Q  268
            GW+ +WI+ PT  + + W  +   +  + + FG  G    +YTFP++  A +G VYL   
Sbjct  33   GWIFIWIMSPTNTFRQAWLPRYKAKTNNTTYFGSKGAYLLLYTFPILLIATLGCVYLHIG  92

Query  269  KKQKQKEGISRQERRCLAFL-SNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            KK       S   ++  A +   P+++K  LGI+SG E+  + +FI+ L W F T + N 
Sbjct  93   KKVNDSNTESCNAKKFKATIWKRPVLIKGPLGIVSGTELAFLFMFILLLIWVFATSVHNS  152

Query  446  F---RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  616
            F      +  KD +  +W+ ++  VA R G++   CLA +  PV R   V  LLGL  E 
Sbjct  153  FATITPQLAAKDGE-KMWEEKLDSVALRLGVVGNICLAFMFFPVARGSCVLPLLGLTSES  211

Query  617  SVRYHTWLGTAMIVFATLHGAGTFFIW  697
             ++YH WLG   ++  T HG     +W
Sbjct  212  CIKYHIWLGHIAMLLFTSHGICYIILW  238



>gb|AES62461.2| oxidoreductase/ferric-chelate reductase [Medicago truncatula]
Length=707

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 106/206 (51%), Gaps = 8/206 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+S+WIL PT+++ + W    + K +++ F   G+    +TFP++    +  +YL   +
Sbjct  24   GWLSVWILLPTKIYKKIWAPMLQNKFNSTYFRGQGINLLFFTFPMMFIGALSCIYLHFHQ  83

Query  275  QKQKEGISRQE----RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
            +K  E +  +     +RCL FL  P +V S +GI+S +E++ V +F   L W+    +  
Sbjct  84   EKITEKLPSRSGGALKRCLGFLRRPFLVMSPIGIVSAMELIFVLMFAALLIWSLSNYLHT  143

Query  443  DFRKT-VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
             F    +  +D K  +W+ ++  V+ R   +   CLA L  PV R  ++  L+GL  E S
Sbjct  144  GFDHLRMHKQDEK--IWEAKLRSVSLRLAYIGNICLAFLFFPVTRMSSILPLVGLTSESS  201

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG   +V    H  G    W
Sbjct  202  IKYHIWLGQLSMVLFAAHSIGFIIYW  227



>ref|XP_010270349.1| PREDICTED: probable ferric reduction oxidase 1 [Nelumbo nucifera]
Length=718

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 108/204 (53%), Gaps = 11/204 (5%)
 Frame = +2

Query  113  WILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQKQKE  289
            WI+ PT ++ R W      K +++ FG  G    +YT PV+  A++G VYL  +K+    
Sbjct  36   WIITPTSIYNRVWFPNIRAKTNSTYFGRQGTLILIYTVPVLLLAVLGCVYLHLEKKYGDN  95

Query  290  GISRQERRCL---AFL-SNPLIVKSSLGILSGIEILGVSLFIIFLAWTF--YTRISNDF-  448
             I    +  L   AFL + P++V   LGI++  E+   ++FI  L W++  Y ++  D+ 
Sbjct  96   SIGSNGQTKLIRLAFLRARPMLVDGPLGIVTWTELAFFTMFIALLVWSYAVYLQVGLDYI  155

Query  449  -RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
              +  + K  KL  WQ ++   A R G++   CLA L  PV R  +V  LLGL +E S++
Sbjct  156  TSEIAEAKGEKL--WQAQLDCAAVRLGVVGNVCLAFLFFPVTRGSSVLPLLGLTWEASIK  213

Query  626  YHTWLGTAMIVFATLHGAGTFFIW  697
            YH W+G A ++  T HG   F  W
Sbjct  214  YHIWVGHAAMILLTAHGLCYFVYW  237



>ref|XP_003592210.1| Ferric-chelate reductase [Medicago truncatula]
Length=736

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 106/206 (51%), Gaps = 8/206 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+S+WIL PT+++ + W    + K +++ F   G+    +TFP++    +  +YL   +
Sbjct  24   GWLSVWILLPTKIYKKIWAPMLQNKFNSTYFRGQGINLLFFTFPMMFIGALSCIYLHFHQ  83

Query  275  QKQKEGISRQE----RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
            +K  E +  +     +RCL FL  P +V S +GI+S +E++ V +F   L W+    +  
Sbjct  84   EKITEKLPSRSGGALKRCLGFLRRPFLVMSPIGIVSAMELIFVLMFAALLIWSLSNYLHT  143

Query  443  DFRKT-VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
             F    +  +D K  +W+ ++  V+ R   +   CLA L  PV R  ++  L+GL  E S
Sbjct  144  GFDHLRMHKQDEK--IWEAKLRSVSLRLAYIGNICLAFLFFPVTRMSSILPLVGLTSESS  201

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG   +V    H  G    W
Sbjct  202  IKYHIWLGQLSMVLFAAHSIGFIIYW  227



>ref|XP_012083336.1| PREDICTED: ferric reduction oxidase 2-like isoform X3 [Jatropha 
curcas]
Length=616

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/215 (33%), Positives = 108/215 (50%), Gaps = 15/215 (7%)
 Frame = +2

Query  98   GWVSLWILKPTQVW-TRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G++ LW+L PT+++  + +     K  ++ FG  G+   +Y FP++  A++G VYL   K
Sbjct  31   GYLILWVLMPTKIYRHQLFPRVRNKLDSAFFGIQGIMLLLYFFPILFVAVLGCVYLHLLK  90

Query  275  QK----QKEGISRQ--------ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAW  418
            ++    Q E I            +  +     P+IVK  LGI+SGIE+  + +F   + W
Sbjct  91   KRSSNEQFESIPTHFNKYSGNGRKHAVGAWKKPMIVKDPLGIVSGIELAFLIMFTALVIW  150

Query  419  TFYTRISNDFRK-TVQTK-DFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFR  592
            +F T + N F   T Q+  +    VW+ ++   A R  L    CL  L  PV R  +V  
Sbjct  151  SFATYLRNSFATITPQSAAENGQKVWEAKLESSALRLALAGNMCLTFLFFPVARGSSVLP  210

Query  593  LLGLQFEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            L GL FE S++YH WLG  ++ F T HG G    W
Sbjct  211  LFGLTFEGSIKYHIWLGHMVMAFFTAHGLGYIIYW  245



>ref|XP_010477584.1| PREDICTED: ferric reduction oxidase 3, mitochondrial-like [Camelina 
sativa]
Length=722

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 106/203 (52%), Gaps = 13/203 (6%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASV-FGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + +WI+ PT  + + W K+   K   S+ FG  G+   VY FP+I  A +G +YL  K
Sbjct  54   GTMVIWIMMPTSTYKKIWLKSMRAKLGESIYFGRPGVNLLVYMFPMILLAFLGSIYLHLK  113

Query  272  KQ----KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWT----FY  427
            KQ    +   G+ R++R     L  P++VK  LGI++  E++ +++F+  L W+    FY
Sbjct  114  KQTTVSQLNSGVERKKRNKFGALKKPMLVKG-LGIVTVTEVMFLTMFLALLLWSLANYFY  172

Query  428  TRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQ  607
               S    +++ T    L  WQ R+  +A R GL    CL  L  PV R  ++   +GL 
Sbjct  173  VTFSTITPQSIPTDGDNL--WQARLKSIAVRLGLTGNICLGFLFYPVARGSSLLTAVGLT  230

Query  608  FEVSVRYHTWLGTAMIVFATLHG  676
             E S++YH WLG  ++   T HG
Sbjct  231  SESSIKYHIWLGNLVMTLLTSHG  253



>ref|XP_009367868.1| PREDICTED: ferric reduction oxidase 2-like [Pyrus x bretschneideri]
Length=717

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 102/204 (50%), Gaps = 6/204 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVF-GYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + +W++ PT  + + W      KAS+S + G  G    VYTFP++  A++G VYL   
Sbjct  36   GTLLIWLMMPTNTYRQIWLPQIRLKASSSTYLGAEGGTILVYTFPILFIAVLGCVYLHLG  95

Query  272  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
            K       +++ R   A    P++VK  LGI+SGIE+    +F+  L W+  T + N F+
Sbjct  96   KNSSSSSGTKKNR--FAVWKQPMLVKGPLGIVSGIELAFFVIFVTLLVWSLSTYLHNKFK  153

Query  452  K--TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
               T         VW+ ++   A   GL+   CLA L  PV R  +V  L GL  E S++
Sbjct  154  NITTQSAAKHHEQVWESKLDSAALVLGLVGNICLAFLFFPVARGSSVLALFGLTSEGSIK  213

Query  626  YHTWLGTAMIVFATLHGAGTFFIW  697
            YH WLG  ++ F T HG      W
Sbjct  214  YHIWLGHIVLAFFTAHGLCYIIYW  237



>ref|XP_002272836.2| PREDICTED: ferric reduction oxidase 4 [Vitis vinifera]
Length=723

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 105/204 (51%), Gaps = 7/204 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+ +W+L PT+V+ + W      K +++ FG  G    ++TFP++  A VG VYL  +K
Sbjct  41   GWLMVWVLLPTKVYKQQWTPKLNSKLNSTYFGEQGTNLLLFTFPMMLIAAVGCVYLHFQK  100

Query  275  QKQKE---GISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            +K       IS   R  LAF   P++V + LGI+S +E++  ++FI+ L W+    +   
Sbjct  101  KKGNSFSRSISASHR--LAFWKKPVLVMAPLGIVSAMELVFAAMFIMLLIWSLANYLYVS  158

Query  446  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
            F      K  +  VW+ +   V+ R G +   C A L  PV R  ++  L+GL  E S++
Sbjct  159  FGHLHMHKQGE-KVWEAKFRSVSLRLGYIGNLCWAFLFFPVTRGSSILPLVGLTSESSIK  217

Query  626  YHTWLGTAMIVFATLHGAGTFFIW  697
            YH WLG   +V    H  G    W
Sbjct  218  YHIWLGHLSMVLFAAHSIGFVIYW  241



>ref|XP_009119709.1| PREDICTED: ferric reduction oxidase 2 [Brassica rapa]
Length=702

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 107/206 (52%), Gaps = 7/206 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEK--ASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + LWI+ PT+ +   W+        +++ FG  G    +Y FP+I  A +G VYL  K
Sbjct  14   GTIMLWIMMPTRTYKNKWQPYMRLKFGASTYFGATGTTLFMYMFPMILVACLGCVYLHFK  73

Query  272  KQKQKEGISRQERRCL-AFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            K+K    I R+ +  + + L  P++VK  LGI+S  EI+ +++F+  L W+F T + N F
Sbjct  74   KRKSPHHIDREIKGGVWSALRKPMLVKGPLGIVSVTEIMFLAMFVALLLWSFITYLRNKF  133

Query  449  RKTVQTKDFKLA---VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
              T+  +        +WQ ++   A R G +   CLA L LPV R  ++   +GL  E S
Sbjct  134  -ATITPQSAAADGQYLWQAKLESAALRIGFIGNICLAFLFLPVARGSSLLPAVGLTSESS  192

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG  +I   T HG      W
Sbjct  193  IKYHIWLGHMVIAIFTAHGLCYIIYW  218



>ref|XP_012083334.1| PREDICTED: ferric reduction oxidase 2-like isoform X1 [Jatropha 
curcas]
 gb|KDP28593.1| hypothetical protein JCGZ_14364 [Jatropha curcas]
Length=723

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/215 (33%), Positives = 108/215 (50%), Gaps = 15/215 (7%)
 Frame = +2

Query  98   GWVSLWILKPTQVW-TRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G++ LW+L PT+++  + +     K  ++ FG  G+   +Y FP++  A++G VYL   K
Sbjct  31   GYLILWVLMPTKIYRHQLFPRVRNKLDSAFFGIQGIMLLLYFFPILFVAVLGCVYLHLLK  90

Query  275  QK----QKEGISRQ--------ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAW  418
            ++    Q E I            +  +     P+IVK  LGI+SGIE+  + +F   + W
Sbjct  91   KRSSNEQFESIPTHFNKYSGNGRKHAVGAWKKPMIVKDPLGIVSGIELAFLIMFTALVIW  150

Query  419  TFYTRISNDFRK-TVQTK-DFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFR  592
            +F T + N F   T Q+  +    VW+ ++   A R  L    CL  L  PV R  +V  
Sbjct  151  SFATYLRNSFATITPQSAAENGQKVWEAKLESSALRLALAGNMCLTFLFFPVARGSSVLP  210

Query  593  LLGLQFEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            L GL FE S++YH WLG  ++ F T HG G    W
Sbjct  211  LFGLTFEGSIKYHIWLGHMVMAFFTAHGLGYIIYW  245



>ref|XP_002975964.1| hypothetical protein SELMODRAFT_51485, partial [Selaginella moellendorffii]
 gb|EFJ22869.1| hypothetical protein SELMODRAFT_51485, partial [Selaginella moellendorffii]
Length=587

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 99/195 (51%), Gaps = 5/195 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+ +W+++PT  +++ W++  +  +   +G  G     Y+ PV+  A+VG +YL+  K 
Sbjct  12   GWILMWVMRPTSAYSKFWQSFTKDTTTKAYGVAGSFTLFYSAPVVILAVVGAIYLQLSKD  71

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
                   R   R   F S P +V+  L + S  E+  + LF+  L WT    +S  F K 
Sbjct  72   DSTR--RRDGVRVNPF-SFPAVVRGPLAVASAAELTCLVLFVALLVWTLSEYLSTKFAKI  128

Query  458  VQT--KDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
                    +L +W+ ++  V T  GL+   CLA L  PV R     RLL + FE +++YH
Sbjct  129  TPAYLHKHQLKLWERKLEMVGTNLGLVGIVCLAFLFFPVARGSVFLRLLNVPFEHAIKYH  188

Query  632  TWLGTAMIVFATLHG  676
             W+G  M+V  T+HG
Sbjct  189  IWIGHIMMVIWTVHG  203



>ref|XP_007139803.1| hypothetical protein PHAVU_008G060100g [Phaseolus vulgaris]
 gb|ESW11797.1| hypothetical protein PHAVU_008G060100g [Phaseolus vulgaris]
Length=710

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 98/196 (50%), Gaps = 3/196 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QKK  274
            GW+ +WI+ PT  + + WK   +  + S FG  G    VYT P++  A +G VY+   KK
Sbjct  32   GWIFVWIMTPTNTYQQKWKHRLQAKTNSGFGKQGARLLVYTSPILLIAALGCVYIHIAKK  91

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
                   S  ++  ++     + V+  LGI+SG E+   S+FI+ L W+    + N F K
Sbjct  92   GNGSNAESYGKKDEVSIWKRLVFVRGPLGIVSGTELAFFSMFILLLVWSLSIYLHNGFAK  151

Query  455  TVQTK--DFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
                   +  + VWQ R+     + GL+   CLA L  PV+R  +V  LLGL  E  ++Y
Sbjct  152  ITHKSAAEHGVEVWQKRLASAGVKLGLVGNICLAFLFFPVVRSSSVLPLLGLTPESCIKY  211

Query  629  HTWLGTAMIVFATLHG  676
            H WLG   +   T HG
Sbjct  212  HIWLGHIAMTLFTAHG  227



>ref|XP_002968520.1| hypothetical protein SELMODRAFT_145556 [Selaginella moellendorffii]
 gb|EFJ30774.1| hypothetical protein SELMODRAFT_145556 [Selaginella moellendorffii]
Length=667

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 101/195 (52%), Gaps = 5/195 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+ +W+++PT  +++ W++  +  +   +G  G     Y+ PV+  A+VG +YL+  K 
Sbjct  7    GWILMWVMRPTSAYSKFWQSFTKDTTTKAYGVAGSFTLFYSAPVVILAVVGAIYLQLSKD  66

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
               +   R++   +   S P +V+  L + S  E+  + LF+  L WT    +S  F K 
Sbjct  67   ---DSTRRRDGVRVNPFSFPAVVRGPLAVASAAELTCLVLFVALLVWTLSEYLSTKFAKI  123

Query  458  VQT--KDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
                    +L +W+ ++  V T  GL+   CLA L  PV R     RLL + FE +++YH
Sbjct  124  TPAYLHKHQLKLWERKLEMVGTNLGLVGIVCLAFLFFPVARGSVFLRLLNVPFEHAIKYH  183

Query  632  TWLGTAMIVFATLHG  676
             W+G  M+V  T+HG
Sbjct  184  KWIGHIMMVIWTVHG  198



>gb|AAK95654.2|AF405422_1 ferric-chelate reductase [Pisum sativum]
 gb|AAU94356.1| iron reductase [Pisum sativum]
Length=712

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 102/203 (50%), Gaps = 5/203 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G + ++I+ P   + + W    + K +++ FG  G    +YTFP++  A +G VY+   K
Sbjct  32   GLLFIFIMMPVTTFKQKWIPKIQAKTNSTYFGVQGFRILIYTFPLLLIATLGCVYIHIAK  91

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
            +  +  I   ++        P++VK  LGI+S  EI  + +FI  L WT  T + NDF  
Sbjct  92   KSNQ--IDNGKKHETTIWKRPMLVKGPLGIVSITEIAFLLMFIALLVWTLATYLHNDFSS  149

Query  455  TVQT--KDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
               +  ++    VWQ ++  V  R GL+   CL LL  PV R  +V  + GL  E S++Y
Sbjct  150  IASSPEEEHGPKVWQEKLESVGLRLGLVGNICLVLLFFPVTRGTSVLPMFGLTSEGSIKY  209

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLG  ++   TLHG      W
Sbjct  210  HIWLGHVLMTIFTLHGVCYIIYW  232



>emb|CBI22668.3| unnamed protein product [Vitis vinifera]
Length=1178

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 105/204 (51%), Gaps = 7/204 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+ +W+L PT+V+ + W      K +++ FG  G    ++TFP++  A VG VYL  +K
Sbjct  496  GWLMVWVLLPTKVYKQQWTPKLNSKLNSTYFGEQGTNLLLFTFPMMLIAAVGCVYLHFQK  555

Query  275  QKQKE---GISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            +K       IS   R  LAF   P++V + LGI+S +E++  ++FI+ L W+    +   
Sbjct  556  KKGNSFSRSISASHR--LAFWKKPVLVMAPLGIVSAMELVFAAMFIMLLIWSLANYLYVS  613

Query  446  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
            F      K  +  VW+ +   V+ R G +   C A L  PV R  ++  L+GL  E S++
Sbjct  614  FGHLHMHKQGE-KVWEAKFRSVSLRLGYIGNLCWAFLFFPVTRGSSILPLVGLTSESSIK  672

Query  626  YHTWLGTAMIVFATLHGAGTFFIW  697
            YH WLG   +V    H  G    W
Sbjct  673  YHIWLGHLSMVLFAAHSIGFVIYW  696



>ref|XP_010456303.1| PREDICTED: ferric reduction oxidase 2-like [Camelina sativa]
Length=720

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 106/201 (53%), Gaps = 8/201 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA---EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            G + +WI+ PT V+   W       E  +++ FG  GL F ++ FP++    +G +YL  
Sbjct  36   GIIFIWIVMPTMVYRTKWLNPVMRTEFGTSTFFGAIGLTFFMFMFPIVLLVCLGCLYLHL  95

Query  269  KKQKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  439
            KK K    + R+   E   LA +  P++VK  LGI+S  E++  ++F+  L W F+  + 
Sbjct  96   KKPKTTNHLVREKITEGGVLAAMKRPMLVKGPLGIVSATELILFAMFVALLLWEFFMYMR  155

Query  440  NDFRKTVQTKDFKL--AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFE  613
            N F         K    +WQ ++  +A R GL+   CLA L +PV+R  ++  ++GL  E
Sbjct  156  NAFPTITPQSAAKHHQKLWQAKLEAMAIRIGLVGNCCLAFLFIPVVRGSSLLPVIGLTSE  215

Query  614  VSVRYHTWLGTAMIVFATLHG  676
             S++YH WLG  ++   T HG
Sbjct  216  SSIKYHIWLGHMLMTLFTAHG  236



>ref|XP_006418435.1| hypothetical protein EUTSA_v10006930mg [Eutrema salsugineum]
 gb|ESQ36788.1| hypothetical protein EUTSA_v10006930mg [Eutrema salsugineum]
Length=725

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 107/199 (54%), Gaps = 6/199 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAE--EKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + LWI+ PT  +   W      +  +++ FG  G    ++ FP++  A +G VYL  K
Sbjct  37   GTIMLWIMMPTLTYRNKWLPHMRIKFGASTYFGATGTTLFMFMFPMMVVASLGCVYLHFK  96

Query  272  KQKQKEGISRQERR--CLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            K+K    I R+ ++    + L  P++VK  LGI+S  EI+ +++F+  L W+F T + N+
Sbjct  97   KRKSLHHIDRETKKGGVWSALRKPMLVKGPLGIVSVTEIMFLAMFVALLLWSFITYVRNN  156

Query  446  FRKTVQTKDFKL--AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
            F          L  ++WQ ++   A R GL+   CLA L LPV R  ++   +GL  E S
Sbjct  157  FATITPQSAAALGQSLWQAKLHSAALRLGLIGNICLAFLFLPVARGSSLLPAVGLTSESS  216

Query  620  VRYHTWLGTAMIVFATLHG  676
            ++YH WLG  ++   T+HG
Sbjct  217  IKYHIWLGHMVMTIFTVHG  235



>gb|ERN13812.1| hypothetical protein AMTR_s00049p00212370 [Amborella trichopoda]
Length=599

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = +2

Query  356  LGILSGIEILGVSLFIIFLAWTFYTRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllt  535
            +GI+S  E+L  S+FIIFL WTFY+   N F+K   ++      W ++ +++  +FG + 
Sbjct  1    MGIVSMKEVLTTSVFIIFLGWTFYSNTYNGFKKMKHSESENWQPWYFKTMKIGVKFGFVA  60

Query  536  eaclallllpvlRRMAVFRLLGLQFEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            EACLALLL P+LR +A+ +LLGLQ+EVSVRYH WLG  M++F+ LHG    F W
Sbjct  61   EACLALLLFPILRVLALPQLLGLQYEVSVRYHIWLGNTMMLFSVLHGFTIMFAW  114



>gb|ADR70891.1| ferric reductase oxidase [Manihot esculenta]
Length=692

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 70/206 (34%), Positives = 106/206 (51%), Gaps = 10/206 (5%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYL----  262
            GW+ +WIL PT+V+  TW    E K +++ F   G    +++FPV+  A  G VYL    
Sbjct  12   GWIVIWILLPTKVYKNTWTPKLESKLNSTYFEGEGNNLLLFSFPVMFIAAFGSVYLHFQK  71

Query  263  EQKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
            E +K   K  +    R  L+FL  PL+V + LGI++ +EI   ++FI  L W+    +  
Sbjct  72   ELRKPTCKSAVVSSNR--LSFLKRPLLVMAPLGIVTAMEIAFAAMFIALLIWSLANYLYV  129

Query  443  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
             F      K  +  +WQ +   V+ R G +   C A L  PV R  ++  L+GL  E S+
Sbjct  130  SFGHLHMHKQGE-KIWQAKFRSVSLRLGYIGNICWAFLFFPVTRGSSILPLVGLTSESSI  188

Query  623  RYHTWLGT-AMIVFATLHGAGTFFIW  697
            +YH W+G  +MI+FA  H  G    W
Sbjct  189  KYHIWVGHLSMILFAA-HAVGFIIYW  213



>emb|CAN74772.1| hypothetical protein VITISV_024875 [Vitis vinifera]
Length=1230

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 102/202 (50%), Gaps = 3/202 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  271
            GW+ +W+L PT+V+ + W      K +++ FG  G    ++TFP++  A VG VYL  QK
Sbjct  548  GWLMVWVLLPTKVYKQQWTPKLNSKLNSTYFGEQGTNLLLFTFPMMLIAAVGCVYLHFQK  607

Query  272  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
            K       S      LAF   P++V + LGI+S +E++  ++FI+ L W+    +   F 
Sbjct  608  KNGNSFSRSISASHRLAFWKKPVLVMAPLGIVSAMELVFAAMFIMLLIWSLANYLYVSFG  667

Query  452  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
                 K  +  VW+ +   V+ R G +   C A L  PV R  ++  L+GL  E S++YH
Sbjct  668  HLHMHKQGE-KVWEAKFRSVSLRLGYIGNLCWAFLFFPVTRGSSILPLVGLTSESSIKYH  726

Query  632  TWLGTAMIVFATLHGAGTFFIW  697
             WLG   +V    H  G    W
Sbjct  727  IWLGHLSMVLFAAHSIGFVIYW  748



>ref|XP_007143461.1| hypothetical protein PHAVU_007G073800g [Phaseolus vulgaris]
 gb|ESW15455.1| hypothetical protein PHAVU_007G073800g [Phaseolus vulgaris]
Length=717

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 68/208 (33%), Positives = 108/208 (52%), Gaps = 12/208 (6%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G+V +WIL+PT  +   W    E K  +  FG  G    +YTFP++  A +  VYL  ++
Sbjct  33   GYVMVWILRPTNFFYLQWFPHIEAKTDSIYFGKQGTIILIYTFPILLIATLTSVYLHLEQ  92

Query  275  QKQKEGISRQERRCLAFLS--NPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            ++       +  R L   S   PL+ K  LGI++  E+    +F++ L WTF++ + + F
Sbjct  93   KRSNHNTESKGGRFLGLASWKRPLLTKGPLGIITMTELSFAIMFVLLLIWTFFSYLHSLF  152

Query  449  ----RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  616
                +   + +D    VW+ ++   +   GL+   CL LL  PV R  ++ R +GL  E 
Sbjct  153  ASAAKDAAKERD---QVWEIKLEYSSLALGLVGNICLVLLFFPVSRGSSILRFIGLTSEG  209

Query  617  SVRYHTWLG-TAMIVFATLHGAGTFFIW  697
            S++YH WLG TAM++F T HG G    W
Sbjct  210  SIKYHIWLGHTAMLLF-TAHGLGYIIFW  236



>ref|XP_002892053.1| hypothetical protein ARALYDRAFT_470119 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68312.1| hypothetical protein ARALYDRAFT_470119 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 106/207 (51%), Gaps = 9/207 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAE--EKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + LWI+ PT  +   W      +  +++ FG  G    +Y FP++  A +G VYL  K
Sbjct  38   GTIMLWIMMPTLTYRTKWLPHMRIKFGTSTYFGATGTTLFMYMFPMMVVACLGCVYLHFK  97

Query  272  KQKQKEGISRQERRCL-AFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
             +K  + I R+ +  + + L  P++VK  LGI+S  EI  +++F+  L W F T + N F
Sbjct  98   NRKSSDHIDRETKGGVWSKLRKPMLVKGPLGIVSVTEITFLAMFVALLLWCFITYLRNSF  157

Query  449  ----RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  616
                 K+    D  L  WQ ++   A R GL+   CLA L LPV R  ++   +GL  E 
Sbjct  158  ATITPKSAAAHDESL--WQAKLESAALRLGLIGNICLAFLFLPVARGSSLLPAMGLTSES  215

Query  617  SVRYHTWLGTAMIVFATLHGAGTFFIW  697
            S++YH WLG  ++   T+HG      W
Sbjct  216  SIKYHIWLGHMVMALFTVHGLCYIIYW  242



>ref|XP_003622505.1| Ferric-chelate reductase [Medicago truncatula]
 gb|KEH18829.1| oxidoreductase/ferric-chelate reductase [Medicago truncatula]
Length=716

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 102/201 (51%), Gaps = 5/201 (2%)
 Frame = +2

Query  110  LWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVG--FVYLEQKKQK  280
            ++I+ PT  +  TW    + K +++ FG  G    +YTFPV+  A +G  F+++ +K  +
Sbjct  36   IFIMMPTYTFKHTWNPQFQAKTNSTYFGAQGTRILIYTFPVLLIATLGCVFLHIAKKSNE  95

Query  281  QKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKTV  460
                I   ++      + P++VK  LGI+S  EI  + +FI  L W+F   + NDF   +
Sbjct  96   SNMEIGNGKKHGTTIWNRPMLVKGPLGIVSITEIAFLLMFIALLIWSFSIYLHNDFATII  155

Query  461  QTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  634
               + +    VWQ ++  VA R GL+   CLALL  PV R   V  + GL  E  ++YH 
Sbjct  156  SKSEAENGEKVWQEKIESVALRLGLVGNICLALLFFPVTRGSTVLPIFGLTSEGCIKYHI  215

Query  635  WLGTAMIVFATLHGAGTFFIW  697
            WLG  ++   T HG      W
Sbjct  216  WLGHVLMTLFTTHGVCYIIYW  236



>ref|XP_010424035.1| PREDICTED: ferric reduction oxidase 2-like [Camelina sativa]
Length=585

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 107/201 (53%), Gaps = 8/201 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA---EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            G++ +WI+ PT V+   W       E  +++ FG  GL F ++ FP++  A +G +YL  
Sbjct  36   GFIFIWIVMPTMVYRTEWLNPVMRTEFGTSTFFGAIGLTFFMFMFPMVLLACLGCLYLHL  95

Query  269  KKQKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  439
            KK K    + R+   E   LA +  P++VK  L I+S  E++  ++F+  L W F+  + 
Sbjct  96   KKPKTTNPLVREKITEGGVLAAMRRPMLVKGPLRIVSATELILFAMFVALLLWEFFMYMR  155

Query  440  NDFRKTVQTKDFKL--AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFE  613
            N F         K    +WQ ++  +A R GL+   CLA L +PV+R  ++  ++GL  E
Sbjct  156  NAFPTITPQSAAKHHQKLWQAKLEAMAIRIGLVGNCCLAFLFIPVVRGSSLLPVIGLTSE  215

Query  614  VSVRYHTWLGTAMIVFATLHG  676
             S++YH WLG  ++   T HG
Sbjct  216  SSIKYHIWLGHMLMTLFTAHG  236



>ref|XP_002272804.1| PREDICTED: ferric reduction oxidase 2 [Vitis vinifera]
Length=714

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 98/203 (48%), Gaps = 5/203 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQV-WTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G++ +WI+ PT   W         K  +  FG  G    VYTFPV+  A +G +YL   K
Sbjct  32   GYIMVWIMMPTNTFWLHWLPDIHAKTDSKYFGQQGANLLVYTFPVLLIATLGCLYLHLGK  91

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
            +     I    R   A    P++VK +LGI+S IE+  +S+F + L W+    +   F  
Sbjct  92   KCVDHDIDENSR--WALWKRPVLVKGTLGIVSWIELSFLSMFFVLLVWSVSAYLHGMFAN  149

Query  455  TVQTKDFKLAV--WQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
              +    K+ V  W+ ++   A   GL+   CLA L  PV R  +V RL+GL  E S++Y
Sbjct  150  ITRQSAAKMGVQVWEAKLESAALMLGLVGNICLAFLFFPVTRGSSVLRLIGLTSESSIKY  209

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLG  ++   T HG      W
Sbjct  210  HIWLGHTVMTLFTAHGLCYIIFW  232



>emb|CBI22669.3| unnamed protein product [Vitis vinifera]
Length=727

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 98/203 (48%), Gaps = 5/203 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQV-WTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G++ +WI+ PT   W         K  +  FG  G    VYTFPV+  A +G +YL   K
Sbjct  45   GYIMVWIMMPTNTFWLHWLPDIHAKTDSKYFGQQGANLLVYTFPVLLIATLGCLYLHLGK  104

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
            +     I    R   A    P++VK +LGI+S IE+  +S+F + L W+    +   F  
Sbjct  105  KCVDHDIDENSR--WALWKRPVLVKGTLGIVSWIELSFLSMFFVLLVWSVSAYLHGMFAN  162

Query  455  TVQTKDFKLAV--WQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
              +    K+ V  W+ ++   A   GL+   CLA L  PV R  +V RL+GL  E S++Y
Sbjct  163  ITRQSAAKMGVQVWEAKLESAALMLGLVGNICLAFLFFPVTRGSSVLRLIGLTSESSIKY  222

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLG  ++   T HG      W
Sbjct  223  HIWLGHTVMTLFTAHGLCYIIFW  245



>emb|CAN76960.1| hypothetical protein VITISV_029500 [Vitis vinifera]
Length=730

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 98/203 (48%), Gaps = 5/203 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQV-WTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G++ +WI+ PT   W         K  +  FG  G    VYTFPV+  A +G +YL   K
Sbjct  32   GYIMVWIMMPTNTFWLHWLPDIHAKTDSKYFGQQGANLLVYTFPVLLIATLGCLYLHLGK  91

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
            +     I    R   A    P++VK +LGI+S IE+  +S+F + L W+    +   F  
Sbjct  92   KCVDHDIDENSR--WALWKRPVLVKGTLGIVSWIELSFLSMFFVLLVWSVSAYLHGMFAN  149

Query  455  TVQTKDFKLAV--WQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
              +    K+ V  W+ ++   A   GL+   CLA L  PV R  +V RL+GL  E S++Y
Sbjct  150  ITRQSAAKMGVQVWEAKLESAALMLGLVGNICLAFLFFPVTRGSSVLRLIGLTSESSIKY  209

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLG  ++   T HG      W
Sbjct  210  HIWLGHTVMTLFTAHGLCYIIFW  232



>gb|EMT07839.1| Superoxide-generating NADPH oxidase heavy chain subunit C [Aegilops 
tauschii]
Length=639

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 75/222 (34%), Positives = 110/222 (50%), Gaps = 27/222 (12%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGL------------C-------FAVYT  220
            GW+ +W + PT+ ++ TW  A + A+ + FG  G             C         VY 
Sbjct  36   GWLMMWAMLPTRTYSSTW--APKLAALTGFGKQGFLLTLHGLSELHRCRFSRGIRMTVYA  93

Query  221  FPVIAFAIVGFVYLEQKKQK--QKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVS  394
            FPV+   +V  VYL  ++QK    +   R   R  A    P++V+  LGI++GIE+  + 
Sbjct  94   FPVLFVYVVACVYLHLQQQKGGDPDTQRRTSTRIAAAWRRPVLVRGPLGIVTGIELAILL  153

Query  395  LFIIFLAWTFYTRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlR  574
            +F+  L W +Y  I+ +F K       KL  WQ  + + A R G +   C ALL LPV R
Sbjct  154  MFMALLVWFYYAYITVEFSKLRVKPGEKL--WQAELEKAAKRLGSVGSLCCALLFLPVAR  211

Query  575  RMAVFRLLGLQFEVSVRYHTWLG-TAMIVFATLHGAGTFFIW  697
              ++  L+GL  E  ++YH WLG TAM +F T HG    F W
Sbjct  212  GSSLLPLVGLTSEAGIKYHVWLGNTAMAIF-TAHGLCYVFFW  252



>gb|KJB41380.1| hypothetical protein B456_007G101800 [Gossypium raimondii]
Length=699

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/205 (34%), Positives = 103/205 (50%), Gaps = 7/205 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  271
            G   +WI+ PT  + + W+ +  +K  ++ FG       ++TFPV+  A +G +YL   K
Sbjct  20   GICMMWIMAPTNTYLQKWRPSIHKKLVSTYFGTQAPSMLIWTFPVLFVASLGSLYLHLGK  79

Query  272  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYT---RISN  442
               Q    S +++   A    P++VK  LGI+SGIE+  + +FI  L W+  T   R+  
Sbjct  80   NSNQDASQSNEKKHRRALWRKPVLVKGPLGIVSGIELALLIMFIALLVWSLVTYLRRLHT  139

Query  443  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
               K    +  K  VW+ ++  VA   GL    CLA L  PV R  +V  LLGL  E S+
Sbjct  140  ITPKAAAKEGVK--VWEMKLFDVALWIGLTGNVCLAFLFYPVARGSSVLPLLGLTSEGSI  197

Query  623  RYHTWLGTAMIVFATLHGAGTFFIW  697
            +YH WLG   +V  T+HG      W
Sbjct  198  KYHIWLGHMTMVLFTIHGICYIIDW  222



>gb|AAF81316.1|AC061957_12 Identical to FRO2 protein from Arabidopsis thaliana gb|Y09581 
and contains a ferric reductase like transmembrane component 
PF|01794 [Arabidopsis thaliana]
Length=703

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 105/207 (51%), Gaps = 9/207 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAE--EKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + LWI+ PT  +   W      +  +++ FG  G    +Y FP++  A +G VYL  K
Sbjct  37   GTIMLWIMMPTLTYRTKWLPHLRIKFGTSTYFGATGTTLFMYMFPMMVVACLGCVYLHFK  96

Query  272  KQKQKEGISRQERRCL-AFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
             +K    I R+ +  + + L  P++VK  LGI+S  EI  +++F+  L W F T + N F
Sbjct  97   NRKSPHHIDRETKGGVWSKLRKPMLVKGPLGIVSVTEITFLAMFVALLLWCFITYLRNSF  156

Query  449  ----RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  616
                 K+    D  L  WQ ++   A R GL+   CLA L LPV R  ++   +GL  E 
Sbjct  157  ATITPKSAAAHDESL--WQAKLESAALRLGLIGNICLAFLFLPVARGSSLLPAMGLTSES  214

Query  617  SVRYHTWLGTAMIVFATLHGAGTFFIW  697
            S++YH WLG  ++   T+HG      W
Sbjct  215  SIKYHIWLGHMVMALFTVHGLCYIIYW  241



>gb|KJB41381.1| hypothetical protein B456_007G101800 [Gossypium raimondii]
Length=727

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/205 (34%), Positives = 103/205 (50%), Gaps = 7/205 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  271
            G   +WI+ PT  + + W+ +  +K  ++ FG       ++TFPV+  A +G +YL   K
Sbjct  20   GICMMWIMAPTNTYLQKWRPSIHKKLVSTYFGTQAPSMLIWTFPVLFVASLGSLYLHLGK  79

Query  272  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYT---RISN  442
               Q    S +++   A    P++VK  LGI+SGIE+  + +FI  L W+  T   R+  
Sbjct  80   NSNQDASQSNEKKHRRALWRKPVLVKGPLGIVSGIELALLIMFIALLVWSLVTYLRRLHT  139

Query  443  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
               K    +  K  VW+ ++  VA   GL    CLA L  PV R  +V  LLGL  E S+
Sbjct  140  ITPKAAAKEGVK--VWEMKLFDVALWIGLTGNVCLAFLFYPVARGSSVLPLLGLTSEGSI  197

Query  623  RYHTWLGTAMIVFATLHGAGTFFIW  697
            +YH WLG   +V  T+HG      W
Sbjct  198  KYHIWLGHMTMVLFTIHGICYIIDW  222



>ref|XP_010460078.1| PREDICTED: ferric reduction oxidase 3, mitochondrial [Camelina 
sativa]
Length=722

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 106/203 (52%), Gaps = 13/203 (6%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASV-FGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + +WI+ PT  + + W K+   K   S+ FG  G+   VY FP+I  A +G +YL  K
Sbjct  54   GSMVIWIMMPTSTYKKIWLKSMRAKLGESIYFGRPGVNLLVYMFPMILLAFLGSIYLHLK  113

Query  272  KQ----KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWT----FY  427
            KQ    +   G+ R++R     L  P++VK  LGI++  E++ +++F+  L W+    FY
Sbjct  114  KQTTVNQLNSGVERKKRNKFGALKKPMLVKG-LGIVTVTEVMFLTMFLALLLWSLANYFY  172

Query  428  TRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQ  607
               +    +++ T    L  WQ R+  +A R GL    CL  L  PV R  ++   +GL 
Sbjct  173  FTFATITPQSIPTDGDNL--WQARLNAIAVRLGLTGNICLGFLFYPVARGSSLLAAVGLT  230

Query  608  FEVSVRYHTWLGTAMIVFATLHG  676
             E S++YH WLG  ++   T HG
Sbjct  231  SESSIKYHIWLGNLVMTLLTSHG  253



>emb|CAN74771.1| hypothetical protein VITISV_024874 [Vitis vinifera]
Length=730

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 99/203 (49%), Gaps = 5/203 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQV-WTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G++ +WI+ PT   W         K  +  FG  G    VYTFPV+  A +G +YL   K
Sbjct  32   GYIMVWIIMPTNTFWLHWLPDIHAKTDSKYFGQQGANLLVYTFPVLLIATLGCLYLHLGK  91

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
            +     I+   R   A    P++VK +LGI+S IE+  +S+F + L W+    +   F  
Sbjct  92   KCVDHDIAENSR--WALWKRPVLVKGTLGIVSWIELSFLSMFFVLLVWSVSAYLHGMFAN  149

Query  455  TVQTKDFKLAV--WQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
              +    K+ V  W+ ++   A   GL+   CLA L  PV R  +V RL+GL  E S++Y
Sbjct  150  ITRQSAAKMGVQVWEAKLESAALMLGLVGNICLAFLFFPVTRGSSVLRLIGLTSESSIKY  209

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLG  ++   T HG      W
Sbjct  210  HIWLGHIVMTLFTAHGLCYIIFW  232



>ref|NP_171664.1| ferric reduction oxidase 2 [Arabidopsis thaliana]
 sp|P92949.2|FRO2_ARATH RecName: Full=Ferric reduction oxidase 2; Short=AtFRO2; AltName: 
Full=Ferric-chelate reductase 2; AltName: Full=Protein FERRIC 
CHELATE REDUCTASE DEFECTIVE 1 [Arabidopsis thaliana]
 emb|CAA70770.1| FRO2 [Arabidopsis thaliana]
 gb|AAP51420.1| ferric-chelate reductase [Arabidopsis thaliana]
 gb|AEE27308.1| ferric reduction oxidase 2 [Arabidopsis thaliana]
Length=725

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 104/207 (50%), Gaps = 9/207 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEK--ASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + LWI+ PT  +   W         +++ FG  G    +Y FP++  A +G VYL  K
Sbjct  37   GTIMLWIMMPTLTYRTKWLPHLRIKFGTSTYFGATGTTLFMYMFPMMVVACLGCVYLHFK  96

Query  272  KQKQKEGISRQERRCL-AFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
             +K    I R+ +  + + L  P++VK  LGI+S  EI  +++F+  L W F T + N F
Sbjct  97   NRKSPHHIDRETKGGVWSKLRKPMLVKGPLGIVSVTEITFLAMFVALLLWCFITYLRNSF  156

Query  449  ----RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  616
                 K+    D  L  WQ ++   A R GL+   CLA L LPV R  ++   +GL  E 
Sbjct  157  ATITPKSAAAHDESL--WQAKLESAALRLGLIGNICLAFLFLPVARGSSLLPAMGLTSES  214

Query  617  SVRYHTWLGTAMIVFATLHGAGTFFIW  697
            S++YH WLG  ++   T+HG      W
Sbjct  215  SIKYHIWLGHMVMALFTVHGLCYIIYW  241



>ref|XP_006490654.1| PREDICTED: ferric reduction oxidase 4-like [Citrus sinensis]
 gb|KDO56763.1| hypothetical protein CISIN_1g005360mg [Citrus sinensis]
Length=700

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 100/202 (50%), Gaps = 3/202 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+ +W L PT+V+  TW      K +++ F   G    +++FPV+  A++G VYL  +K
Sbjct  18   GWLLVWALIPTKVYKNTWTPKLNNKLNSTYFREQGTNLLLFSFPVMLIALLGCVYLHLQK  77

Query  275  QKQKEGISRQERRCLAFLSN-PLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
            +  K    R+ R    F S  P++V + LGI++ IE+    +F+ FL W+    +   F 
Sbjct  78   KPNKLQSKRKMRSPRLFFSQRPVLVMAPLGIVTAIELTIAVMFVAFLIWSLANYLYVSFG  137

Query  452  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
                 K  +  VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++YH
Sbjct  138  HLHMHKAGE-KVWQAKFRSVSLRLGYIGNTCWAFLFFPVTRGSSILPLVGLTSESSIKYH  196

Query  632  TWLGTAMIVFATLHGAGTFFIW  697
             WLG        LH  G    W
Sbjct  197  IWLGHLSNALFALHAVGFLIYW  218



>gb|KDO86264.1| hypothetical protein CISIN_1g005553mg [Citrus sinensis]
Length=691

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 100/206 (49%), Gaps = 6/206 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + LW+L PT  + + W      +    + FG  G    +YTFP++  A+ G +YL   
Sbjct  6    GTLMLWVLMPTNTYRQNWLPHLRAKFGFTTYFGAQGTTLLIYTFPILFIAVTGCLYLHLG  65

Query  272  KQKQKEGISRQ--ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
             +     +  +  ++  L     P++VK  LGI+SGIE+    + I  L W+    + N 
Sbjct  66   NKLNDNNVLERNGKKHRLGIWKKPMLVKGPLGIVSGIELAFFMMLIALLIWSLSNYLHNS  125

Query  446  FRK-TVQTK-DFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
            F   T Q+  +  + VWQ ++   A RFGL+   CL LL  PV R  +V  L GL  E S
Sbjct  126  FADITPQSAAEEGVKVWQGKLESTALRFGLVGNICLTLLFFPVARGSSVLPLFGLTSEAS  185

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG  ++   T HG      W
Sbjct  186  IKYHIWLGHMVMTLFTAHGVCYIIFW  211



>ref|XP_006444982.1| hypothetical protein CICLE_v10019053mg [Citrus clementina]
 ref|XP_006491162.1| PREDICTED: ferric reduction oxidase 2-like [Citrus sinensis]
 gb|ESR58222.1| hypothetical protein CICLE_v10019053mg [Citrus clementina]
Length=718

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 101/207 (49%), Gaps = 8/207 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKAS---ASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  268
            G + LW+L PT  + + W     +A     + FG  G    +YTFP++  A+ G +YL  
Sbjct  33   GTLMLWVLMPTNTYRQNW-LPHLRAKFGFTTYFGAQGTTLLIYTFPILFIAVTGCLYLHL  91

Query  269  KKQKQKEGISRQ--ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
              +     +  +  ++  L     P++VK  LGI+SGIE+    + I  L W+    + N
Sbjct  92   GNKLNDNNVLERNGKKHRLGIWKKPMLVKGPLGIVSGIELAFFMMLIALLIWSLSNYLHN  151

Query  443  DFRK-TVQTK-DFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  616
             F   T Q+  +  + VWQ ++   A RFGL+   CL LL  PV R  +V  L GL  E 
Sbjct  152  SFADITPQSAAEEGVKVWQGKLESTALRFGLVGNICLTLLFFPVARGSSVLPLFGLTSEA  211

Query  617  SVRYHTWLGTAMIVFATLHGAGTFFIW  697
            S++YH WLG  ++   T HG      W
Sbjct  212  SIKYHIWLGHMVMTLFTAHGVCYIIFW  238



>ref|XP_010661833.1| PREDICTED: ferric reduction oxidase 2 isoform X2 [Vitis vinifera]
Length=714

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 99/205 (48%), Gaps = 8/205 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  271
            G + LW++ PT  +   W      K  ++ FG  G    +YTFPV+  A++G VYL   K
Sbjct  33   GCLVLWVMMPTNTYRGKWLLQLRAKTDSTYFGQQGTTMLIYTFPVLFAAVLGCVYLHLGK  92

Query  272  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
            K    + IS +E R L     P +VK  LGI+S  E+L   +FI  L W+F+  + N F+
Sbjct  93   KLNDNKSISPKEDR-LTVWKKPALVKGPLGIVSMTELLFFVMFIALLVWSFWEYLHNGFQ  151

Query  452  ---KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
                T   K  KL  W  ++   A R GL     LA L  PV R  ++  L GL  E S+
Sbjct  152  GIEATAAKKGEKL--WVSKLGAAALRLGLTGNIVLAFLFFPVARGSSILPLFGLTSEGSI  209

Query  623  RYHTWLGTAMIVFATLHGAGTFFIW  697
            +YH WLG   +   T HG      W
Sbjct  210  KYHIWLGHICLALFTSHGVCYIIRW  234



>ref|XP_010474762.1| PREDICTED: ferric reduction oxidase 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010474763.1| PREDICTED: ferric reduction oxidase 2-like isoform X2 [Camelina 
sativa]
Length=724

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 67/206 (33%), Positives = 108/206 (52%), Gaps = 7/206 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEK--ASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + LWI+ PT  +   W+        +++ FG +G    +Y FP++  A +G VYL  K
Sbjct  37   GIILLWIMMPTLTYRNKWQPLMRIKFGTSTYFGSSGTTLFMYMFPMMVVACLGCVYLHFK  96

Query  272  KQKQKEGISRQERR-CLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
             +++   I R+ +   L+ L  P++VK  LGI+S  EI  +++F+  L W+F   + N F
Sbjct  97   TKRKSYHIDRETKGGVLSALRKPMLVKGPLGIVSVTEITFLAMFVALLLWSFIIYLRNSF  156

Query  449  RKTVQTKDFKL---AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
              T+  +       ++WQ ++   A R GL+   CLA L LPV R  ++   +GL  E S
Sbjct  157  -ATITPQSLAAHGESLWQAKLESAALRLGLVGNICLAFLFLPVARGSSLLPAVGLTSESS  215

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG  ++   TLHG      W
Sbjct  216  IKYHIWLGHMVMFLFTLHGLCYIIYW  241



>gb|AAB72168.1| unknown [Arabidopsis thaliana]
Length=693

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 104/202 (51%), Gaps = 11/202 (5%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASV-FGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G V +WI+ PT  + + W K+   K   S+ FG  G+   VY FP+I  A +G +YL  K
Sbjct  25   GTVVIWIMMPTSTYKKIWLKSMRAKLGKSIYFGKPGVNLLVYMFPMILLASLGSIYLHLK  84

Query  272  KQKQKEGISRQERRCL---AFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWT----FYT  430
            KQ +    +R +R+ +     L  P++VK+ LGI++  E++ + +F+  L W+    FY 
Sbjct  85   KQTRVNQFNRMDRKKIDKFGALKRPMLVKAGLGIVTVTEVMFLMMFMALLLWSLANYFYH  144

Query  431  RISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQF  610
                   +++ T    L  WQ R+  +A R GL    CL  L  PV R  ++   +GL  
Sbjct  145  TFVTITPQSLPTDGDNL--WQARLDSIAVRLGLTGNICLGFLFYPVARGSSLLAAVGLTS  202

Query  611  EVSVRYHTWLGTAMIVFATLHG  676
            E S +YH WLG  ++   T HG
Sbjct  203  ESSTKYHIWLGNLVMTLFTSHG  224



>ref|XP_009411425.1| PREDICTED: ferric reduction oxidase 2-like [Musa acuminata subsp. 
malaccensis]
Length=699

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 100/206 (49%), Gaps = 8/206 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAE-EKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+ +WI++PT+ +   W      +  ++ FG  G    +YTFP++  +++G +YL   K
Sbjct  16   GWLMIWIVRPTKTYQNQWSPQLLSETDSTYFGRQGTNILIYTFPILFISVLGCIYLHLVK  75

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYT-----RIS  439
            +      S      LA    P++V   LGI+SGIE+    LF++ L W FYT       S
Sbjct  76   RTDNSQ-SGSSTHSLAAWKRPVVVNWPLGIVSGIELTFCVLFLVLLIW-FYTMYLVVNFS  133

Query  440  NDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
            N  +   Q     L +WQ R+     R  LL + C A L  PV+R  ++  L+GL  E S
Sbjct  134  NSHQSHSQDTGEMLKLWQTRLDGAGIRLALLGDLCCAFLFFPVIRGSSLLPLVGLTSESS  193

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            +RYH WLG   +   + H       W
Sbjct  194  IRYHVWLGHITLAVFSAHSVCYIVYW  219



>gb|KHN21778.1| Ferric reduction oxidase 4 [Glycine soja]
Length=702

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/204 (31%), Positives = 102/204 (50%), Gaps = 5/204 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+++WIL PT+V+  TW    + K +++ F   G    ++TFPV+    +  +YL   +
Sbjct  17   GWLTVWILLPTKVYKNTWTPKLKTKLNSTYFREQGTNLLLFTFPVMLIGALSCIYLHLHE  76

Query  275  QKQKEGISRQE---RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            +  ++  S+      R L FL  P +V S +GI++ +EI+   +F+  L W+    +   
Sbjct  77   KGTEKLPSKSGGVVNRWLCFLRRPFLVMSPIGIVTSMEIIFALMFVALLIWSLSNYLHTS  136

Query  446  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
            F      K+ +  VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++
Sbjct  137  FGHLHMHKEGE-KVWQAKFRSVSLRLGYIGNICWAFLFFPVTRGSSILPLVGLTSESSIK  195

Query  626  YHTWLGTAMIVFATLHGAGTFFIW  697
            YH WLG    V    H  G F  W
Sbjct  196  YHIWLGHLSNVLFAAHTVGFFIYW  219



>ref|NP_173715.2| ferric reduction oxidase 3 [Arabidopsis thaliana]
 gb|AEE30322.1| ferric reduction oxidase 3 [Arabidopsis thaliana]
Length=716

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 104/202 (51%), Gaps = 11/202 (5%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASV-FGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G V +WI+ PT  + + W K+   K   S+ FG  G+   VY FP+I  A +G +YL  K
Sbjct  48   GTVVIWIMMPTSTYKKIWLKSMRAKLGKSIYFGKPGVNLLVYMFPMILLASLGSIYLHLK  107

Query  272  KQKQKEGISRQERRCL---AFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWT----FYT  430
            KQ +    +R +R+ +     L  P++VK+ LGI++  E++ + +F+  L W+    FY 
Sbjct  108  KQTRVNQFNRMDRKKIDKFGALKRPMLVKAGLGIVTVTEVMFLMMFMALLLWSLANYFYH  167

Query  431  RISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQF  610
                   +++ T    L  WQ R+  +A R GL    CL  L  PV R  ++   +GL  
Sbjct  168  TFVTITPQSLPTDGDNL--WQARLDSIAVRLGLTGNICLGFLFYPVARGSSLLAAVGLTS  225

Query  611  EVSVRYHTWLGTAMIVFATLHG  676
            E S +YH WLG  ++   T HG
Sbjct  226  ESSTKYHIWLGNLVMTLFTSHG  247



>gb|ABJ16556.1| Fe(III)-chelate reductase [Citrus junos]
Length=700

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 99/202 (49%), Gaps = 3/202 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+ +W L PT+V+  TW      K +++ F   G    +++FPV+  A++G VYL  +K
Sbjct  18   GWLLVWALIPTKVYKNTWTPKLNNKLNSTYFREQGTNLLLFSFPVMLIALLGCVYLHLQK  77

Query  275  QKQKEGISRQERRCLAFLSN-PLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
            +  K    R+ R    F S  P++V + LGI++ IE+    +F+ FL W     +   F 
Sbjct  78   KPNKLQSKRKMRSPRLFFSQRPVLVMAPLGIVTAIELTIAVMFVAFLIWALANYLYVSFG  137

Query  452  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
                 K  +  VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++YH
Sbjct  138  HLHMHKAGE-KVWQAKFRSVSLRLGYIGNTCWAFLFFPVTRGSSILPLVGLTSESSIKYH  196

Query  632  TWLGTAMIVFATLHGAGTFFIW  697
             WLG        LH  G    W
Sbjct  197  IWLGHLSNALFALHAVGFLIYW  218



>emb|CDY38014.1| BnaCnng08750D [Brassica napus]
Length=705

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 63/212 (30%), Positives = 105/212 (50%), Gaps = 12/212 (6%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + +WI+ PT  + + W  +   +    + FG  G+   VY FP+I  A +G +YL  K
Sbjct  26   GTMVIWIMMPTSTYKKIWLTSMRAKLGKTTTFGKPGVNLLVYMFPMILLAFLGCIYLHLK  85

Query  272  KQKQKEG----ISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWT-----F  424
            K+   +     + R++R     L  PL+VK  LGI++  E++ +++F+  L W+     +
Sbjct  86   KKTSVDQFHSVLERKKRDKFGALRKPLLVKGPLGIVTVTEVMFLTMFMTLLLWSLTNYFY  145

Query  425  YTRIS-NDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLG  601
            YT ++       V     KL  W+ R+  ++ R G+    CLA L  PV R  ++   +G
Sbjct  146  YTFVTITPQSAAVHGDKIKLKRWEARLDSISVRLGVAGNICLAFLFYPVARGSSLLAAVG  205

Query  602  LQFEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            L  E S++YH WLG  ++   T HG      W
Sbjct  206  LTSESSIKYHIWLGHLVMTLVTSHGVCYVIYW  237



>emb|CBI40432.3| unnamed protein product [Vitis vinifera]
Length=693

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 97/205 (47%), Gaps = 7/205 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  271
            G + LW++ PT  +   W      K  ++ FG  G    +YTFPV+  A++G VYL   K
Sbjct  11   GCLVLWVMMPTNTYRGKWLLQLRAKTDSTYFGQQGTTMLIYTFPVLFAAVLGCVYLHLGK  70

Query  272  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
            K    + IS  +   L     P +VK  LGI+S  E+L   +FI  L W+F+  + N F+
Sbjct  71   KLNDNKSISSPKEDRLTVWKKPALVKGPLGIVSMTELLFFVMFIALLVWSFWEYLHNGFQ  130

Query  452  ---KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
                T   K  KL  W  ++   A R GL     LA L  PV R  ++  L GL  E S+
Sbjct  131  GIEATAAKKGEKL--WVSKLGAAALRLGLTGNIVLAFLFFPVARGSSILPLFGLTSEGSI  188

Query  623  RYHTWLGTAMIVFATLHGAGTFFIW  697
            +YH WLG   +   T HG      W
Sbjct  189  KYHIWLGHICLALFTSHGVCYIIRW  213



>ref|XP_010498794.1| PREDICTED: ferric reduction oxidase 3, mitochondrial-like [Camelina 
sativa]
Length=721

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 106/210 (50%), Gaps = 13/210 (6%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASV-FGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + +WI+ PT  + + W K+   K   S+ FG  G    VY FP+I  A +G +YL  K
Sbjct  54   GTMVIWIMMPTSTYKKIWLKSMRAKLGESIYFGRPGANLLVYMFPMILLAFLGSIYLHLK  113

Query  272  KQ----KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWT----FY  427
            KQ    +   G+ R++R     L  P++VK  LGI++  E++ +++F+  L W+    FY
Sbjct  114  KQTTVNQLNSGVERKKRNKFGALKKPMLVKG-LGIVTVTEVMFLTMFLALLLWSLANYFY  172

Query  428  TRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQ  607
               +    +++ T    L  WQ R+  +A R GL    CL  L  PV R  ++   +GL 
Sbjct  173  FTFATITPQSIPTGGDNL--WQARLNAIAVRLGLTGNICLGFLFYPVARGSSLLAAVGLT  230

Query  608  FEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
             E S++YH WLG  ++   T HG      W
Sbjct  231  SESSIKYHIWLGNLVMTLLTSHGLCYCLYW  260



>ref|XP_002275993.1| PREDICTED: ferric reduction oxidase 2 isoform X1 [Vitis vinifera]
Length=715

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 97/205 (47%), Gaps = 7/205 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  271
            G + LW++ PT  +   W      K  ++ FG  G    +YTFPV+  A++G VYL   K
Sbjct  33   GCLVLWVMMPTNTYRGKWLLQLRAKTDSTYFGQQGTTMLIYTFPVLFAAVLGCVYLHLGK  92

Query  272  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
            K    + IS  +   L     P +VK  LGI+S  E+L   +FI  L W+F+  + N F+
Sbjct  93   KLNDNKSISSPKEDRLTVWKKPALVKGPLGIVSMTELLFFVMFIALLVWSFWEYLHNGFQ  152

Query  452  ---KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
                T   K  KL  W  ++   A R GL     LA L  PV R  ++  L GL  E S+
Sbjct  153  GIEATAAKKGEKL--WVSKLGAAALRLGLTGNIVLAFLFFPVARGSSILPLFGLTSEGSI  210

Query  623  RYHTWLGTAMIVFATLHGAGTFFIW  697
            +YH WLG   +   T HG      W
Sbjct  211  KYHIWLGHICLALFTSHGVCYIIRW  235



>ref|XP_010480116.1| PREDICTED: ferric reduction oxidase 2-like [Camelina sativa]
Length=723

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 70/206 (34%), Positives = 109/206 (53%), Gaps = 8/206 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEK--ASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + LWI+ PT  +   W         +++ FG +G    +Y FP++A A +G VYL  K
Sbjct  37   GIILLWIMMPTLTYRTKWLPLMRIKFGTSTYFGSSGTTLFMYMFPMMAVACLGCVYLHFK  96

Query  272  KQKQKEGISRQERRCL-AFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            K+K    I R+ +  + + L  P++VK  LGI+S  EI  +++F+  L W+F   + N F
Sbjct  97   KRKSCH-IDRERKGGVWSALRKPMLVKGPLGIVSVTEITFLAMFVALLLWSFIIYLRNSF  155

Query  449  RKTVQTKDFKL---AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
              T+  +       ++WQ ++   A R GL+   CLA L LPV R  ++   +GL  E S
Sbjct  156  -ATITPQSLAAHGESLWQAKLESAALRLGLIGNICLAFLFLPVARGSSLLPAVGLTSESS  214

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG  ++V  TLHG      W
Sbjct  215  IKYHIWLGHMVMVLFTLHGLCYIIYW  240



>gb|EYU32157.1| hypothetical protein MIMGU_mgv1a019436mg [Erythranthe guttata]
Length=728

 Score = 92.8 bits (229),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 70/213 (33%), Positives = 103/213 (48%), Gaps = 13/213 (6%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVF--GYNGLCFAVYTFPVIAFAIVGFVYL  262
            V TG++ LW++ PT  +   W+      +AS +    +G  + V+TFPV+  A++G  Y+
Sbjct  34   VFTGYLFLWVMLPTNPYRLKWQPKLRTQTASTYFGTTHGATYLVFTFPVLLIAVLGCAYV  93

Query  263  EQKKQ----KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYT  430
               K+       EG +      LA    P+I+K  LGI+S IEI    +FI  L W+F T
Sbjct  94   HLGKKSSDDDHTEGKNGNNNHRLAIWKRPMIIKG-LGIVSRIEIAFFLMFIALLIWSFAT  152

Query  431  RISNDF----RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLL  598
             + N F     K+   K  K  VW+ ++   + R   +     A L  PV R  +V  L 
Sbjct  153  YLHNSFATITPKSAAKKGEK--VWEVKLDSASHRLAFIGNIAFAFLFFPVTRGSSVLPLF  210

Query  599  GLQFEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            GL  E SV+YH WLG  ++   T HG G    W
Sbjct  211  GLTSEGSVKYHIWLGHIIMTLFTAHGIGYVVYW  243



>ref|XP_008233004.1| PREDICTED: ferric reduction oxidase 2 isoform X1 [Prunus mume]
Length=702

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 64/207 (31%), Positives = 103/207 (50%), Gaps = 7/207 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + +W + PT  +++ W+    ++  S++  G  G    ++TFP++  A++G V+L   
Sbjct  16   GSLFVWFMMPTNTYSQIWRLQIRQKTNSSTYLGSEGSNIVMFTFPILFLALLGCVFLHLG  75

Query  272  KQKQK---EGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
            K+      E  S   +   A    P++VK  LGI+SGIE+    +FI  L W+F T + N
Sbjct  76   KKLNDYKVESSSNGTKNRFAVWKKPMLVKGPLGIVSGIELAFFIMFIALLIWSFSTYLHN  135

Query  443  DFRKTVQTKDFK--LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  616
             F         K    +W+ ++   A R GL+   CLA L  PV R  ++  L GL  E 
Sbjct  136  SFANITPKSAAKNHEKIWESKLDSAALRLGLVGNICLAFLFFPVARGSSILALFGLTSEG  195

Query  617  SVRYHTWLGTAMIVFATLHGAGTFFIW  697
            S++YH WLG  +++  T HG      W
Sbjct  196  SIKYHIWLGHLVMLLFTAHGVCYVIYW  222



>gb|AAU94355.1| iron reductase [Pisum sativum]
Length=712

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 102/203 (50%), Gaps = 5/203 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G + ++I+ P   + + W    + K +++ FG  G    +YTFP++  A +G VY+    
Sbjct  32   GLLFIFIMMPITTFKQNWIPKIQAKTNSTYFGVQGFRILIYTFPLLLIATLGCVYIHIAT  91

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
            +  +  I   ++        P++VK  LGI+S  EI  + +FI  L WT  T + NDF  
Sbjct  92   KSNQ--IDNGKKHETTIWKRPMLVKGPLGIVSITEIAFLLMFIALLVWTLATYLHNDFLS  149

Query  455  --TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
              ++  ++    VWQ ++  V  R GL+   CL LL  PV R  +V  + GL  E S++Y
Sbjct  150  IASLPKEEHGPKVWQEKLESVGLRLGLVGNICLVLLFFPVTRGTSVLPMFGLTSEGSIKY  209

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H W+G  ++   TLHG      W
Sbjct  210  HIWVGHVLMTIFTLHGVFYIIYW  232



>gb|KEH31790.1| oxidoreductase/ferric-chelate reductase [Medicago truncatula]
Length=576

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  458  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  637
            +Q K  KL +WQ + LR+ATRFGLL EACLALLLLP+LR +A+FR+ G+QFE SV+YHTW
Sbjct  1    MQDKSLKLNIWQLKSLRIATRFGLLAEACLALLLLPILRGLAIFRIFGIQFEASVKYHTW  60

Query  638  LGTAMIVFATLHGAGTFFIW  697
            +GTAMI+FAT+HGA T F+W
Sbjct  61   IGTAMILFATIHGASTLFVW  80



>ref|XP_008233005.1| PREDICTED: ferric reduction oxidase 2 isoform X2 [Prunus mume]
Length=701

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 104/206 (50%), Gaps = 6/206 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVG--FVYLE  265
            G + +W + PT  +++ W+    ++  S++  G  G    ++TFP++  A++G  F++L 
Sbjct  16   GSLFVWFMMPTNTYSQIWRLQIRQKTNSSTYLGSEGSNIVMFTFPILFLALLGCVFLHLG  75

Query  266  QKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            +K    K   S   +   A    P++VK  LGI+SGIE+    +FI  L W+F T + N 
Sbjct  76   KKLNDYKVESSNGTKNRFAVWKKPMLVKGPLGIVSGIELAFFIMFIALLIWSFSTYLHNS  135

Query  446  FRKTVQTKDFK--LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
            F         K    +W+ ++   A R GL+   CLA L  PV R  ++  L GL  E S
Sbjct  136  FANITPKSAAKNHEKIWESKLDSAALRLGLVGNICLAFLFFPVARGSSILALFGLTSEGS  195

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG  +++  T HG      W
Sbjct  196  IKYHIWLGHLVMLLFTAHGVCYVIYW  221



>ref|XP_012090199.1| PREDICTED: ferric reduction oxidase 4-like isoform X1 [Jatropha 
curcas]
Length=683

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 100/203 (49%), Gaps = 5/203 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  271
            GW+ +W++ PT+++   W      K   S F   G    +++FPV+  AI G VYL  QK
Sbjct  12   GWIMIWVMLPTKLYDNKWTPKLTSKLINSKFEVQGTNLLLFSFPVMFIAISGCVYLHLQK  71

Query  272  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
            K K          + L+FL  P++V + LGI + +EI    +FI  L W+    +   F 
Sbjct  72   KLKNSSSKRVVTSKRLSFLRRPVLVMAPLGIFTAVEIAFAVMFIALLIWSLANYLYVSFG  131

Query  452  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
                 K  +  VWQ +   V+ R G +   C A L  PV R  +V  L+GL  E S++YH
Sbjct  132  HLHMDKQGE-KVWQAKFRSVSLRLGYIGNICWAFLFFPVTRGSSVLPLVGLTSESSIKYH  190

Query  632  TWLGT-AMIVFATLHGAGTFFIW  697
             WLG  +MI+FA  H  G    W
Sbjct  191  IWLGHLSMILFAA-HTIGFIIYW  212



>ref|XP_007220622.1| hypothetical protein PRUPE_ppa002203mg [Prunus persica]
 gb|EMJ21821.1| hypothetical protein PRUPE_ppa002203mg [Prunus persica]
Length=701

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 104/206 (50%), Gaps = 6/206 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVG--FVYLE  265
            G + +W + PT  +++ W+    ++  S++  G  G    ++TFP++  A++G  F++L 
Sbjct  16   GSLFVWFMMPTNTYSQIWRLQIRQKTNSSTYLGSEGSNIVMFTFPILFLALLGCVFLHLG  75

Query  266  QKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            +K    K   S   +   A    P++VK  LGI+SGIE+    +FI  L W+F T + N 
Sbjct  76   KKLNDYKVESSNGTKNRFAVWKKPMLVKGPLGIVSGIELAFFIMFIALLIWSFSTYLHNS  135

Query  446  FRKTVQTKDFK--LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
            F         K    +W+ ++   A R GL+   CLA L  PV R  ++  L GL  E S
Sbjct  136  FANITPKSAAKNHEKIWESKLDSAALRLGLVGNICLAFLFFPVARGSSILALFGLTSEGS  195

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG  +++  T HG      W
Sbjct  196  IKYHIWLGHLVMLLFTAHGLCYVIYW  221



>gb|KDP22239.1| hypothetical protein JCGZ_26070 [Jatropha curcas]
Length=630

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 100/203 (49%), Gaps = 5/203 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  271
            GW+ +W++ PT+++   W      K   S F   G    +++FPV+  AI G VYL  QK
Sbjct  12   GWIMIWVMLPTKLYDNKWTPKLTSKLINSKFEVQGTNLLLFSFPVMFIAISGCVYLHLQK  71

Query  272  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
            K K          + L+FL  P++V + LGI + +EI    +FI  L W+    +   F 
Sbjct  72   KLKNSSSKRVVTSKRLSFLRRPVLVMAPLGIFTAVEIAFAVMFIALLIWSLANYLYVSFG  131

Query  452  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
                 K  +  VWQ +   V+ R G +   C A L  PV R  +V  L+GL  E S++YH
Sbjct  132  HLHMDKQGE-KVWQAKFRSVSLRLGYIGNICWAFLFFPVTRGSSVLPLVGLTSESSIKYH  190

Query  632  TWLGT-AMIVFATLHGAGTFFIW  697
             WLG  +MI+FA  H  G    W
Sbjct  191  IWLGHLSMILFAA-HTIGFIIYW  212



>ref|XP_002511896.1| ferric-chelate reductase, putative [Ricinus communis]
 gb|EEF50565.1| ferric-chelate reductase, putative [Ricinus communis]
Length=714

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 110/206 (53%), Gaps = 8/206 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKA-AEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G++ LWI+ PT  + R W    +EK +++  G  G    ++ FP++  A++G  Y+   K
Sbjct  30   GYLVLWIILPTNTYWRHWYGRIDEKFTSTYLGRQGQPLLLFFFPILFIAVLGCAYIHLGK  89

Query  275  QKQK---EGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            +  +   EG  R+ R  LA L  P++VK  LGI+S IE+  + +FI  L W+  T + N 
Sbjct  90   RSNQNILEGNGRKHR--LAALRKPMLVKGPLGIVSSIELAFLIMFIALLIWSLSTYLHNS  147

Query  446  FRK-TVQTKDFKLA-VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
            F   T Q    + A VW+ ++   +  FGL+   CL  L  PV+R  +V  L GL  E S
Sbjct  148  FSTITPQFAATRNARVWEAKLESASFLFGLVGNICLTFLFFPVVRGSSVLPLFGLTSEGS  207

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG  M+V  T HG G    W
Sbjct  208  IKYHIWLGHMMMVLFTAHGIGYIIYW  233



>ref|XP_006418436.1| hypothetical protein EUTSA_v10006972mg [Eutrema salsugineum]
 gb|ESQ36789.1| hypothetical protein EUTSA_v10006972mg [Eutrema salsugineum]
Length=693

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 107/212 (50%), Gaps = 15/212 (7%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASV-FGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + +WI+ PT  + + W  +   K   S+ FG  G+   VY FPVI  A +G ++L  K
Sbjct  20   GTIVIWIMMPTSTYKKIWLTSMRAKLGKSIYFGKPGVNLLVYMFPVILLAFLGCIHLHLK  79

Query  272  KQKQKE----GISRQERRC-LAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWT-----  421
            KQ   +    G+ R+++R     L  P++VK  LGI++  E++ +++F+  L W+     
Sbjct  80   KQTSVDHFHSGVERKKKRDKFGALRRPMLVKGPLGIVTVTEVMFLTMFMTLLLWSLTNYF  139

Query  422  FYTRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLG  601
            +YT ++   +      D    +WQ R+  +A R GL    CL  L  PV R  ++   +G
Sbjct  140  YYTFVTITPQSAAIHGD---NLWQARLDSIAVRLGLAGNICLGFLFYPVARGSSLLAAIG  196

Query  602  LQFEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            L  E S++YH WLG  ++   T HG      W
Sbjct  197  LTSESSIKYHIWLGHMVMTLFTSHGLCYVIYW  228



>ref|XP_006362676.1| PREDICTED: ferric reduction oxidase 4-like [Solanum tuberosum]
Length=707

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 95/198 (48%), Gaps = 3/198 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEE-KASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE--Q  268
            GW+ +W++ PT  +  +W    + K +++ F   G+   ++TFP++  A V  VYL    
Sbjct  17   GWLFIWVMLPTPTYRNSWTPQLKIKLNSTYFREQGINLLLFTFPIMLIAAVSCVYLHLYN  76

Query  269  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            K        + + R     L   ++V   LGI++ +E+    +FI+ L W+    I   F
Sbjct  77   KSTSDHSSTTNKGREYFGSLKRKVVVMEPLGIVNAVELSFAVMFIVLLIWSLANYIYISF  136

Query  449  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
               +   +    VW+ +   V+ R G L   C A L  PV R  ++  L+GL  E S++Y
Sbjct  137  NGNLHMHNPTEKVWKAKFRSVSLRLGYLGNICYAFLFFPVTRVSSILPLMGLTSESSIKY  196

Query  629  HTWLGTAMIVFATLHGAG  682
            H WLG   +  A LH AG
Sbjct  197  HIWLGHLSMALALLHSAG  214



>ref|XP_009118820.1| PREDICTED: probable ferric reduction oxidase 1 isoform X3 [Brassica 
rapa]
Length=694

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/212 (31%), Positives = 108/212 (51%), Gaps = 16/212 (8%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + +WI+ PT  + + W  +   +    + FG  G+   VY FP+I    +G +YL  K
Sbjct  25   GTIVIWIMMPTSTYRKIWLTSMRAKLGKTTNFGKPGVNLLVYMFPMILLPSLGCIYLHLK  84

Query  272  KQKQ----KEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  439
            KQ      + G+ R++R   + L  P++VK  LGI++  E++ +++F+  L W+    ++
Sbjct  85   KQTSVDQFRSGVERKKREKCSALRRPMLVKGPLGIVTVTELMFLTMFMALLLWS----LT  140

Query  440  NDFRKTVQTKDFKLA------VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLG  601
            N F  T  T   + A      +W+ R+  VA R GL    CLA L  PV R  ++   +G
Sbjct  141  NYFYFTFVTVTPQSAAIHGDKLWEARLDSVAVRLGLAGNICLAFLFYPVSRGSSLLAAVG  200

Query  602  LQFEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            L  E S++YH W+G  +++  T HG      W
Sbjct  201  LTSESSIKYHIWVGHLVMILITSHGVCYVVYW  232



>ref|XP_011043854.1| PREDICTED: ferric reduction oxidase 4-like isoform X2 [Populus 
euphratica]
Length=696

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 107/205 (52%), Gaps = 9/205 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+ +WI+ PT+++  TW      K +++ F   G    + +FP++  A +G +YL  K+
Sbjct  17   GWLVVWIMLPTKLYKNTWTPKLNSKLNSTYFSGQGTNLLLLSFPMMFIAALGCIYLHAKQ  76

Query  275  QKQ---KEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            Q++    + I    R  L+FL  P +V + LGI++ +E+  V++FI  L W+    +   
Sbjct  77   QQRISYSKSIVASNR--LSFLRRPALVMAPLGIVTAMELAFVAMFIALLIWSLGNYLYVS  134

Query  446  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
            F   +     +  VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++
Sbjct  135  FGH-LHIHKLREKVWQAKFRSVSLRLGYVGNICWAFLFFPVTRGSSILPLVGLTSESSIK  193

Query  626  YHTWLGT-AMIVFATLHGAGTFFIW  697
            YH WLG  +MI+FA  H  G    W
Sbjct  194  YHIWLGHLSMILFAA-HTVGFVIYW  217



>ref|XP_011043852.1| PREDICTED: ferric reduction oxidase 4-like isoform X1 [Populus 
euphratica]
 ref|XP_011043853.1| PREDICTED: ferric reduction oxidase 4-like isoform X1 [Populus 
euphratica]
Length=703

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 107/205 (52%), Gaps = 9/205 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+ +WI+ PT+++  TW      K +++ F   G    + +FP++  A +G +YL  K+
Sbjct  17   GWLVVWIMLPTKLYKNTWTPKLNSKLNSTYFSGQGTNLLLLSFPMMFIAALGCIYLHAKQ  76

Query  275  QKQ---KEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            Q++    + I    R  L+FL  P +V + LGI++ +E+  V++FI  L W+    +   
Sbjct  77   QQRISYSKSIVASNR--LSFLRRPALVMAPLGIVTAMELAFVAMFIALLIWSLGNYLYVS  134

Query  446  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
            F   +     +  VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++
Sbjct  135  FGH-LHIHKLREKVWQAKFRSVSLRLGYVGNICWAFLFFPVTRGSSILPLVGLTSESSIK  193

Query  626  YHTWLGT-AMIVFATLHGAGTFFIW  697
            YH WLG  +MI+FA  H  G    W
Sbjct  194  YHIWLGHLSMILFAA-HTVGFVIYW  217



>ref|XP_009118817.1| PREDICTED: probable ferric reduction oxidase 1 isoform X1 [Brassica 
rapa]
Length=700

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/212 (31%), Positives = 108/212 (51%), Gaps = 16/212 (8%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + +WI+ PT  + + W  +   +    + FG  G+   VY FP+I    +G +YL  K
Sbjct  25   GTIVIWIMMPTSTYRKIWLTSMRAKLGKTTNFGKPGVNLLVYMFPMILLPSLGCIYLHLK  84

Query  272  KQKQ----KEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  439
            KQ      + G+ R++R   + L  P++VK  LGI++  E++ +++F+  L W+    ++
Sbjct  85   KQTSVDQFRSGVERKKREKCSALRRPMLVKGPLGIVTVTELMFLTMFMALLLWS----LT  140

Query  440  NDFRKTVQTKDFKLA------VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLG  601
            N F  T  T   + A      +W+ R+  VA R GL    CLA L  PV R  ++   +G
Sbjct  141  NYFYFTFVTVTPQSAAIHGDKLWEARLDSVAVRLGLAGNICLAFLFYPVSRGSSLLAAVG  200

Query  602  LQFEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            L  E S++YH W+G  +++  T HG      W
Sbjct  201  LTSESSIKYHIWVGHLVMILITSHGVCYVVYW  232



>ref|XP_009118818.1| PREDICTED: probable ferric reduction oxidase 1 isoform X2 [Brassica 
rapa]
 ref|XP_009118819.1| PREDICTED: probable ferric reduction oxidase 1 isoform X2 [Brassica 
rapa]
Length=695

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/212 (31%), Positives = 108/212 (51%), Gaps = 16/212 (8%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + +WI+ PT  + + W  +   +    + FG  G+   VY FP+I    +G +YL  K
Sbjct  20   GTIVIWIMMPTSTYRKIWLTSMRAKLGKTTNFGKPGVNLLVYMFPMILLPSLGCIYLHLK  79

Query  272  KQKQ----KEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  439
            KQ      + G+ R++R   + L  P++VK  LGI++  E++ +++F+  L W+    ++
Sbjct  80   KQTSVDQFRSGVERKKREKCSALRRPMLVKGPLGIVTVTELMFLTMFMALLLWS----LT  135

Query  440  NDFRKTVQTKDFKLA------VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLG  601
            N F  T  T   + A      +W+ R+  VA R GL    CLA L  PV R  ++   +G
Sbjct  136  NYFYFTFVTVTPQSAAIHGDKLWEARLDSVAVRLGLAGNICLAFLFYPVSRGSSLLAAVG  195

Query  602  LQFEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            L  E S++YH W+G  +++  T HG      W
Sbjct  196  LTSESSIKYHIWVGHLVMILITSHGVCYVVYW  227



>ref|XP_002893257.1| ATFRO3/FRO3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69516.1| ATFRO3/FRO3 [Arabidopsis lyrata subsp. lyrata]
Length=695

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 102/204 (50%), Gaps = 14/204 (7%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASV-FGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G V +WI+ PT  + + W K+   K   S+ FG  G+   VY FP+I  A +G ++L  K
Sbjct  25   GTVVIWIMMPTSTYKKIWLKSMRAKLGKSIYFGKPGVNLLVYMFPMILLAFLGSIHLHLK  84

Query  272  KQK-----QKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWT----F  424
            KQ         G+ R++R     L  P++VK  LGI++  E++ +++F+  L W+    F
Sbjct  85   KQTTVNQFNSGGVERKKRDKFGALKRPMLVKG-LGIVTVTEVMFLTMFMSLLLWSLANYF  143

Query  425  YTRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGL  604
            Y        +T+      L  WQ R+  +A R GL    CL  L  PV R  ++   +GL
Sbjct  144  YYTFVTITPQTIPIDGHNL--WQARLDSIAVRLGLTGNICLGFLFYPVSRGSSLLAAVGL  201

Query  605  QFEVSVRYHTWLGTAMIVFATLHG  676
              E S RYH WLG  ++   T HG
Sbjct  202  TSESSTRYHIWLGHLVMTLLTSHG  225



>ref|XP_006306887.1| hypothetical protein CARUB_v10008441mg [Capsella rubella]
 gb|EOA39785.1| hypothetical protein CARUB_v10008441mg [Capsella rubella]
Length=723

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 70/206 (34%), Positives = 108/206 (52%), Gaps = 8/206 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAE--EKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + LWIL PT  +   W      +  +++ FG +G    +Y FP++  A +G VYL  K
Sbjct  37   GTILLWILMPTLTYKTKWLPLMRIKFGTSTYFGSSGTTLFMYMFPMLLIACLGCVYLHFK  96

Query  272  KQKQKEGISRQERRCL-AFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            K+K    I R+ +  + + L  P++VK  LGI+S  EI  +++F+  L WTF   + N F
Sbjct  97   KRKSYH-IDRETKGGVWSALRKPMLVKGPLGIVSVTEITFLAMFVALLLWTFTIYLRNSF  155

Query  449  RKTVQTKDFKL---AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
              T+  +       ++WQ ++   A R GL+   CLA L LPV R  ++   +GL  E S
Sbjct  156  -ATITPQSLAAHGESLWQAKLESAALRLGLIGNICLAFLFLPVARGSSLLPAVGLTSESS  214

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG  ++   TLHG      W
Sbjct  215  IKYHIWLGHMVMALFTLHGLCYIIYW  240



>ref|XP_003622477.1| Ferric reductase [Medicago truncatula]
Length=403

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 97/198 (49%), Gaps = 5/198 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G + +WI+ PT  +   W      KA  + FG  G    +YTFPV+  A +G VYL   K
Sbjct  19   GCIMIWIMMPTNTFNLKWFPKIRGKADPTYFGAQGETILMYTFPVLLIATLGCVYLHIAK  78

Query  275  QKQKEG---ISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            +   E    I   ++      + P++VK  LGI+S  EI  + +FI  L W+F T +   
Sbjct  79   KSSNESNIEIRNGKKHGTTIWNRPMLVKGPLGIVSITEIAFLLMFIALLVWSFTTYLHIG  138

Query  446  FRKTVQT-KDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
            F+   +T  ++   V Q ++  V    GL+   CLA L  PV R  +V  + GL  E  +
Sbjct  139  FKTVAKTAAEYGNTVEQEKLYSVGIWLGLVGNICLAFLFFPVTRGSSVLPIFGLTSEGCI  198

Query  623  RYHTWLGTAMIVFATLHG  676
            +YH WLG  ++   T HG
Sbjct  199  KYHIWLGHILMAIFTTHG  216



>gb|KJB34152.1| hypothetical protein B456_006G050400 [Gossypium raimondii]
Length=685

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 103/202 (51%), Gaps = 4/202 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G++ LW + PT+++   W       + ++ FG  G    +YTFP++  A +G +YL   K
Sbjct  16   GYMMLWFMMPTKLYFEHWLPKIRANSKSTYFGQQGSTMLIYTFPILFIATLGCIYLHLGK  75

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
            +     +  + R   + L  P++VK  LGI+S +E+  +++F++ LAW+  + ++  F  
Sbjct  76   KHGDHNV--EGRVPTSKLKQPVMVKGPLGIVSWMELSFLTMFVVLLAWSTTSYLNGMFTH  133

Query  455  TVQTKDFK-LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
              Q      L VW+ ++       GL+   CLA L  PV R  +V RL+GL  E S++YH
Sbjct  134  IDQMASRSGLLVWEAKLEMSGLTLGLVGNICLAFLFFPVTRGSSVLRLIGLSSEASIKYH  193

Query  632  TWLGTAMIVFATLHGAGTFFIW  697
             W+G   +   T HG      W
Sbjct  194  IWVGHIAMTIFTAHGLCYLVFW  215



>ref|XP_010055096.1| PREDICTED: ferric reduction oxidase 2-like isoform X2 [Eucalyptus 
grandis]
Length=714

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 101/206 (49%), Gaps = 11/206 (5%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G V + I+ PT  + + W  +   +  +++ FG  G    ++TFPV+  A +G VYL   
Sbjct  35   GTVLILIMLPTNTYRKHWSVSIRAKSGTSTFFGSQGYTMLMFTFPVLFIASLGCVYLHLG  94

Query  272  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF-  448
             +  + GI R   + LA    P++V   LGI+S  E+  + +F+  L W+F T + N F 
Sbjct  95   NKSSENGIERS--KVLATWKRPVLVSGPLGIVSWTELAFLVMFVALLIWSFATYLRNSFL  152

Query  449  ---RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
               R+     D    VW+ ++     R GL+    LA L  PV R  +V  L GL  E S
Sbjct  153  NIDRQGPMHGD---KVWEAKLEDSGLRLGLVGNIVLAFLFFPVTRLSSVLPLFGLTSEAS  209

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG  ++V  T HG      W
Sbjct  210  IKYHIWLGHIVMVIFTAHGLTYIIYW  235



>ref|XP_008803960.1| PREDICTED: ferric reduction oxidase 2-like [Phoenix dactylifera]
Length=711

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 101/198 (51%), Gaps = 10/198 (5%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+ +WI+ PT  +   W        +++ FG  G    ++TFP++  +++  +YL   K
Sbjct  32   GWLMIWIMVPTSTYKYNWLPKLRANTNSTYFGRQGTNMLIFTFPILFISVLACIYLHLVK  91

Query  275  QKQKEGISRQER----RCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
                 G SR +R    R LA    P+IV+  LG++SGIE+    +F+  L W++   +S 
Sbjct  92   -----GSSRIQRGTFSRRLAVWKRPVIVRWPLGMVSGIELSFCFMFLALLIWSYSMYLSV  146

Query  443  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
             F       +    +WQ ++   A R GL+   C A L  PV R  ++  L+GL  E S+
Sbjct  147  GFSSLHGAANKGEKLWQSKLDSAAVRLGLVGNLCCAFLFFPVTRLSSLLPLIGLTSESSI  206

Query  623  RYHTWLGTAMIVFATLHG  676
            +YH WLG  +++  T HG
Sbjct  207  KYHVWLGHVVMILFTSHG  224



>ref|NP_001185067.1| ferric reduction oxidase 3 [Arabidopsis thaliana]
 sp|F4I4K7.1|FRO3_ARATH RecName: Full=Ferric reduction oxidase 3, mitochondrial; Short=AtFRO3; 
AltName: Full=Ferric-chelate reductase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE30323.1| ferric reduction oxidase 3 [Arabidopsis thaliana]
Length=717

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 105/203 (52%), Gaps = 12/203 (6%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASV-FGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G V +WI+ PT  + + W K+   K   S+ FG  G+   VY FP+I  A +G +YL  K
Sbjct  48   GTVVIWIMMPTSTYKKIWLKSMRAKLGKSIYFGKPGVNLLVYMFPMILLASLGSIYLHLK  107

Query  272  KQKQ-KEGISRQERRCL---AFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWT----FY  427
            KQ +  +  SR +R+ +     L  P++VK+ LGI++  E++ + +F+  L W+    FY
Sbjct  108  KQTRVNQFNSRMDRKKIDKFGALKRPMLVKAGLGIVTVTEVMFLMMFMALLLWSLANYFY  167

Query  428  TRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQ  607
                    +++ T    L  WQ R+  +A R GL    CL  L  PV R  ++   +GL 
Sbjct  168  HTFVTITPQSLPTDGDNL--WQARLDSIAVRLGLTGNICLGFLFYPVARGSSLLAAVGLT  225

Query  608  FEVSVRYHTWLGTAMIVFATLHG  676
             E S +YH WLG  ++   T HG
Sbjct  226  SESSTKYHIWLGNLVMTLFTSHG  248



>emb|CDP08775.1| unnamed protein product [Coffea canephora]
Length=715

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 71/209 (34%), Positives = 110/209 (53%), Gaps = 8/209 (4%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWK-AAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  265
            VS G++ +WI+ PT  + + W      +++ + FG  G  F V+TFPV+  A +G V+L 
Sbjct  29   VSAGYIFIWIMVPTNTFKQHWLLKIRAESNTTYFGSQGANFLVFTFPVLFVAALGCVFLH  88

Query  266  QKKQKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRI  436
              K++  E  S++   + R +A+   P+I+K  LGI+S IE+  + +FI  L W +   +
Sbjct  89   LGKKRSNEHDSKRRDGKNRTVAW-KRPVIIKG-LGIVSRIELAFLVMFIALLVWFYTVYV  146

Query  437  SNDFRKTVQTKDFK--LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQF  610
             N F         K  + VWQ ++   + R GLL   CL LL  PV R  +V +L GL  
Sbjct  147  RNGFDSITPKSAAKSGMKVWQAKLGSASLRLGLLGNLCLTLLFFPVTRGSSVLQLFGLTS  206

Query  611  EVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            E S++YH WLG  ++   T HG      W
Sbjct  207  EASIKYHIWLGHTVMTLFTAHGVCYIIFW  235



>ref|XP_010472415.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like, partial 
[Camelina sativa]
Length=106

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+SLWI+KPT +W ++W  AE+    + FGY GL FAV++FP IA +I+G +YL    Q
Sbjct  20   GWISLWIIKPTTLWIQSWHQAEDTIKHTFFGYYGLNFAVFSFPPIALSIIGLIYLSLLPQ  79

Query  278  KQKEGISRQERRCLAFLSNPLIVKSSLGI  364
              +   +R  R     +S P I+ S +GI
Sbjct  80   HHRP--TRGGRSASITISRPAIINSFIGI  106



>ref|XP_010457106.1| PREDICTED: ferric reduction oxidase 2 [Camelina sativa]
Length=723

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 109/206 (53%), Gaps = 8/206 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAE--EKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + LWI+ PT  +   W      +  +++ FG +G    +Y FP++  A +G VYL  K
Sbjct  37   GIILLWIMMPTLTYRNKWLPLMRIKFGTSTYFGSSGTTLFMYMFPMMVVACLGCVYLHFK  96

Query  272  KQKQKEGISRQERRCL-AFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            K+K    I R+ +  + + L  P++VK  LGI+S  EI  +++F+  L W+F   + N F
Sbjct  97   KRKSYH-IDRETKGGVWSALRKPMLVKGPLGIVSVTEITFLAMFVALLLWSFIIYLRNSF  155

Query  449  RKTVQTKDFKL---AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
              T+  +       ++WQ ++   A R GL+   CLA L LPV R  ++   +GL  E S
Sbjct  156  -ATITPQSLAAHGESLWQAKLESAALRLGLIGNICLAFLFLPVARGSSLLPAVGLTSESS  214

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG  ++V  T+HG      W
Sbjct  215  IKYHIWLGHMVMVLFTVHGLCYIIYW  240



>ref|XP_010060545.1| PREDICTED: ferric reduction oxidase 4-like [Eucalyptus grandis]
Length=709

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 103/204 (50%), Gaps = 7/204 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+ +WI+ PT+ +   W    + K  ++ F   G+   + TFPV+  A  G VYL  ++
Sbjct  17   GWLMIWIMLPTKTYKNKWTPNLQMKLDSTYFEGQGINLLLLTFPVMFIAAFGCVYLHLQR  76

Query  275  QKQK---EGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            + +K   +  S+  R  LAFL  P++V  +LGI++  E+  V++FI  L W+    I   
Sbjct  77   KSEKLYTKSASKTGR--LAFLRRPVLVMPTLGIVTLTELAFVAMFIALLIWSLANYIYIS  134

Query  446  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
            +   +   D  + VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++
Sbjct  135  YSGHLHM-DKGVEVWQAKFRSVSLRLGYVGNICWAFLFFPVTRGSSILPLVGLTSESSIK  193

Query  626  YHTWLGTAMIVFATLHGAGTFFIW  697
            YH WLG    +   LH  G    W
Sbjct  194  YHIWLGHLSNLLFLLHTIGFIIYW  217



>ref|XP_009411423.1| PREDICTED: ferric reduction oxidase 2-like [Musa acuminata subsp. 
malaccensis]
Length=674

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 66/208 (32%), Positives = 102/208 (49%), Gaps = 16/208 (8%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYL----  262
            GW+ +W + PT  +   W      K   + FG  G    ++TFP++  A+VG VYL    
Sbjct  11   GWLMIWGMLPTHTFGERWLPMLLSKTKTTYFGRLGTNVLIFTFPILFIAVVGCVYLHIVR  70

Query  263  EQKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
            +  + K   G  +  RR       PL++K  LGI+SG E+    +F+ F+ W F   +SN
Sbjct  71   KSDRNKSSSGALKAWRR-------PLLIKQPLGIVSGTELAFCLMFLAFIVWFFSCYLSN  123

Query  443  ---DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFE  613
               +F+     K+    +W  ++   A R GLL   C A L  PV R  ++  L+GL  E
Sbjct  124  ALANFKGEGGEKESN-GLWLAKLEIAALRLGLLGSLCFAFLFFPVTRASSLLPLVGLTSE  182

Query  614  VSVRYHTWLGTAMIVFATLHGAGTFFIW  697
             S++YH WLG  +++  T HG     +W
Sbjct  183  CSIKYHVWLGHIVMLVFTAHGVCYIIVW  210



>ref|XP_011043855.1| PREDICTED: ferric reduction oxidase 4-like isoform X3 [Populus 
euphratica]
Length=688

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 104/194 (54%), Gaps = 8/194 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+ +WI+ PT+++  TW      K +++ F   G    + +FP++  A +G +YL  K+
Sbjct  17   GWLVVWIMLPTKLYKNTWTPKLNSKLNSTYFSGQGTNLLLLSFPMMFIAALGCIYLHAKQ  76

Query  275  QKQ---KEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            Q++    + I    R  L+FL  P +V + LGI++ +E+  V++FI  L W+    +   
Sbjct  77   QQRISYSKSIVASNR--LSFLRRPALVMAPLGIVTAMELAFVAMFIALLIWSLGNYLYVS  134

Query  446  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
            F   +     +  VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++
Sbjct  135  FGH-LHIHKLREKVWQAKFRSVSLRLGYVGNICWAFLFFPVTRGSSILPLVGLTSESSIK  193

Query  626  YHTWLGT-AMIVFA  664
            YH WLG  +MI+FA
Sbjct  194  YHIWLGHLSMILFA  207



>ref|XP_007038788.1| Ferric reduction oxidase 2 [Theobroma cacao]
 gb|EOY23289.1| Ferric reduction oxidase 2 [Theobroma cacao]
Length=747

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 101/204 (50%), Gaps = 5/204 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
             ++ LWI+ PT ++   W      K  ++ FG  G    +YTFP++  A +G +YL   K
Sbjct  29   AYMVLWIMMPTNLYFEHWMPEIRAKTKSTYFGNQGASMLIYTFPILFIATMGCIYLHLGK  88

Query  275  QKQKEGISR--QERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            +       R  Q  R LA L  P IV+  LGI+S +E+  +++F+  L W+  + +++ F
Sbjct  89   KDADHNRHRMVQTSR-LATLKQPAIVRGPLGIVSWMELSFLTMFVALLVWSTSSYLNHMF  147

Query  449  RKTVQ-TKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
                Q      L VW+ ++       GL+   CLA L  PV R  +V RL+GL  E SV+
Sbjct  148  VHIDQMAAKSGLLVWEAKLEMSGLALGLVGNICLAFLFFPVTRGSSVLRLIGLTSEASVK  207

Query  626  YHTWLGTAMIVFATLHGAGTFFIW  697
            YH W+G   +   T HG      W
Sbjct  208  YHIWIGHIAMTIFTAHGLCFIIFW  231



>gb|EMS45573.1| Superoxide-generating NADPH oxidase heavy chain subunit B [Triticum 
urartu]
Length=1019

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 110/202 (54%), Gaps = 5/202 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  277
            GW+ +W + PT+ ++ TW  A + A+ + FG  G+   VY FPV+   +V  VYL  ++Q
Sbjct  36   GWLMMWAMLPTRTYSSTW--APKLAALTGFGKQGIRITVYVFPVLFVFVVACVYLHLQQQ  93

Query  278  KQKEGIS--RQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
            K  +  +  R   R  A    P++V+  LGI++GIE+  + +F+  L W +Y  ++ +F 
Sbjct  94   KGGDPNTQRRTSTRIAAAWRRPVLVRGPLGIVTGIELAVLLMFMALLVWFYYAYVTVEFS  153

Query  452  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
            K ++ K  +  +WQ  + + A R G +   C ALL LPV R  ++  L+GL  E  ++YH
Sbjct  154  KLLRVKPGQ-KLWQAELEKAAKRLGSVGSLCCALLFLPVARGSSLLPLVGLTSESGIKYH  212

Query  632  TWLGTAMIVFATLHGAGTFFIW  697
             WLG   +   T HG    F W
Sbjct  213  VWLGNMAMAIFTAHGLCYVFFW  234



>ref|XP_010045373.1| PREDICTED: ferric reduction oxidase 7, chloroplastic-like [Eucalyptus 
grandis]
Length=732

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 104/201 (52%), Gaps = 2/201 (1%)
 Frame = +2

Query  101  WVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQK  280
            W++++ + PT+  T  +   E+  S +++G  G    +YT P++  A++   YL      
Sbjct  46   WIAMFFVIPTEFGTDFYTDWEDATSGTLYGTEGSALLLYTGPILLIAVLAVPYLLLSGGD  105

Query  281  QKEGISRQERRC-LAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
              + ++ +++   L   + P++V    G+++  E +G+++F++F+AW  Y     +F   
Sbjct  106  DDDVVAEKKKSPRLRLGTFPVLVDGVFGVVTAAEFIGIAMFVVFVAWAVYGYTVVNFEML  165

Query  458  VQTKDFKLAVWQYRMLRVATR-FGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  634
                D      + +ML+++   FGL    CLA L LPV R   + RL+G+ FE + RYH 
Sbjct  166  PTYGDLTPLEKRVQMLQMSAYIFGLTALTCLAFLFLPVARGSILLRLIGIPFEHATRYHV  225

Query  635  WLGTAMIVFATLHGAGTFFIW  697
            WLG   +   T+HG   F +W
Sbjct  226  WLGNLTMFLLTMHGLCYFIVW  246



>gb|KEH18825.1| oxidoreductase/ferric-chelate reductase [Medicago truncatula]
Length=701

 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 97/198 (49%), Gaps = 5/198 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G + +WI+ PT  +   W      KA  + FG  G    +YTFPV+  A +G VYL   K
Sbjct  19   GCIMIWIMMPTNTFNLKWFPKIRGKADPTYFGAQGETILMYTFPVLLIATLGCVYLHIAK  78

Query  275  QKQKEG---ISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            +   E    I   ++      + P++VK  LGI+S  EI  + +FI  L W+F T +   
Sbjct  79   KSSNESNIEIRNGKKHGTTIWNRPMLVKGPLGIVSITEIAFLLMFIALLVWSFTTYLHIG  138

Query  446  FRKTVQT-KDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
            F+   +T  ++   V Q ++  V    GL+   CLA L  PV R  +V  + GL  E  +
Sbjct  139  FKTVAKTAAEYGNTVEQEKLYSVGIWLGLVGNICLAFLFFPVTRGSSVLPIFGLTSEGCI  198

Query  623  RYHTWLGTAMIVFATLHG  676
            +YH WLG  ++   T HG
Sbjct  199  KYHIWLGHILMAIFTTHG  216



>ref|XP_009757787.1| PREDICTED: ferric reduction oxidase 2-like [Nicotiana sylvestris]
Length=718

 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 74/212 (35%), Positives = 110/212 (52%), Gaps = 14/212 (7%)
 Frame = +2

Query  89   VSTGWVSLWILKPT----QVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFV  256
            V+ G+  L I+ PT    Q+WT   KA  + A+++ FG  G    + TFP I  A++G V
Sbjct  31   VTIGYFLLLIVTPTNMYRQIWTPMIKA--QTATSTYFGAQGRTLLMNTFPFIFIAVLGCV  88

Query  257  YLEQKKQKQKEGISRQE-RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTR  433
            YL   K+   + I+R E ++ L     P+I+K  LGI+S IE+    +FI  L WTF + 
Sbjct  89   YLHLWKKSNDKNINRVEGKQKLTIWRRPIIMKG-LGIVSRIELCFFVMFIALLVWTFASY  147

Query  434  ISNDF----RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLG  601
            +   F     K+V  K  K  VW+ ++   A R GL+    L  L +PV R  +V ++ G
Sbjct  148  LHIIFPTITPKSVAKKGEK--VWEAKLEDSALRLGLVGNIALTFLFVPVTRGSSVLQVFG  205

Query  602  LQFEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            L  E SV+YH WLG  ++   + HG      W
Sbjct  206  LTSEASVKYHIWLGHIVMTLFSAHGICYIIYW  237



>gb|KEH18826.1| oxidoreductase/ferric-chelate reductase [Medicago truncatula]
Length=732

 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 97/198 (49%), Gaps = 5/198 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G + +WI+ PT  +   W      KA  + FG  G    +YTFPV+  A +G VYL   K
Sbjct  19   GCIMIWIMMPTNTFNLKWFPKIRGKADPTYFGAQGETILMYTFPVLLIATLGCVYLHIAK  78

Query  275  QKQKEG---ISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            +   E    I   ++      + P++VK  LGI+S  EI  + +FI  L W+F T +   
Sbjct  79   KSSNESNIEIRNGKKHGTTIWNRPMLVKGPLGIVSITEIAFLLMFIALLVWSFTTYLHIG  138

Query  446  FRKTVQT-KDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
            F+   +T  ++   V Q ++  V    GL+   CLA L  PV R  +V  + GL  E  +
Sbjct  139  FKTVAKTAAEYGNTVEQEKLYSVGIWLGLVGNICLAFLFFPVTRGSSVLPIFGLTSEGCI  198

Query  623  RYHTWLGTAMIVFATLHG  676
            +YH WLG  ++   T HG
Sbjct  199  KYHIWLGHILMAIFTTHG  216



>ref|XP_011043857.1| PREDICTED: ferric reduction oxidase 2-like isoform X1 [Populus 
euphratica]
Length=703

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 101/202 (50%), Gaps = 3/202 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQV-WTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G++ +W +K T   +   W    +K S++  G  G    +Y FP++  A +G +YL  +K
Sbjct  27   GYMMIWSMKSTNTFYLHWWPDVLKKTSSTYLGEQGTTTLIYAFPILFIATIGSLYLHLEK  86

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR-  451
            +   +  +R   R +  L  P+I K  LGI+S  E+  +++F+  L W+ Y+   N F  
Sbjct  87   KYDHDHSTRFISRII-LLKRPVITKGPLGIVSWTELTFLAMFVALLVWSMYSYTHNMFAF  145

Query  452  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
              ++    K  VW+ ++   A   GL   ACLA L  PV R  ++ + +GL  E S++YH
Sbjct  146  AALEAAQEKFQVWEVKLRGAALSLGLAGNACLAFLFFPVTRGSSILQFVGLTSEASIKYH  205

Query  632  TWLGTAMIVFATLHGAGTFFIW  697
             WLG   +V  T HG      W
Sbjct  206  IWLGNITMVIFTAHGLSYITYW  227



>ref|XP_010055097.1| PREDICTED: ferric reduction oxidase 2-like [Eucalyptus grandis]
Length=724

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/208 (32%), Positives = 101/208 (49%), Gaps = 10/208 (5%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G V +WI+ PT  +   W  +   + ++++ FGY G    ++TFPV+  A +G VYL   
Sbjct  40   GTVLMWIMLPTNTYREHWFPSIWAKSSTSTFFGYQGYTMLMFTFPVLFIACLGCVYLHLG  99

Query  272  KQK-----QKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRI  436
             +       K G+ R  ++ LA    P++V   LGI+S  E+    +FI  L W+F T +
Sbjct  100  NESIEPRVGKNGVER--KKGLAMWKRPVLVSGPLGIVSWTELAFFVMFIALLVWSFATDL  157

Query  437  SNDFRKTVQTKDFK-LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFE  613
               F    +T       +W+ ++ R     G +    LALL  PV R  +V  L GL  E
Sbjct  158  RISFLDIERTGPMDGDKMWEAKLERSGLWLGSVGNIALALLFFPVTRVSSVLPLFGLTSE  217

Query  614  VSVRYHTWLGTAMIVFATLHGAGTFFIW  697
             S++YH WLG  ++V  T HG      W
Sbjct  218  ASIKYHIWLGHIVMVLFTTHGLVYILYW  245



>ref|XP_011043858.1| PREDICTED: ferric reduction oxidase 2-like isoform X2 [Populus 
euphratica]
Length=683

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 101/202 (50%), Gaps = 3/202 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQV-WTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G++ +W +K T   +   W    +K S++  G  G    +Y FP++  A +G +YL  +K
Sbjct  27   GYMMIWSMKSTNTFYLHWWPDVLKKTSSTYLGEQGTTTLIYAFPILFIATIGSLYLHLEK  86

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR-  451
            +   +  +R   R +  L  P+I K  LGI+S  E+  +++F+  L W+ Y+   N F  
Sbjct  87   KYDHDHSTRFISRII-LLKRPVITKGPLGIVSWTELTFLAMFVALLVWSMYSYTHNMFAF  145

Query  452  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
              ++    K  VW+ ++   A   GL   ACLA L  PV R  ++ + +GL  E S++YH
Sbjct  146  AALEAAQEKFQVWEVKLRGAALSLGLAGNACLAFLFFPVTRGSSILQFVGLTSEASIKYH  205

Query  632  TWLGTAMIVFATLHGAGTFFIW  697
             WLG   +V  T HG      W
Sbjct  206  IWLGNITMVIFTAHGLSYITYW  227



>gb|KCW71571.1| hypothetical protein EUGRSUZ_E00107 [Eucalyptus grandis]
Length=690

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/208 (32%), Positives = 101/208 (49%), Gaps = 10/208 (5%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G V +WI+ PT  +   W  +   + ++++ FGY G    ++TFPV+  A +G VYL   
Sbjct  6    GTVLMWIMLPTNTYREHWFPSIWAKSSTSTFFGYQGYTMLMFTFPVLFIACLGCVYLHLG  65

Query  272  KQK-----QKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRI  436
             +       K G+ R  ++ LA    P++V   LGI+S  E+    +FI  L W+F T +
Sbjct  66   NESIEPRVGKNGVER--KKGLAMWKRPVLVSGPLGIVSWTELAFFVMFIALLVWSFATDL  123

Query  437  SNDFRKTVQTKDFK-LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFE  613
               F    +T       +W+ ++ R     G +    LALL  PV R  +V  L GL  E
Sbjct  124  RISFLDIERTGPMDGDKMWEAKLERSGLWLGSVGNIALALLFFPVTRVSSVLPLFGLTSE  183

Query  614  VSVRYHTWLGTAMIVFATLHGAGTFFIW  697
             S++YH WLG  ++V  T HG      W
Sbjct  184  ASIKYHIWLGHIVMVLFTTHGLVYILYW  211



>gb|KCW71572.1| hypothetical protein EUGRSUZ_E00107 [Eucalyptus grandis]
Length=655

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/208 (32%), Positives = 101/208 (49%), Gaps = 10/208 (5%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G V +WI+ PT  +   W  +   + ++++ FGY G    ++TFPV+  A +G VYL   
Sbjct  6    GTVLMWIMLPTNTYREHWFPSIWAKSSTSTFFGYQGYTMLMFTFPVLFIACLGCVYLHLG  65

Query  272  KQK-----QKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRI  436
             +       K G+ R  ++ LA    P++V   LGI+S  E+    +FI  L W+F T +
Sbjct  66   NESIEPRVGKNGVER--KKGLAMWKRPVLVSGPLGIVSWTELAFFVMFIALLVWSFATDL  123

Query  437  SNDFRKTVQTKDFK-LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFE  613
               F    +T       +W+ ++ R     G +    LALL  PV R  +V  L GL  E
Sbjct  124  RISFLDIERTGPMDGDKMWEAKLERSGLWLGSVGNIALALLFFPVTRVSSVLPLFGLTSE  183

Query  614  VSVRYHTWLGTAMIVFATLHGAGTFFIW  697
             S++YH WLG  ++V  T HG      W
Sbjct  184  ASIKYHIWLGHIVMVLFTTHGLVYILYW  211



>gb|AAR15416.1| ferric reductase [Medicago truncatula]
Length=703

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 97/198 (49%), Gaps = 5/198 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G + +WI+ PT  +   W      KA  + FG  G    +YTFPV+  A +G VYL   K
Sbjct  19   GCIMIWIMMPTNTFNLKWFPKIRGKADPTYFGAQGETILMYTFPVLLIATLGCVYLHIAK  78

Query  275  QKQKEG---ISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            +   E    I   ++      + P++VK  LGI+S  EI  + +FI  L W+F T +   
Sbjct  79   KSSNESNIEIRNGKKHGTTIWNRPMLVKGPLGIVSITEIAFLLMFIALLVWSFTTYLHIG  138

Query  446  FRKTVQT-KDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
            F+   +T  ++   V Q ++  V    GL+   CLA L  PV R  +V  + GL  E  +
Sbjct  139  FKTVAKTAAEYGNTVEQEKLYSVGIWLGLVGNICLAFLFFPVTRGSSVLPIFGLTSEGCI  198

Query  623  RYHTWLGTAMIVFATLHG  676
            +YH WLG  ++   T HG
Sbjct  199  KYHIWLGHILMAIFTTHG  216



>gb|EYU20558.1| hypothetical protein MIMGU_mgv1a002085mg [Erythranthe guttata]
Length=717

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/206 (32%), Positives = 97/206 (47%), Gaps = 7/206 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVF--GYNGLCFAVYTFPVIAFAIVG--FVYLE  265
            G++ LW++ PT  +   W+      +AS +    +G  + V+TFPV+  A++G  +V+L 
Sbjct  32   GYLFLWVMLPTNPYRLKWQPKLRTQTASTYFGTTHGATYLVFTFPVLLIAVLGCAYVHLG  91

Query  266  QKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            +K               LA L  P+I+K  LGI+S IEI    +FI  L W+F T + N 
Sbjct  92   KKSSDNHTKGKNGNNHRLAILKRPMIIKG-LGIVSRIEIAFFLMFIALLIWSFATYLRNS  150

Query  446  FRKTVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
            F         K    VW+ ++   + R   +     A L  PV R  +V  L GL  E S
Sbjct  151  FATITPKSAAKKGEEVWEVKLDSASHRLAFIGNIAFAFLFFPVTRGSSVLPLFGLTSEGS  210

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            V+YH WLG  ++   T H  G    W
Sbjct  211  VKYHIWLGHIVMTLFTAHAFGYIIYW  236



>ref|XP_004253309.1| PREDICTED: ferric reduction oxidase 4-like, partial [Solanum 
lycopersicum]
Length=222

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 94/199 (47%), Gaps = 4/199 (2%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTWKAAEE-KASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  265
            V  GW+ +W++ PT  +  +W      K +++ F   G+   ++TFP++  A V  VYL 
Sbjct  14   VFVGWLFIWVMLPTPTYKNSWTPHLLIKLNSTYFREQGINLLLFTFPIMLIAAVSCVYLH  73

Query  266  QKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
               +       R   +   +   P +V  SLGI++ +E++  ++F + L W+    I   
Sbjct  74   LYNKSTSN--HRSSNKVREYFRRPRLVIESLGIVNAVELIFAAMFTVLLIWSLANYIYIS  131

Query  446  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
            +   +   +    VW  +   VA R G +   C A L  PV R  ++  L+GL  E S++
Sbjct  132  Y-GNLHMHNPAEKVWMAKFRSVALRLGYIGNVCYAFLFFPVTRLSSILPLVGLTSESSIK  190

Query  626  YHTWLGTAMIVFATLHGAG  682
            YH WLG   +  A LH  G
Sbjct  191  YHIWLGHLSMALAVLHSVG  209



>gb|KCW90645.1| hypothetical protein EUGRSUZ_A02749 [Eucalyptus grandis]
Length=1185

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 103/204 (50%), Gaps = 7/204 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+ +WI+ PT+ +   W    + K  ++ F   G+   + TFPV+  A  G VYL  ++
Sbjct  493  GWLMIWIMLPTKTYKNKWTPNLQMKLDSTYFEGQGINLLLLTFPVMFIAAFGCVYLHLQR  552

Query  275  QKQK---EGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            + +K   +  S+  R  LAFL  P++V  +LGI++  E+  V++FI  L W+    I   
Sbjct  553  KSEKLYTKSASKTGR--LAFLRRPVLVMPTLGIVTLTELAFVAMFIALLIWSLANYIYIS  610

Query  446  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
            +   +   D  + VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++
Sbjct  611  YSGHLHM-DKGVEVWQAKFRSVSLRLGYVGNICWAFLFFPVTRGSSILPLVGLTSESSIK  669

Query  626  YHTWLGTAMIVFATLHGAGTFFIW  697
            YH WLG    +   LH  G    W
Sbjct  670  YHIWLGHLSNLLFLLHTIGFIIYW  693



>gb|EYU34160.1| hypothetical protein MIMGU_mgv1a023886mg [Erythranthe guttata]
Length=706

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 99/204 (49%), Gaps = 5/204 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVF--GYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G++ LW++  T  +   W       +AS +    +G  + ++TFPV+  A +G VYL   
Sbjct  38   GYLFLWMMISTNPYRLKWLPKVRTQTASTYFGTTHGATYLLFTFPVMFIATLGCVYLHLG  97

Query  272  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
            K+   +  ++ +   LA L  P+I+K  LGI+S IEI    +FI  L W F T + N F 
Sbjct  98   KKSSTDNHTKGKNERLAILKRPMIIK-GLGIVSWIEIAFFIMFIALLTWNFATYLRNSFA  156

Query  452  KTVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
                    K    VW+ ++   + R  L+    LA L  PV R  +V  L GL  E SV+
Sbjct  157  TITSKSAAKKGEQVWEVKLDSASHRLALVANIALAFLFFPVTRGSSVLPLFGLTSEGSVK  216

Query  626  YHTWLGTAMIVFATLHGAGTFFIW  697
            YH WLG  ++   T+H  G    W
Sbjct  217  YHIWLGHIVMTLFTVHSLGYIVYW  240



>gb|AAT01415.1| ferric reductase [Cucumis sativus]
Length=694

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 101/205 (49%), Gaps = 13/205 (6%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            GW+ LW++ PT  + + W  K  E+   ++ FG  G    +YTFP++  AI+G VY   +
Sbjct  21   GWIFLWVMMPTNTYRKKWLPKVREKSYKSTYFGSEGTSLLMYTFPILFIAILGCVYNHLE  80

Query  272  KQKQKEGISRQE---RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
            K++    +  ++      LA    P IVK  LGI+S  E+  +++FII L W+F T + N
Sbjct  81   KKRSDPNVKTRKGTKHHGLAMWKQPAIVKGPLGIVSWTELTLLTMFIILLVWSFATYLHN  140

Query  443  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
             F            +W+ R+       G++   CL  L  PV R  ++  LLGL  E  +
Sbjct  141  SF--------ITEKMWEIRLGSAGFWLGIVGNICLVFLFFPVARGSSLLPLLGLTSEGCI  192

Query  623  RYHTWLGTAMIVFATLHGAGTFFIW  697
            +YH WLG   + F + HG      W
Sbjct  193  KYHIWLGHMTMAFFSAHGICFLIYW  217



>ref|XP_002513661.1| ferric-chelate reductase, putative [Ricinus communis]
 gb|EEF49064.1| ferric-chelate reductase, putative [Ricinus communis]
Length=1368

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 104/206 (50%), Gaps = 10/206 (5%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+ +W+L PT+V+  +W      K +++ FG  G    +++FPV+  A  G V+L   K
Sbjct  17   GWLIVWVLLPTKVYKNSWTPKLNSKLNSTYFGTQGTNLLLFSFPVMFIAAFGCVHLHFHK  76

Query  275  QKQKEGISRQERR--CLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTF--YTRIS-  439
             K+    S+   +   L+F   P++V + LGI++ +EI   ++FI  + W+   Y  IS 
Sbjct  77   NKRGNSSSKSNVKGNLLSFFRRPVLVMAPLGIVTAMEIAFSAMFIALMIWSLANYLYISF  136

Query  440  NDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
             +    V+ +     VWQ +   V+ R G +   C A L +PV R  ++  L+GL  E S
Sbjct  137  GNLHMHVEGEK----VWQAKFRSVSLRLGYIGNVCWAFLFIPVTRGSSLLHLVGLTSESS  192

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG    +    H  G    W
Sbjct  193  IKYHIWLGHLSNILFAAHTMGFIIYW  218


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 84/178 (47%), Gaps = 8/178 (4%)
 Frame = +2

Query  167  KASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQKQKEGISRQERRCLAFLSNPLIV  346
            K +++ FG  G    V+ FP++  A +  +YL         G + Q     A    P+I+
Sbjct  719  KTNSTFFGKQGANMLVFMFPILFIATLSCLYLHM-------GNTSQIDYWFASWKRPVIM  771

Query  347  KSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR-KTVQTKDFKLAVWQYRMLRVATRF  523
            K  LGI+S +E+  + +FI  L W+ ++ +   F     +     L VW+ ++       
Sbjct  772  KGPLGIVSWMEVSFLVMFITLLMWSLFSYLHGMFAFAAPEAAYLGLKVWEAKLQSAGLSL  831

Query  524  GllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            GL+   CLA L  PV R  +V RLLGL  E S++YH WLG   +   T HG      W
Sbjct  832  GLVGNVCLAFLFFPVTRGSSVLRLLGLNSEASIKYHIWLGHIALTIFTSHGLCYIVFW  889



>ref|XP_004143614.1| PREDICTED: ferric reduction oxidase 2-like [Cucumis sativus]
Length=694

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 101/205 (49%), Gaps = 13/205 (6%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            GW+ LW++ PT  + + W  K  E+   ++ FG  G    +YTFP++  AI+G VY   +
Sbjct  21   GWIFLWVMMPTNTYRKKWLPKIREKSYKSTYFGSEGTSLLMYTFPILFIAILGCVYNHLE  80

Query  272  KQKQKEGISRQE---RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
            K++    +  ++      LA    P IVK  LGI+S  E+  +++FII L W+F T + N
Sbjct  81   KKRSDPNVKTRKGTKHHGLAMWKQPAIVKGPLGIVSWTELTLLTMFIILLVWSFATYLHN  140

Query  443  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
             F            +W+ R+       G++   CL  L  PV R  ++  LLGL  E  +
Sbjct  141  SF--------ITEKMWEIRLGSAGFWLGIVGNICLVFLFFPVARGSSLLPLLGLTSEGCI  192

Query  623  RYHTWLGTAMIVFATLHGAGTFFIW  697
            +YH WLG   + F + HG      W
Sbjct  193  KYHIWLGHMTMAFFSAHGICFLIYW  217



>ref|XP_006339613.1| PREDICTED: ferric reduction oxidase 2-like [Solanum tuberosum]
Length=721

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 109/209 (52%), Gaps = 8/209 (4%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYL  262
            V+ G+  L I+ PT ++ + W  K      +++ FG  G    + TFP+I  A++G VYL
Sbjct  34   VTIGYFILLIVTPTNMYRQIWTPKIKAHTTNSTYFGAQGRTLLMNTFPLIFIAVLGCVYL  93

Query  263  EQKKQKQKEGISR-QERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  439
               K+   + I+R +E++ LA    P+I+K  LGI+S IE+    +FI  L WTF + + 
Sbjct  94   HLWKKSNNKNINRVEEKQKLAIWKRPIIMK-GLGIVSRIELGFFVMFIALLVWTFASYLH  152

Query  440  NDFRKTVQTKDFKLA---VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQF  610
              F  T+  K    +   VW+ ++     R GL+   CL  L +PV R  +V ++ GL  
Sbjct  153  IIF-PTITPKSVAKSGEKVWEAKLEDSGLRLGLVGNICLTFLFVPVTRGSSVLQVFGLTS  211

Query  611  EVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            E SV+YH WLG  ++   + HG      W
Sbjct  212  EASVKYHIWLGHIVMTLFSGHGICYIIYW  240



>ref|XP_002305246.1| hypothetical protein POPTR_0004s07730g [Populus trichocarpa]
 gb|EEE85757.1| hypothetical protein POPTR_0004s07730g [Populus trichocarpa]
Length=705

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 99/202 (49%), Gaps = 3/202 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQV-WTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G++ +W +K T   +   W    +K S++  G  G    +Y FP++  A +G +YL  +K
Sbjct  27   GYMMIWSMKSTNTFYLHWWPDVLKKTSSTYLGEQGTTTLIYAFPILFIATIGSLYLHLEK  86

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR-  451
            +   +  +R   R +  L  P+I K  LGI+S  E+  +++F+  L W+ Y+   N F  
Sbjct  87   KYDHDHSTRFISRII-LLKRPVITKGPLGIVSWTELTFLAMFVALLVWSMYSYTHNMFAF  145

Query  452  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
              ++    K   W+ ++   A   GL    CLA L  PV R  ++ + +GL  E S++YH
Sbjct  146  AALEAAQEKFQAWEVKLRSAALGLGLAGNTCLAFLFFPVTRGSSILQFVGLTSEASIKYH  205

Query  632  TWLGTAMIVFATLHGAGTFFIW  697
             WLG   +V  T HG      W
Sbjct  206  IWLGNITMVIFTAHGLSYITYW  227



>ref|XP_011038370.1| PREDICTED: LOW QUALITY PROTEIN: ferric reduction oxidase 4-like 
[Populus euphratica]
Length=696

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 99/202 (49%), Gaps = 3/202 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  271
            GW+ +W++ PT+V+   W      K +++ F   G    +++FPV+  A  G +YL  QK
Sbjct  17   GWLMIWVMLPTKVYKNAWTPKLNGKLNSTYFEGQGTNLLLFSFPVMFIAAFGCLYLHLQK  76

Query  272  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
              ++    S      L+FL  P +V + LGI++ +E+  V++FI  L W+    +   F 
Sbjct  77   NLRKPNSRSVVTSNRLSFLRRPALVMAPLGIVTAMELAFVAMFIALLIWSLANYLYVSFG  136

Query  452  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
                 K  +  VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++YH
Sbjct  137  HLHMHKQGE-KVWQAKFRSVSLRLGYIGNICWAFLFFPVTRGSSILPLVGLTSESSIKYH  195

Query  632  TWLGTAMIVFATLHGAGTFFIW  697
             WLG   ++    H  G    W
Sbjct  196  IWLGHLSMILFVAHTVGFIIYW  217



>ref|XP_008445871.1| PREDICTED: ferric reduction oxidase 2-like [Cucumis melo]
Length=693

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 101/205 (49%), Gaps = 13/205 (6%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            GW+ LW++ PT  + + W  K  E+   ++ FG  G    +YTFP++  AI+G VY   +
Sbjct  21   GWIFLWVMMPTNTYRKKWLPKIREKTYQSTYFGSEGTSLLMYTFPILFIAILGCVYNHLE  80

Query  272  KQKQKEGISRQE---RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
            K++  + I  ++      LA    P IVK  LGI+S  E+  +++FI  L W+F T + N
Sbjct  81   KKRSDQNIETRKGTKHHGLAMWKQPAIVKGPLGIVSWTELTLLTMFITLLVWSFATYLHN  140

Query  443  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
             F            +W+ R+       G++   CL  L  PV R  ++  LLGL  E  +
Sbjct  141  SF--------ISEKMWEIRLGSAGFWLGIVGNICLVFLFFPVARGSSLLPLLGLTSEGCI  192

Query  623  RYHTWLGTAMIVFATLHGAGTFFIW  697
            +YH WLG   + F + HG      W
Sbjct  193  KYHIWLGHMTMAFFSAHGVCFVIYW  217



>ref|XP_004496531.1| PREDICTED: ferric reduction oxidase 2-like [Cicer arietinum]
Length=706

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 99/203 (49%), Gaps = 10/203 (5%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  265
            +S G++ +W++ PT  +   W    + KA    FG  G    VYTFP+I  A +  +Y  
Sbjct  22   ISLGYMMVWLMMPTNTFFMHWLPDIQAKADPIYFGKQGTTILVYTFPIIFMATLASLYHH  81

Query  266  QKKQKQKEGISRQERRCLAFLSN-----PLIVKSSLGILSGIEILGVSLFIIFLAWTFYT  430
              ++     I   E   + FL       PL V   LGI+S  E   + +F++ L W+  +
Sbjct  82   MMQKGSNHDI---ESSKMGFLRKASWRKPLFVNGHLGIISRTEFSFIIMFVVLLIWSLCS  138

Query  431  RISNDFRK-TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQ  607
             +   F K  +Q  + ++ +W+ ++   A   GL+   CLA +  PV R  ++ R +GL 
Sbjct  139  YLHGMFAKVALQAANERVQMWETKLENSALALGLVGNICLAFMFFPVSRGSSILRFIGLT  198

Query  608  FEVSVRYHTWLGTAMIVFATLHG  676
             E S++YH WLG   + F T HG
Sbjct  199  SEASIKYHIWLGHIAMTFFTAHG  221



>gb|EYU25131.1| hypothetical protein MIMGU_mgv1a023728mg, partial [Erythranthe 
guttata]
Length=688

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 98/203 (48%), Gaps = 3/203 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVF-GYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G++ +WI+ PT V+   W       + S+F G  G    VYT P++  A +G +YL   +
Sbjct  9    GYIMIWIMMPTNVFWLHWSPRIHAETDSMFFGQQGANILVYTSPILLIATLGCIYLHLDR  68

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
                      +    A  + P+ V+  LGI+S  E+  + +FI+ L W+    +   F+ 
Sbjct  69   YTGDSNNRTTKDSRFATWARPVFVRGPLGIVSWTELSFILMFIVLLIWSISAYVHGMFKN  128

Query  455  TVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
              +    K+   VW+ ++  VA   GL+   CL+ L  P+ R  ++ RL+G+  E SV+Y
Sbjct  129  ITRQSSSKIGELVWEVKLDSVALMLGLVGNICLSFLFFPINRGSSILRLVGVTSESSVKY  188

Query  629  HTWLGTAMIVFATLHGAGTFFIW  697
            H WLG  ++   T HG      W
Sbjct  189  HIWLGHTVLTLFTAHGVCYIIYW  211



>ref|XP_009609066.1| PREDICTED: ferric reduction oxidase 2-like [Nicotiana tomentosiformis]
Length=718

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 71/210 (34%), Positives = 107/210 (51%), Gaps = 10/210 (5%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYL  262
            V+ G+  L I+ PT ++ + W  K   + A+++ FG  G    + TFP I  A++G VYL
Sbjct  31   VTIGYFLLLIVTPTNMYRQIWTPKIKAQTATSTYFGAQGRTLLLNTFPFIFIAVLGCVYL  90

Query  263  EQKKQKQKEGISRQE-RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTF--YTR  433
               K+   + I+R E ++ L     P+I+K  LGI+S IE+    +FI  L WTF  Y R
Sbjct  91   HLWKKSNDKNINRVEGKQKLTIWRRPIIMKG-LGIVSRIELCFFVMFIALLVWTFASYLR  149

Query  434  I--SNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQ  607
            I       K+V     K  VW+ ++     R GL+    L  L +PV R  +V ++ GL 
Sbjct  150  IIFPTITPKSVAKSGEK--VWEAKLENSGLRLGLVGNIALTFLFVPVTRGSSVLQVFGLT  207

Query  608  FEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
             E SV+YH WLG  ++   + HG      W
Sbjct  208  SEASVKYHIWLGHIVMTLFSAHGICYIIYW  237



>ref|XP_009368746.1| PREDICTED: ferric reduction oxidase 4-like isoform X2 [Pyrus 
x bretschneideri]
Length=690

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 104/203 (51%), Gaps = 6/203 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+ +WI+ PT+ +   W    + K +++ FG  G+   +++FPV+  A +  VYL  +K
Sbjct  19   GWLVIWIMMPTKTYKNGWMPNLQSKLNSTYFGEQGVNLLLFSFPVMLIAALSCVYLHLQK  78

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF-R  451
            +      +  +   LAF   P++VK+ LGI++ IE+    +F+  L W+    +   F  
Sbjct  79   KSISTTTTGIKTNRLAFWRRPVVVKAPLGIVTAIELAFGLMFVSLLVWSLANYLYVSFGH  138

Query  452  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
              +     K  VW+ +   V+ R G +   C ALL  PV R  ++  L GL  E S++YH
Sbjct  139  LHIHMPGEK--VWEAKFRSVSLRLGYIGNICWALLFFPVTRGSSILPLFGLTSESSIKYH  196

Query  632  TWLGT-AMIVFATLHGAGTFFIW  697
             WLG  +MI+FA  H  G    W
Sbjct  197  IWLGHLSMILFAA-HTVGFVIYW  218



>gb|KHN46714.1| Ferric reduction oxidase 2 [Glycine soja]
Length=683

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 85/166 (51%), Gaps = 6/166 (4%)
 Frame = +2

Query  215  YTFPVIAFAIVGFVYLE-QKKQKQKEGISRQERRC-LAFLSNPLIVKSSLGILSGIEILG  388
            YTFP++  A +G VYL   KK       S   ++C +     P+++K  LGI+SG EI  
Sbjct  39   YTFPILLLATLGCVYLHIGKKVIHSNTESCNAKKCGVTIWKRPVLIKGPLGIVSGTEIAF  98

Query  389  VSLFIIFLAWTFYTRISNDFRKTVQ---TKDFKLAVWQYRMLRVATRFGllteaclalll  559
            + LFI  LAW F T + N F         KD +  +W+ ++ RVA R G++   CLA + 
Sbjct  99   LFLFIALLAWVFSTSVQNSFATITPQFAAKDGQ-KIWEEKLDRVAKRLGVVGNICLAFMF  157

Query  560  lpvlRRMAVFRLLGLQFEVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
             PV R  +V  LL L  E  ++YH WLG   +   T HG     +W
Sbjct  158  FPVARGSSVLPLLDLTSESCIKYHIWLGNIAMTLFTSHGLCYIILW  203



>ref|XP_002305245.2| ferric-chelate reductase family protein [Populus trichocarpa]
 gb|EEE85756.2| ferric-chelate reductase family protein [Populus trichocarpa]
Length=689

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 105/204 (51%), Gaps = 7/204 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+ +WI+ PT+++  TW      K +++ F   G    + +FP++  A +G +YL  KK
Sbjct  17   GWLVVWIMLPTKLYKITWTPKLNSKLNSTYFSGQGTNLLLLSFPMMFIAALGCIYLHAKK  76

Query  275  QKQKEGISRQ--ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  448
            Q Q+   S+       L+FL  P +V + LG ++ +E+  V++FI  L W+    +   F
Sbjct  77   Q-QRSSYSKSVVTSNRLSFLRRPALVMAPLGTVTAMELAFVAMFIALLIWSLGNYLYVSF  135

Query  449  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
                  K  +  VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++Y
Sbjct  136  GHLHIHKQGE-KVWQAKFRSVSLRLGYVGNICWAFLFFPVTRGSSILPLVGLTSESSIKY  194

Query  629  HTWLGT-AMIVFATLHGAGTFFIW  697
            H WLG  +MI+FA  H  G    W
Sbjct  195  HIWLGHLSMILFAA-HTVGFVIYW  217



>ref|XP_008234849.1| PREDICTED: ferric reduction oxidase 4-like [Prunus mume]
Length=690

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 97/201 (48%), Gaps = 5/201 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+ +W + PT+ +   W    + K +++ FG  G+   + +FP++  A +  VYL  +K
Sbjct  21   GWLMIWTMLPTKTYKNVWTLNLQSKLNSTYFGAQGVNLLLLSFPMMLIAALSCVYLHFQK  80

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
            Q     I+      L F   P +VK+ LGI++ +E+  V +F   L W+    +   F  
Sbjct  81   QSNSSVITTSR---LTFWRRPAVVKAPLGIVTAMELAFVIMFAALLVWSLANYLYVSFGH  137

Query  455  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  634
                KD +  VW+ +   V+ R G +   C A L  PV R  ++  L GL  E S++YH+
Sbjct  138  LHMHKDGE-KVWEAKFRSVSLRLGYIGNICWAFLFFPVTRGSSILPLFGLTSESSIKYHS  196

Query  635  WLGTAMIVFATLHGAGTFFIW  697
            WLG   ++    H  G    W
Sbjct  197  WLGHLSMILFVAHTLGFIIYW  217



>ref|XP_010919103.1| PREDICTED: ferric reduction oxidase 2-like [Elaeis guineensis]
Length=673

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 95/199 (48%), Gaps = 9/199 (5%)
 Frame = +2

Query  110  LWILKPTQVWTRTWKAAEEKASASV-FGYNGLCFAVYTFPVIAFAIVGFV--YLEQKKQK  280
            +W++ PT+ + +TW+      + S  FG  G    ++TFP++  A VG +  +LEQK   
Sbjct  2    MWVVVPTRTYRKTWQPKLLSETNSTWFGRQGTTILIFTFPILFIAAVGCICLHLEQKSGN  61

Query  281  QKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKTV  460
               G     RR L     P++VK  LGI+S IE+     F+  L W F   +S       
Sbjct  62   AHSG---SLRRRLEAWRKPVLVKGPLGIVSAIELAFCLKFLALLIWAFSNYVSVGL---A  115

Query  461  QTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTWL  640
              K      WQ ++  V    GL+   C A L  PV R  ++  L+GL  E S+RYH WL
Sbjct  116  NLKAEGAESWQAKLGTVGVMLGLVGNICCAFLFFPVARGSSLLPLVGLTSEASIRYHVWL  175

Query  641  GTAMIVFATLHGAGTFFIW  697
            G  ++V  T HG     +W
Sbjct  176  GHIVMVLFTAHGVCFVILW  194



>ref|NP_001234329.1| ferric-chelate reductase [Solanum lycopersicum]
 gb|AAP46144.1| ferric-chelate reductase [Solanum lycopersicum]
Length=719

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 68/209 (33%), Positives = 109/209 (52%), Gaps = 8/209 (4%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYL  262
            V+ G+  L I+ PT ++ + W  K      +++ FG  G    + TFP+I  A++G VYL
Sbjct  32   VTIGYFLLLIVTPTNMYRQIWTPKIKAHTTNSTYFGAQGRTLLMNTFPLIFIAVLGCVYL  91

Query  263  EQKKQKQKEGISR-QERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  439
               K+   + I+R ++++ LA    P+I+K  LGI+S IE+    +FI  L WTF + + 
Sbjct  92   HLWKKSNNKNINRFEKKQKLAIWRRPIIMK-GLGIVSRIELGFFVMFIALLVWTFASYLH  150

Query  440  NDFRKTVQTKDFKLA---VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQF  610
              F  T+  K    +   VW+ ++     R GL+   CL  L +PV R  +V ++ GL  
Sbjct  151  IIF-PTITPKSVANSGEKVWEAKLEDSGLRLGLVGNICLTFLFVPVTRGSSVLQVFGLTS  209

Query  611  EVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            E SV+YH WLG  ++   + HG      W
Sbjct  210  EASVKYHIWLGHIVMTLFSAHGICYIIYW  238



>ref|XP_011093123.1| PREDICTED: LOW QUALITY PROTEIN: ferric reduction oxidase 2-like 
[Sesamum indicum]
Length=681

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 97/202 (48%), Gaps = 7/202 (3%)
 Frame = +2

Query  110  LWILKPTQVWTRTWKAAEEKASASVF--GYNGLCFAVYTFPVIAFAIVGFVYLEQKKQKQ  283
            +W++ PT  + +TW       +AS +     G  + V+TFPV+  A +G +YL    Q +
Sbjct  1    MWVMMPTNAYRQTWLPELRSQTASTYFGTTQGATYLVFTFPVVFIAALGCLYLHLGNQSR  60

Query  284  KEGISRQER--RCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  457
               +++       L     PLI+K  LGI+SGIE+    +FI  L W F   +   F K 
Sbjct  61   FNNLTKGSNGGHRLGKYQRPLIIKG-LGIVSGIELAFFLMFIALLLWNFAAYLQLSFPKI  119

Query  458  VQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
                  +    VW+ ++   A R GL+    L+ L  PV R  +V  +LGL +E SV+YH
Sbjct  120  TPNSAAQSGEKVWEAKLDAAALRLGLVGNIGLSFLFFPVTRGSSVLGVLGLTWEASVKYH  179

Query  632  TWLGTAMIVFATLHGAGTFFIW  697
             W+G  ++   T HG      W
Sbjct  180  IWVGHIVMTLFTAHGLCYLIYW  201



>ref|XP_010661832.1| PREDICTED: ferric reduction oxidase 2 isoform X1 [Vitis vinifera]
 emb|CBI40431.3| unnamed protein product [Vitis vinifera]
Length=714

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 97/196 (49%), Gaps = 4/196 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G + L+++ PT  + + W         ++ FG  G    +YTFPV+  A++G  YL   K
Sbjct  33   GILVLFVMMPTNTYKKKWFVQVVATTDSTYFGRQGATILIYTFPVLFSAVLGCAYLHLGK  92

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
            +          +  LA L  P++VK  LGI+S IE+L + +FI  L W+ YT +   F+ 
Sbjct  93   KLNNNKSKSSPKDRLAVLKRPVLVKGPLGIVSMIEMLFLVMFIALLVWSIYTYLRTGFQG  152

Query  455  TVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
             ++ K  K    +W  ++   A R  L     LA L  PV R  ++  L+GL  E S++Y
Sbjct  153  -IEDKAAKKGEKLWVSKLGAAALRLALTGNIALAFLFFPVARGSSILPLIGLTSEASIKY  211

Query  629  HTWLGTAMIVFATLHG  676
            H WLG   +   T HG
Sbjct  212  HIWLGHTCLTLFTTHG  227



>ref|XP_009368744.1| PREDICTED: ferric reduction oxidase 2-like [Pyrus x bretschneideri]
Length=721

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 99/195 (51%), Gaps = 2/195 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G++ +WI+ PT  +   W     +K  ++ FG  G    +YTFP++  A +G + L    
Sbjct  39   GYMMIWIIMPTNTYYLKWFPHIHKKTDSTYFGQEGADILIYTFPILFTATMGCLLLHMGN  98

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR-  451
            +       R ++   A  + P +VK  LGI+S IE+  + +FI    W+  + + + F  
Sbjct  99   KNVDLNNQRAKKSYRASWNRPALVKGPLGIVSCIELSFLVMFIALFVWSISSYLHDMFAY  158

Query  452  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
             T++    K  VW+ ++  VA   G++    LA L  PV R  ++ +++GL  E S++YH
Sbjct  159  ATLEAAAKKEHVWENKLGSVALTLGIVGNIGLAFLFFPVSRCSSILQIIGLTSEASIKYH  218

Query  632  TWLGTAMIVFATLHG  676
             WLG  ++   T HG
Sbjct  219  IWLGHLVMTLFTAHG  233



>ref|XP_010055095.1| PREDICTED: ferric reduction oxidase 2-like isoform X1 [Eucalyptus 
grandis]
Length=722

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 103/209 (49%), Gaps = 12/209 (6%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE--  265
            G V + I+ PT  + + W  +   +  +++ FG  G    ++TFPV+  A +G VYL   
Sbjct  35   GTVLILIMLPTNTYRKHWSVSIRAKSGTSTFFGSQGYTMLMFTFPVLFIASLGCVYLHLG  94

Query  266  QKKQKQKEGISRQER-RCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
             K  + + G +  ER + LA    P++V   LGI+S  E+  + +F+  L W+F T + N
Sbjct  95   NKSSEPRVGKNGIERSKVLATWKRPVLVSGPLGIVSWTELAFLVMFVALLIWSFATYLRN  154

Query  443  DF----RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQF  610
             F    R+     D    VW+ ++     R GL+    LA L  PV R  +V  L GL  
Sbjct  155  SFLNIDRQGPMHGD---KVWEAKLEDSGLRLGLVGNIVLAFLFFPVTRLSSVLPLFGLTS  211

Query  611  EVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            E S++YH WLG  ++V  T HG      W
Sbjct  212  EASIKYHIWLGHIVMVIFTAHGLTYIIYW  240



>ref|XP_002275942.2| PREDICTED: ferric reduction oxidase 2 isoform X2 [Vitis vinifera]
Length=713

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 99/196 (51%), Gaps = 5/196 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G + L+++ PT  + + W         ++ FG  G    +YTFPV+  A++G  YL   K
Sbjct  33   GILVLFVMMPTNTYKKKWFVQVVATTDSTYFGRQGATILIYTFPVLFSAVLGCAYLHLGK  92

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
             K     S+  +  LA L  P++VK  LGI+S IE+L + +FI  L W+ YT +   F+ 
Sbjct  93   -KLNNNKSKSPKDRLAVLKRPVLVKGPLGIVSMIEMLFLVMFIALLVWSIYTYLRTGFQG  151

Query  455  TVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
             ++ K  K    +W  ++   A R  L     LA L  PV R  ++  L+GL  E S++Y
Sbjct  152  -IEDKAAKKGEKLWVSKLGAAALRLALTGNIALAFLFFPVARGSSILPLIGLTSEASIKY  210

Query  629  HTWLGTAMIVFATLHG  676
            H WLG   +   T HG
Sbjct  211  HIWLGHTCLTLFTTHG  226



>emb|CAA70769.1| FRO1 [Arabidopsis thaliana]
Length=704

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 64/209 (31%), Positives = 102/209 (49%), Gaps = 11/209 (5%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVF-GYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + +WI+ PT  +   W  +   K   S++ G  G+   VY FP+I  A +G +YL  K
Sbjct  25   GTIVIWIMMPTSTYKEIWLTSMRAKLGKSIYYGRPGVNLLVYMFPMILLAFLGCIYLHLK  84

Query  272  KQ---KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTF----YT  430
            K     Q      ++R     L  P++V   LGI++  E++ +++F+  L W+     Y 
Sbjct  85   KSTTVNQFNSGVEKKRAKFGALRRPMLVNGPLGIVTVTEVMFLTMFMALLLWSLANYMYR  144

Query  431  RISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQF  610
               N   ++  T    L  WQ R+  +A R G++   CLA L  PV R  ++   +GL  
Sbjct  145  TFVNVTSESAATDGNNL--WQARLDLIAVRIGIVGNICLAFLFYPVARGSSLLAAVGLTS  202

Query  611  EVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            E S++YH WLG  +++  T HG   F  W
Sbjct  203  ESSIKYHIWLGHLVMIIFTSHGLCYFIYW  231



>ref|NP_171665.1| ferric reduction oxidase 1 [Arabidopsis thaliana]
 sp|Q9LMM2.1|FRO1_ARATH RecName: Full=Probable ferric reduction oxidase 1; Short=AtFRO1; 
AltName: Full=Ferric-chelate reductase 1 [Arabidopsis thaliana]
 gb|AAF81317.1|AC061957_13 Identical to a FRO1 protein from Arabidopsis thaliana gb|Y09581 
and contains a ferric reductase like transmembrane component 
PF|01794 [Arabidopsis thaliana]
 gb|AEE27309.1| ferric reduction oxidase 1 [Arabidopsis thaliana]
Length=704

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 64/209 (31%), Positives = 102/209 (49%), Gaps = 11/209 (5%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVF-GYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + +WI+ PT  +   W  +   K   S++ G  G+   VY FP+I  A +G +YL  K
Sbjct  25   GTIVIWIMMPTSTYKEIWLTSMRAKLGKSIYYGRPGVNLLVYMFPMILLAFLGCIYLHLK  84

Query  272  KQ---KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTF----YT  430
            K     Q      ++R     L  P++V   LGI++  E++ +++F+  L W+     Y 
Sbjct  85   KSTTVNQFNSGVEKKRAKFGALRRPMLVNGPLGIVTVTEVMFLTMFMALLLWSLANYMYR  144

Query  431  RISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQF  610
               N   ++  T    L  WQ R+  +A R G++   CLA L  PV R  ++   +GL  
Sbjct  145  TFVNVTSESAATDGNNL--WQARLDLIAVRIGIVGNICLAFLFYPVARGSSLLAAVGLTS  202

Query  611  EVSVRYHTWLGTAMIVFATLHGAGTFFIW  697
            E S++YH WLG  +++  T HG   F  W
Sbjct  203  ESSIKYHIWLGHLVMIIFTSHGLCYFIYW  231



>ref|XP_002892052.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68311.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=704

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/208 (31%), Positives = 105/208 (50%), Gaps = 9/208 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVF-GYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G + +WI+ PT  +   W      K   S++ G  G+   VY FP+I  A +G +YL   
Sbjct  25   GTIVIWIMMPTSTYKEIWLTPMRAKLGKSMYYGKQGVNLLVYMFPMILLAFLGCIYLHLM  84

Query  272  KQ---KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
            KQ    Q      ++R   A L  P++V   LGI++  E++ +++F+  L W+    I  
Sbjct  85   KQTTVNQFNSGVEKKRAKFAALRRPMLVTGPLGIVTVTEVMFLTMFMALLLWSLTNYIYR  144

Query  443  DFRKTVQTKDF---KLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFE  613
             F  T+ ++     + ++WQ R+  +A R G++   CLA L  PV R  ++   +GL  E
Sbjct  145  TF-VTITSESAATDRNSLWQARLDLIAVRLGIVGNICLAFLFYPVARGSSLLAAVGLTSE  203

Query  614  VSVRYHTWLGTAMIVFATLHGAGTFFIW  697
             S++YH WLG  +++  T HG   F  W
Sbjct  204  SSIKYHIWLGHLVMILFTSHGLCYFIYW  231



>ref|XP_007038790.1| Ferric reduction oxidase 4 isoform 2 [Theobroma cacao]
 gb|EOY23291.1| Ferric reduction oxidase 4 isoform 2 [Theobroma cacao]
Length=648

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 101/201 (50%), Gaps = 4/201 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+++W++ PT+++  TW+   + K +++ +   G    +++FP++  A  G  YL    
Sbjct  17   GWLTIWVMLPTKLYKYTWRPKLDSKLNSTYYAAQGTNLLLFSFPMMFIAAFGCAYLH--F  74

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
            QK+    + +    +AFL  P++V + LGI+S ++++  ++F+  + W+    +   F  
Sbjct  75   QKKSRASNSKSSGAVAFLKRPVLVMAPLGIVSALDLIFSAMFVALMIWSLANYLYVSFGH  134

Query  455  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  634
             +        +WQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++YH 
Sbjct  135  -LHMDGVGEKIWQAKFRSVSLRLGYIGNICWAFLFFPVTRASSLLPLVGLTSESSIKYHI  193

Query  635  WLGTAMIVFATLHGAGTFFIW  697
            WLG    +    H  G    W
Sbjct  194  WLGHVSNILFVAHTIGFIIYW  214



>emb|CAN82573.1| hypothetical protein VITISV_034719 [Vitis vinifera]
Length=792

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 97/196 (49%), Gaps = 4/196 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G + L+++ PT  + + W         ++ FG  G    +YTFPV+  A++G  YL   K
Sbjct  33   GILVLFVMMPTNTYKKKWFVQVVATTDSTYFGRQGATILIYTFPVLFSAVLGCAYLHLGK  92

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
            +          +  LA L  P++VK  LGI+S IE+L + +FI  L W+ YT +   F +
Sbjct  93   KLNNNKSKSSPKDRLAVLKRPVLVKGPLGIVSMIEMLFLVMFIALLVWSIYTYLRTGF-Q  151

Query  455  TVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  628
             ++ K  K    +W  ++   A R  L     LA L  PV R  ++  L+GL  E S++Y
Sbjct  152  GIEDKAAKKGEKLWVSKLGAAALRLALTGNIALAFLFFPVARGSSILPLIGLTSEASIKY  211

Query  629  HTWLGTAMIVFATLHG  676
            H WLG   +   T HG
Sbjct  212  HIWLGHTCLTLFTTHG  227



>ref|XP_007135107.1| hypothetical protein PHAVU_010G101500g [Phaseolus vulgaris]
 gb|ESW07101.1| hypothetical protein PHAVU_010G101500g [Phaseolus vulgaris]
Length=718

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 99/206 (48%), Gaps = 6/206 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            GW+ +W++ PT  +   W  K   +  + +  G  G    +YTFP++  A +G VYL   
Sbjct  33   GWIFIWVMSPTNTYRERWLPKYRAKTNTTTYLGSKGSNLLMYTFPILLIATLGCVYLHIT  92

Query  272  KQKQKEGIS--RQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            K+     +     ++  +A    P+++K  LGI+SG E+    +FI  L W+F   + N 
Sbjct  93   KKTNDSTMESCNSKKHKVAIWKRPVLIKGPLGIVSGTELAFFLMFIALLVWSFAATLRNK  152

Query  446  FRKTVQTK--DFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
            F K       +    +WQ ++   A  FG++   CL  +  PV R  ++  LLGL  E  
Sbjct  153  FAKVTPESAAEDGHNIWQEKVDITALMFGVVGNICLVFMFFPVARGSSLLPLLGLTSESC  212

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG   +V  T HG     +W
Sbjct  213  IKYHIWLGHIALVLFTAHGLSYITLW  238



>ref|XP_007038789.1| Ferric reduction oxidase 4 isoform 1 [Theobroma cacao]
 gb|EOY23290.1| Ferric reduction oxidase 4 isoform 1 [Theobroma cacao]
Length=694

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 101/201 (50%), Gaps = 4/201 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+++W++ PT+++  TW+   + K +++ +   G    +++FP++  A  G  YL    
Sbjct  17   GWLTIWVMLPTKLYKYTWRPKLDSKLNSTYYAAQGTNLLLFSFPMMFIAAFGCAYLH--F  74

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
            QK+    + +    +AFL  P++V + LGI+S ++++  ++F+  + W+    +   F  
Sbjct  75   QKKSRASNSKSSGAVAFLKRPVLVMAPLGIVSALDLIFSAMFVALMIWSLANYLYVSFGH  134

Query  455  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  634
             +        +WQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++YH 
Sbjct  135  -LHMDGVGEKIWQAKFRSVSLRLGYIGNICWAFLFFPVTRASSLLPLVGLTSESSIKYHI  193

Query  635  WLGTAMIVFATLHGAGTFFIW  697
            WLG    +    H  G    W
Sbjct  194  WLGHVSNILFVAHTIGFIIYW  214



>gb|KCW87545.1| hypothetical protein EUGRSUZ_B03992 [Eucalyptus grandis]
Length=684

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 98/193 (51%), Gaps = 2/193 (1%)
 Frame = +2

Query  125  PTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQKQKEGISRQ  304
            PT+  T  +   E+  S +++G  G    +YT P++  A++   YL        + ++ +
Sbjct  6    PTEFGTDFYTDWEDATSGTLYGTEGSALLLYTGPILLIAVLAVPYLLLSGGDDDDVVAEK  65

Query  305  ERRC-LAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKTVQTKDFKL  481
            ++   L   + P++V    G+++  E +G+++F++F+AW  Y     +F       D   
Sbjct  66   KKSPRLRLGTFPVLVDGVFGVVTAAEFIGIAMFVVFVAWAVYGYTVVNFEMLPTYGDLTP  125

Query  482  AVWQYRMLRVATR-FGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTWLGTAMIV  658
               + +ML+++   FGL    CLA L LPV R   + RL+G+ FE + RYH WLG   + 
Sbjct  126  LEKRVQMLQMSAYIFGLTALTCLAFLFLPVARGSILLRLIGIPFEHATRYHVWLGNLTMF  185

Query  659  FATLHGAGTFFIW  697
              T+HG   F +W
Sbjct  186  LLTMHGLCYFIVW  198



>ref|XP_007220890.1| hypothetical protein PRUPE_ppa014767mg [Prunus persica]
 gb|EMJ22089.1| hypothetical protein PRUPE_ppa014767mg [Prunus persica]
Length=684

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/201 (29%), Positives = 97/201 (48%), Gaps = 6/201 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+ +W + PT+ +   W    + K +++ FG  G+   + +FP++  A +  VYL  +K
Sbjct  16   GWLMIWTMLPTKTYKNVWTLNLQSKLNSTYFGAQGVNLLLLSFPMMLIAALSCVYLHFQK  75

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
            Q     I+ +    L F   P +VK+ LGI++ +E+    +F   L W+    +   F  
Sbjct  76   QSNSSVITSR----LTFWRRPAVVKAPLGIVTAMELAFAIMFAALLVWSLANYLYVSFGH  131

Query  455  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  634
                KD +  VW+ +   V+ R G +   C A L  PV R  ++  L GL  E S++YH+
Sbjct  132  LHMHKDGE-KVWEAKFRSVSLRLGYIGNICWAFLFFPVTRGSSILPLFGLTSESSIKYHS  190

Query  635  WLGTAMIVFATLHGAGTFFIW  697
            WLG   ++    H  G    W
Sbjct  191  WLGHLSMILFVAHTLGFIIYW  211



>ref|XP_012090201.1| PREDICTED: ferric reduction oxidase 4-like isoform X3 [Jatropha 
curcas]
Length=676

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 99/203 (49%), Gaps = 16/203 (8%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  271
            GW+ +W++ PT+++   W      K   S F   G    +++FPV+  AI G VYL  QK
Sbjct  16   GWIMIWVMLPTKLYDNKWTPKLTSKLINSKFEVQGTNLLLFSFPVMFIAISGCVYLHLQK  75

Query  272  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  451
            K K     S  +RR       P++V + LGI + +EI    +FI  L W+    +   F 
Sbjct  76   KLKN----SSSKRR-------PVLVMAPLGIFTAVEIAFAVMFIALLIWSLANYLYVSFG  124

Query  452  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
                 K  +  VWQ +   V+ R G +   C A L  PV R  +V  L+GL  E S++YH
Sbjct  125  HLHMDKQGE-KVWQAKFRSVSLRLGYIGNICWAFLFFPVTRGSSVLPLVGLTSESSIKYH  183

Query  632  TWLGT-AMIVFATLHGAGTFFIW  697
             WLG  +MI+FA  H  G    W
Sbjct  184  IWLGHLSMILFAA-HTIGFIIYW  205



>gb|EYU32154.1| hypothetical protein MIMGU_mgv1a002115mg [Erythranthe guttata]
Length=711

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 66/204 (32%), Positives = 103/204 (50%), Gaps = 9/204 (4%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVF-GYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G + +WI+ PT  +   W      A+ S F G  G     +TFP++  AI+G +YL    
Sbjct  31   GNIMMWIIMPTDTYYNDWLLHILAATNSTFFGIQGPIMLDFTFPILFIAILGCLYLHLGN  90

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
            + Q     R ++  L F + P+IVK  LGI++  E+  ++LFI    W F   I + F++
Sbjct  91   KLQPNFTPRDKK--LRFATKPMIVKG-LGIVTLTELALLTLFIALCVWYFADYIRHWFKQ  147

Query  455  TVQ---TKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
             +Q    KD KL  WQ ++ RV    G+    CL  +  PV R  ++  +LGL +E S++
Sbjct  148  ALQRSIDKDEKL--WQTKLDRVGIVTGVTGNLCLTFVFYPVTRSSSILPMLGLTYESSIK  205

Query  626  YHTWLGTAMIVFATLHGAGTFFIW  697
            YH W+G   ++  T HG      W
Sbjct  206  YHVWIGNLAMLLFTAHGFLYILYW  229



>ref|XP_008376640.1| PREDICTED: ferric reduction oxidase 4-like isoform X1 [Malus 
domestica]
Length=693

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 105/205 (51%), Gaps = 7/205 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  271
            GW+ +WI+ PT+ +   W    + K +++ FG  G+   +++FPV+  A +  VYL  QK
Sbjct  19   GWLVIWIMMPTKTYKNGWMPNLQSKLNSTYFGEQGVNLLLFSFPVMLIAALSCVYLHLQK  78

Query  272  KQKQKEGISRQERRC--LAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  445
            K  +    +    +   LAF   P++VK+ LGI++ IE+    +F+  L W+    +   
Sbjct  79   KSIRSPSTTTTGVKTNRLAFWRRPVVVKAPLGIVTAIELAFGLMFVSLLVWSLANYLYVS  138

Query  446  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  625
            F + +        VW+ +   V+ R G +   C ALL  PV R  ++  L GL  E S++
Sbjct  139  FGQ-LHMHMPGEKVWEAKFRSVSLRLGYIGNICWALLFFPVTRGSSILPLFGLTSESSIK  197

Query  626  YHTWLGT-AMIVFATLHGAGTFFIW  697
            YH WLG  +MI+FA  H  G    W
Sbjct  198  YHIWLGHLSMILFAA-HTVGFVIYW  221



>ref|XP_009800600.1| PREDICTED: ferric reduction oxidase 2-like [Nicotiana sylvestris]
Length=715

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 101/205 (49%), Gaps = 6/205 (3%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  271
            G+  + I+ PT ++  TW  K     A+++ FG  G+   + TFP +  A++G +YL   
Sbjct  31   GYFLILIVSPTNMYYLTWTPKIKARAATSTYFGAQGMSLLLDTFPFLFIAVLGCIYLHLS  90

Query  272  KQKQKEGISRQE-RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTF--YTRISN  442
            K+   + I+R E +  LA    P+I+K  LGI++ IE+  + +FI  L W++  Y   + 
Sbjct  91   KKSSDKNINRVEGKEKLAIWRRPIIMK-GLGIVTRIELCFLVMFIALLVWSYASYLHAAF  149

Query  443  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  622
             F            VW+ ++       GL+    L  L +PV R  +V +L GL  E SV
Sbjct  150  PFITPQSVAQSGQKVWEVKLEEAGLMLGLVGNVVLTFLFVPVTRGSSVLQLFGLTSEASV  209

Query  623  RYHTWLGTAMIVFATLHGAGTFFIW  697
            +YH WLG  ++   + HG      W
Sbjct  210  KYHIWLGHIVMTLFSAHGICYIIYW  234



>ref|XP_012090729.1| PREDICTED: probable ferric reduction oxidase 1 [Jatropha curcas]
Length=349

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 100/206 (49%), Gaps = 3/206 (1%)
 Frame = +2

Query  89   VSTGWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  265
            V  G++ +W++K T  +   W        +++ FG  G    VYTFPV+  A +   YL 
Sbjct  13   VFLGYMMIWVMKATNTYYLHWLPNIHSHINSTFFGEQGANMLVYTFPVLFIAALACAYLH  72

Query  266  -QKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
              KK   +E  +R+      +   P++VK  LGI+  IEI  + +F   L W+FY+ + +
Sbjct  73   LGKKFPHQETENRKVDSWFGWWRRPVLVKGPLGIVLWIEISFLGIFFALLIWSFYSYLHD  132

Query  443  DFR-KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
             F   +++     + +W+ ++       GL+   CLA L  PV R  ++ + +GL  E S
Sbjct  133  LFAYASLEAAYSGIQLWEAKLENAGLSLGLVGNVCLAFLFFPVTRGSSILQFIGLTSEAS  192

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG   +   T HG      W
Sbjct  193  IKYHIWLGHTTLAIFTAHGLCYLVFW  218



>gb|ABU54827.1| ferric reductase [Malus baccata var. xiaojinensis]
Length=721

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/195 (29%), Positives = 99/195 (51%), Gaps = 2/195 (1%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G++ +WI+ PT  +   W     +K  ++ FG  G    +YTFP++  A +G + L    
Sbjct  39   GYMMIWIIMPTNTYYLKWFPHIHKKTDSTYFGQEGADILIYTFPILFTATMGCLLLHMGN  98

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR-  451
            +       R ++   A  + P +VK  +GI+S IE+  + +FI  L W+  + + + F  
Sbjct  99   KNVDINNQRAKKSYRASWNRPALVKGPIGIVSWIELSFLVMFIALLVWSISSYLHDMFAY  158

Query  452  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
             T++    K  VW+ ++  V    G++    LA L  PV R  ++ +++GL  E S++YH
Sbjct  159  ATLEAAAKKEHVWENKLGSVVLTLGIVGNIGLAFLFFPVSRGSSILQIIGLTSEASIKYH  218

Query  632  TWLGTAMIVFATLHG  676
             WLG  ++   T HG
Sbjct  219  IWLGHLVMTLFTAHG  233



>ref|XP_011470323.1| PREDICTED: ferric reduction oxidase 2-like [Fragaria vesca subsp. 
vesca]
Length=719

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 102/206 (50%), Gaps = 12/206 (6%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  271
            G+  +WI+ PT  +   W      K  ++ FG  G    VYTFP++  A +G + L  Q 
Sbjct  37   GYSMIWIMMPTNTYYLHWLPDIHAKTDSTYFGQQGAGILVYTFPILFIATLGCLLLHIQN  96

Query  272  K---QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  442
            K    K + G+ +      +    P++VK  LGI+S IE+  +++FI  L W+  + +  
Sbjct  97   KTADNKNQSGVMK------SLWKRPVLVKGPLGIVSWIELSFLAMFIALLVWSISSYLHG  150

Query  443  DFRK-TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  619
             F   ++Q    +  VWQ ++   A   GL+   CLA L  PV R  ++ +L+GL  E S
Sbjct  151  MFATISLQAAAKREHVWQAKLESTALMLGLVGNICLAFLFFPVARGSSILQLVGLTSEAS  210

Query  620  VRYHTWLGTAMIVFATLHGAGTFFIW  697
            ++YH WLG  ++   T HG      W
Sbjct  211  IKYHIWLGHLVMTIFTAHGLCYIIFW  236



>ref|XP_004253331.2| PREDICTED: ferric reduction oxidase 4 [Solanum lycopersicum]
Length=689

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 93/196 (47%), Gaps = 4/196 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEE-KASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            GW+ +W++ PT  +  +W      K +++ F   G+   ++TFP++  A V  VYL    
Sbjct  17   GWLFIWVMLPTPTYKNSWTPHLLIKLNSTYFREQGINLLLFTFPIMLIAAVSCVYLHLYN  76

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
            +       R   +   +   P +V  SLGI++ +E++  ++F + L W+    I   +  
Sbjct  77   KSTSN--HRSSNKVREYFRRPRLVIESLGIVNAVELIFAAMFTVLLIWSLANYIYISY-G  133

Query  455  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  634
             +   +    VW  +   VA R G +   C A L  PV R  ++  L+GL  E S++YH 
Sbjct  134  NLHMHNPAEKVWMAKFRSVALRLGYIGNVCYAFLFFPVTRLSSILPLVGLTSESSIKYHI  193

Query  635  WLGTAMIVFATLHGAG  682
            WLG   +  A LH  G
Sbjct  194  WLGHLSMALAVLHSVG  209



>ref|XP_009800599.1| PREDICTED: ferric reduction oxidase 2-like isoform X2 [Nicotiana 
sylvestris]
Length=713

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 3/195 (2%)
 Frame = +2

Query  98   GWVSLWILKPTQVWTRTWKAAEEKASASVF-GYNGLCFAVYTFPVIAFAIVGFVYLEQKK  274
            G + +W++ PT  + + W  A   A+ S F    G     +T P++  A++G +Y+  +K
Sbjct  35   GNLMMWVIMPTFTYYQKWVPALLAATNSTFFDIQGPIMMNFTLPILFIAVLGCIYVHLEK  94

Query  275  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  454
            QK     S   +  L  L  P I+K  LGI++ IE+  +++FII   W F   +   +  
Sbjct  95   QKSYSVTSYCNKDWLKVLKKPKIIKP-LGIVTWIELFFLAMFIILCVWYFSAFVYFHYST  153

Query  455  TVQTKDFK-LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  631
                   K + VWQ R+ R+A   GL    CL  L  PV R  ++  LLGL  E S++YH
Sbjct  154  ITTYAATKGVQVWQARIDRLALVIGLTGNICLTFLFYPVSRGSSILPLLGLTSEGSIKYH  213

Query  632  TWLGTAMIVFATLHG  676
             WLG   +   T+HG
Sbjct  214  IWLGHMAMTLFTIHG  228



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1211687344902