BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10802

Length=676
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009613748.1|  PREDICTED: non-specific lipid-transfer prote...    122   1e-31   
ref|XP_010320740.1|  PREDICTED: non-specific lipid-transfer prote...    121   4e-31   
ref|XP_011076327.1|  PREDICTED: non-specific lipid-transfer prote...    119   2e-30   Sesamum indicum [beniseed]
emb|CDP00664.1|  unnamed protein product                                119   2e-30   Coffea canephora [robusta coffee]
ref|XP_008243280.1|  PREDICTED: non-specific lipid-transfer prote...    113   5e-28   Prunus mume [ume]
ref|XP_007044235.1|  Bifunctional inhibitor/lipid-transfer protei...    112   1e-27   
ref|XP_007226001.1|  hypothetical protein PRUPE_ppa013833mg             112   1e-27   Prunus persica
ref|XP_004137484.1|  PREDICTED: non-specific lipid-transfer prote...    112   1e-27   Cucumis sativus [cucumbers]
ref|XP_008460998.1|  PREDICTED: non-specific lipid-transfer prote...    111   2e-27   
ref|XP_003620406.1|  Non-specific lipid-transfer protein                110   3e-27   Medicago truncatula
ref|XP_006468752.1|  PREDICTED: probable non-specific lipid-trans...    110   6e-27   Citrus sinensis [apfelsine]
gb|AFK34114.1|  unknown                                                 110   6e-27   Medicago truncatula
gb|KHN44569.1|  Putative non-specific lipid-transfer protein AKCS9      109   8e-27   Glycine soja [wild soybean]
ref|XP_006448406.1|  hypothetical protein CICLE_v10017614mg             109   9e-27   
ref|XP_007152725.1|  hypothetical protein PHAVU_004G154200g             109   1e-26   Phaseolus vulgaris [French bean]
ref|XP_004512892.1|  PREDICTED: probable non-specific lipid-trans...    108   3e-26   Cicer arietinum [garbanzo]
ref|XP_009357223.1|  PREDICTED: non-specific lipid-transfer prote...    107   5e-26   
ref|XP_008389256.1|  PREDICTED: non-specific lipid-transfer prote...    107   1e-25   
ref|NP_001235108.1|  uncharacterized protein LOC100306442 precursor     106   2e-25   Glycine max [soybeans]
ref|XP_002527025.1|  Nonspecific lipid-transfer protein, putative       105   3e-25   
ref|XP_008339633.1|  PREDICTED: non-specific lipid-transfer prote...    105   4e-25   
ref|XP_012075730.1|  PREDICTED: non-specific lipid-transfer prote...    105   6e-25   Jatropha curcas
gb|AFK37583.1|  unknown                                                 104   7e-25   Lotus japonicus
ref|XP_009360132.1|  PREDICTED: non-specific lipid-transfer prote...    104   1e-24   Pyrus x bretschneideri [bai li]
ref|XP_008240231.1|  PREDICTED: non-specific lipid-transfer prote...    104   1e-24   Prunus mume [ume]
gb|KJB34314.1|  hypothetical protein B456_006G059100                    103   1e-24   Gossypium raimondii
ref|XP_008393327.1|  PREDICTED: non-specific lipid-transfer prote...    104   1e-24   
emb|CDP02751.1|  unnamed protein product                                103   1e-24   Coffea canephora [robusta coffee]
gb|KEH44195.1|  Lipid transfer protein                                  103   1e-24   Medicago truncatula
ref|XP_007211115.1|  hypothetical protein PRUPE_ppa025024mg             103   2e-24   
ref|XP_010044111.1|  PREDICTED: non-specific lipid-transfer prote...    103   2e-24   
gb|KHN42434.1|  Putative non-specific lipid-transfer protein AKCS9      103   3e-24   Glycine soja [wild soybean]
emb|CDY51937.1|  BnaAnng11140D                                          103   3e-24   Brassica napus [oilseed rape]
ref|XP_004299573.1|  PREDICTED: non-specific lipid-transfer prote...    102   4e-24   Fragaria vesca subsp. vesca
ref|NP_188456.1|  Bifunctional inhibitor/lipid-transfer protein/s...    102   5e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002322068.2|  protease inhibitor/seed storage/lipid transf...    102   7e-24   
gb|ABK92836.1|  unknown                                                 102   7e-24   Populus trichocarpa [western balsam poplar]
ref|XP_010279351.1|  PREDICTED: non-specific lipid-transfer prote...    102   8e-24   Nelumbo nucifera [Indian lotus]
ref|XP_006442592.1|  hypothetical protein CICLE_v10023053mg             101   1e-23   Citrus clementina [clementine]
ref|XP_010665172.1|  PREDICTED: non-specific lipid-transfer prote...    101   1e-23   Vitis vinifera
ref|XP_009347476.1|  PREDICTED: non-specific lipid-transfer prote...    102   1e-23   
emb|CDX75963.1|  BnaC03g40460D                                          101   1e-23   
ref|XP_002317903.2|  protease inhibitor/seed storage/lipid transf...    101   1e-23   
ref|NP_001236829.1|  uncharacterized protein LOC100500614 precursor     101   1e-23   Glycine max [soybeans]
emb|CDY24453.1|  BnaC05g35010D                                          101   2e-23   Brassica napus [oilseed rape]
emb|CDX92224.1|  BnaA05g21830D                                          101   2e-23   
ref|XP_008374782.1|  PREDICTED: non-specific lipid-transfer prote...    101   2e-23   
ref|XP_009145909.1|  PREDICTED: non-specific lipid-transfer prote...    101   2e-23   Brassica rapa
ref|XP_010032280.1|  PREDICTED: non-specific lipid-transfer prote...    100   2e-23   Eucalyptus grandis [rose gum]
dbj|BAM05641.1|  lipid transfer protein                                 100   3e-23   Eucalyptus pilularis
ref|XP_006299714.1|  hypothetical protein CARUB_v10015906mg             100   3e-23   Capsella rubella
gb|KJB52998.1|  hypothetical protein B456_008G287700                    100   5e-23   Gossypium raimondii
emb|CDY48021.1|  BnaA04g26690D                                        99.8    5e-23   Brassica napus [oilseed rape]
gb|EYU40792.1|  hypothetical protein MIMGU_mgv1a022792mg              99.0    6e-23   Erythranthe guttata [common monkey flower]
ref|XP_006406624.1|  hypothetical protein EUTSA_v10021828mg           99.8    7e-23   
gb|ACM78621.1|  non-specific lipid-transfer protein type 2            99.4    7e-23   Tamarix hispida
dbj|BAM05643.1|  lipid transfer protein                               99.0    1e-22   Eucalyptus pyrocarpa
ref|XP_010110085.1|  hypothetical protein L484_013260                 99.0    1e-22   
ref|XP_010036906.1|  PREDICTED: non-specific lipid-transfer prote...  98.6    1e-22   
gb|AFP49331.1|  non-specific lipid-transfer protein type 2            98.2    2e-22   Olea europaea
ref|XP_009113462.1|  PREDICTED: non-specific lipid-transfer prote...  98.6    2e-22   Brassica rapa
ref|XP_006383409.1|  hypothetical protein POPTR_0005s15210g           98.6    2e-22   Populus trichocarpa [western balsam poplar]
gb|ABK95885.1|  unknown                                               98.2    2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_011035101.1|  PREDICTED: non-specific lipid-transfer prote...  98.2    2e-22   Populus euphratica
ref|XP_006430726.1|  hypothetical protein CICLE_v10013191mg           98.2    2e-22   
ref|XP_008229268.1|  PREDICTED: non-specific lipid-transfer prote...  98.2    3e-22   Prunus mume [ume]
ref|XP_006482207.1|  PREDICTED: probable non-specific lipid-trans...  98.2    3e-22   
ref|XP_010534224.1|  PREDICTED: non-specific lipid-transfer prote...  97.8    3e-22   Tarenaya hassleriana [spider flower]
ref|XP_008362493.1|  PREDICTED: non-specific lipid-transfer prote...  97.8    4e-22   
ref|XP_011021288.1|  PREDICTED: non-specific lipid-transfer prote...  97.4    4e-22   Populus euphratica
gb|AGC08429.1|  lipid transfer protein                                97.1    6e-22   Gossypium hirsutum [American cotton]
emb|CBI33621.3|  unnamed protein product                              96.7    6e-22   Vitis vinifera
ref|XP_002284213.1|  PREDICTED: non-specific lipid-transfer prote...  96.7    7e-22   Vitis vinifera
ref|XP_009135573.1|  PREDICTED: non-specific lipid-transfer prote...  96.7    8e-22   Brassica rapa
ref|XP_010108883.1|  hypothetical protein L484_027077                 96.7    8e-22   Morus notabilis
ref|XP_006430725.1|  hypothetical protein CICLE_v10013188mg           96.7    8e-22   Citrus clementina [clementine]
ref|XP_006482208.1|  PREDICTED: probable non-specific lipid-trans...  96.3    1e-21   Citrus sinensis [apfelsine]
ref|XP_008453433.1|  PREDICTED: non-specific lipid-transfer prote...  96.3    1e-21   Cucumis melo [Oriental melon]
ref|XP_009589620.1|  PREDICTED: non-specific lipid-transfer prote...  95.9    1e-21   Nicotiana tomentosiformis
ref|XP_009589151.1|  PREDICTED: non-specific lipid-transfer prote...  95.1    3e-21   
ref|XP_011648973.1|  PREDICTED: non-specific lipid-transfer prote...  95.5    3e-21   Cucumis sativus [cucumbers]
ref|XP_010506694.1|  PREDICTED: non-specific lipid-transfer prote...  95.1    3e-21   
ref|XP_007217198.1|  hypothetical protein PRUPE_ppa013890mg           95.1    3e-21   Prunus persica
ref|XP_008229267.1|  PREDICTED: non-specific lipid-transfer prote...  94.7    4e-21   
ref|XP_009792617.1|  PREDICTED: non-specific lipid-transfer prote...  94.4    6e-21   Nicotiana sylvestris
ref|XP_010667862.1|  PREDICTED: non-specific lipid-transfer prote...  94.4    7e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001275625.1|  probable non-specific lipid-transfer protein...  94.0    7e-21   Solanum tuberosum [potatoes]
ref|XP_010062206.1|  PREDICTED: non-specific lipid-transfer prote...  94.4    8e-21   
ref|XP_009346593.1|  PREDICTED: non-specific lipid-transfer prote...  94.0    8e-21   
gb|KFK39166.1|  hypothetical protein AALP_AA3G208800                  94.0    9e-21   Arabis alpina [alpine rockcress]
gb|ACM78620.1|  non-specific lipid-transfer protein type 2            93.6    1e-20   Tamarix hispida
ref|XP_004235834.1|  PREDICTED: non-specific lipid-transfer prote...  93.6    1e-20   Solanum lycopersicum
gb|AAS79106.1|  probable lipid transfer protein family protein        93.6    1e-20   Tamarix androssowii
ref|XP_006365399.1|  PREDICTED: probable non-specific lipid-trans...  92.8    2e-20   
ref|XP_010506674.1|  PREDICTED: non-specific lipid-transfer prote...  92.8    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009781752.1|  PREDICTED: non-specific lipid-transfer prote...  92.4    3e-20   Nicotiana sylvestris
ref|XP_009804140.1|  PREDICTED: non-specific lipid-transfer prote...  92.0    5e-20   Nicotiana sylvestris
gb|ACM78626.1|  non-specific lipid-transfer protein type 2            91.7    6e-20   Tamarix hispida
ref|XP_009599113.1|  PREDICTED: non-specific lipid-transfer prote...  91.7    7e-20   Nicotiana tomentosiformis
ref|XP_010062205.1|  PREDICTED: non-specific lipid-transfer prote...  91.7    7e-20   Eucalyptus grandis [rose gum]
ref|XP_004241634.1|  PREDICTED: non-specific lipid-transfer prote...  91.3    9e-20   
gb|KFK26688.1|  hypothetical protein AALP_AA8G280300                  90.5    2e-19   Arabis alpina [alpine rockcress]
ref|XP_004492965.1|  PREDICTED: probable non-specific lipid-trans...  90.1    2e-19   
ref|XP_007139181.1|  hypothetical protein PHAVU_008G008200g           90.1    2e-19   Phaseolus vulgaris [French bean]
gb|AFK45248.1|  unknown                                               90.1    3e-19   Lotus japonicus
ref|NP_564532.1|  bifunctional inhibitor/lipid-transfer protein/s...  89.7    3e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KDP32977.1|  hypothetical protein JCGZ_13008                       89.0    6e-19   Jatropha curcas
ref|XP_006367504.1|  PREDICTED: probable non-specific lipid-trans...  89.0    7e-19   
dbj|BAJ25798.1|  putative non-specific lipid-transfer protein typ...  88.6    9e-19   Nicotiana tabacum [American tobacco]
ref|XP_009777694.1|  PREDICTED: non-specific lipid-transfer prote...  88.6    9e-19   Nicotiana sylvestris
ref|XP_003555069.1|  PREDICTED: probable non-specific lipid-trans...  88.6    1e-18   
ref|XP_006482397.1|  PREDICTED: probable non-specific lipid-trans...  88.6    1e-18   Citrus sinensis [apfelsine]
ref|XP_009613979.1|  PREDICTED: non-specific lipid-transfer prote...  88.2    1e-18   Nicotiana tomentosiformis
ref|XP_012078002.1|  PREDICTED: non-specific lipid-transfer prote...  89.0    1e-18   Jatropha curcas
ref|XP_010252340.1|  PREDICTED: non-specific lipid-transfer prote...  88.2    1e-18   Nelumbo nucifera [Indian lotus]
ref|XP_008444081.1|  PREDICTED: non-specific lipid-transfer prote...  88.2    1e-18   
ref|XP_010500416.1|  PREDICTED: non-specific lipid-transfer prote...  88.2    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009626576.1|  PREDICTED: non-specific lipid-transfer prote...  88.2    1e-18   
ref|XP_006430727.1|  hypothetical protein CICLE_v10013181mg           88.2    1e-18   Citrus clementina [clementine]
emb|CDP02752.1|  unnamed protein product                              87.8    2e-18   Coffea canephora [robusta coffee]
ref|XP_009357787.1|  PREDICTED: non-specific lipid-transfer prote...  87.8    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_008444080.1|  PREDICTED: non-specific lipid-transfer prote...  87.8    2e-18   Cucumis melo [Oriental melon]
ref|XP_006589067.1|  PREDICTED: non-specific lipid-transfer prote...  87.8    2e-18   
gb|ACM78623.1|  non-specific lipid-transfer protein type 2            87.4    2e-18   Tamarix hispida
gb|KDO63208.1|  hypothetical protein CISIN_1g036197mg                 87.8    2e-18   Citrus sinensis [apfelsine]
ref|XP_004234577.1|  PREDICTED: non-specific lipid-transfer prote...  87.4    2e-18   Solanum lycopersicum
gb|KHN41531.1|  Non-specific lipid-transfer protein 2                 87.4    2e-18   Glycine soja [wild soybean]
ref|XP_008381283.1|  PREDICTED: non-specific lipid-transfer prote...  87.0    3e-18   
gb|EYU41301.1|  hypothetical protein MIMGU_mgv1a021579mg              87.0    3e-18   Erythranthe guttata [common monkey flower]
gb|KEH21557.1|  Nodule Cysteine-Rich (NCR) secreted peptide           87.0    4e-18   Medicago truncatula
ref|XP_009357786.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    4e-18   
ref|XP_010479305.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    5e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010461704.1|  PREDICTED: non-specific lipid-transfer prote...  86.3    5e-18   Camelina sativa [gold-of-pleasure]
gb|KJB32221.1|  hypothetical protein B456_005G230400                  86.3    6e-18   Gossypium raimondii
ref|XP_010279350.1|  PREDICTED: non-specific lipid-transfer prote...  86.3    6e-18   Nelumbo nucifera [Indian lotus]
ref|XP_003567950.1|  PREDICTED: non-specific lipid-transfer prote...  86.3    7e-18   Brachypodium distachyon [annual false brome]
ref|XP_003633726.1|  PREDICTED: non-specific lipid-transfer prote...  85.9    8e-18   
ref|XP_003624386.1|  Non-specific lipid-transfer protein              85.9    8e-18   
ref|XP_009804692.1|  PREDICTED: non-specific lipid-transfer prote...  85.9    9e-18   Nicotiana sylvestris
gb|ABK26735.1|  unknown                                               85.5    1e-17   Picea sitchensis
gb|AAA33933.1|  lipid transfer protein                                85.1    1e-17   Senecio odorus
gb|EMT00048.1|  Putative non-specific lipid-transfer protein AKCS9    85.1    1e-17   
ref|XP_007033193.1|  Bifunctional inhibitor/lipid-transfer protei...  85.9    1e-17   
ref|XP_006362367.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    2e-17   
emb|CDM81734.1|  unnamed protein product                              85.1    2e-17   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003524566.1|  PREDICTED: probable non-specific lipid-trans...  85.1    2e-17   
gb|AAB47967.1|  nonspecific lipid transfer protein                    85.1    2e-17   Hordeum vulgare [barley]
gb|KJB10462.1|  hypothetical protein B456_001G202600                  84.7    2e-17   Gossypium raimondii
emb|CDM81735.1|  unnamed protein product                              84.7    2e-17   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008810040.1|  PREDICTED: non-specific lipid-transfer prote...  84.7    2e-17   
ref|XP_003552717.1|  PREDICTED: probable non-specific lipid-trans...  84.3    3e-17   Glycine max [soybeans]
gb|KHN27477.1|  Non-specific lipid-transfer protein 2                 84.3    3e-17   Glycine soja [wild soybean]
ref|NP_001238401.1|  uncharacterized protein LOC100306409 precursor   84.3    3e-17   Glycine max [soybeans]
ref|NP_001056241.1|  Os05g0550300                                     84.0    4e-17   
sp|P82353.1|NLTP2_PRUAR  RecName: Full=Non-specific lipid-transfe...  83.2    5e-17   Prunus armeniaca
emb|CDY40833.1|  BnaC01g31230D                                        84.0    5e-17   Brassica napus [oilseed rape]
ref|XP_003567951.1|  PREDICTED: non-specific lipid-transfer prote...  84.0    5e-17   Brachypodium distachyon [annual false brome]
sp|Q43681.1|NLTP_VIGUN  RecName: Full=Probable non-specific lipid...  83.6    5e-17   Vigna unguiculata
ref|XP_006357827.1|  PREDICTED: probable non-specific lipid-trans...  83.6    7e-17   
gb|EMT28561.1|  Non-specific lipid-transfer protein 2                 83.2    7e-17   
ref|XP_002305838.1|  hypothetical protein POPTR_0004s09510g           83.2    8e-17   Populus trichocarpa [western balsam poplar]
gb|KGN53813.1|  hypothetical protein Csa_4G141210                     83.2    8e-17   Cucumis sativus [cucumbers]
gb|EYU41302.1|  hypothetical protein MIMGU_mgv1a019842mg              82.8    9e-17   Erythranthe guttata [common monkey flower]
ref|XP_009145000.1|  PREDICTED: non-specific lipid-transfer prote...  83.2    1e-16   Brassica rapa
gb|KGN53816.1|  hypothetical protein Csa_4G141240                     82.8    1e-16   
gb|KGN53818.1|  hypothetical protein Csa_4G146250                     82.8    1e-16   Cucumis sativus [cucumbers]
ref|XP_012078005.1|  PREDICTED: non-specific lipid-transfer prote...  82.4    2e-16   Jatropha curcas
ref|XP_011097163.1|  PREDICTED: non-specific lipid-transfer prote...  82.0    2e-16   Sesamum indicum [beniseed]
ref|XP_004234576.1|  PREDICTED: non-specific lipid-transfer prote...  82.0    2e-16   
gb|AGC08422.1|  lipid transfer protein                                82.0    2e-16   Gossypium hirsutum [American cotton]
ref|XP_006855793.1|  PREDICTED: non-specific lipid-transfer prote...  81.3    4e-16   Amborella trichopoda
gb|KJB60036.1|  hypothetical protein B456_009G286700                  80.9    4e-16   Gossypium raimondii
ref|XP_008444077.1|  PREDICTED: non-specific lipid-transfer prote...  81.3    4e-16   
ref|XP_009418385.1|  PREDICTED: non-specific lipid-transfer prote...  80.9    4e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006654745.1|  PREDICTED: non-specific lipid-transfer prote...  81.3    4e-16   Oryza brachyantha
emb|CDO98408.1|  unnamed protein product                              80.9    5e-16   Coffea canephora [robusta coffee]
ref|XP_004232333.1|  PREDICTED: non-specific lipid-transfer prote...  80.9    5e-16   
gb|KJB46840.1|  hypothetical protein B456_008G057100                  80.9    6e-16   Gossypium raimondii
ref|XP_009386356.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    7e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU41300.1|  hypothetical protein MIMGU_mgv1a024516mg              80.1    7e-16   Erythranthe guttata [common monkey flower]
ref|XP_008444076.1|  PREDICTED: non-specific lipid-transfer prote...  80.1    1e-15   
ref|XP_010528992.1|  PREDICTED: non-specific lipid-transfer prote...  80.1    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_009107339.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    2e-15   Brassica rapa
ref|NP_198633.1|  bifunctional inhibitor/lipid-transfer protein/s...  79.7    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008782311.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    3e-15   Phoenix dactylifera
sp|P86809.1|NLTP2_APIGA  RecName: Full=Non-specific lipid-transfe...  78.2    3e-15   Apium graveolens Rapaceum Group [celeriac]
gb|ERN12382.1|  hypothetical protein AMTR_s00025p00111520             78.6    3e-15   Amborella trichopoda
ref|XP_009418081.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    3e-15   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY16462.1|  BnaA08g03050D                                        79.0    3e-15   Brassica napus [oilseed rape]
ref|XP_010528502.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    4e-15   Tarenaya hassleriana [spider flower]
gb|ACI26699.1|  lipid transfer protein                                79.0    4e-15   Gossypium hirsutum [American cotton]
gb|KHN25489.1|  Non-specific lipid-transfer protein 2                 78.6    4e-15   Glycine soja [wild soybean]
ref|XP_010550264.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    4e-15   Tarenaya hassleriana [spider flower]
ref|XP_003535202.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    5e-15   
emb|CDY52889.1|  BnaC06g27820D                                        78.2    6e-15   Brassica napus [oilseed rape]
ref|XP_006367505.1|  PREDICTED: uncharacterized protein LOC102587705  80.1    6e-15   
gb|KJB32222.1|  hypothetical protein B456_005G230500                  78.2    6e-15   Gossypium raimondii
emb|CDX77289.1|  BnaC08g03340D                                        77.8    8e-15   
gb|KFK43095.1|  hypothetical protein AALP_AA1G079200                  77.8    9e-15   Arabis alpina [alpine rockcress]
ref|XP_006390508.1|  hypothetical protein EUTSA_v10019361mg           77.4    1e-14   Eutrema salsugineum [saltwater cress]
ref|XP_007142957.1|  hypothetical protein PHAVU_007G031600g           77.0    1e-14   Phaseolus vulgaris [French bean]
gb|ACG48207.1|  nonspecific lipid-transfer protein precursor          77.0    1e-14   Zea mays [maize]
ref|XP_004961319.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    1e-14   Setaria italica
gb|EMT31755.1|  Putative non-specific lipid-transfer protein AKCS9    76.6    2e-14   
ref|XP_002887506.1|  protease inhibitor/seed storage/lipid transf...  76.6    2e-14   
ref|XP_010926507.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    2e-14   Elaeis guineensis
emb|CDY50600.1|  BnaC02g16970D                                        76.3    3e-14   Brassica napus [oilseed rape]
ref|XP_004986022.1|  PREDICTED: non-specific lipid-transfer prote...  75.9    3e-14   Setaria italica
ref|XP_004288629.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    3e-14   Fragaria vesca subsp. vesca
ref|XP_009127492.1|  PREDICTED: non-specific lipid-transfer prote...  75.9    4e-14   Brassica rapa
gb|AGC08430.1|  lipid transfer protein                                75.5    4e-14   Gossypium hirsutum [American cotton]
dbj|BAA25680.1|  Lipid transfer protein                               75.5    4e-14   Brassica rapa
ref|XP_010034442.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    5e-14   Eucalyptus grandis [rose gum]
ref|NP_177519.1|  bifunctional inhibitor/lipid-transfer protein/s...  75.1    6e-14   
gb|KGN53815.1|  hypothetical protein Csa_4G141230                     75.1    7e-14   Cucumis sativus [cucumbers]
ref|XP_002870865.1|  hypothetical protein ARALYDRAFT_916549           75.1    7e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_010528993.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    8e-14   Tarenaya hassleriana [spider flower]
ref|XP_002887080.1|  hypothetical protein ARALYDRAFT_475781           75.1    8e-14   
ref|XP_010528501.1|  PREDICTED: probable non-specific lipid-trans...  74.7    9e-14   Tarenaya hassleriana [spider flower]
emb|CDP02750.1|  unnamed protein product                              74.7    1e-13   Coffea canephora [robusta coffee]
ref|XP_008809159.1|  PREDICTED: non-specific lipid-transfer prote...  74.3    1e-13   
ref|XP_007150889.1|  hypothetical protein PHAVU_004G002700g           74.3    1e-13   Phaseolus vulgaris [French bean]
gb|EYU40788.1|  hypothetical protein MIMGU_mgv1a025902mg              74.3    1e-13   Erythranthe guttata [common monkey flower]
emb|CDO98409.1|  unnamed protein product                              73.9    1e-13   Coffea canephora [robusta coffee]
ref|XP_003624381.1|  Non-specific lipid-transfer protein              74.3    1e-13   
gb|AAG60123.1|AC073555_7  lipid transfer protein, putative            73.6    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001043932.1|  Os01g0691100                                     73.9    2e-13   
ref|XP_002466001.1|  hypothetical protein SORBIDRAFT_01g049830        73.6    2e-13   Sorghum bicolor [broomcorn]
ref|XP_006301055.1|  hypothetical protein CARUB_v10021448mg           73.6    2e-13   Capsella rubella
emb|CDY47738.1|  BnaA02g16570D                                        73.6    3e-13   Brassica napus [oilseed rape]
ref|XP_010317751.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    3e-13   
ref|XP_009128011.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    3e-13   Brassica rapa
emb|CDY45874.1|  BnaC02g22460D                                        73.6    3e-13   Brassica napus [oilseed rape]
gb|EMT21725.1|  Putative non-specific lipid-transfer protein AKCS9    73.2    3e-13   
ref|XP_010108881.1|  hypothetical protein L484_027075                 73.2    4e-13   
ref|NP_001150566.1|  nonspecific lipid-transfer protein precursor     73.2    4e-13   Zea mays [maize]
ref|XP_002440195.1|  hypothetical protein SORBIDRAFT_09g027590        72.8    4e-13   Sorghum bicolor [broomcorn]
ref|NP_001065005.1|  Os10g0504900                                     72.4    4e-13   
ref|XP_009596861.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    4e-13   
ref|XP_006304814.1|  hypothetical protein CARUB_v10012448mg           72.8    5e-13   Capsella rubella
ref|NP_001148293.1|  LOC100281901 precursor                           72.8    5e-13   
emb|CDM81736.1|  unnamed protein product                              72.8    5e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010474155.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    6e-13   Camelina sativa [gold-of-pleasure]
ref|XP_003558992.1|  PREDICTED: non-specific lipid-transfer prote...  72.0    7e-13   Brachypodium distachyon [annual false brome]
ref|XP_010511588.1|  PREDICTED: non-specific lipid-transfer prote...  72.0    9e-13   Camelina sativa [gold-of-pleasure]
ref|XP_004961318.1|  PREDICTED: probable non-specific lipid-trans...  71.6    1e-12   Setaria italica
gb|EAY75443.1|  hypothetical protein OsI_03343                        73.6    1e-12   Oryza sativa Indica Group [Indian rice]
gb|KFK41090.1|  hypothetical protein AALP_AA2G084400                  71.6    1e-12   Arabis alpina [alpine rockcress]
ref|XP_010419026.1|  PREDICTED: non-specific lipid-transfer prote...  71.6    1e-12   Camelina sativa [gold-of-pleasure]
gb|ACU14682.1|  unknown                                               70.9    1e-12   Glycine max [soybeans]
ref|XP_006391441.1|  hypothetical protein EUTSA_v10019362mg           71.2    2e-12   Eutrema salsugineum [saltwater cress]
ref|XP_006405794.1|  hypothetical protein EUTSA_v10028094mg           70.9    2e-12   Eutrema salsugineum [saltwater cress]
dbj|BAA06462.1|  TED4                                                 70.9    2e-12   Zinnia elegans [garden zinnia]
ref|XP_009105236.1|  PREDICTED: non-specific lipid-transfer prote...  70.9    2e-12   Brassica rapa
gb|KFK33268.1|  hypothetical protein AALP_AA6G352500                  70.9    3e-12   Arabis alpina [alpine rockcress]
ref|XP_006300368.1|  hypothetical protein CARUB_v10022343mg           70.9    3e-12   Capsella rubella
ref|XP_002528083.1|  Nonspecific lipid-transfer protein, putative     70.5    3e-12   
gb|KFK26687.1|  hypothetical protein AALP_AA8G280200                  70.1    4e-12   Arabis alpina [alpine rockcress]
ref|NP_001148304.1|  LOC100281913 precursor                           70.1    4e-12   
ref|XP_009110931.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    4e-12   Brassica rapa
ref|XP_004234627.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    4e-12   
ref|XP_010440916.1|  PREDICTED: probable non-specific lipid-trans...  70.1    4e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006393362.1|  hypothetical protein EUTSA_v10011892mg           69.7    5e-12   Eutrema salsugineum [saltwater cress]
ref|NP_176857.1|  bifunctional inhibitor/lipid-transfer protein/s...  69.7    5e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435719.1|  PREDICTED: probable non-specific lipid-trans...  69.7    5e-12   Camelina sativa [gold-of-pleasure]
ref|XP_007150888.1|  hypothetical protein PHAVU_004G002600g           69.7    6e-12   Phaseolus vulgaris [French bean]
ref|XP_010450959.1|  PREDICTED: probable non-specific lipid-trans...  69.7    7e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006649254.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    8e-12   
emb|CDY61300.1|  BnaCnng37660D                                        69.3    8e-12   Brassica napus [oilseed rape]
emb|CDY04317.1|  BnaC05g25790D                                        69.3    8e-12   
ref|XP_003567948.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    8e-12   Brachypodium distachyon [annual false brome]
sp|P20145.1|NLTP2_HORVU  RecName: Full=Probable non-specific lipi...  68.9    1e-11   Hordeum vulgare [barley]
ref|XP_006405797.1|  hypothetical protein EUTSA_v10028232mg           68.9    1e-11   
gb|AGT16134.1|  hypothetical protein SHCRBa_127_N06_F_60              68.6    2e-11   Saccharum hybrid cultivar R570
tpg|DAA42889.1|  TPA: nonspecific lipid-transfer protein              68.6    2e-11   
gb|KGN53811.1|  hypothetical protein Csa_4G135200                     68.2    2e-11   
emb|CDF66370.1|  lipid transfer protein                               68.2    2e-11   Coffea arabica [arabica coffee]
ref|NP_001056242.1|  Os05g0550600                                     68.2    2e-11   
ref|XP_009388790.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-11   
gb|EAY88245.1|  hypothetical protein OsI_09696                        68.2    2e-11   
sp|A2XBN5.2|NLTPX_ORYSI  RecName: Full=Non-specific lipid-transfe...  68.2    2e-11   
ref|XP_008809160.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    2e-11   
emb|CDY61301.1|  BnaCnng37670D                                        68.2    2e-11   
ref|XP_008444075.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    3e-11   
gb|AAS68185.1|  lipid transfer-like protein                           67.8    3e-11   
gb|ACJ68112.1|  hypothetical protein                                  67.8    3e-11   
emb|CDY60143.1|  BnaA07g39070D                                        67.4    3e-11   
ref|XP_006397095.1|  hypothetical protein EUTSA_v10029435mg           67.4    3e-11   
gb|AIC77182.1|  lipid transfer protein 2                              67.0    5e-11   
ref|XP_004234622.1|  PREDICTED: non-specific lipid-transfer prote...  67.0    5e-11   
gb|AGT16137.1|  hypothetical protein SHCRBa_127_N06_F_390             67.0    5e-11   
gb|AAX95718.1|  Protease inhibitor/seed storage/LTP family, putative  67.0    6e-11   
gb|AAC50030.1|  lipid transfer protein                                66.6    6e-11   
ref|XP_006368152.1|  PREDICTED: probable non-specific lipid-trans...  66.6    7e-11   
emb|CDY01688.1|  BnaC04g30640D                                        67.4    7e-11   
emb|CDG03097.1|  LTP (lipid transfer protein)                         66.6    7e-11   
dbj|BAK07816.1|  predicted protein                                    66.6    7e-11   
ref|XP_009139763.1|  PREDICTED: non-specific lipid-transfer prote...  66.6    8e-11   
gb|AAP37973.1|  seed specific protein Bn15D80B                        66.6    8e-11   
emb|CDF66372.1|  lipid transfer protein                               66.2    9e-11   
pdb|1L6H|A  Chain A, Solution Structure Of Plant Nsltp2 Purified ...  65.5    9e-11   
ref|XP_002870864.1|  protease inhibitor/seed storage/lipid transf...  66.2    1e-10   
ref|XP_002440196.1|  hypothetical protein SORBIDRAFT_09g027600        65.9    1e-10   
emb|CDX93626.1|  BnaA06g04220D                                        65.5    2e-10   
emb|CDX95131.1|  BnaC05g05400D                                        65.5    2e-10   
ref|XP_010440915.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    2e-10   
ref|NP_001268090.1|  alcohol dehydrogenase 7                          69.3    2e-10   
ref|XP_002528082.1|  lipid binding protein, putative                  65.5    2e-10   
ref|XP_006292428.1|  hypothetical protein CARUB_v10018643mg           65.5    2e-10   
ref|NP_198632.1|  Bifunctional inhibitor/lipid-transfer protein/s...  65.5    2e-10   
emb|CDG03100.1|  LTP (lipid transfer protein)                         65.1    2e-10   
emb|CDG03099.1|  LTP (lipid transfer protein)                         65.1    2e-10   
gb|EAY79130.1|  hypothetical protein OsI_34237                        65.1    2e-10   
emb|CDY15627.1|  BnaA08g29110D                                        65.5    2e-10   
ref|NP_001065008.1|  Os10g0505700                                     64.7    3e-10   
gb|ACJ68107.1|  lipid transfer-like protein                           64.7    3e-10   
gb|EAY79134.1|  hypothetical protein OsI_34241                        64.7    3e-10   
gb|AAP54508.1|  Nonspecific lipid-transfer protein 2, putative        64.3    4e-10   
ref|XP_006855789.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    4e-10   
gb|EMS65828.1|  putative non-specific lipid-transfer protein AKCS9    64.3    4e-10   
gb|EEC68552.1|  hypothetical protein OsI_36865                        64.3    5e-10   
ref|XP_006292917.1|  hypothetical protein CARUB_v10019183mg           63.9    5e-10   
ref|NP_001152727.1|  nonspecific lipid-transfer protein AKCS9 pre...  63.9    6e-10   
ref|NP_001152008.1|  nonspecific lipid-transfer protein AKCS9 pre...  63.9    6e-10   
ref|XP_002887008.1|  hypothetical protein ARALYDRAFT_894246           63.5    7e-10   
gb|KFK41089.1|  hypothetical protein AALP_AA2G084300                  63.5    8e-10   
ref|NP_001048723.1|  Os03g0111300                                     63.5    8e-10   
gb|EAZ25324.1|  hypothetical protein OsJ_09135                        63.5    9e-10   
gb|AAP54510.1|  Nonspecific lipid-transfer protein 2, putative        63.5    9e-10   
gb|ACM78625.1|  non-specific lipid-transfer protein type 2            62.8    9e-10   
emb|CDM83892.1|  unnamed protein product                              63.2    1e-09   
ref|XP_009148019.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    1e-09   
emb|CDX95132.1|  BnaC05g05390D                                        63.2    1e-09   
gb|EAY79133.1|  hypothetical protein OsI_34240                        63.2    1e-09   
ref|XP_010450960.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    1e-09   
gb|EMT19327.1|  Putative non-specific lipid-transfer protein AKCS9    63.2    1e-09   
ref|XP_010317750.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    1e-09   
ref|XP_009148020.1|  PREDICTED: probable non-specific lipid-trans...  63.2    1e-09   
ref|XP_008462815.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    1e-09   
gb|EMT06942.1|  Putative non-specific lipid-transfer protein          62.8    1e-09   
ref|XP_010317726.1|  PREDICTED: non-specific lipid-transfer prote...  62.8    2e-09   
ref|XP_010227440.1|  PREDICTED: probable non-specific lipid-trans...  62.8    2e-09   
gb|EMS52279.1|  Non-specific lipid-transfer protein 2G                62.4    2e-09   
ref|XP_006405796.1|  hypothetical protein EUTSA_v10028346mg           62.4    2e-09   
ref|XP_010317725.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    2e-09   
ref|XP_010232168.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    3e-09   
ref|XP_006417774.1|  hypothetical protein EUTSA_v10009184mg           62.0    3e-09   
emb|CAH69201.1|  type 2 non specific lipid transfer protein precu...  62.0    3e-09   
ref|XP_002458343.1|  hypothetical protein SORBIDRAFT_03g031716        61.6    3e-09   
ref|XP_009128605.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    3e-09   
gb|EMS65238.1|  Non-specific lipid-transfer protein 2                 62.0    3e-09   
sp|P82901.1|NLT2P_WHEAT  RecName: Full=Non-specific lipid-transfe...  61.2    3e-09   
ref|NP_001068293.1|  Os11g0620300                                     62.0    3e-09   
ref|XP_009398150.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    4e-09   
ref|XP_002464408.1|  hypothetical protein SORBIDRAFT_01g017710        61.6    4e-09   
ref|XP_006404280.1|  hypothetical protein EUTSA_v10010852mg           61.6    4e-09   
ref|XP_011099530.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    4e-09   
ref|XP_006292537.1|  hypothetical protein CARUB_v10018768mg           61.6    4e-09   
emb|CAG28936.1|  lipid transfer protein                               61.6    4e-09   
ref|XP_010064822.1|  PREDICTED: uncharacterized protein LOC104451978  61.6    6e-09   
emb|CAH04982.1|  type 2 non-specific lipid transfer protein precu...  61.2    6e-09   
gb|ABK28726.1|  unknown                                               61.2    6e-09   
ref|NP_568555.1|  bifunctional inhibitor/lipid-transfer protein/s...  60.8    6e-09   
ref|XP_011653423.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    6e-09   
gb|AAM63788.1|  lipid transfer-like protein                           60.8    6e-09   
ref|XP_006395303.1|  hypothetical protein EUTSA_v10005361mg           61.2    7e-09   
emb|CAH69205.1|  type 2 non specific lipid transfer protein precu...  60.8    8e-09   
ref|NP_001058516.1|  Os06g0705400                                     60.5    9e-09   
sp|P83506.1|NLTP2_MAIZE  RecName: Full=Probable non-specific lipi...  60.1    9e-09   
ref|XP_007216172.1|  hypothetical protein PRUPE_ppa015726mg           61.2    9e-09   
gb|AAC28263.1|  7 kDa lipid transfer protein                          60.5    1e-08   
dbj|BAJ86749.1|  predicted protein                                    60.1    1e-08   
ref|XP_008670719.1|  PREDICTED: probable non-specific lipid-trans...  60.1    1e-08   
ref|XP_006292881.1|  hypothetical protein CARUB_v10019146mg           60.1    1e-08   
ref|XP_006405795.1|  hypothetical protein EUTSA_v10028000mg           60.1    1e-08   
gb|AAT08737.1|  auxin-induced lipid transfer protein                  59.7    2e-08   
emb|CAH69202.1|  type 2 non specific lipid transfer protein precu...  59.7    2e-08   
sp|P82900.2|NLT2G_WHEAT  RecName: Full=Non-specific lipid-transfe...  59.7    2e-08   
ref|XP_002875492.1|  hypothetical protein ARALYDRAFT_905202           59.3    2e-08   
pdb|1N89|A  Chain A, Solution Structure Of A Liganded Type 2 Whea...  58.9    2e-08   
ref|XP_006362363.1|  PREDICTED: probable non-specific lipid-trans...  59.3    3e-08   
gb|AAD27634.1|AF128457_8  hypothetical protein                        61.6    3e-08   
gb|ACJ68106.1|  hypothetical protein                                  58.9    4e-08   
gb|AAT08689.1|  lipid transfer protein                                58.2    6e-08   
gb|EMS52281.1|  Non-specific lipid-transfer protein 2G                58.2    6e-08   
gb|EMS64122.1|  Non-specific lipid-transfer protein 2G                58.2    6e-08   
gb|EMS52280.1|  Non-specific lipid-transfer protein 2G                58.2    7e-08   
gb|ERN17259.1|  hypothetical protein AMTR_s00044p00213670             58.2    7e-08   
ref|XP_006362365.1|  PREDICTED: probable non-specific lipid-trans...  57.8    7e-08   
ref|XP_008444079.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    7e-08   
gb|KGN66906.1|  hypothetical protein Csa_1G711160                     57.8    9e-08   
ref|XP_009111220.1|  PREDICTED: probable non-specific lipid-trans...  57.8    9e-08   
emb|CDY40472.1|  BnaC09g14300D                                        57.8    1e-07   
ref|XP_004972106.1|  PREDICTED: probable non-specific lipid-trans...  57.8    1e-07   
ref|NP_001043934.1|  Os01g0691300                                     57.8    1e-07   
ref|XP_006391440.1|  hypothetical protein EUTSA_v10019407mg           56.6    2e-07   
ref|XP_002464407.1|  hypothetical protein SORBIDRAFT_01g017700        57.4    2e-07   
gb|EMT25475.1|  Non-specific lipid-transfer protein 2G                56.6    2e-07   
gb|EMS49764.1|  Non-specific lipid-transfer protein 2G                56.6    2e-07   
dbj|BAB01987.1|  lipid transfer protein-like                          56.6    2e-07   
ref|NP_001065007.1|  Os10g0505500                                     56.2    3e-07   
ref|NP_001078221.1|  protease inhibitor/seed storage/LTP family p...  56.6    3e-07   
ref|XP_008459140.1|  PREDICTED: non-specific lipid-transfer prote...  56.2    4e-07   
ref|XP_004980771.1|  PREDICTED: probable non-specific lipid-trans...  55.8    4e-07   
ref|XP_009129327.1|  PREDICTED: non-specific lipid-transfer prote...  56.2    4e-07   
ref|NP_973968.1|  bifunctional inhibitor/lipid-transfer protein/s...  56.2    4e-07   
ref|XP_006292190.1|  hypothetical protein CARUB_v10018396mg           55.8    5e-07   
ref|NP_001146849.1|  LOC100280457 precursor                           55.8    5e-07   
ref|XP_002878145.1|  protease inhibitor/seed storage/lipid transf...  56.2    5e-07   
ref|XP_009113158.1|  PREDICTED: non-specific lipid-transfer prote...  55.8    5e-07   
ref|XP_002437557.1|  hypothetical protein SORBIDRAFT_10g029330        55.8    5e-07   
ref|XP_006395305.1|  hypothetical protein EUTSA_v10005534mg           55.8    5e-07   
gb|EMT30485.1|  Non-specific lipid-transfer protein 2G                55.5    6e-07   
gb|EMT15663.1|  Non-specific lipid-transfer protein 2G                55.8    6e-07   
emb|CDY12874.1|  BnaA09g14000D                                        55.8    6e-07   
ref|XP_002863289.1|  hypothetical protein ARALYDRAFT_333050           55.5    7e-07   
ref|XP_006282777.1|  hypothetical protein CARUB_v10006242mg           55.5    7e-07   
ref|NP_198634.1|  Bifunctional inhibitor/lipid-transfer protein/s...  55.5    7e-07   
ref|XP_004969610.1|  PREDICTED: probable non-specific lipid-trans...  55.5    8e-07   
ref|XP_010445476.1|  PREDICTED: uncharacterized protein LOC104728145  56.6    8e-07   
ref|XP_006293217.1|  hypothetical protein CARUB_v10019541mg           55.1    9e-07   
ref|XP_006304705.1|  hypothetical protein CARUB_v10011969mg           54.7    1e-06   
ref|XP_004966368.1|  PREDICTED: probable non-specific lipid-trans...  55.1    1e-06   
ref|XP_002443686.1|  hypothetical protein SORBIDRAFT_07g000330        54.7    1e-06   
ref|XP_002458344.1|  hypothetical protein SORBIDRAFT_03g031720        54.7    1e-06   
ref|XP_004982671.1|  PREDICTED: non-specific lipid-transfer prote...  54.7    1e-06   
ref|XP_003607410.1|  Non-specific lipid-transfer protein              54.3    1e-06   
ref|NP_973462.1|  bifunctional inhibitor/lipid-transfer protein/s...  54.7    1e-06   
emb|CDX85249.1|  BnaC07g25600D                                        54.3    2e-06   
ref|XP_003580751.2|  PREDICTED: non-specific lipid-transfer prote...  54.7    2e-06   
gb|EYU30007.1|  hypothetical protein MIMGU_mgv1a024747mg              54.3    2e-06   
emb|CDY04056.1|  BnaC02g37710D                                        54.3    2e-06   
ref|NP_849769.1|  bifunctional inhibitor/lipid-transfer protein/s...  54.3    2e-06   
emb|CDM80438.1|  unnamed protein product                              54.3    2e-06   
ref|XP_006417775.1|  hypothetical protein EUTSA_v10009190mg           53.9    2e-06   
ref|NP_001078379.1|  protease inhibitor/seed storage/LTP family p...  53.9    3e-06   
gb|EMT06945.1|  Non-specific lipid-transfer protein 2G                53.1    3e-06   
ref|NP_001065006.1|  Os10g0505000                                     53.5    4e-06   
ref|NP_001150554.1|  nonspecific lipid-transfer protein AKCS9 pre...  53.5    4e-06   
gb|EMS52109.1|  Non-specific lipid-transfer protein 2G                53.5    4e-06   
gb|EAY79135.1|  hypothetical protein OsI_34242                        53.1    5e-06   
ref|XP_002449439.1|  hypothetical protein SORBIDRAFT_05g011660        53.1    5e-06   
emb|CDX85248.1|  BnaC07g25590D                                        52.8    6e-06   
gb|EMT06944.1|  Non-specific lipid-transfer protein 2G                52.8    7e-06   
ref|NP_191290.1|  bifunctional inhibitor/lipid-transfer protein/s...  52.8    7e-06   
ref|NP_001141006.1|  nonspecific lipid-transfer protein AKCS9 pre...  52.8    8e-06   
ref|XP_002449441.1|  hypothetical protein SORBIDRAFT_05g011680        52.4    8e-06   
gb|ABR26025.1|  nonspecific lipid-transfer protein precursor          51.2    1e-05   
ref|XP_002889660.1|  hypothetical protein ARALYDRAFT_887992           52.0    1e-05   
ref|XP_010445591.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  53.9    1e-05   
ref|NP_001148419.1|  nonspecific lipid-transfer protein precursor     51.6    2e-05   
ref|NP_001149668.1|  nonspecific lipid-transfer protein AKCS9 pre...  51.6    2e-05   
ref|XP_002889661.1|  hypothetical protein ARALYDRAFT_887993           51.6    2e-05   
ref|XP_006395306.1|  hypothetical protein EUTSA_v10005391mg           51.6    2e-05   
ref|XP_009151803.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    2e-05   
ref|XP_010514630.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    3e-05   
ref|XP_008644734.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    3e-05   
ref|XP_009129312.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    3e-05   
ref|XP_002889662.1|  hypothetical protein ARALYDRAFT_887994           50.8    3e-05   
ref|XP_010425717.1|  PREDICTED: non-specific lipid-transfer prote...  50.8    4e-05   
ref|NP_001150064.1|  nonspecific lipid-transfer protein precursor     50.8    4e-05   
ref|XP_006656462.1|  PREDICTED: probable non-specific lipid-trans...  50.4    5e-05   
ref|XP_009113157.1|  PREDICTED: probable non-specific lipid-trans...  49.7    8e-05   
ref|XP_006305952.1|  hypothetical protein CARUB_v10011199mg           49.3    9e-05   
ref|NP_683375.1|  Bifunctional inhibitor/lipid-transfer protein/s...  50.1    1e-04   
ref|XP_009129313.1|  PREDICTED: non-specific lipid-transfer prote...  49.3    1e-04   
ref|XP_010475550.1|  PREDICTED: probable non-specific lipid-trans...  49.3    1e-04   
ref|NP_001077480.1|  protease inhibitor/seed storage/LTP family p...  48.9    2e-04   
ref|NP_001149680.1|  nonspecific lipid-transfer protein precursor     48.9    2e-04   
ref|XP_010436675.1|  PREDICTED: uncharacterized protein LOC104720475  50.8    2e-04   
dbj|BAM28757.1|  lipid transfer protein homolog                       48.5    3e-04   
ref|XP_004982670.1|  PREDICTED: non-specific lipid-transfer prote...  47.8    4e-04   
ref|XP_002528081.1|  lipid binding protein, putative                  47.4    5e-04   
emb|CDY70822.1|  BnaCnng69950D                                        47.4    7e-04   



>ref|XP_009613748.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
tomentosiformis]
Length=94

 Score =   122 bits (306),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 81/96 (84%), Gaps = 2/96 (2%)
 Frame = -3

Query  602  IAMRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQ  423
            +AMR +AI A++L+++   +K+   + VTCNPL LSPCA AI SS T+PS +CCSKLKEQ
Sbjct  1    MAMRCVAIFAMVLLILGQETKIAKAD-VTCNPLMLSPCANAIMSS-TTPSAMCCSKLKEQ  58

Query  422  RPCLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            RPCLC+YMKDPRLQ+ I+SPNAKKVA+TCGSPFP+C
Sbjct  59   RPCLCQYMKDPRLQKMISSPNAKKVASTCGSPFPKC  94



>ref|XP_010320740.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=95

 Score =   121 bits (303),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 3/97 (3%)
 Frame = -3

Query  602  IAMRSIAICAIllvlvLGASKVEVTEA-VTCNPLQLSPCATAITSSNTSPSPVCCSKLKE  426
            + MR ++I AI+L LV    + +VT+A V+CNPLQLS CA AITSS T+PS +CCSKLKE
Sbjct  1    MTMRFVSIFAIVLFLVF-VQETKVTKANVSCNPLQLSACANAITSS-TTPSSICCSKLKE  58

Query  425  QRPCLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            QRPCLCKYMKDPRLQ+ I+SPNAKKVA TCGSPFP C
Sbjct  59   QRPCLCKYMKDPRLQKMISSPNAKKVATTCGSPFPNC  95



>ref|XP_011076327.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=96

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
             +VEVT AVTCNPLQLSPCA+AITSS + PS  CC+K+KEQRPCLC+YMK+P LQ+FI S
Sbjct  21   GEVEVTNAVTCNPLQLSPCASAITSS-SKPSAACCAKIKEQRPCLCQYMKNPNLQKFIKS  79

Query  365  PNAKKVANTCGSPFPRC  315
            P AKKVAN+CG+P+PRC
Sbjct  80   PGAKKVANSCGTPYPRC  96



>emb|CDP00664.1| unnamed protein product [Coffea canephora]
Length=90

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 80/94 (85%), Gaps = 4/94 (4%)
 Frame = -3

Query  596  MRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRP  417
            M+ +A  A+LL+++ G   +E  +AVTCNPLQLSPCA AITSS +SP+ +CCSK+KEQRP
Sbjct  1    MKYLAFVAVLLLVLGG---IEKAKAVTCNPLQLSPCANAITSS-SSPTAICCSKIKEQRP  56

Query  416  CLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            CLC YM++P L++FI+SPNA+KVANTCG+PFP+C
Sbjct  57   CLCSYMRNPNLKKFISSPNARKVANTCGTPFPQC  90



>ref|XP_008243280.1| PREDICTED: non-specific lipid-transfer protein 2-like [Prunus 
mume]
Length=100

 Score =   113 bits (282),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 73/89 (82%), Gaps = 2/89 (2%)
 Frame = -3

Query  581  ICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKY  402
            +C +  VLV G S+V  T AVTC+PL+L+PCATAITSS + PS +CC KLKEQRPCLCKY
Sbjct  12   LCVVAFVLVFGGSQV-CTAAVTCSPLELAPCATAITSS-SPPSAICCGKLKEQRPCLCKY  69

Query  401  MKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            +KDP LQ+ + SPNAKKVA+TCGSPFP C
Sbjct  70   VKDPNLQKLVNSPNAKKVASTCGSPFPSC  98



>ref|XP_007044235.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
 gb|EOY00067.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
Length=95

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
             K +V+  VTCN LQLSPCA+AITSS T PSP+CCSKLKEQRPCLC Y+KDP LQ+ + S
Sbjct  20   GKAQVSMGVTCNALQLSPCASAITSS-TPPSPLCCSKLKEQRPCLCNYVKDPNLQKLVNS  78

Query  365  PNAKKVANTCGSPFPRC  315
            PNA+KVA+ CGSPFP C
Sbjct  79   PNARKVASICGSPFPNC  95



>ref|XP_007226001.1| hypothetical protein PRUPE_ppa013833mg [Prunus persica]
 gb|EMJ27200.1| hypothetical protein PRUPE_ppa013833mg [Prunus persica]
Length=100

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 73/89 (82%), Gaps = 2/89 (2%)
 Frame = -3

Query  581  ICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKY  402
            +C +  VLV G S++  T AVTC+PL+L+PCATAITSS + PS +CC KLKEQRPCLCKY
Sbjct  12   LCVVAFVLVFGGSQL-CTAAVTCSPLELAPCATAITSS-SPPSAICCGKLKEQRPCLCKY  69

Query  401  MKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            +KDP LQ+ + SPNAKKVA+TCGSPFP C
Sbjct  70   VKDPNLQKLVNSPNAKKVASTCGSPFPSC  98



>ref|XP_004137484.1| PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis 
sativus]
 gb|KGN64146.1| hypothetical protein Csa_1G042560 [Cucumis sativus]
Length=90

 Score =   112 bits (279),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 67/75 (89%), Gaps = 1/75 (1%)
 Frame = -3

Query  539  VEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPN  360
            VE+T AVTC+P+QLS C +AITSS   PS +CCSK+KEQ+PCLCKYM++P L++F+ASPN
Sbjct  17   VEITMAVTCSPVQLSSCVSAITSS-VPPSKLCCSKIKEQKPCLCKYMQNPTLKKFVASPN  75

Query  359  AKKVANTCGSPFPRC  315
            A+KVANTCG+PFP+C
Sbjct  76   ARKVANTCGTPFPKC  90



>ref|XP_008460998.1| PREDICTED: non-specific lipid-transfer protein 2 [Cucumis melo]
Length=90

 Score =   111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 67/75 (89%), Gaps = 1/75 (1%)
 Frame = -3

Query  539  VEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPN  360
            VE++ AVTC+P+QLS C +AITSS   PS +CCSK+KEQRPCLCKYM++P L++F+ASPN
Sbjct  17   VEISMAVTCSPVQLSSCVSAITSS-VPPSSLCCSKIKEQRPCLCKYMQNPTLKKFVASPN  75

Query  359  AKKVANTCGSPFPRC  315
            AKKVA+TCG+PFP+C
Sbjct  76   AKKVASTCGTPFPKC  90



>ref|XP_003620406.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|ACJ85882.1| unknown [Medicago truncatula]
 gb|AES76624.1| Chitinase / Hevein / PR-4 / Wheatwin2 [Medicago truncatula]
Length=92

 Score =   110 bits (276),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 77/91 (85%), Gaps = 4/91 (4%)
 Frame = -3

Query  587  IAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLC  408
            IAIC  L++L++    V+V+ AVTC+P+QLS C +AITSS T PS +CCSK+KEQRPCLC
Sbjct  6    IAICTFLVLLLIN---VQVSMAVTCSPVQLSSCVSAITSS-TPPSNLCCSKIKEQRPCLC  61

Query  407  KYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            +YMK+P L++F+ +PNA+KVANTCG+PFPRC
Sbjct  62   QYMKNPNLRKFVNTPNARKVANTCGTPFPRC  92



>ref|XP_006468752.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Citrus sinensis]
 gb|KDO76904.1| hypothetical protein CISIN_1g035485mg [Citrus sinensis]
Length=93

 Score =   110 bits (274),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 62/70 (89%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
            A+TCNPL+LSPCA+AIT +N +PS +CCSKLKEQR CLC+YMKDP L++F+ SPNA+KVA
Sbjct  25   AMTCNPLELSPCASAITGAN-APSAICCSKLKEQRICLCQYMKDPNLRKFVNSPNARKVA  83

Query  344  NTCGSPFPRC  315
              CGSPFPRC
Sbjct  84   TVCGSPFPRC  93



>gb|AFK34114.1| unknown [Medicago truncatula]
Length=92

 Score =   110 bits (274),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 76/91 (84%), Gaps = 4/91 (4%)
 Frame = -3

Query  587  IAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLC  408
            IAIC  L++L++    V+V+ AVTC+P+QLS C +AITSS T PS +CCSK+KEQRPCLC
Sbjct  6    IAICTFLVLLLIN---VQVSMAVTCSPVQLSSCVSAITSS-TPPSNLCCSKIKEQRPCLC  61

Query  407  KYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            +YMK+P L +F+ +PNA+KVANTCG+PFPRC
Sbjct  62   QYMKNPNLTKFVNTPNARKVANTCGTPFPRC  92



>gb|KHN44569.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
Length=93

 Score =   109 bits (273),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 79/94 (84%), Gaps = 1/94 (1%)
 Frame = -3

Query  596  MRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRP  417
            M++  I    LV++L  ++V+V++AVTC+P+QLS C +AITSS T PS +CCSK+KEQ+P
Sbjct  1    MKASRIALFTLVVLLFVAEVQVSKAVTCSPVQLSACVSAITSS-TPPSNLCCSKIKEQKP  59

Query  416  CLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            CLC+Y+K+P L++F+ SPNA++VANTCG+PFPRC
Sbjct  60   CLCQYLKNPNLKKFVDSPNARRVANTCGTPFPRC  93



>ref|XP_006448406.1| hypothetical protein CICLE_v10017614mg, partial [Citrus clementina]
 gb|ESR61646.1| hypothetical protein CICLE_v10017614mg, partial [Citrus clementina]
Length=86

 Score =   109 bits (272),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 62/70 (89%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
            A+TCNPL+LSPCA+AIT +N +PS +CCSKLKEQR CLC+YMKDP L++F+ SPNA+KVA
Sbjct  18   AMTCNPLELSPCASAITGAN-APSAICCSKLKEQRICLCQYMKDPNLRKFVNSPNARKVA  76

Query  344  NTCGSPFPRC  315
              CGSPFPRC
Sbjct  77   TVCGSPFPRC  86



>ref|XP_007152725.1| hypothetical protein PHAVU_004G154200g [Phaseolus vulgaris]
 gb|ESW24719.1| hypothetical protein PHAVU_004G154200g [Phaseolus vulgaris]
Length=92

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 78/91 (86%), Gaps = 4/91 (4%)
 Frame = -3

Query  587  IAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLC  408
            IA+C ++++L    ++V+V+ AVTC+P+QLS C +AITSS T PS +CCSK+KEQ+PCLC
Sbjct  6    IALCTLVVLL---VAEVQVSMAVTCSPVQLSSCVSAITSS-TPPSNLCCSKIKEQKPCLC  61

Query  407  KYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            KY+K+P L++F+ SPNA+KVA+TCG+PFPRC
Sbjct  62   KYLKNPNLKKFVDSPNARKVASTCGTPFPRC  92



>ref|XP_004512892.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Cicer arietinum]
Length=92

 Score =   108 bits (269),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 78/91 (86%), Gaps = 4/91 (4%)
 Frame = -3

Query  587  IAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLC  408
            IAIC  L++L++   +V+V+ AVTC+PLQLS C +AITSS T PS +CCSK+KEQRPCLC
Sbjct  6    IAICTFLMLLLI---EVQVSMAVTCSPLQLSSCVSAITSS-TPPSNLCCSKIKEQRPCLC  61

Query  407  KYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            +Y+K+P L++F+ SPNAKKVA+TCG+P+P+C
Sbjct  62   QYLKNPNLRKFVNSPNAKKVASTCGTPYPKC  92



>ref|XP_009357223.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=99

 Score =   107 bits (268),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 76/99 (77%), Gaps = 6/99 (6%)
 Frame = -3

Query  596  MRSIAICAIl----lvlvLGASKVEVTEA-VTCNPLQLSPCATAITSSNTSPSPVCCSKL  432
            MRS++ C +     +V ++  S+ +V EA VTCNP++L+PCA AI SSN SP+ VCC KL
Sbjct  2    MRSMSYCNVGILCLVVFLVVVSETQVGEAAVTCNPMELAPCAAAIMSSN-SPTAVCCGKL  60

Query  431  KEQRPCLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            KEQ PCLC+Y+K+P LQ+ + SPNAKKVA+TCGSPFP C
Sbjct  61   KEQSPCLCQYVKNPNLQKLVNSPNAKKVADTCGSPFPTC  99



>ref|XP_008389256.1| PREDICTED: non-specific lipid-transfer protein 2-like [Malus 
domestica]
Length=99

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
            AVTCNP++L+PC+ AI SSN SP+PVCC KLKEQ PCLC+Y+K+P LQR + SPNAKKVA
Sbjct  31   AVTCNPMELAPCSAAIMSSN-SPTPVCCKKLKEQSPCLCQYVKNPNLQRLVNSPNAKKVA  89

Query  344  NTCGSPFPRC  315
            +TCGSPFP C
Sbjct  90   DTCGSPFPTC  99



>ref|NP_001235108.1| uncharacterized protein LOC100306442 precursor [Glycine max]
 gb|ACU14623.1| unknown [Glycine max]
 gb|KHN23756.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
Length=93

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = -3

Query  596  MRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRP  417
            M++  I    LV+V   ++V+V+ AVTC+P+QLS C +AITSS T PS +CCSK+KEQ+P
Sbjct  1    MKASPIAWFTLVVVFLVAEVQVSMAVTCSPVQLSACVSAITSS-TPPSNLCCSKIKEQKP  59

Query  416  CLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            CLC+Y+K+P L++F+ SPNA++VA+TCG+PFPRC
Sbjct  60   CLCQYLKNPNLKKFVDSPNARRVASTCGTPFPRC  93



>ref|XP_002527025.1| Nonspecific lipid-transfer protein, putative [Ricinus communis]
 gb|EEF35397.1| Nonspecific lipid-transfer protein, putative [Ricinus communis]
Length=91

 Score =   105 bits (262),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = -3

Query  539  VEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPN  360
            V+VT AVTC+P++LS CA AITSS + PS +CCSKLK+QRPCLC+Y+K+P LQ+ + SPN
Sbjct  18   VQVTSAVTCDPVELSACANAITSS-SPPSAICCSKLKQQRPCLCQYVKNPNLQKLVNSPN  76

Query  359  AKKVANTCGSPFPRC  315
            AKKVA  CGSPFP C
Sbjct  77   AKKVATICGSPFPNC  91



>ref|XP_008339633.1| PREDICTED: non-specific lipid-transfer protein 2-like [Malus 
domestica]
Length=99

 Score =   105 bits (262),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 60/70 (86%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
            AVTCNP++L+PCA AI SSN SP+ VCC KLKEQ PCLC+Y+K+P LQ+ + SPNAKKVA
Sbjct  31   AVTCNPMELAPCAAAIMSSN-SPTAVCCGKLKEQSPCLCQYVKNPNLQKLVNSPNAKKVA  89

Query  344  NTCGSPFPRC  315
            +TCGSPFP C
Sbjct  90   DTCGSPFPTC  99



>ref|XP_012075730.1| PREDICTED: non-specific lipid-transfer protein 2-like [Jatropha 
curcas]
 gb|KDP35032.1| hypothetical protein JCGZ_09320 [Jatropha curcas]
Length=94

 Score =   105 bits (261),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = -3

Query  539  VEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPN  360
            ++V  AVTCNP++L+PCA AITSS + PS +CCSKLKEQ+PCLC+Y+K+P LQ+ + SPN
Sbjct  20   LQVAMAVTCNPVELTPCAKAITSS-SPPSTICCSKLKEQKPCLCQYLKNPYLQKLVNSPN  78

Query  359  AKKVANTCGSPFPR  318
            AKKVA TCGSPFP 
Sbjct  79   AKKVATTCGSPFPN  92



>gb|AFK37583.1| unknown [Lotus japonicus]
Length=93

 Score =   104 bits (260),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 70/78 (90%), Gaps = 2/78 (3%)
 Frame = -3

Query  545  SKVEVTEA-VTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
            ++VE++ A VTC+P+QLS C +AITSS T P+ +CCSK+KEQ+PCLC+Y+K+P L++F++
Sbjct  17   AEVEMSMATVTCSPVQLSSCVSAITSS-TPPTNLCCSKIKEQKPCLCQYLKNPYLRKFVS  75

Query  368  SPNAKKVANTCGSPFPRC  315
            SPNA+KVANTCG+PFPRC
Sbjct  76   SPNARKVANTCGTPFPRC  93



>ref|XP_009360132.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=97

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 76/92 (83%), Gaps = 4/92 (4%)
 Frame = -3

Query  590  SIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCL  411
            +IA+C +L++L+  A    V+ AVTCN +QLSPCA AITSS T PS +CCSK+KEQ+PCL
Sbjct  10   AIALCTVLVLLLATA---PVSTAVTCNAIQLSPCAGAITSS-TPPSTLCCSKIKEQKPCL  65

Query  410  CKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            C+Y+K+P L++ + +PNA+KVA+TCG+PFP+C
Sbjct  66   CQYLKNPNLKKLVNTPNARKVASTCGTPFPKC  97



>ref|XP_008240231.1| PREDICTED: non-specific lipid-transfer protein 2-like [Prunus 
mume]
Length=96

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
             K +V+ AVTCNP +LSPCA AITSS T PS +CC+K+K+Q+PCLC+Y+ +P L++F+ +
Sbjct  21   GKADVSMAVTCNPTELSPCAGAITSS-TPPSTICCTKIKQQKPCLCQYLNNPNLKKFVNT  79

Query  365  PNAKKVANTCGSPFPRC  315
            PNA+KVA TCG+PFP+C
Sbjct  80   PNARKVARTCGTPFPKC  96



>gb|KJB34314.1| hypothetical protein B456_006G059100 [Gossypium raimondii]
Length=93

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 76/91 (84%), Gaps = 3/91 (3%)
 Frame = -3

Query  587  IAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLC  408
            IA CA++++L+  A  VEV+ AVTC+P QLS C +AITSS + PS +CCSK+KEQ+PCLC
Sbjct  6    IAWCAVMVILL--AEAVEVSTAVTCSPTQLSSCVSAITSS-SPPSQLCCSKIKEQKPCLC  62

Query  407  KYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            +Y+K+P L++FI + NA+KVA+TCG+PFP+C
Sbjct  63   QYLKNPNLKKFINTGNARKVASTCGTPFPKC  93



>ref|XP_008393327.1| PREDICTED: non-specific lipid-transfer protein 2-like [Malus 
domestica]
Length=97

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 76/92 (83%), Gaps = 4/92 (4%)
 Frame = -3

Query  590  SIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCL  411
            +IA+C +L++L+  A    V+ AVTCN +QLSPCA AITSS T PS +CCSK+KEQ+PCL
Sbjct  10   AIALCTVLVLLLAXA---PVSTAVTCNAIQLSPCAGAITSS-TPPSTLCCSKIKEQKPCL  65

Query  410  CKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            C+Y+K+P L++ + +PNA+KVA+TCG+PFP+C
Sbjct  66   CQYLKNPNLKKLVNTPNARKVASTCGTPFPKC  97



>emb|CDP02751.1| unnamed protein product [Coffea canephora]
Length=95

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = -3

Query  602  IAMRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQ  423
            + +  + +C++LL++ +   +VEV+ AVTC+P +LSPC  AI S N  PSP CCSKL+EQ
Sbjct  1    MKLSQMRLCSVLLLVAVIVGEVEVSRAVTCSPTELSPCVGAIIS-NQPPSPACCSKLREQ  59

Query  422  RPCLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            RPCLC Y++DP L++++ SPNA++VA++CG P PRC
Sbjct  60   RPCLCGYLRDPNLRQYVNSPNARRVASSCGVPTPRC  95



>gb|KEH44195.1| Lipid transfer protein [Medicago truncatula]
Length=92

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            +K E++  +TCN LQLS CA AI SSN  PS +CCSKLKEQ+PCLC+Y+KDP L++F+ S
Sbjct  17   AKTELSMEITCNALQLSACANAIISSN-PPSAICCSKLKEQKPCLCQYLKDPNLKKFVNS  75

Query  365  PNAKKVANTCGSPFPRC  315
            PNA KV++ CGSPFP C
Sbjct  76   PNAIKVSDACGSPFPIC  92



>ref|XP_007211115.1| hypothetical protein PRUPE_ppa025024mg, partial [Prunus persica]
 gb|EMJ12314.1| hypothetical protein PRUPE_ppa025024mg, partial [Prunus persica]
Length=94

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
             K +V+ AVTCNP +LSPCA AITSS T PS +CC+K+K+Q+PCLC+Y+ +P L++F+ +
Sbjct  19   GKADVSMAVTCNPTELSPCAGAITSS-TPPSTICCTKIKQQKPCLCQYLNNPNLKKFVNT  77

Query  365  PNAKKVANTCGSPFPRC  315
            PNA+KVA TCG+PFP+C
Sbjct  78   PNARKVARTCGTPFPKC  94



>ref|XP_010044111.1| PREDICTED: non-specific lipid-transfer protein 2-like [Eucalyptus 
grandis]
 gb|KCW86149.1| hypothetical protein EUGRSUZ_B02852 [Eucalyptus grandis]
Length=90

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = -3

Query  542  KVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASP  363
            K+E + AVTCNP++LS CA+AITSS + PS +CC+KLKEQRPCLC+YMK+P LQ+FI SP
Sbjct  16   KLEPSMAVTCNPIELSSCASAITSS-SPPSAMCCAKLKEQRPCLCQYMKNPNLQKFINSP  74

Query  362  NAKKVANTCGSPFPRC  315
            N++ VA  CGSPFP C
Sbjct  75   NSRNVAIKCGSPFPSC  90



>gb|KHN42434.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
Length=95

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
            AVTCN LQLS CA+AITSS T PS +CCSKLKEQRPCLC+Y+KDP L++ + SPNA+ VA
Sbjct  27   AVTCNALQLSACASAITSS-TPPSALCCSKLKEQRPCLCQYLKDPNLKKLVNSPNARMVA  85

Query  344  NTCGSPFPRC  315
            N CGSPFP C
Sbjct  86   NACGSPFPTC  95



>emb|CDY51937.1| BnaAnng11140D [Brassica napus]
Length=96

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = -3

Query  539  VEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPN  360
            V   EAVTC+P+QLSPCA AITSS + PS +CC+KLKEQ+PC+C YM++P L+R+I+SPN
Sbjct  23   VPAAEAVTCSPMQLSPCAAAITSS-SPPSALCCAKLKEQKPCICGYMRNPSLRRYISSPN  81

Query  359  AKKVANTCGSPFPRC  315
            A+KV+NTC  P PRC
Sbjct  82   ARKVSNTCKFPMPRC  96



>ref|XP_004299573.1| PREDICTED: non-specific lipid-transfer protein 2 [Fragaria vesca 
subsp. vesca]
Length=96

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 77/93 (83%), Gaps = 5/93 (5%)
 Frame = -3

Query  590  SIAICAIllvlvLGASKVEVT-EAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPC  414
            +IA+C +++V++  A   EV+  AVTC+P+QLS CA+AI SSNT PS +CC+KL+EQ+PC
Sbjct  7    AIALCTVVVVMLATA---EVSMAAVTCSPVQLSSCASAI-SSNTPPSSLCCTKLREQKPC  62

Query  413  LCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            LC+Y+ +P L++F+ +PNA+KVA TCG+PFPRC
Sbjct  63   LCQYLNNPNLKKFVNTPNARKVARTCGTPFPRC  95



>ref|NP_188456.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 dbj|BAB01177.1| lipid transfer protein [Arabidopsis thaliana]
 gb|AAK64007.1| AT3g18280/MIE15_7 [Arabidopsis thaliana]
 gb|AAL76158.1| AT3g18280/MIE15_7 [Arabidopsis thaliana]
 gb|AEE76075.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=96

 Score =   102 bits (255),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = -3

Query  527  EAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKV  348
            EAVTC+P+QLSPCATAITSS+  PS +CC+KLKEQRPCLC YM++P L+RF+++PNA+KV
Sbjct  27   EAVTCSPMQLSPCATAITSSS-PPSALCCAKLKEQRPCLCGYMRNPSLRRFVSTPNARKV  85

Query  347  ANTCGSPFPRC  315
            + +C  P PRC
Sbjct  86   SKSCKLPIPRC  96



>ref|XP_002322068.2| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
 gb|EEF06195.2| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
Length=93

 Score =   102 bits (253),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -3

Query  596  MRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRP  417
            M++  + A  ++++L A +     AVTC+P QLS C +AITSS T PS +CCSK+KEQ+P
Sbjct  1    MKTSYMVAYTMLVLLLAQEHVKVSAVTCSPAQLSSCVSAITSS-TPPSKLCCSKIKEQKP  59

Query  416  CLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            CLC+Y+K+P LQ+FI +PNA+KVA+TCG+PFP+C
Sbjct  60   CLCQYLKNPNLQKFINTPNARKVASTCGTPFPKC  93



>gb|ABK92836.1| unknown [Populus trichocarpa]
Length=93

 Score =   102 bits (253),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 62/70 (89%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
            AVTC+P QLS C +AITSS T PS +CCSK+KEQ+PCLC+Y+K+P LQ+FI +PNA+KVA
Sbjct  25   AVTCSPAQLSSCVSAITSS-TPPSKLCCSKIKEQKPCLCQYLKNPNLQKFINTPNARKVA  83

Query  344  NTCGSPFPRC  315
            +TCG+PFP+C
Sbjct  84   STCGTPFPKC  93



>ref|XP_010279351.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nelumbo 
nucifera]
Length=92

 Score =   102 bits (253),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            ++  ++ AV C P +L+ CA+AITSS  +PS +CCSKLKEQRPCLCKY+KDP LQ+ I +
Sbjct  17   NEAHISVAVVCRPTELASCASAITSS-AAPSKMCCSKLKEQRPCLCKYLKDPNLQKLINT  75

Query  365  PNAKKVANTCGSPFPRC  315
            PNAKKVA+TCG PFP C
Sbjct  76   PNAKKVASTCGIPFPSC  92



>ref|XP_006442592.1| hypothetical protein CICLE_v10023053mg [Citrus clementina]
 ref|XP_006477780.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Citrus sinensis]
 gb|ESR55832.1| hypothetical protein CICLE_v10023053mg [Citrus clementina]
 gb|KDO49801.1| hypothetical protein CISIN_1g034465mg [Citrus sinensis]
Length=94

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 68/78 (87%), Gaps = 1/78 (1%)
 Frame = -3

Query  548  ASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
            A++ +V+ AVTC+P QLS C +AITSS T PS +CCSK+KEQ+PCLC+Y+++P L++FI 
Sbjct  18   AAETQVSVAVTCSPTQLSSCVSAITSS-TPPSRLCCSKIKEQKPCLCQYLRNPSLRKFIN  76

Query  368  SPNAKKVANTCGSPFPRC  315
            +PNA++VA+TCG+PFP+C
Sbjct  77   TPNARRVASTCGTPFPKC  94



>ref|XP_010665172.1| PREDICTED: non-specific lipid-transfer protein 2-like [Vitis 
vinifera]
Length=92

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 4/96 (4%)
 Frame = -3

Query  602  IAMRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQ  423
            + M  IA+C  LL+L   A   +V+ AVTC+P++LS CA AI SS + P+  CCSKLKEQ
Sbjct  1    MKMSYIAVCFALLLLFGEA---QVSTAVTCSPMELSTCANAIISS-SPPTATCCSKLKEQ  56

Query  422  RPCLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            R CLC+Y+K+P LQ+FI SPNA+KVA+TCGSPFP C
Sbjct  57   RSCLCQYVKNPNLQKFINSPNARKVASTCGSPFPNC  92



>ref|XP_009347476.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=98

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 74/92 (80%), Gaps = 4/92 (4%)
 Frame = -3

Query  590  SIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCL  411
            +IA+C ++L+L+  A    V+ AVTCN +QLSPCA AITSS T PS +CCSK+KEQ+PCL
Sbjct  11   AIALCTVVLLLLATA---PVSMAVTCNAIQLSPCAGAITSS-TPPSKLCCSKIKEQKPCL  66

Query  410  CKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            C+Y+K+P L++ + +PNA+ VA TCG+PFP+C
Sbjct  67   CQYLKNPNLKKLVNTPNARNVARTCGTPFPKC  98



>emb|CDX75963.1| BnaC03g40460D [Brassica napus]
Length=96

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = -3

Query  527  EAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKV  348
            EAVTC+P+QLSPCA AITSS + PS +CC+KLKEQ+PC+C YM++P L+R+I+SPNA+KV
Sbjct  27   EAVTCSPMQLSPCAAAITSS-SPPSALCCAKLKEQKPCICGYMRNPSLRRYISSPNARKV  85

Query  347  ANTCGSPFPRC  315
            +NTC  P PRC
Sbjct  86   SNTCKFPMPRC  96



>ref|XP_002317903.2| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
 gb|ABK92986.1| unknown [Populus trichocarpa]
 gb|EEE96123.2| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
Length=93

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 64/71 (90%), Gaps = 1/71 (1%)
 Frame = -3

Query  527  EAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKV  348
            +AVTC+P QLS C +AITSS T P+ +CCSK+KEQ+PCLC+Y+K+P+LQ+FI +PNA+KV
Sbjct  24   DAVTCSPAQLSSCVSAITSS-TPPTNLCCSKIKEQKPCLCQYLKNPKLQKFINTPNARKV  82

Query  347  ANTCGSPFPRC  315
            A+TCG+PFP+C
Sbjct  83   ASTCGTPFPKC  93



>ref|NP_001236829.1| uncharacterized protein LOC100500614 precursor [Glycine max]
 gb|ACU15740.1| unknown [Glycine max]
Length=95

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 58/70 (83%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
            AVTCN LQLS CA+AITSS T PS +CCSKLKEQRPCLC+Y+KDP L++ + SPNA+  A
Sbjct  27   AVTCNALQLSACASAITSS-TPPSALCCSKLKEQRPCLCQYLKDPNLKKLVNSPNARMAA  85

Query  344  NTCGSPFPRC  315
            N CGSPFP C
Sbjct  86   NACGSPFPTC  95



>emb|CDY24453.1| BnaC05g35010D [Brassica napus]
Length=96

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = -3

Query  527  EAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKV  348
            EAVTC+P+QLSPCA AITSS + PS +CC+KLKEQ+PCLC YM++P L+RF++SPNA+KV
Sbjct  27   EAVTCSPMQLSPCAQAITSS-SPPSALCCAKLKEQKPCLCGYMRNPSLRRFVSSPNARKV  85

Query  347  ANTCGSPFPRC  315
            +N C  P PRC
Sbjct  86   SNRCKLPIPRC  96



>emb|CDX92224.1| BnaA05g21830D [Brassica napus]
Length=96

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = -3

Query  530  TEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKK  351
             EAVTC+P+QLSPCA AITSS + PS +CC+KLKEQ+PCLC YM++P L+RF++SPNA+K
Sbjct  26   AEAVTCSPMQLSPCAQAITSS-SPPSALCCAKLKEQKPCLCGYMRNPSLRRFVSSPNARK  84

Query  350  VANTCGSPFPRC  315
            V+N C  P PRC
Sbjct  85   VSNRCKLPIPRC  96



>ref|XP_008374782.1| PREDICTED: non-specific lipid-transfer protein 2 [Malus domestica]
Length=98

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 73/92 (79%), Gaps = 4/92 (4%)
 Frame = -3

Query  590  SIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCL  411
            +IA+C ++++L+  A    V+ AVTCN +QLSPCA AITSS T PS +CCSK+KEQ+PCL
Sbjct  11   AIALCTVVVLLLATA---PVSTAVTCNAIQLSPCAGAITSS-TPPSKLCCSKIKEQKPCL  66

Query  410  CKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            C+Y+K+P L++ + +PNA+ VA TCG PFP+C
Sbjct  67   CQYLKNPNLKKLVNTPNARNVARTCGXPFPKC  98



>ref|XP_009145909.1| PREDICTED: non-specific lipid-transfer protein 2 [Brassica rapa]
Length=96

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = -3

Query  527  EAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKV  348
            EAVTC+P+QLSPCA AITSS + PS +CC+KLKEQ+PCLC YM++P L+RF++SPNA+KV
Sbjct  27   EAVTCSPMQLSPCAQAITSS-SPPSALCCAKLKEQKPCLCGYMRNPSLRRFVSSPNARKV  85

Query  347  ANTCGSPFPRC  315
            +N C  P PRC
Sbjct  86   SNRCKLPIPRC  96



>ref|XP_010032280.1| PREDICTED: non-specific lipid-transfer protein 2-like [Eucalyptus 
grandis]
 dbj|BAM05644.1| lipid transfer protein [Eucalyptus globulus subsp. globulus]
 gb|KCW83938.1| hypothetical protein EUGRSUZ_B00824 [Eucalyptus grandis]
 emb|CEG03556.1| unnamed protein product [Fusarium acuminatum CS5907]
Length=95

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = -3

Query  539  VEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPN  360
            V V  AVTC P++LS C +AITS+ T P+ +CCSK+KEQ+PCLC+Y+++P L++F++SPN
Sbjct  22   VRVEAAVTCRPIELSACVSAITSA-TPPTTLCCSKIKEQKPCLCQYLQNPNLKKFVSSPN  80

Query  359  AKKVANTCGSPFPRC  315
            AKKVA+TCG+PFP+C
Sbjct  81   AKKVASTCGTPFPKC  95



>dbj|BAM05641.1| lipid transfer protein [Eucalyptus pilularis]
 dbj|BAM05642.1| lipid transfer protein [Eucalyptus pilularis]
Length=95

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = -3

Query  539  VEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPN  360
            V V  AV C P++LS C  AITS+ T P+ +CCSK+KEQ+PCLC+Y+++P L++F++SPN
Sbjct  22   VRVEAAVACRPIELSACVNAITSA-TPPTTLCCSKIKEQKPCLCQYLQNPNLKKFVSSPN  80

Query  359  AKKVANTCGSPFPRC  315
            AKKVANTCG+PFP+C
Sbjct  81   AKKVANTCGTPFPKC  95



>ref|XP_006299714.1| hypothetical protein CARUB_v10015906mg [Capsella rubella]
 gb|EOA32612.1| hypothetical protein CARUB_v10015906mg [Capsella rubella]
Length=97

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = -3

Query  527  EAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKV  348
            EAVTC+P+QLSPCA+AITSS + PS +CC KLKEQ+PCLC YM++P L+RF++SPNA+KV
Sbjct  28   EAVTCSPMQLSPCASAITSS-SPPSALCCKKLKEQKPCLCGYMRNPSLRRFVSSPNARKV  86

Query  347  ANTCGSPFPRC  315
            +N C  P PRC
Sbjct  87   SNHCRLPIPRC  97



>gb|KJB52998.1| hypothetical protein B456_008G287700 [Gossypium raimondii]
Length=97

 Score =   100 bits (248),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = -3

Query  542  KVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASP  363
            + +V+ AVTC+P QLS C +AITSS + PS +CCSK+KEQ+PCLC+Y+K+P L++FI +P
Sbjct  23   EAKVSVAVTCSPTQLSSCVSAITSS-SPPSKLCCSKIKEQKPCLCQYLKNPNLKKFINTP  81

Query  362  NAKKVANTCGSPFPRC  315
            NA+KVA+TCG+PFP+C
Sbjct  82   NARKVASTCGTPFPKC  97



>emb|CDY48021.1| BnaA04g26690D [Brassica napus]
 emb|CDX95546.1| BnaC01g34380D [Brassica napus]
Length=96

 Score = 99.8 bits (247),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = -3

Query  539  VEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPN  360
            V   EAVTC+P+QLSPCA+AITSS + PS +CC+KLKEQ+PCLC YM++  L+RF++SPN
Sbjct  23   VPAAEAVTCSPMQLSPCASAITSS-SQPSALCCAKLKEQKPCLCGYMRNRSLRRFVSSPN  81

Query  359  AKKVANTCGSPFPRC  315
            A+KV+N C  P PRC
Sbjct  82   ARKVSNRCKLPIPRC  96



>gb|EYU40792.1| hypothetical protein MIMGU_mgv1a022792mg, partial [Erythranthe 
guttata]
Length=77

 Score = 99.0 bits (245),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 60/70 (86%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
            AV+CNPLQLSPCA+AITSS + PS  CC+KLKEQRPCLC+YM++P LQ+FI S  AKKVA
Sbjct  9    AVSCNPLQLSPCASAITSS-SKPSATCCAKLKEQRPCLCQYMRNPNLQKFIKSSGAKKVA  67

Query  344  NTCGSPFPRC  315
            ++C  P+P+C
Sbjct  68   SSCRIPYPKC  77



>ref|XP_006406624.1| hypothetical protein EUTSA_v10021828mg [Eutrema salsugineum]
 gb|ESQ48077.1| hypothetical protein EUTSA_v10021828mg [Eutrema salsugineum]
Length=97

 Score = 99.8 bits (247),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = -3

Query  539  VEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPN  360
            V   EAVTC+P+QLSPCA+AITSS + PS +CC+KLKEQ+PCLC YM++P L+RF++S N
Sbjct  24   VPAGEAVTCSPMQLSPCASAITSS-SPPSALCCAKLKEQKPCLCGYMRNPSLRRFVSSSN  82

Query  359  AKKVANTCGSPFPRC  315
            A+KV+N C  P PRC
Sbjct  83   ARKVSNRCKLPIPRC  97



>gb|ACM78621.1| non-specific lipid-transfer protein type 2 [Tamarix hispida]
Length=92

 Score = 99.4 bits (246),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            S+ +V+ AVTC+P QLSPC  AITSS + PS +CCSK+++Q+PCLC+YMK+P L++F+ +
Sbjct  17   SQTQVSTAVTCSPAQLSPCVGAITSS-SPPSGLCCSKVRQQKPCLCQYMKNPYLRKFVNT  75

Query  365  PNAKKVANTCGSPFPRC  315
            PNAKKVA+ C +PFPRC
Sbjct  76   PNAKKVASQCRTPFPRC  92



>dbj|BAM05643.1| lipid transfer protein [Eucalyptus pyrocarpa]
Length=95

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = -3

Query  539  VEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPN  360
            V V  AV C P++LS C  AITS+ T P+ +CCSK+KEQ+PCLC+Y+++P L++FI+SPN
Sbjct  22   VRVEAAVACRPIELSACVNAITSA-TPPTTLCCSKIKEQKPCLCQYLQNPNLKKFISSPN  80

Query  359  AKKVANTCGSPFPRC  315
            AKKVA+TCG+PFP+C
Sbjct  81   AKKVASTCGTPFPKC  95



>ref|XP_010110085.1| hypothetical protein L484_013260 [Morus notabilis]
 gb|EXC25172.1| hypothetical protein L484_013260 [Morus notabilis]
Length=94

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            +K +V+ AVTC+P+QLS C +AIT+S + P+ +CC+K+KEQ+PCLC+Y+K+P L++F+ S
Sbjct  19   AKSQVSMAVTCSPVQLSACVSAITTS-SPPTQLCCTKIKEQKPCLCQYLKNPNLKKFVDS  77

Query  365  PNAKKVANTCGSPFPRC  315
            PNA++VANTC +PFP+C
Sbjct  78   PNARRVANTCKTPFPKC  94



>ref|XP_010036906.1| PREDICTED: non-specific lipid-transfer protein 2-like [Eucalyptus 
grandis]
 gb|KCW48562.1| hypothetical protein EUGRSUZ_K02234 [Eucalyptus grandis]
Length=92

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            +++++T AVTC P +LS CA +I SS T PS +CC+K+KEQ+PCLC+Y+K+P L++F+ S
Sbjct  17   AEMQITMAVTCKPTELSSCANSIVSS-TPPSRLCCTKIKEQKPCLCQYLKNPSLKKFVNS  75

Query  365  PNAKKVANTCGSPFPRC  315
            PNA+KVA+TCG+PFP+C
Sbjct  76   PNARKVASTCGTPFPKC  92



>gb|AFP49331.1| non-specific lipid-transfer protein type 2, partial [Olea europaea]
Length=82

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
             ++ V+EAVTCNPLQLSPC  AITS    PS  CC KL+EQ+PCLC Y+KDP L +++ S
Sbjct  7    GELHVSEAVTCNPLQLSPCLGAITSGQP-PSAACCKKLQEQKPCLCGYIKDPNLGKYVNS  65

Query  365  PNAKKVANTCGSPFPRC  315
            PNAKKVA++CG   P C
Sbjct  66   PNAKKVASSCGVAVPNC  82



>ref|XP_009113462.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brassica 
rapa]
Length=97

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = -3

Query  539  VEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPN  360
            V   EAVTC+P+QLSPCA+AITSS+ + S +CC+KLKEQ+PCLC YM++  L+RF++SPN
Sbjct  24   VPAAEAVTCSPMQLSPCASAITSSSQT-SALCCAKLKEQKPCLCGYMRNRSLRRFVSSPN  82

Query  359  AKKVANTCGSPFPRC  315
            A+KV+N C  P PRC
Sbjct  83   ARKVSNRCKLPIPRC  97



>ref|XP_006383409.1| hypothetical protein POPTR_0005s15210g [Populus trichocarpa]
 gb|ERP61206.1| hypothetical protein POPTR_0005s15210g [Populus trichocarpa]
Length=94

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            ++ +V++A TCNP QLSPC  AI SS T PS  CCSKLKEQ+PCLC Y+KDP L++F++S
Sbjct  19   AEAQVSQAQTCNPGQLSPCLGAIMSS-TPPSTTCCSKLKEQKPCLCGYLKDPSLKQFVSS  77

Query  365  PNAKKVANTCGSPFPRC  315
            P A+KVA+ CG P+P C
Sbjct  78   PGARKVASDCGVPYPSC  94



>gb|ABK95885.1| unknown [Populus trichocarpa]
Length=93

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 63/71 (89%), Gaps = 1/71 (1%)
 Frame = -3

Query  527  EAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKV  348
            +AVT +P QLS C +AITSS T P+ +CCSK+KEQ+PCLC+Y+K+P+LQ+FI +PNA+KV
Sbjct  24   DAVTGSPAQLSSCVSAITSS-TPPTNLCCSKIKEQKPCLCQYLKNPKLQKFINTPNARKV  82

Query  347  ANTCGSPFPRC  315
            A+TCG+PFP+C
Sbjct  83   ASTCGTPFPKC  93



>ref|XP_011035101.1| PREDICTED: non-specific lipid-transfer protein 2-like [Populus 
euphratica]
Length=94

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 61/74 (82%), Gaps = 1/74 (1%)
 Frame = -3

Query  536  EVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNA  357
            +V++AVTCNP QLSPC  AITSS+  PS  CCSKLKEQ+PCLC Y+KDP L++F++SP +
Sbjct  22   KVSQAVTCNPGQLSPCLPAITSSSP-PSTACCSKLKEQKPCLCGYLKDPSLKQFVSSPGS  80

Query  356  KKVANTCGSPFPRC  315
            +KVA+ CG P+P C
Sbjct  81   RKVASACGVPYPSC  94



>ref|XP_006430726.1| hypothetical protein CICLE_v10013191mg [Citrus clementina]
 gb|ESR43966.1| hypothetical protein CICLE_v10013191mg [Citrus clementina]
Length=99

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            S+V V EA TCNP +LSPCA AITSS   PS  CC+K+++QRPCLC +++DP L++++ S
Sbjct  24   SQVNVAEAATCNPTELSPCAPAITSS-APPSRACCNKMRQQRPCLCGFLRDPNLKQYVNS  82

Query  365  PNAKKVANTCGSPFPRC  315
            PNAK+V  TCG P+PRC
Sbjct  83   PNAKRVIATCGIPYPRC  99



>ref|XP_008229268.1| PREDICTED: non-specific lipid-transfer protein 2-like [Prunus 
mume]
Length=98

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 68/92 (74%), Gaps = 1/92 (1%)
 Frame = -3

Query  590  SIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCL  411
             + +C ++++ ++   +  +TEAVTC+PL+LS C   I  S T PS  CC KL+EQ+PCL
Sbjct  8    GVGLCVVVMMAMVLGEEARMTEAVTCSPLELSSCLEPI-RSGTPPSTTCCQKLREQKPCL  66

Query  410  CKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            C Y+KDP L+++++SP A+KVA+TCG PFP+C
Sbjct  67   CGYLKDPALKQYVSSPTARKVASTCGVPFPQC  98



>ref|XP_006482207.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Citrus sinensis]
Length=100

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            S+V V EA TCNP +LSPC  A+TSS   PS  CC+KL++QRPCLC Y++DP L++++ S
Sbjct  25   SQVHVAEAATCNPTELSPCLAALTSS-APPSGPCCNKLRQQRPCLCGYLRDPNLKQYVNS  83

Query  365  PNAKKVANTCGSPFPRC  315
            PNAK+V  TCG P+PRC
Sbjct  84   PNAKRVVATCGIPYPRC  100



>ref|XP_010534224.1| PREDICTED: non-specific lipid-transfer protein 2-like [Tarenaya 
hassleriana]
Length=94

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -3

Query  527  EAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKV  348
            EAVTC+PL+LSPCA AITS+ T PS  CC KL+EQ+PCLC Y+K+P L+ F++SPNAKKV
Sbjct  24   EAVTCSPLELSPCAAAITSAKTPPSGQCCQKLREQKPCLCGYLKNPTLRSFVSSPNAKKV  83

Query  347  ANTCGSPFPRC  315
            +  C  PFP C
Sbjct  84   STKCNLPFPNC  94



>ref|XP_008362493.1| PREDICTED: non-specific lipid-transfer protein 2-like [Malus 
domestica]
Length=97

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 66/92 (72%), Gaps = 1/92 (1%)
 Frame = -3

Query  590  SIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCL  411
            S+  C ++ V V    +V  TEAVTC+PL+LSPC  AI S  T PS  CC KLKEQ+PCL
Sbjct  7    SLVFCLMVAVXVALCDEVRTTEAVTCSPLELSPCLEAIRSX-TPPSATCCEKLKEQQPCL  65

Query  410  CKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            C+Y+K+P L+ +I +PNAKKVA  CG PFP+C
Sbjct  66   CEYIKNPALKPYINNPNAKKVAXACGVPFPQC  97



>ref|XP_011021288.1| PREDICTED: non-specific lipid-transfer protein 2 [Populus euphratica]
Length=94

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            ++ +V++A TCNP QLSPC  AITSS T PS  CCSKLKEQ+PCLC Y+KDP L+++++S
Sbjct  19   AEAQVSQAETCNPEQLSPCLGAITSS-TPPSTTCCSKLKEQKPCLCGYLKDPSLKQYVSS  77

Query  365  PNAKKVANTCGSPFPRC  315
            P A+KV + CG P+P C
Sbjct  78   PGARKVVSACGVPYPSC  94



>gb|AGC08429.1| lipid transfer protein [Gossypium hirsutum]
Length=96

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = -3

Query  587  IAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLC  408
            +A+C + L +VL + +  + EAVTCNP +LSPC +A TSS + PS  CCSKLK Q+PCLC
Sbjct  7    VALCVVALSVVLFSGESRMAEAVTCNPTELSPCLSAFTSS-SPPSAACCSKLKAQKPCLC  65

Query  407  KYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
             Y+K+P L++++ SPNAK VA+TCG  +P+C
Sbjct  66   GYIKNPSLKQYVNSPNAKNVASTCGVTYPKC  96



>emb|CBI33621.3| unnamed protein product [Vitis vinifera]
Length=81

 Score = 96.7 bits (239),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            S+  +T+AVTC+PL+LS C  AITSS   PS +CCSKL+EQRPCLC Y++DP L +++ S
Sbjct  6    SEAHLTKAVTCSPLELSSCFAAITSS-APPSSMCCSKLREQRPCLCGYIRDPNLSQYVNS  64

Query  365  PNAKKVANTCGSPFPRC  315
             NA++VA+TCG PFP C
Sbjct  65   ANARRVASTCGVPFPNC  81



>ref|XP_002284213.1| PREDICTED: non-specific lipid-transfer protein 2-like [Vitis 
vinifera]
Length=92

 Score = 96.7 bits (239),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            S+  +T+AVTC+PL+LS C  AITSS   PS +CCSKL+EQRPCLC Y++DP L +++ S
Sbjct  17   SEAHLTKAVTCSPLELSSCFAAITSS-APPSSMCCSKLREQRPCLCGYIRDPNLSQYVNS  75

Query  365  PNAKKVANTCGSPFPRC  315
             NA++VA+TCG PFP C
Sbjct  76   ANARRVASTCGVPFPNC  92



>ref|XP_009135573.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brassica 
rapa]
Length=96

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = -3

Query  539  VEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPN  360
            V   EAVTC+P+QLSP A AI SS + PS +CC+KLKEQ+PC+C YM++P L+R+I+SPN
Sbjct  23   VPAAEAVTCSPMQLSPGAGAIPSS-SPPSALCCAKLKEQKPCICGYMRNPSLRRYISSPN  81

Query  359  AKKVANTCGSPFPRC  315
            A+KV+NTC  P PRC
Sbjct  82   ARKVSNTCKFPMPRC  96



>ref|XP_010108883.1| hypothetical protein L484_027077 [Morus notabilis]
 gb|EXC20523.1| hypothetical protein L484_027077 [Morus notabilis]
Length=98

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            SK  V EA TC+ + LSPC +AIT   T+PS VCCS+L+EQRPCLC Y+KDP L++++ S
Sbjct  22   SKAPVAEAATCSAVALSPCLSAITG-GTAPSSVCCSRLREQRPCLCGYLKDPNLRQYVNS  80

Query  365  PNAKKVANTCGSPFPRC  315
            PNAKKVA+ CG  +P+C
Sbjct  81   PNAKKVASVCGVSYPKC  97



>ref|XP_006430725.1| hypothetical protein CICLE_v10013188mg [Citrus clementina]
 gb|ESR43965.1| hypothetical protein CICLE_v10013188mg [Citrus clementina]
 gb|KDO63207.1| hypothetical protein CISIN_1g034237mg [Citrus sinensis]
Length=100

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            S+V V EAVTC+P +LSPC  A+TSS   PS  CC+KL++QRPCLC Y+++P L++++ S
Sbjct  25   SQVHVAEAVTCSPTELSPCLAALTSS-APPSGACCNKLRQQRPCLCGYLRNPNLRQYVNS  83

Query  365  PNAKKVANTCGSPFPRC  315
            PNAK++  TCG P+PRC
Sbjct  84   PNAKRIVATCGIPYPRC  100



>ref|XP_006482208.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Citrus sinensis]
Length=99

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            S+V V EA TC+P +LSPCA AITSS   PS  CC+K+++QRPCLC +++DP L++++ S
Sbjct  24   SQVNVAEAATCSPTELSPCAPAITSS-APPSGACCNKMRQQRPCLCGFLRDPNLKQYVNS  82

Query  365  PNAKKVANTCGSPFPRC  315
            PNAK+V  TCG P+PRC
Sbjct  83   PNAKRVIATCGIPYPRC  99



>ref|XP_008453433.1| PREDICTED: non-specific lipid-transfer protein 2 [Cucumis melo]
Length=100

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 64/91 (70%), Gaps = 1/91 (1%)
 Frame = -3

Query  587  IAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLC  408
            + + AILL+       VE  + V CNP+Q+S C  +I S  T PS  CCSK+KEQ+PCLC
Sbjct  11   MIVGAILLISNSNEVMVEGADQVACNPMQMSSCMNSIVSG-TPPSSQCCSKIKEQKPCLC  69

Query  407  KYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
             Y+K+P L+ F++SPNA+KVAN CG+PFP C
Sbjct  70   GYLKNPFLKSFVSSPNARKVANDCGTPFPNC  100



>ref|XP_009589620.1| PREDICTED: non-specific lipid-transfer protein 2 {ECO:0000303|PubMed:23913675}-like 
[Nicotiana tomentosiformis]
Length=93

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -3

Query  596  MRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRP  417
            M++ +  A+  VLVL  ++  ++ AVTC+ +QLSPC  AITS N+ PS +CCSK++EQ+P
Sbjct  1    MKTASKLAVFTVLVLLLAEAHISVAVTCSAIQLSPCLGAITS-NSPPSGLCCSKIREQKP  59

Query  416  CLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            CLC+Y+K+P L+ ++ SP AKKVA TCG P+P+C
Sbjct  60   CLCQYLKNPNLRNYVNSPGAKKVARTCGVPYPKC  93



>ref|XP_009589151.1| PREDICTED: non-specific lipid-transfer protein 2 {ECO:0000303|PubMed:23913675}-like 
[Nicotiana tomentosiformis]
Length=93

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            S+  ++ A TC+P+QLSPC  AI SS T PS +CCSK+K+Q+PCLC+Y+K+P L++++ S
Sbjct  18   SEAHISFAATCSPVQLSPCLGAIRSS-TPPSKLCCSKIKQQKPCLCQYLKNPNLKKYVNS  76

Query  365  PNAKKVANTCGSPFPRC  315
            P AKKVA TCG P+PRC
Sbjct  77   PAAKKVARTCGVPYPRC  93



>ref|XP_011648973.1| PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis 
sativus]
 gb|KGN63840.1| hypothetical protein Csa_1G024245 [Cucumis sativus]
Length=100

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = -3

Query  539  VEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPN  360
            VE  + V CNP+QLS C  +I S    PS  CCSK+KEQ+PCLC Y+K+P L+ F++SPN
Sbjct  27   VEGADGVACNPMQLSSCMNSIISG-APPSTQCCSKIKEQKPCLCGYLKNPILKSFVSSPN  85

Query  359  AKKVANTCGSPFPRC  315
            A+KVAN CG+PFP C
Sbjct  86   ARKVANDCGTPFPNC  100



>ref|XP_010506694.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=96

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = -3

Query  527  EAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKV  348
            E+VTC+P+QLSPCA AITSS + PS +CC++LKEQ+PCLC YM++P L+RF+++PNA+KV
Sbjct  27   ESVTCSPMQLSPCAAAITSS-SPPSALCCARLKEQKPCLCGYMRNPSLRRFVSTPNARKV  85

Query  347  ANTCGSPFPRC  315
            +N C    PRC
Sbjct  86   SNHCRLAIPRC  96



>ref|XP_007217198.1| hypothetical protein PRUPE_ppa013890mg [Prunus persica]
 gb|EMJ18397.1| hypothetical protein PRUPE_ppa013890mg [Prunus persica]
Length=98

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = -3

Query  602  IAMRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQ  423
            ++   +A+C +++V V+ + +  + EAVTC+P+QLSPC   I +S + PS  CC KL+EQ
Sbjct  4    LSYSGVALCVVVMVAVMLSEEARMAEAVTCSPVQLSPCLGPI-NSGSPPSTTCCQKLREQ  62

Query  422  RPCLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            RPCLC Y+K+P L++++ SPNA+K+A+ CG P P+C
Sbjct  63   RPCLCGYLKNPSLRQYVNSPNARKLASNCGVPVPQC  98



>ref|XP_008229267.1| PREDICTED: non-specific lipid-transfer protein 2 [Prunus mume]
Length=98

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = -3

Query  602  IAMRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQ  423
            ++   +A+C +++V V+ + +  + EAVTC+P+QLSPC   I +S   PS  CC KL+EQ
Sbjct  4    LSYSGVALCVVVMVAVMLSEEARMAEAVTCSPVQLSPCLGPI-NSGARPSTTCCQKLREQ  62

Query  422  RPCLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            RPCLC Y+K+P L++++ SPNA+K+A+ CG P P+C
Sbjct  63   RPCLCGYLKNPSLRQYVNSPNARKLASNCGVPVPQC  98



>ref|XP_009792617.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=93

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            ++  ++ A TC+P+QLSPC  AI SS T PS +CCSK+K+Q+PCLC+Y+K+P L++++ S
Sbjct  18   AEAHISFAATCSPVQLSPCLGAIRSS-TPPSKLCCSKIKQQKPCLCQYLKNPNLKKYVNS  76

Query  365  PNAKKVANTCGSPFPRC  315
            P AKKVA TCG P+PRC
Sbjct  77   PAAKKVARTCGVPYPRC  93



>ref|XP_010667862.1| PREDICTED: non-specific lipid-transfer protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=96

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = -3

Query  518  TCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVANT  339
            +C+P+QLSPC +AITSS + P+ +CC+K+KEQRPCLC+YMK+P L++F+ +PNA KVA +
Sbjct  30   SCSPVQLSPCVSAITSS-SPPTAICCTKIKEQRPCLCQYMKNPYLKKFVNTPNAWKVARS  88

Query  338  CGSPFPRC  315
            CG+PFP+C
Sbjct  89   CGTPFPKC  96



>ref|NP_001275625.1| probable non-specific lipid-transfer protein AKCS9-like precursor 
[Solanum tuberosum]
 dbj|BAC23052.1| putative lipid transfer protein [Solanum tuberosum]
Length=93

 Score = 94.0 bits (232),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = -3

Query  542  KVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASP  363
            +  ++ AVTC+ +QLSPC  AITS N++PS +CCS+++EQ+PCLC Y+K+P L+ ++ SP
Sbjct  19   EAHISVAVTCSAIQLSPCLGAITS-NSAPSTLCCSRIREQKPCLCTYLKNPTLRNYVNSP  77

Query  362  NAKKVANTCGSPFPRC  315
             AKKVA TCG P+P+C
Sbjct  78   GAKKVARTCGVPYPKC  93



>ref|XP_010062206.1| PREDICTED: non-specific lipid-transfer protein 2-like [Eucalyptus 
grandis]
 gb|KCW69298.1| hypothetical protein EUGRSUZ_F02789 [Eucalyptus grandis]
Length=103

 Score = 94.4 bits (233),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 60/79 (76%), Gaps = 1/79 (1%)
 Frame = -3

Query  551  GASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFI  372
             A + +V EAVTC+  +LSPC  AITSS  +PS +CCSKL+EQRPCLC Y+KDP L+++ 
Sbjct  26   SADRAQVVEAVTCSATELSPCLPAITSS-AAPSALCCSKLREQRPCLCGYIKDPNLKQYF  84

Query  371  ASPNAKKVANTCGSPFPRC  315
             SPNAK+VA+TCG   P C
Sbjct  85   TSPNAKRVASTCGVASPTC  103



>ref|XP_009346593.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=97

 Score = 94.0 bits (232),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 65/92 (71%), Gaps = 1/92 (1%)
 Frame = -3

Query  590  SIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCL  411
            S+A C ++ ++V    +    EAVTC+PL+LSPC  AI  S   PS  CC KLKEQ+PC 
Sbjct  7    SLAFCLMVAMVVALCDEARTVEAVTCSPLELSPCLEAI-RSGAPPSATCCEKLKEQQPCF  65

Query  410  CKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            C+Y+K+P L+ +I +PNAKKVA+ CG PFP+C
Sbjct  66   CEYIKNPVLKPYIDNPNAKKVASACGVPFPQC  97



>gb|KFK39166.1| hypothetical protein AALP_AA3G208800 [Arabis alpina]
Length=95

 Score = 94.0 bits (232),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
 Frame = -3

Query  521  VTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVAN  342
            VTC+P+QLSPCA AITSS + PS +CC+KLKEQ+PCLC YM++P L+RF++SPNA+KV+N
Sbjct  28   VTCSPMQLSPCAAAITSS-SPPSALCCAKLKEQKPCLCGYMRNPSLRRFVSSPNARKVSN  86

Query  341  TCGSPFPRC  315
             C    PRC
Sbjct  87   RCKLAIPRC  95



>gb|ACM78620.1| non-specific lipid-transfer protein type 2 [Tamarix hispida]
Length=94

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
             + E+ EAVTC+PLQLSPCA AIT S   PS  CCS+L+EQ PCLC Y +DP L++++ S
Sbjct  20   GEAEIAEAVTCSPLQLSPCAGAITGSG-PPSATCCSRLREQTPCLCGYYRDPNLRQYVNS  78

Query  365  PNAKKVANTCG  333
            PNA+KVA TCG
Sbjct  79   PNAQKVARTCG  89



>ref|XP_004235834.1| PREDICTED: non-specific lipid-transfer protein 2 [Solanum lycopersicum]
Length=93

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = -3

Query  542  KVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASP  363
            +  ++ AVTC+ +QLSPC +AITS  ++PS +CCS++++Q+PCLC Y+K+P L+ ++ SP
Sbjct  19   EAHISVAVTCSAIQLSPCLSAITS-KSAPSKLCCSRIRQQKPCLCTYLKNPTLRNYVNSP  77

Query  362  NAKKVANTCGSPFPRC  315
             AKKVANTCG P+P+C
Sbjct  78   GAKKVANTCGVPYPKC  93



>gb|AAS79106.1| probable lipid transfer protein family protein [Tamarix androssowii]
Length=94

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
             + E+ EAVTC+PLQLSPCA AIT S   PS  CCS+L+EQ PCLC Y +DP L++++ S
Sbjct  20   GEAEIAEAVTCSPLQLSPCAGAITGSG-PPSATCCSRLREQTPCLCGYYRDPNLRQYVNS  78

Query  365  PNAKKVANTCG  333
            PNA+KVA TCG
Sbjct  79   PNAQKVARTCG  89



>ref|XP_006365399.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Solanum tuberosum]
Length=94

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 60/74 (81%), Gaps = 1/74 (1%)
 Frame = -3

Query  536  EVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNA  357
             ++ A TC+P+QLSPC  AI SS + PS +CCSK+K+Q+PCLC+Y+K+P L++++ SP A
Sbjct  22   HISLAATCSPVQLSPCLGAIRSS-SPPSKLCCSKIKQQKPCLCQYLKNPTLKKYVNSPGA  80

Query  356  KKVANTCGSPFPRC  315
            KKVA +CG P+PRC
Sbjct  81   KKVARSCGVPYPRC  94



>ref|XP_010506674.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
 ref|XP_010497756.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=96

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
 Frame = -3

Query  521  VTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVAN  342
            VTC+P+QLSPCA AITSS + PS +CC++LKEQ+PCLC YM++P L+RF+++PNA+KV+N
Sbjct  29   VTCSPMQLSPCAAAITSS-SPPSALCCARLKEQKPCLCGYMRNPSLRRFVSTPNARKVSN  87

Query  341  TCGSPFPRC  315
             C    PRC
Sbjct  88   HCRLAIPRC  96



>ref|XP_009781752.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=94

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
             +++ +EAVTCN  QLS C  A+TSS   PS  CCSK++EQ+PCLC YMKDP L++++ S
Sbjct  19   GELQASEAVTCNASQLSECVGAVTSSQP-PSSACCSKMREQQPCLCGYMKDPSLRQYVNS  77

Query  365  PNAKKVANTCGSPFPRC  315
            PNA++VAN CG   P C
Sbjct  78   PNARRVANACGVAVPSC  94



>ref|XP_009804140.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=93

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = -3

Query  536  EVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNA  357
             ++ AVTC+ +QLSPC  AITS  + PS +CCSK++EQ+PCLC+Y+K+P L+ ++ SP A
Sbjct  21   HISVAVTCSAIQLSPCLGAITS-KSPPSILCCSKIREQKPCLCQYLKNPNLRNYVNSPGA  79

Query  356  KKVANTCGSPFPRC  315
            KKVA TCG P+P+C
Sbjct  80   KKVARTCGVPYPKC  93



>gb|ACM78626.1| non-specific lipid-transfer protein type 2 [Tamarix hispida]
Length=94

 Score = 91.7 bits (226),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -3

Query  533  VTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAK  354
            ++EA TCNP+QLS CA AIT    SPS  CCSKL+ QRPCLC+Y +DPRL+R++ SP A+
Sbjct  24   ISEAATCNPIQLSACAGAITGGG-SPSRSCCSKLRAQRPCLCRYYRDPRLRRYVRSPGAR  82

Query  353  KVANTC  336
            KVA  C
Sbjct  83   KVAGAC  88



>ref|XP_009599113.1| PREDICTED: non-specific lipid-transfer protein 2 {ECO:0000303|PubMed:23913675}-like 
[Nicotiana tomentosiformis]
Length=94

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = -3

Query  542  KVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASP  363
            + + +EAVTC+  QLS C  A+TSS  +PS  CCSK++EQ+PCLC YMKDP L++++ SP
Sbjct  20   EFQASEAVTCSASQLSECVGAVTSSQ-APSSACCSKMREQQPCLCGYMKDPSLRQYVNSP  78

Query  362  NAKKVANTCGSPFPRC  315
            NA++VAN CG   P C
Sbjct  79   NARRVANACGVAVPSC  94



>ref|XP_010062205.1| PREDICTED: non-specific lipid-transfer protein 2-like [Eucalyptus 
grandis]
 gb|KCW69297.1| hypothetical protein EUGRSUZ_F02788 [Eucalyptus grandis]
Length=103

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = -3

Query  542  KVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASP  363
            +  V EAVTC+  +LS C +AITSS   PS +CCSKL+EQRPCLC Y+++P L++++ SP
Sbjct  29   QARVAEAVTCSATELSSCVSAITSS-APPSALCCSKLREQRPCLCGYIRNPNLRQYVTSP  87

Query  362  NAKKVANTCGSPFPRC  315
            NAK+VA TCG P+P C
Sbjct  88   NAKRVARTCGVPYPTC  103



>ref|XP_004241634.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=94

 Score = 91.3 bits (225),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 60/74 (81%), Gaps = 1/74 (1%)
 Frame = -3

Query  536  EVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNA  357
             ++ A TC+P+QLSPC  AI SS + PS +CC+K+K+Q+PCLC+Y+K+P L++++ SP A
Sbjct  22   HISLAATCSPVQLSPCLGAIRSS-SPPSKLCCTKIKQQKPCLCQYLKNPTLKKYVNSPGA  80

Query  356  KKVANTCGSPFPRC  315
            KKVA +CG P+PRC
Sbjct  81   KKVARSCGVPYPRC  94



>gb|KFK26688.1| hypothetical protein AALP_AA8G280300 [Arabis alpina]
Length=97

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = -3

Query  542  KVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASP  363
            ++ V E VTC+P+ L+PCA A+TSS + PS  CC++L+EQ+PCLC YM++P L+++++SP
Sbjct  23   EIPVVEGVTCSPMALAPCAAAMTSS-SPPSATCCTRLREQQPCLCGYMRNPSLRQYVSSP  81

Query  362  NAKKVANTCGSPFPRC  315
            NAKKV+N+C  P P C
Sbjct  82   NAKKVSNSCRIPSPNC  97



>ref|XP_004492965.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Cicer arietinum]
Length=92

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = -3

Query  533  VTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAK  354
            + EAV CNPL LSPC  AITS N+ PS  CCSKLKEQ PCLC Y+K+P L++++ SP +K
Sbjct  21   IAEAVNCNPLALSPCLGAITS-NSPPSANCCSKLKEQTPCLCGYLKNPNLRQYVNSPGSK  79

Query  353  KVANTCGSPFPRC  315
            +VA+TCG   P+C
Sbjct  80   QVASTCGVTIPKC  92



>ref|XP_007139181.1| hypothetical protein PHAVU_008G008200g [Phaseolus vulgaris]
 gb|ESW11175.1| hypothetical protein PHAVU_008G008200g [Phaseolus vulgaris]
Length=98

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = -3

Query  602  IAMRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQ  423
            + M++  +CA++L+ ++ +    V EA TC+P QL+PC +AIT   ++PS  CC KLKEQ
Sbjct  4    MKMKNCVVCAVVLMALVLSDVGPVAEAATCSPTQLTPCLSAITG-GSAPSQACCQKLKEQ  62

Query  422  RPCLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            +PCLC Y+ +P L++++ SP AK V  TCG P+P C
Sbjct  63   KPCLCSYINNPALKQYVNSPRAKAVLKTCGVPYPTC  98



>gb|AFK45248.1| unknown [Lotus japonicus]
Length=104

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = -3

Query  533  VTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAK  354
            + EAVTC+P+ LSPC  AI+SS T PS  CC KL+EQ+PCLC Y+++P L  ++ SP A+
Sbjct  33   IAEAVTCSPVALSPCLGAISSS-TPPSAACCQKLREQKPCLCGYLRNPSLAPYVNSPGAR  91

Query  353  KVANTCGSPFPRC  315
             VA+TCG P+PRC
Sbjct  92   AVASTCGIPYPRC  104



>ref|NP_564532.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
 gb|AAK76553.1| putative lipid transfer protein [Arabidopsis thaliana]
 gb|AAM14109.1| putative lipid transfer protein [Arabidopsis thaliana]
 gb|AEE32344.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
Length=94

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = -3

Query  539  VEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPN  360
            V V E VTC+P+QL+ CA A+TSS + PS  CC+KL+EQ+PCLC YM++P L+++++SPN
Sbjct  21   VPVAEGVTCSPMQLASCAAAMTSS-SPPSEACCTKLREQQPCLCGYMRNPTLRQYVSSPN  79

Query  359  AKKVANTCGSPFPRC  315
            A+KV+N+C  P P C
Sbjct  80   ARKVSNSCKIPSPSC  94



>gb|KDP32977.1| hypothetical protein JCGZ_13008 [Jatropha curcas]
Length=96

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = -3

Query  548  ASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
            A +V ++ AVTC+PL LSPC  AI SS + PS  CC KL+EQ+PCLC Y+K+P L+++++
Sbjct  20   AFEVRLSNAVTCSPLALSPCLPAINSS-SPPSNDCCVKLREQKPCLCGYLKNPSLKQYVS  78

Query  368  SPNAKKVANTCGSPFPRC  315
            SP A++VAN+CG P P C
Sbjct  79   SPGARRVANSCGVPIPTC  96



>ref|XP_006367504.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Solanum tuberosum]
Length=96

 Score = 89.0 bits (219),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 61/96 (64%), Gaps = 7/96 (7%)
 Frame = -3

Query  602  IAMRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQ  423
             A+  IAI  IL        ++ V E+VTCN ++L PC+ AI S    PS VCC+KLKEQ
Sbjct  8    FAIFFIAILVIL------LGELLVIESVTCNVMELVPCSPAIISGQ-PPSEVCCAKLKEQ  60

Query  422  RPCLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
             PCLC Y  DP L+ ++ SPNA+KV  TCG P P+C
Sbjct  61   VPCLCGYFNDPTLKPYVGSPNAQKVFQTCGVPIPKC  96



>dbj|BAJ25798.1| putative non-specific lipid-transfer protein type 2 subfamily 
[Nicotiana tabacum]
Length=97

 Score = 88.6 bits (218),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = -3

Query  533  VTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAK  354
            VTEAVTC+ ++LSPCA AI SS   PS  CC+KLKEQ+PCLC Y+K+P L+ ++ SPNAK
Sbjct  26   VTEAVTCSVVELSPCAGAI-SSPQPPSSACCAKLKEQKPCLCGYLKNPNLRPYVNSPNAK  84

Query  353  KVANTCGSPFPRC  315
            +VA +CG P P C
Sbjct  85   RVAKSCGVPTPSC  97



>ref|XP_009777694.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=97

 Score = 88.6 bits (218),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = -3

Query  533  VTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAK  354
            VTEAVTC+ ++LSPCA AI SS   PS  CC+KLKEQ+PCLC Y+K+P L+ ++ SPNAK
Sbjct  26   VTEAVTCSVVELSPCAGAI-SSPQPPSSACCAKLKEQKPCLCGYLKNPNLRPYVNSPNAK  84

Query  353  KVANTCGSPFPRC  315
            +VA +CG P P C
Sbjct  85   RVAKSCGVPTPSC  97



>ref|XP_003555069.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Glycine max]
 gb|KHN19692.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
Length=97

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 67/92 (73%), Gaps = 4/92 (4%)
 Frame = -3

Query  581  ICAIllvlvLGASKVEVT---EAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCL  411
            +C   +V++     VE++   EAVTC+P++LSPC  AITSS + PS  CC K++EQRPCL
Sbjct  7    VCGFAIVVMAALFLVEMSPMAEAVTCSPVELSPCLGAITSS-SPPSTTCCQKVREQRPCL  65

Query  410  CKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            C Y+K+P L+ ++ SP +++VA++CG PFP C
Sbjct  66   CGYLKNPSLRPYVNSPGSRRVASSCGVPFPTC  97



>ref|XP_006482397.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Citrus sinensis]
Length=103

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = -3

Query  575  AIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMK  396
            A+LL  V+ + ++ V EAVTCNP QL PC  A TS+   PS VCC+ L++QRPCLC Y++
Sbjct  18   ALLLATVVFSRELPVAEAVTCNPSQLIPCLPAFTST-APPSTVCCNSLRQQRPCLCTYLR  76

Query  395  DPRLQRFIASPNAKKVANTCGSPFPRC  315
            +P  +++  SPN++++A TCG PFPRC
Sbjct  77   NPLYKQYYDSPNSRRIAVTCGVPFPRC  103



>ref|XP_009613979.1| PREDICTED: non-specific lipid-transfer protein 2 {ECO:0000303|PubMed:23913675}-like 
[Nicotiana tomentosiformis]
Length=94

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = -3

Query  548  ASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
              ++  +EAVTC+  QLSPC  AITS  T PS  CC++L+ Q+PCLC YM+DP L++++ 
Sbjct  18   GDQLGASEAVTCSATQLSPCLGAITS-GTPPSQACCARLRGQQPCLCGYMRDPNLRQYVN  76

Query  368  SPNAKKVANTCGSPFPRC  315
            SPNA+KVA++CG   P C
Sbjct  77   SPNARKVASSCGVSIPSC  94



>ref|XP_012078002.1| PREDICTED: non-specific lipid-transfer protein 2-like [Jatropha 
curcas]
Length=123

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = -3

Query  548  ASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
            A +V ++ AVTC+PL LSPC  AI SS + PS  CC KL+EQ+PCLC Y+K+P L+++++
Sbjct  47   AFEVRLSNAVTCSPLALSPCLPAINSS-SPPSNDCCVKLREQKPCLCGYLKNPSLKQYVS  105

Query  368  SPNAKKVANTCGSPFPRC  315
            SP A++VAN+CG P P C
Sbjct  106  SPGARRVANSCGVPIPTC  123



>ref|XP_010252340.1| PREDICTED: non-specific lipid-transfer protein 2 [Nelumbo nucifera]
Length=92

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 73/96 (76%), Gaps = 4/96 (4%)
 Frame = -3

Query  602  IAMRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQ  423
            + +  IA+CA+L++LV  A    ++ AVTC P++L+    +  +S++SPS +CC+KLKEQ
Sbjct  1    MKLAYIALCAVLVLLVNEA---HISMAVTCKPIELAA-CASAITSSSSPSQMCCNKLKEQ  56

Query  422  RPCLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            RPCLCKY+KDP LQ+ I +PNAKKVANTCG+P P C
Sbjct  57   RPCLCKYLKDPNLQKLINTPNAKKVANTCGTPIPSC  92



>ref|XP_008444081.1| PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis 
melo]
Length=94

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
             +V V EAV+CNP++LS C+ AITS  T+PS +CC+KLK+Q+ CLC Y+K+P L  ++ S
Sbjct  19   GRVRVAEAVSCNPVELSSCSGAITSG-TNPSSICCNKLKQQKACLCGYIKNPALGPYVNS  77

Query  365  PNAKKVANTCGSPFPRC  315
            P AK VA+ CG P P C
Sbjct  78   PGAKNVASKCGVPIPSC  94



>ref|XP_010500416.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=97

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            +K+ VTE VTC+P++L+PCA A+TSS + PS  CC+KL+EQ+PCLC Y+++P L+++I S
Sbjct  22   AKIPVTEGVTCSPMELTPCAAAMTSS-SPPSQACCAKLREQKPCLCGYLRNPSLRQYINS  80

Query  365  PNAKKVANTCGSPFPRC  315
            PNA+KV ++C    P C
Sbjct  81   PNARKVTSSCQIATPNC  97



>ref|XP_009626576.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
tomentosiformis]
Length=97

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
             +   TEAVTC+ ++LSPC  AITSS   PS  CC+KL+EQ+PCLC Y+K+P L+ ++ S
Sbjct  22   GEFRATEAVTCSAVELSPCVGAITSSQ-PPSSACCAKLREQKPCLCGYLKNPNLRPYVNS  80

Query  365  PNAKKVANTCGSPFPRC  315
            PNAK+VA +CG P P C
Sbjct  81   PNAKRVARSCGVPTPSC  97



>ref|XP_006430727.1| hypothetical protein CICLE_v10013181mg [Citrus clementina]
 gb|ESR43967.1| hypothetical protein CICLE_v10013181mg [Citrus clementina]
Length=103

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = -3

Query  608  NNIAMRSIAIC-AIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKL  432
            NN++   I +  A+LL  V+ + ++ V EAVTCNP QL+PC  A T +   PS VCC+ L
Sbjct  6    NNVSGAFIFMASALLLATVVFSRELPVPEAVTCNPSQLTPCLPAFTWT-APPSTVCCNSL  64

Query  431  KEQRPCLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            ++QRPCLC Y+++P  +++  SPN++++A TCG PFPRC
Sbjct  65   RQQRPCLCTYLRNPLYKQYYDSPNSRRIAVTCGVPFPRC  103



>emb|CDP02752.1| unnamed protein product [Coffea canephora]
Length=90

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = -3

Query  587  IAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLC  408
            + +C++LL++V+   +V+V+ A+ C+P +LSPC  A  S    PS  CCSKL+EQRPC C
Sbjct  1    MGLCSVLLLVVMIVGEVQVSRAIICSPTELSPCVAAFISQQP-PSGACCSKLREQRPCFC  59

Query  407  KYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
             Y++DP L++++ +PN ++ A+ CG P PRC
Sbjct  60   GYLRDPYLRQYVNTPNGRREASFCGVPSPRC  90



>ref|XP_009357787.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=97

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = -3

Query  533  VTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAK  354
             TEAVTC+P++L+PC   I  S ++PS  CC KL+EQRPCLC Y+K+P L+ ++ SPNA+
Sbjct  26   TTEAVTCSPVELTPCMGPI-RSGSAPSGTCCQKLREQRPCLCGYIKNPALRTYVTSPNAR  84

Query  353  KVANTCGSPFPRC  315
            K+A+ CG P P+C
Sbjct  85   KLASACGVPIPQC  97



>ref|XP_008444080.1| PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis 
melo]
Length=96

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = -3

Query  536  EVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNA  357
             V EAVTCN +QLSPC  AITS+   PS  CCSKL+EQ+PC C YMK+P L  ++ S  A
Sbjct  24   RVAEAVTCNTMQLSPCIGAITST-APPSTTCCSKLREQQPCFCGYMKNPSLGGYVKSARA  82

Query  356  KKVANTCGSPFPRC  315
            K + +TCG P P+C
Sbjct  83   KAIISTCGVPLPKC  96



>ref|XP_006589067.1| PREDICTED: non-specific lipid-transfer protein 2-like [Glycine 
max]
Length=100

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = -3

Query  527  EAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKV  348
            EAVTC+P++LSPC  AITSS + PS  CC K++EQRPCLC Y+++P L++++ SP +++V
Sbjct  31   EAVTCSPVELSPCLGAITSS-SPPSTTCCQKVREQRPCLCGYLQNPSLRQYVNSPGSRRV  89

Query  347  ANTCGSPFPRC  315
            A++CG PFP C
Sbjct  90   ASSCGVPFPTC  100



>gb|ACM78623.1| non-specific lipid-transfer protein type 2 [Tamarix hispida]
Length=95

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 63/91 (69%), Gaps = 3/91 (3%)
 Frame = -3

Query  608  NNIAMRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLK  429
            N + + +    A+  + +LG  + ++ EA TCNP+ LSPCA A++ S   PS +CCSKL+
Sbjct  2    NKLVLFTFLAMAVAAITLLG--EADIAEAATCNPVGLSPCAGAMSGSG-PPSKLCCSKLR  58

Query  428  EQRPCLCKYMKDPRLQRFIASPNAKKVANTC  336
            EQ+PCLC Y +DP L++++ SPNAKKVA  C
Sbjct  59   EQKPCLCGYYRDPNLRQYVDSPNAKKVATAC  89



>gb|KDO63208.1| hypothetical protein CISIN_1g036197mg [Citrus sinensis]
Length=103

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = -3

Query  608  NNIAMRSIAIC-AIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKL  432
            NN++   I +  A+LL  V+ + ++ V EAVTCNP QL+PC  A T +   PS VCC+ L
Sbjct  6    NNVSGAFIFMASALLLATVVFSRELPVPEAVTCNPSQLTPCLPAFTWT-APPSTVCCNSL  64

Query  431  KEQRPCLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            ++QRPCLC Y+++P  +++  SPN +++A TCG PFPRC
Sbjct  65   RQQRPCLCTYLRNPLYKQYYDSPNYRRIAVTCGVPFPRC  103



>ref|XP_004234577.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=92

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = -3

Query  533  VTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAK  354
            VTEAVTC+  +L PCA AI SS   PS  CC+KLKEQ+PCLC Y+K+P L++++ SPNAK
Sbjct  21   VTEAVTCSVTELVPCAAAILSSQ-PPSKECCNKLKEQKPCLCGYLKNPSLKQYVNSPNAK  79

Query  353  KVANTCGSPFPRC  315
            KVA TCG   P C
Sbjct  80   KVAKTCGVSTPSC  92



>gb|KHN41531.1| Non-specific lipid-transfer protein 2 [Glycine soja]
Length=98

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = -3

Query  527  EAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKV  348
            EAVTC+P++LSPC  AITSS + PS  CC K++EQRPCLC Y+++P L++++ SP +++V
Sbjct  29   EAVTCSPVELSPCLGAITSS-SPPSTTCCQKVREQRPCLCGYLQNPSLRQYVNSPGSRRV  87

Query  347  ANTCGSPFPRC  315
            A++CG PFP C
Sbjct  88   ASSCGVPFPTC  98



>ref|XP_008381283.1| PREDICTED: non-specific lipid-transfer protein 2 [Malus domestica]
Length=95

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 68/95 (72%), Gaps = 3/95 (3%)
 Frame = -3

Query  599  AMRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQR  420
            ++RS+ +C  + V++   ++    EAVTC+P++LSPC   I  S ++PS  CC KL+EQR
Sbjct  4    SLRSLVLCLAVAVVLCEVART--AEAVTCSPVELSPCLGPI-RSGSAPSGTCCQKLREQR  60

Query  419  PCLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            PCLC Y+K+P L+ ++ SPNA+K+A+ CG P P+C
Sbjct  61   PCLCGYIKNPALRTYVTSPNARKLASACGVPTPQC  95



>gb|EYU41301.1| hypothetical protein MIMGU_mgv1a021579mg [Erythranthe guttata]
Length=96

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = -3

Query  536  EVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNA  357
            E T A  CNPL+LSPC  AI  S   PS  CC KLKEQ PC C Y+KDP L++FI SPNA
Sbjct  24   ETTAAANCNPLELSPCLGAIMGSG-QPSAECCQKLKEQVPCFCTYLKDPTLRQFIDSPNA  82

Query  356  KKVANTCGSPFPRC  315
            KKVA  CG   P C
Sbjct  83   KKVAAACGLQQPSC  96



>gb|KEH21557.1| Nodule Cysteine-Rich (NCR) secreted peptide [Medicago truncatula]
Length=98

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = -3

Query  548  ASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
              +  + +A+TC P++ SPC  +IT+S+  P+  CC KL+EQRPCLC Y+K+P L+++I 
Sbjct  22   GEETYMAKALTCTPVEFSPCLGSITTSS-PPTSACCQKLREQRPCLCGYLKNPSLKKYIY  80

Query  368  SPNAKKVANTCGSPFPRC  315
            SP A++VA++CG PFP C
Sbjct  81   SPGARRVASSCGVPFPTC  98



>ref|XP_009357786.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=95

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = -3

Query  527  EAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKV  348
            EAVTC+P++LSPC   I  S ++PS  CC KL+EQRPCLC Y+K+P L+ ++ SPNA+K+
Sbjct  26   EAVTCSPVELSPCLGPI-RSGSAPSGTCCQKLREQRPCLCGYIKNPALRTYVTSPNARKL  84

Query  347  ANTCGSPFPRC  315
            A+ CG P P+C
Sbjct  85   ASACGVPTPQC  95



>ref|XP_010479305.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=97

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            +K+ V E VTC+P++L+PCA A+TSS + PS  CC+KL+EQ+PCLC Y+++P L+++I S
Sbjct  22   AKIPVAEGVTCSPMELAPCAAAMTSS-SPPSQACCAKLREQKPCLCGYLRNPSLRQYINS  80

Query  365  PNAKKVANTCGSPFPRC  315
            PNA+KV ++C    P C
Sbjct  81   PNARKVTSSCQIATPNC  97



>ref|XP_010461704.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=97

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            +K+ V E VTC+P++L+PCA A+TSS + PS  CC+KL+EQ+PCLC Y+++P L+++I S
Sbjct  22   AKIPVAEGVTCSPMELTPCAAAMTSS-SPPSQACCAKLREQKPCLCGYLRNPSLRQYINS  80

Query  365  PNAKKVANTCGSPFPRC  315
            PNA+KV ++C    P C
Sbjct  81   PNARKVTSSCQIATPNC  97



>gb|KJB32221.1| hypothetical protein B456_005G230400 [Gossypium raimondii]
Length=99

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  533  VTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAK  354
            + EAVTCNP++LSPC  AI   +  PS  CCSKLKEQ+PC C Y+KDP L++++ +PN  
Sbjct  26   MVEAVTCNPIELSPCLAAIMMPSQPPSAACCSKLKEQQPCFCGYIKDPTLKQYMNNPNIP  85

Query  353  KVANTCGSPFP  321
            KVA++CG  +P
Sbjct  86   KVASSCGVAYP  96



>ref|XP_010279350.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nelumbo 
nucifera]
Length=93

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            S+ +++ +VTCN  QLSPC+ A+ + N+ PS +CC KL+EQRPC C+Y++DP L +++ S
Sbjct  18   SEAQLSVSVTCNFSQLSPCSNALVN-NSPPSKLCCDKLREQRPCFCQYLRDPSLGQYVNS  76

Query  365  PNAKKVANTCGSPFPRC  315
            PNAKKV ++CG   P C
Sbjct  77   PNAKKVVSSCGVSIPNC  93



>ref|XP_003567950.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brachypodium 
distachyon]
Length=100

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = -3

Query  518  TCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVANT  339
            TCN LQLSPCA AI   N +P+  CCS++K Q+PCLC+Y KDP LQR+++SPN KKV   
Sbjct  34   TCNALQLSPCAGAIIG-NAAPTAACCSRMKAQQPCLCQYAKDPNLQRYVSSPNGKKVMAA  92

Query  338  CGSPFPRC  315
            C  P P C
Sbjct  93   CKVPVPSC  100



>ref|XP_003633726.1| PREDICTED: non-specific lipid-transfer protein 2 [Vitis vinifera]
 emb|CBI33623.3| unnamed protein product [Vitis vinifera]
Length=92

 Score = 85.9 bits (211),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 55/77 (71%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            S+  +T+AVTC+P +LS C+ A TSS   PS  CCSKLKEQ+PCLC Y+KDP   +++ S
Sbjct  17   SEAHLTKAVTCSPQELSSCSAAFTSS-APPSSTCCSKLKEQKPCLCGYLKDPNFSQYVNS  75

Query  365  PNAKKVANTCGSPFPRC  315
              A ++A+TCG  FP C
Sbjct  76   AKANRIASTCGVQFPNC  92



>ref|XP_003624386.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES80604.1| Lipid transfer protein [Medicago truncatula]
 gb|AFK45216.1| unknown [Medicago truncatula]
Length=94

 Score = 85.9 bits (211),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -3

Query  596  MRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRP  417
            M+   +CA+++++VL      + EA  C+P++LSPC  AITS N  PS  CCSKL+EQRP
Sbjct  2    MKMKVVCALMIMVVLIVEVATIAEAANCSPIELSPCLGAITS-NAPPSTNCCSKLREQRP  60

Query  416  CLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            CLC Y+K+P L++++ SP +K+VA+ C    P C
Sbjct  61   CLCGYIKNPNLRQYVNSPGSKRVASACNVVIPNC  94



>ref|XP_009804692.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=94

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = -3

Query  548  ASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
              ++  +EAVTC+  QLSPC  AITS  T PS  CC++L+ Q+PCLC YM+DP L++++ 
Sbjct  18   GDQLGASEAVTCSATQLSPCLGAITS-GTPPSQACCARLRAQQPCLCGYMRDPNLRQYVN  76

Query  368  SPNAKKVANTCGSPFPRC  315
            S NA+KVA++CG   P C
Sbjct  77   SSNARKVASSCGVSIPSC  94



>gb|ABK26735.1| unknown [Picea sitchensis]
Length=97

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = -3

Query  602  IAMRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITS-SNTSPSPVCCSKLKE  426
            + M+ I   A++ +++LGA       A TC+P+ LSPCATA+ S S   PS  CC+KLK 
Sbjct  1    MGMKMIIAAALVYLVLLGAYSGRAAAAATCDPMALSPCATAMFSPSKPKPSADCCNKLKL  60

Query  425  QRPCLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            Q  C+CKY  DP+ + +I SP+AK+VA++C  PFP+C
Sbjct  61   QAKCMCKYATDPKFKGYIQSPDAKRVADSCHVPFPKC  97



>gb|AAA33933.1| lipid transfer protein, partial [Senecio odorus]
Length=89

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 67/92 (73%), Gaps = 4/92 (4%)
 Frame = -3

Query  590  SIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCL  411
            +I I A+L+++V G+   +V  A TC+  +L PC++A TSS  +P+  CC+KLKEQ PCL
Sbjct  2    AIYIVALLVMIVAGS---KVATAATCSVTELMPCSSAFTSS-AAPTAQCCTKLKEQSPCL  57

Query  410  CKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            C Y+K+P L+++I +PNAKKV +TCG P P C
Sbjct  58   CGYLKNPTLKQYITNPNAKKVTSTCGVPIPNC  89



>gb|EMT00048.1| Putative non-specific lipid-transfer protein AKCS9 [Aegilops 
tauschii]
Length=96

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = -3

Query  530  TEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKK  351
             +A TC+ LQLSPCA AI   N +P+ VCCS++K QRPC+C+Y +DP L++++ SPN KK
Sbjct  26   VDAATCDALQLSPCAGAIVG-NAAPTAVCCSRMKAQRPCMCQYARDPNLKQYVNSPNGKK  84

Query  350  VANTCGSPFPRC  315
            V   C  P P C
Sbjct  85   VLAACKVPVPSC  96



>ref|XP_007033193.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
 gb|EOY04119.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
Length=118

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = -3

Query  548  ASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
            + +    EAV C+P +L+ C  AITSS + PS  CCSKL+EQ+PCLC Y+++P L++F+ 
Sbjct  42   SGETRTVEAVNCSPSELTSCLPAITSS-SPPSTTCCSKLREQKPCLCGYLQNPNLKQFVN  100

Query  368  SPNAKKVANTCGSPFPRC  315
            +PNA+KVA+TCG  +P+C
Sbjct  101  NPNARKVASTCGVTYPQC  118



>ref|XP_006362367.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=92

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            S++ VTEAVTC+  +L PCA AI SS   PS  CC KL+EQ+PCLC Y+K+P L++++ S
Sbjct  17   SELLVTEAVTCSVTELFPCAGAIMSSQ-PPSSACCIKLREQKPCLCGYLKNPSLKQYVNS  75

Query  365  PNAKKVANTCGSPFPRC  315
            PNA++VA TCG   P C
Sbjct  76   PNAQRVAKTCGVSTPSC  92



>emb|CDM81734.1| unnamed protein product [Triticum aestivum]
Length=96

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = -3

Query  530  TEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKK  351
             EA TCN LQL+PCA AI  S  +P+  CCSK+KEQ+PC+C+Y +DP L++++ SPN KK
Sbjct  26   AEAATCNALQLTPCAGAIIGS-AAPTASCCSKMKEQQPCMCQYARDPNLKQYVDSPNGKK  84

Query  350  VANTCGSPFPRC  315
            V   C  P P C
Sbjct  85   VMAACKVPVPSC  96



>ref|XP_003524566.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Glycine max]
Length=100

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 68/100 (68%), Gaps = 6/100 (6%)
 Frame = -3

Query  605  NIAMRSIAICAIllvlvLGASKVEVT---EAVTCNPLQLSPCATAITSSNTSPSPVCCSK  435
            N+ M+ +  C   +V+V     VEV+   EAVTC P++LSPC  AITSS   PS +CC K
Sbjct  4    NMMMKKV--CGFAIVMVAVQLLVEVSPKAEAVTCTPVELSPCLGAITSSQ-PPSTICCQK  60

Query  434  LKEQRPCLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            ++EQR CLC Y+K+P L+ +  SP +++VA++CG PFP C
Sbjct  61   VREQRQCLCGYLKNPSLRPYANSPGSRRVASSCGVPFPTC  100



>gb|AAB47967.1| nonspecific lipid transfer protein [Hordeum vulgare]
 dbj|BAJ91523.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=96

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = -3

Query  530  TEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKK  351
             EA TCN LQL+PCA AI   N +P+  CCSK++EQ+PC+C+Y +DP L++++ SPN KK
Sbjct  26   AEAATCNALQLTPCAGAIMG-NAAPTASCCSKMREQQPCMCQYARDPNLKQYVDSPNGKK  84

Query  350  VANTCGSPFPRC  315
            V   C  P P C
Sbjct  85   VMAACKVPVPSC  96



>gb|KJB10462.1| hypothetical protein B456_001G202600 [Gossypium raimondii]
Length=96

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = -3

Query  587  IAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLC  408
            +++C + +V+VL + +    EAVTC+  +LSPC  AITSS   PS  CCSKL EQ+PC C
Sbjct  7    LSLCVVGIVVVLFSGETRTAEAVTCDLSELSPCLAAITSSK-PPSSTCCSKLTEQKPCFC  65

Query  407  KYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            +Y+++P +++F+ +P AK++A TC   +P+C
Sbjct  66   QYLRNPTMKQFVDTPKAKRIATTCSVEYPQC  96



>emb|CDM81735.1| unnamed protein product [Triticum aestivum]
Length=96

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = -3

Query  530  TEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKK  351
             +A TC+ LQLSPCA AI   N +P+ VCCS++K QRPC+C+Y  DP L++++ SPN KK
Sbjct  26   VDAATCDALQLSPCAGAIVG-NAAPTAVCCSRMKAQRPCMCQYAHDPNLKQYVNSPNGKK  84

Query  350  VANTCGSPFPRC  315
            V   C  P P C
Sbjct  85   VLAACKVPVPSC  96



>ref|XP_008810040.1| PREDICTED: non-specific lipid-transfer protein 2-like [Phoenix 
dactylifera]
Length=92

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = -3

Query  530  TEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKK  351
            T +VTC+P++LSPCA AI SS   P+  CC+KLKEQ PC C+Y K+P+LQ +I S N+K+
Sbjct  22   TLSVTCDPMELSPCAGAILSS-APPTAACCAKLKEQTPCFCQYKKNPKLQNYINSKNSKR  80

Query  350  VANTCGSPFPRC  315
            VA+ CG P P C
Sbjct  81   VASACGVPMPNC  92



>ref|XP_003552717.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Glycine max]
 gb|KHN17291.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
 gb|KHN33030.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
Length=95

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
            AVTCNP QL+PC  AI +S ++PS  CC KLKEQ+PC C Y+K+P L++++ SPNAKK  
Sbjct  27   AVTCNPTQLTPCLPAI-NSGSAPSSACCQKLKEQKPCFCGYLKNPSLKQYVNSPNAKKTV  85

Query  344  NTCGSPFPRC  315
            ++CG  +P C
Sbjct  86   SSCGIAYPTC  95



>gb|KHN27477.1| Non-specific lipid-transfer protein 2 [Glycine soja]
Length=96

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 58/78 (74%), Gaps = 4/78 (5%)
 Frame = -3

Query  539  VEVT---EAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
            VEV+   EAVTC P++LSPC  AITSS   PS +CC K++EQR CLC Y+K+P L+ +  
Sbjct  20   VEVSPKAEAVTCTPVELSPCLGAITSSQ-PPSTICCQKVREQRQCLCGYLKNPSLRPYAN  78

Query  368  SPNAKKVANTCGSPFPRC  315
            SP +++VA++CG PFP C
Sbjct  79   SPGSRRVASSCGVPFPTC  96



>ref|NP_001238401.1| uncharacterized protein LOC100306409 precursor [Glycine max]
 gb|ACU14566.1| unknown [Glycine max]
 gb|KHN47234.1| Putative non-specific lipid-transfer protein AKCS9-like protein 
[Glycine soja]
Length=95

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = -3

Query  533  VTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAK  354
            + EAVTC P +LSPC  AITS    PS  CC+KLK+Q+PCLC Y+K+  L++++ SPNA+
Sbjct  24   MAEAVTCTPTELSPCLPAITS-GAKPSNACCTKLKQQKPCLCGYLKNASLKQYVNSPNAR  82

Query  353  KVANTCGSPFPRC  315
            K   +CG PFP C
Sbjct  83   KTVASCGIPFPTC  95



>ref|NP_001056241.1| Os05g0550300 [Oryza sativa Japonica Group]
 gb|AAT39264.1| putative lipid transfer protein [Oryza sativa Japonica Group]
 dbj|BAF18155.1| Os05g0550300 [Oryza sativa Japonica Group]
 gb|EAY98926.1| hypothetical protein OsI_20881 [Oryza sativa Indica Group]
 dbj|BAG88327.1| unnamed protein product [Oryza sativa Japonica Group]
Length=94

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = -3

Query  515  CNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVANTC  336
            C+ LQLSPCA+AI   N SPS  CCS++KEQ+PCLC+Y +DP LQR++ SPN KKV   C
Sbjct  29   CDALQLSPCASAIIG-NASPSASCCSRMKEQQPCLCQYARDPNLQRYVNSPNGKKVLAAC  87

Query  335  GSPFPRC  315
              P P C
Sbjct  88   HVPVPSC  94



>sp|P82353.1|NLTP2_PRUAR RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2 [Prunus armeniaca]
Length=68

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = -3

Query  521  VTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVAN  342
            VTC+P+QLSPC   I S   SP+  CC KL+EQRPCLC Y+K+P L++++ SPNA+K+A+
Sbjct  1    VTCSPVQLSPCLGPINSGAPSPT-TCCQKLREQRPCLCGYLKNPSLRQYVNSPNARKLAS  59

Query  341  TCGSPFPRC  315
             CG P P+C
Sbjct  60   NCGVPVPQC  68



>emb|CDY40833.1| BnaC01g31230D [Brassica napus]
 emb|CDY32103.1| BnaC04g44630D [Brassica napus]
Length=97

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = -3

Query  542  KVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASP  363
            K+ V E VTC+  +LSPC  A  SS + PS  CC+KL+EQ+PCLC YM++P L++++ SP
Sbjct  23   KIPVAEGVTCSVTELSPCLAAFMSS-SQPSASCCAKLREQKPCLCGYMRNPSLRQYVTSP  81

Query  362  NAKKVANTCGSPFPRC  315
            NAKKV+N+C    P C
Sbjct  82   NAKKVSNSCKVASPHC  97



>ref|XP_003567951.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brachypodium 
distachyon]
Length=98

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
            A TCN LQLSPCA AI   N  P+  CCS++K Q PCLC Y KDP LQR++ SPN KKV 
Sbjct  30   ATTCNALQLSPCAGAIIG-NAEPTAGCCSRMKAQEPCLCDYAKDPNLQRYVNSPNGKKVM  88

Query  344  NTCGSPFPRC  315
              C  P P C
Sbjct  89   AACKVPVPSC  98



>sp|Q43681.1|NLTP_VIGUN RecName: Full=Probable non-specific lipid-transfer protein AKCS9; 
Short=LTP; Flags: Precursor [Vigna unguiculata]
 emb|CAA56113.1| lipid transfer like protein [Vigna unguiculata]
Length=99

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = -3

Query  533  VTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAK  354
            V EAVTCNP +LS C  AIT   + PS  CCSKLK Q PCLC Y+K+P L++++ SP AK
Sbjct  28   VAEAVTCNPTELSSCVPAITGG-SKPSSTCCSKLKVQEPCLCNYIKNPSLKQYVNSPGAK  86

Query  353  KVANTCGSPFPRC  315
            KV + CG  +P C
Sbjct  87   KVLSNCGVTYPNC  99



>ref|XP_006357827.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Solanum tuberosum]
Length=96

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
             +   +EAVTC+  QLSPC  AI    T+PS  CC++LK Q+PC+C +MKDP L++++ S
Sbjct  21   DQFGASEAVTCSASQLSPCVGAI-QGGTAPSQDCCARLKSQQPCICGFMKDPNLKQYVNS  79

Query  365  PNAKKVANTCGSPFPRC  315
            PNA+KVA  CG   P C
Sbjct  80   PNARKVAGQCGVSIPSC  96



>gb|EMT28561.1| Non-specific lipid-transfer protein 2 [Aegilops tauschii]
Length=96

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = -3

Query  527  EAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKV  348
            EA TCN LQL+PCA AI   N +P+  CCSK+KEQ+ C+C+Y +DP L++++ SPN KKV
Sbjct  27   EAATCNALQLTPCAGAIIG-NAAPTASCCSKMKEQQTCMCQYARDPNLKQYVDSPNGKKV  85

Query  347  ANTCGSPFPRC  315
               C  P P C
Sbjct  86   MAACKVPVPSC  96



>ref|XP_002305838.1| hypothetical protein POPTR_0004s09510g [Populus trichocarpa]
 gb|EEE86349.1| hypothetical protein POPTR_0004s09510g [Populus trichocarpa]
Length=93

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            ++ +V++AVTCNP QLSPC  AI+SS+   +  C SKLKEQ+PCLC Y+KDP L++F++S
Sbjct  18   AEAKVSQAVTCNPAQLSPCLPAISSSSPPSTTCC-SKLKEQKPCLCGYLKDPALKQFVSS  76

Query  365  PNAKKVANTCGSPFPRC  315
            P A+KVA+ CG P+P C
Sbjct  77   PGARKVASACGVPYPSC  93



>gb|KGN53813.1| hypothetical protein Csa_4G141210 [Cucumis sativus]
Length=95

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            S V + EAV+CNP +LSPC +AITSS T+P+  CC KL++Q PC C Y+KDP+ + +  S
Sbjct  20   SSVRLGEAVSCNPTELSPCVSAITSS-TAPTAACCQKLRQQEPCYCGYLKDPKYKAYAES  78

Query  365  PNAKKVANTCGSPFPRC  315
            P  + +A+ C  P P+C
Sbjct  79   PRVRAIASQCRVPIPKC  95



>gb|EYU41302.1| hypothetical protein MIMGU_mgv1a019842mg [Erythranthe guttata]
Length=84

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = -3

Query  548  ASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
            A   E      CNP++L+PC  AI  ++ +PSP CC KLKEQ PC C Y+KDPR  + I 
Sbjct  8    AEAQETAAGANCNPMELAPCLGAIMGTD-NPSPECCQKLKEQVPCFCNYLKDPRAGQIID  66

Query  368  SPNAKKVANTCGSPFPRC  315
            SPNAKK+A  CG   P C
Sbjct  67   SPNAKKIAAVCGLQRPSC  84



>ref|XP_009145000.1| PREDICTED: non-specific lipid-transfer protein 2 [Brassica rapa]
 emb|CDY68337.1| BnaAnng26930D [Brassica napus]
Length=97

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = -3

Query  542  KVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASP  363
            K+ V E VTC+  +LSPC  A  SS + PS  CC+KL+EQ+PCLC YM++P L++++ SP
Sbjct  23   KIPVAEGVTCSVTELSPCLAAFMSS-SQPSASCCAKLREQKPCLCGYMRNPGLRQYVTSP  81

Query  362  NAKKVANTCGSPFPRC  315
            NAKKV+N+C    P C
Sbjct  82   NAKKVSNSCKVASPNC  97



>gb|KGN53816.1| hypothetical protein Csa_4G141240 [Cucumis sativus]
Length=96

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            +   V +A+TCN + LSPC  A+TS+   PS  CCSKL+EQ+PC C+YMK+P L  ++ S
Sbjct  21   TGARVADAITCNTMGLSPCIGAMTST-APPSTTCCSKLREQQPCFCQYMKNPSLGGYVKS  79

Query  365  PNAKKVANTCGSPFPRC  315
              AK + ++CG P+P+C
Sbjct  80   ARAKAIISSCGVPYPKC  96



>gb|KGN53818.1| hypothetical protein Csa_4G146250 [Cucumis sativus]
Length=96

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            +   V +A+TCN + LSPC  A+TS+   PS  CCSKL+EQ+PC C+YMK+P L  ++ S
Sbjct  21   TGARVADAITCNTMGLSPCIGAMTST-APPSTTCCSKLREQQPCFCQYMKNPSLGGYVKS  79

Query  365  PNAKKVANTCGSPFPRC  315
              AK + ++CG P+P+C
Sbjct  80   ARAKAIISSCGVPYPKC  96



>ref|XP_012078005.1| PREDICTED: non-specific lipid-transfer protein 2-like [Jatropha 
curcas]
 gb|KDP32978.1| hypothetical protein JCGZ_13009 [Jatropha curcas]
Length=99

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = -3

Query  542  KVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASP  363
            +V  + AV C+P QLSPC  AI SS + PS  CC KL+EQRPC C Y+K+P L+++++SP
Sbjct  25   EVRFSNAVNCSPAQLSPCLPAIKSS-SPPSNDCCVKLREQRPCFCGYVKNPSLRQYVSSP  83

Query  362  NAKKVANTCGSPFPRC  315
             A++V  +CG PFP C
Sbjct  84   RAREVVKSCGVPFPTC  99



>ref|XP_011097163.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 gb|ABQ53930.1| lipid transfer protein [Sesamum indicum]
Length=96

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = -3

Query  530  TEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKK  351
            T A  CNP++LSPC  AI+ S   PS  CCSKLKEQ PC C Y+K+P  + ++ SPNAKK
Sbjct  26   TGAAPCNPVELSPCLAAISGSQP-PSAECCSKLKEQVPCFCDYVKNPVFKPYVDSPNAKK  84

Query  350  VANTCGSPFPRC  315
            VA TCG  FP C
Sbjct  85   VAATCGVAFPTC  96



>ref|XP_004234576.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=97

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
             ++ V E++ CN ++L PCA AI      P   CC+KLKEQ PCLC Y KDP ++ ++ S
Sbjct  21   GELLVVESINCNAMELVPCAPAIIWGQLPPLDACCAKLKEQVPCLCIYFKDPMMKPYVDS  80

Query  365  PNAKKVANTCGSPFPRC  315
            PNAKKV   CG   P+C
Sbjct  81   PNAKKVFQACGVTTPKC  97



>gb|AGC08422.1| lipid transfer protein [Gossypium hirsutum]
Length=96

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 62/91 (68%), Gaps = 1/91 (1%)
 Frame = -3

Query  587  IAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLC  408
             ++C +  V+VL + +    EAVTC+  +LSPC  AITSS   PS  CCSKL EQ+PC C
Sbjct  7    JSLCVVGJVVVLFSGETRTAEAVTCDLXELSPCLAAITSSK-PPSSTCCSKLTEQKPCFC  65

Query  407  KYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            +Y+++P  ++F+ +P AK++A TC   +P+C
Sbjct  66   QYLRNPTXKQFVDTPKAKRIATTCSVEYPQC  96



>ref|XP_006855793.1| PREDICTED: non-specific lipid-transfer protein 2 [Amborella trichopoda]
 gb|ERN17260.1| hypothetical protein AMTR_s00044p00214770 [Amborella trichopoda]
Length=94

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
            +VTCN   LSPC  AI  +  +PSP CCS+LKEQ+PCLC+Y+ +P+ +  + S NAKKVA
Sbjct  26   SVTCNVSYLSPCIGAIYKAQ-APSPTCCSRLKEQQPCLCQYIANPQFRSIVNSDNAKKVA  84

Query  344  NTCGSPFPRC  315
             TC SPFP+C
Sbjct  85   QTCKSPFPKC  94



>gb|KJB60036.1| hypothetical protein B456_009G286700 [Gossypium raimondii]
Length=86

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
            AVTCNP++LSPC  A+ SS T PS  CCS+L+EQ PC C Y+ DP L++F  +P  + V 
Sbjct  18   AVTCNPIELSPCLAAVMSS-TPPSETCCSRLREQTPCFCGYLNDPSLRQFADNPIIRTVG  76

Query  344  NTCGSPFPRC  315
            N CG  +P+C
Sbjct  77   NACGVAYPQC  86



>ref|XP_008444077.1| PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis 
melo]
Length=102

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = -3

Query  533  VTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAK  354
            + +AV CNP ++ PC  A+ SS   P+  CC KLKEQ PC C+Y+K P  +R++ SPNAK
Sbjct  31   LADAVNCNPTEMRPCLPALESS-VPPTAECCEKLKEQEPCFCEYLKSPIFKRYLESPNAK  89

Query  353  KVANTCGSPFPRC  315
            K+A++CG P P C
Sbjct  90   KIASSCGIPIPTC  102



>ref|XP_009418385.1| PREDICTED: non-specific lipid-transfer protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=91

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = -3

Query  530  TEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKK  351
            T +VTCNPL+LSPC++A+ S    PS  CC+KLKEQ+PC C+Y K+P L+ ++ S N KK
Sbjct  21   TASVTCNPLELSPCSSAVLS-GARPSAACCAKLKEQQPCFCQYKKNPSLKDYVNSDNGKK  79

Query  350  VANTCGSPFPRC  315
                CG P P C
Sbjct  80   ALKACGVPIPSC  91



>ref|XP_006654745.1| PREDICTED: non-specific lipid-transfer protein 2-like [Oryza 
brachyantha]
Length=98

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = -3

Query  521  VTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVAN  342
              C+ +QL+PCA AI   N +P+  CCS++KEQ+PCLC+Y +DP LQR++ SPN KKV  
Sbjct  31   AACDAMQLTPCAGAIIG-NAAPTAACCSRMKEQQPCLCQYARDPNLQRYVNSPNGKKVMA  89

Query  341  TCGSPFPRC  315
             C  P P C
Sbjct  90   ACRVPVPTC  98



>emb|CDO98408.1| unnamed protein product [Coffea canephora]
Length=94

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -3

Query  533  VTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAK  354
            V+EAVTCNP +L+PCA AI SS+   S  C SK+KEQ+PCLC+Y+K+P  ++F+ASP+A+
Sbjct  23   VSEAVTCNPNELNPCAGAIGSSSPPSSQCC-SKIKEQKPCLCQYVKNPTFKQFVASPSAQ  81

Query  353  KVANTCGSPFPRC  315
            KVA TCG P P+C
Sbjct  82   KVAKTCGVPIPKC  94



>ref|XP_004232333.1| PREDICTED: non-specific lipid-transfer protein 2 [Solanum lycopersicum]
Length=96

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
             +    EA TC+  QLSPC  AI    T+PS  CC++LK Q+PC+C +MKDP L++++ S
Sbjct  21   DQFGANEAATCSASQLSPCLGAI-QGGTAPSQDCCARLKNQQPCICGFMKDPNLRQYVNS  79

Query  365  PNAKKVANTCGSPFPRC  315
            PNA+KVA  CG   P C
Sbjct  80   PNARKVAGQCGVSIPSC  96



>gb|KJB46840.1| hypothetical protein B456_008G057100 [Gossypium raimondii]
Length=96

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = -3

Query  587  IAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLC  408
            +A+C + L +VL + +    EAVTCNP++L+PC+ A+TSS+   S  C SKLK Q+PCLC
Sbjct  7    VALCVVALAVVLFSGESRTAEAVTCNPVELAPCSPALTSSSPPSSACC-SKLKAQQPCLC  65

Query  407  KYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
             Y+K+P L++++ SPNAKKVA+TCG P+P+C
Sbjct  66   GYLKNPSLKQYVNSPNAKKVASTCGVPYPKC  96



>ref|XP_009386356.1| PREDICTED: non-specific lipid-transfer protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=91

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
            +VTCNP +LS CA AI +S   P+  CC+KLKEQRPCLC+Y K+P L+ +I S N+KKV+
Sbjct  23   SVTCNPSELSSCAGAILTS-APPTAACCAKLKEQRPCLCEYRKNPNLKGYINSDNSKKVS  81

Query  344  NTCGSPFPRC  315
             +CG P P C
Sbjct  82   KSCGVPIPSC  91



>gb|EYU41300.1| hypothetical protein MIMGU_mgv1a024516mg [Erythranthe guttata]
Length=83

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = -3

Query  518  TCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVANT  339
             CNP++LSPC  A+  ++ +PS VCC KLKEQ PC C Y+K+P L++FI SPNAKKVA  
Sbjct  17   NCNPMELSPCLGAMMGTD-NPSAVCCQKLKEQVPCFCNYLKNPTLRQFIDSPNAKKVAAV  75

Query  338  CGSPFPRC  315
            CG   P C
Sbjct  76   CGLQQPSC  83



>ref|XP_008444076.1| PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis 
melo]
Length=94

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            + V + EA +CNP +LSPC +AITSS T+P+  CC KL++Q PC C Y+KDP+ + +  S
Sbjct  19   TGVRLGEAASCNPTELSPCVSAITSS-TAPTAACCQKLRQQEPCYCGYLKDPKYKAYAES  77

Query  365  PNAKKVANTCGSPFPRC  315
            P  + +A+ C  P P+C
Sbjct  78   PRVRAIASQCRVPIPKC  94



>ref|XP_010528992.1| PREDICTED: non-specific lipid-transfer protein 2-like [Tarenaya 
hassleriana]
Length=92

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = -3

Query  596  MRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRP  417
            M++ AI  + L  +L      +TEA  C   +L+PC TAIT+    PS  CCSKLKEQ+P
Sbjct  1    MKTTAIMFVTLATLLLIQTAPLTEAA-CVVTELTPCLTAITTGG-KPSAACCSKLKEQQP  58

Query  416  CLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            CLC Y K+P   +++ SPNA+KV + CG P P+C
Sbjct  59   CLCGYAKNPAFSQYVNSPNARKVLSACGVPIPKC  92



>ref|XP_009107339.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brassica 
rapa]
Length=97

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            + + V E VTC+P +L+ C++A  S+ + PS  CC+KL+EQ+PCLC Y+++P L +++ S
Sbjct  22   ANIPVAEGVTCSPTELTSCSSAFMSA-SPPSATCCAKLREQKPCLCGYLRNPALSQYVNS  80

Query  365  PNAKKVANTCGSPFPRC  315
            PNAKKVA++C    P+C
Sbjct  81   PNAKKVASSCNVATPKC  97



>ref|NP_198633.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
 dbj|BAB11284.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO42030.1| putative lipid transfer protein [Arabidopsis thaliana]
 gb|AAO50624.1| putative lipid transfer protein [Arabidopsis thaliana]
 gb|AED94275.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
Length=103

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = -3

Query  521  VTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVAN  342
            VTC+ +QLS CAT + +    PS  CC KLKEQ+PC C Y+KDPR  +++ S NAKK   
Sbjct  36   VTCDAVQLSSCATPMLT-GVPPSTECCGKLKEQQPCFCTYIKDPRYSQYVGSANAKKTLA  94

Query  341  TCGSPFPRC  315
            TCG P+P C
Sbjct  95   TCGVPYPTC  103



>ref|XP_008782311.1| PREDICTED: non-specific lipid-transfer protein 2-like [Phoenix 
dactylifera]
Length=94

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            ++   T+A TCNP +LSPCA AI  S + P+  CC+KLK Q+PC C+Y K+P L+ +I S
Sbjct  19   NQAPTTKAATCNPSELSPCAGAILRS-SPPTSACCAKLKAQQPCFCQYTKNPSLRGYINS  77

Query  365  PNAKKVANTCGSPFPRC  315
            PN++KV   CG   PRC
Sbjct  78   PNSRKVVAACGVSIPRC  94



>sp|P86809.1|NLTP2_APIGA RecName: Full=Non-specific lipid-transfer protein 2; AltName: 
Full=Allergen Api g 6.0101; AltName: Allergen=Api g 6 [Apium 
graveolens Rapaceum Group]
Length=67

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 48/63 (76%), Gaps = 1/63 (2%)
 Frame = -3

Query  521  VTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVAN  342
             TC+ +QLSPC  AIT  NT PS  CC+KLKEQ+PCLC Y+KDP L+ ++ SP A+K A+
Sbjct  1    ATCSAVQLSPCLAAITK-NTPPSAACCNKLKEQKPCLCGYLKDPNLKNYVNSPGARKTAS  59

Query  341  TCG  333
            +CG
Sbjct  60   SCG  62



>gb|ERN12382.1| hypothetical protein AMTR_s00025p00111520 [Amborella trichopoda]
Length=91

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
            A +CN   L+ CA A+  S   PS  CCSKLK+Q PC+C+Y KDP L  FIASPNAK +A
Sbjct  23   AASCNSQGLNVCAGALFKS-IPPSTSCCSKLKQQAPCMCQYSKDPHLHNFIASPNAKNIA  81

Query  344  NTCGSPFPRC  315
              CG+P P C
Sbjct  82   QKCGTPLPNC  91



>ref|XP_009418081.1| PREDICTED: non-specific lipid-transfer protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=91

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
            +VTCNP++LS CA AI ++   P+  CC+KLKEQRPC C+Y ++P L+ +I S N+KKVA
Sbjct  23   SVTCNPVELSSCAGAILTA-APPTAGCCAKLKEQRPCFCQYKQNPNLKGYINSDNSKKVA  81

Query  344  NTCGSPFPRC  315
             +CG P P C
Sbjct  82   KSCGVPIPTC  91



>emb|CDY16462.1| BnaA08g03050D [Brassica napus]
Length=97

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            + + V E VTC+P +L+ C++A  S+ + PS  CC+KL+EQ PCLC Y+++P L +++ S
Sbjct  22   ANIPVAEGVTCSPTELTSCSSAFMSA-SPPSATCCAKLREQNPCLCGYLRNPALSQYVNS  80

Query  365  PNAKKVANTCGSPFPRC  315
            PNAKKVA++C    P+C
Sbjct  81   PNAKKVASSCNVATPKC  97



>ref|XP_010528502.1| PREDICTED: non-specific lipid-transfer protein 2-like [Tarenaya 
hassleriana]
Length=97

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = -3

Query  521  VTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVAN  342
            VTC   +L PC  AIT+   +PS  CC KLKEQ+PCLC Y+K+P L ++++SPNA+KV +
Sbjct  30   VTCVVTELRPCLPAITTGG-APSAECCGKLKEQQPCLCGYIKNPALSQYVSSPNARKVLS  88

Query  341  TCGSPFPRC  315
             CG P+P C
Sbjct  89   ACGVPYPSC  97



>gb|ACI26699.1| lipid transfer protein [Gossypium hirsutum]
Length=111

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
            AVTCNP++L PC  A+ SS T PS  CCS+L+EQ PC C Y+ DP L++F  +P  + V 
Sbjct  43   AVTCNPIELIPCLAAVMSS-TPPSETCCSRLREQTPCFCGYLNDPSLRQFADNPIIRTVG  101

Query  344  NTCGSPFPRC  315
            N CG  +P+C
Sbjct  102  NACGVAYPQC  111



>gb|KHN25489.1| Non-specific lipid-transfer protein 2 [Glycine soja]
Length=105

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 2/66 (3%)
 Frame = -3

Query  515  CNPLQLSPCATAITSSNTSPSPVCCSKLKEQ-RPCLCKYMKDPRLQRFIASPNAKKVANT  339
            CN ++L PCA A T+S T PSP CC +L+EQ R C+C+YMKDP L++FI + NAK V+++
Sbjct  38   CNVMELVPCAAAFTTS-TPPSPECCERLREQPRSCICQYMKDPTLEKFINTSNAKMVSDS  96

Query  338  CGSPFP  321
            CGSP P
Sbjct  97   CGSPMP  102



>ref|XP_010550264.1| PREDICTED: non-specific lipid-transfer protein 2-like [Tarenaya 
hassleriana]
Length=104

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 4/75 (5%)
 Frame = -3

Query  530  TEAVTCNPLQLSPCATAIT----SSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASP  363
              AV CNP++LSPC  A+T       T P  +CC KL+EQRPC+C ++ DP L++FI SP
Sbjct  29   VRAVNCNPMELSPCVEAMTLAAAGEATVPPVMCCRKLREQRPCMCGFINDPNLRQFIGSP  88

Query  362  NAKKVANTCGSPFPR  318
             A  VA +CG P P 
Sbjct  89   VAMAVAASCGRPHPH  103



>ref|XP_003535202.1| PREDICTED: non-specific lipid-transfer protein 2-like [Glycine 
max]
Length=107

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 2/66 (3%)
 Frame = -3

Query  515  CNPLQLSPCATAITSSNTSPSPVCCSKLKEQ-RPCLCKYMKDPRLQRFIASPNAKKVANT  339
            CN ++L PCA A T+S T PSP CC +L+EQ R C+C+YMKDP L++FI + NAK V+++
Sbjct  40   CNVMELVPCAAAFTTS-TPPSPECCQRLREQPRSCICQYMKDPTLEKFINTSNAKMVSDS  98

Query  338  CGSPFP  321
            CGSP P
Sbjct  99   CGSPMP  104



>emb|CDY52889.1| BnaC06g27820D [Brassica napus]
Length=96

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = -3

Query  548  ASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
            A+  EV     C+  QL PC  AIT     PS  CC+KLKEQ+PCLC + K+P   ++I+
Sbjct  20   AAPTEVALGAACDAKQLQPCLAAITGGG-QPSGDCCAKLKEQQPCLCGFAKNPAFAQYIS  78

Query  368  SPNAKKVANTCGSPFPRC  315
            SPN++KV + CG P+P C
Sbjct  79   SPNSRKVLSACGIPYPSC  96



>ref|XP_006367505.1| PREDICTED: uncharacterized protein LOC102587705 [Solanum tuberosum]
Length=174

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
             ++ V E+ TCN ++L PC+ AI S    PS VCC+KLKEQ PCLC Y  DP L+ ++ S
Sbjct  21   GELLVVESATCNVMELVPCSPAIISGQ-PPSEVCCAKLKEQVPCLCGYFNDPTLKPYVGS  79

Query  365  PNAKKVANTCGS  330
            PNA+KV  TCG+
Sbjct  80   PNAQKVFQTCGT  91



>gb|KJB32222.1| hypothetical protein B456_005G230500 [Gossypium raimondii]
Length=97

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = -3

Query  596  MRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRP  417
            M+ ++   IL  + L + +    EAVTC+P++L PC  AI++    PS  CC K+KEQ P
Sbjct  1    MKRVSFVMILCAVALFSGETRTVEAVTCSPIELIPCLPAISTPPKPPSAACCRKVKEQLP  60

Query  416  CLCKYMKDPRLQRFIASPNAKKVANTCG  333
            C C Y+KDP  + FI +PN  KVA++CG
Sbjct  61   CFCGYLKDPGAKPFIDNPNIPKVASSCG  88



>emb|CDX77289.1| BnaC08g03340D [Brassica napus]
Length=97

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = -3

Query  539  VEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPN  360
            + V E VTC+P +L+ C+ A  S+ + PS  CC+KL+EQ+PCLC Y+++P L +++ SPN
Sbjct  24   IPVAEGVTCSPTELTSCSPAFMSA-SPPSATCCAKLREQKPCLCGYLRNPTLSQYVNSPN  82

Query  359  AKKVANTCGSPFPRC  315
            AKKVA++C    P+C
Sbjct  83   AKKVASSCNVATPKC  97



>gb|KFK43095.1| hypothetical protein AALP_AA1G079200 [Arabis alpina]
Length=99

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = -3

Query  530  TEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKK  351
            +E V CN ++L PC  A+ S   +PSP CC KLKEQ  CLC+Y+K+P   ++++S NA+K
Sbjct  28   SEKVACNVMELQPCLAALQSGG-NPSPDCCGKLKEQESCLCEYIKNPLFGQYVSSANAQK  86

Query  350  VANTCGSPFPRC  315
            +   CG P P C
Sbjct  87   ILGACGVPLPTC  98



>ref|XP_006390508.1| hypothetical protein EUTSA_v10019361mg [Eutrema salsugineum]
 gb|ESQ27794.1| hypothetical protein EUTSA_v10019361mg [Eutrema salsugineum]
Length=98

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = -3

Query  548  ASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
            A +  V    TC+P QLSPC  AI   +T P+ +CC+++K+Q+ C+C+Y+K+P  + FI 
Sbjct  22   AQENRVAAVETCDPTQLSPCVDAIQRGST-PTRLCCTRVKKQKHCVCQYLKNPTFKSFIN  80

Query  368  SPNAKKVANTCGSPFPRC  315
            SP A+K+A  CG P+P+C
Sbjct  81   SPKARKIATYCGCPYPKC  98



>ref|XP_007142957.1| hypothetical protein PHAVU_007G031600g [Phaseolus vulgaris]
 gb|ESW14951.1| hypothetical protein PHAVU_007G031600g [Phaseolus vulgaris]
Length=94

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 58/70 (83%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
            AVTCN LQLS CA+AITSS++  S  C SKLKEQRPCLC+Y+KDP L+R + SPNA+KVA
Sbjct  26   AVTCNALQLSACASAITSSSSPSSVCC-SKLKEQRPCLCQYLKDPNLKRLVNSPNARKVA  84

Query  344  NTCGSPFPRC  315
            N CGSPFP C
Sbjct  85   NACGSPFPTC  94



>gb|ACG48207.1| nonspecific lipid-transfer protein precursor [Zea mays]
Length=101

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = -3

Query  527  EAVT-CNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKK  351
            +AVT C+  QL+PCA AI     SPS  CCS+LKEQ+PCLC Y +DP LQR++ SPN KK
Sbjct  31   DAVTACDATQLTPCAGAIIIGR-SPSAACCSRLKEQQPCLCTYARDPNLQRYVNSPNGKK  89

Query  350  VANTCGSPFPRC  315
                C  P P C
Sbjct  90   AMAACKVPVPSC  101



>ref|XP_004961319.1| PREDICTED: non-specific lipid-transfer protein 2-like [Setaria 
italica]
Length=95

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = -3

Query  518  TCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVANT  339
            TC+  QL+PCA AI   N+ P+  CCSK++EQ+PC+C Y +DP LQR+++SPN KK    
Sbjct  29   TCDATQLTPCAGAIIG-NSPPTAACCSKMREQQPCMCTYARDPNLQRYVSSPNGKKAMAA  87

Query  338  CGSPFPRC  315
            C  P P C
Sbjct  88   CKVPVPSC  95



>gb|EMT31755.1| Putative non-specific lipid-transfer protein AKCS9 [Aegilops 
tauschii]
Length=98

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = -3

Query  533  VTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQ-RPCLCKYMKDPRLQRFIASPNA  357
              EA TC+P QL+PCA AI   N +PS  CC KLK     CLCKY KDP LQR++ SPN 
Sbjct  26   AVEAATCSPTQLTPCAPAIIG-NAAPSAACCGKLKAHPASCLCKYKKDPHLQRYVNSPNG  84

Query  356  KKVANTCGSPFPRC  315
            KKV   C    PRC
Sbjct  85   KKVFAACKLRLPRC  98



>ref|XP_002887506.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63765.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=98

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = -3

Query  515  CNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVANTC  336
            C+P++LSPC   IT   + PS +CC+K+KEQ+ C+C+Y+K+P  + F+ SPNAKK+A  C
Sbjct  33   CDPMKLSPCLDTITKG-SEPSELCCTKVKEQQHCVCQYLKNPNFKSFLNSPNAKKIATDC  91

Query  335  GSPFPRC  315
              P+P+C
Sbjct  92   HCPYPKC  98



>ref|XP_010926507.1| PREDICTED: non-specific lipid-transfer protein 2-like [Elaeis 
guineensis]
Length=92

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = -3

Query  545  SKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIAS  366
            S+     AVTCNP +LSPCA AI  S + P+  CC+KLK Q+PC C+Y K+P L+ +I S
Sbjct  17   SQAPTAMAVTCNPSELSPCAGAILGS-SPPTSACCAKLKAQQPCFCQYAKNPSLKGYINS  75

Query  365  PNAKKVANTCGSPFPRC  315
            PN++KV   CG   P C
Sbjct  76   PNSRKVLAACGVSTPSC  92



>emb|CDY50600.1| BnaC02g16970D [Brassica napus]
Length=98

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = -3

Query  515  CNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVANTC  336
            C+P QL PC  AIT     PS  CC+KLKEQ+PCLC + K+P   ++I+SPN++KV   C
Sbjct  33   CDPKQLQPCLAAITGGG-QPSGDCCAKLKEQQPCLCGFAKNPAFAQYISSPNSRKVLTAC  91

Query  335  GSPFPRC  315
            G P+P C
Sbjct  92   GIPYPSC  98



>ref|XP_004986022.1| PREDICTED: non-specific lipid-transfer protein 2-like [Setaria 
italica]
Length=93

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  533  VTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAK  354
            V  A +CN  QL+PCA+A+ +  T PS  CCS LK Q+ C C Y K+P   R+I SPNAK
Sbjct  22   VASAASCNVGQLTPCASALATGAT-PSASCCSSLKAQQGCFCTYAKNPTYARYINSPNAK  80

Query  353  KVANTCGSPFPRC  315
            KV  +CG   PRC
Sbjct  81   KVVASCGLTVPRC  93



>ref|XP_004288629.1| PREDICTED: non-specific lipid-transfer protein 2-like [Fragaria 
vesca subsp. vesca]
Length=103

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = -3

Query  518  TCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVANT  339
            TC+P++LS C   I    + PS +CC KLK Q PCLC Y+K+P  ++++  PNA+K+++ 
Sbjct  37   TCSPVELSSCLDPI-QYGSKPSSICCQKLKGQVPCLCGYIKNPAFKKYVTGPNAQKLSSN  95

Query  338  CGSPFPRC  315
            CG PFPRC
Sbjct  96   CGVPFPRC  103



>ref|XP_009127492.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brassica 
rapa]
 emb|CDY12591.1| BnaA02g12590D [Brassica napus]
Length=98

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = -3

Query  515  CNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVANTC  336
            C+P QL PC  AIT     PS  CC+KLKEQ+PCLC + K+P   ++I+SPN++KV   C
Sbjct  33   CDPKQLQPCLAAITGGG-QPSGDCCAKLKEQQPCLCGFSKNPAFAQYISSPNSRKVLTAC  91

Query  335  GSPFPRC  315
            G P+P C
Sbjct  92   GIPYPSC  98



>gb|AGC08430.1| lipid transfer protein [Gossypium hirsutum]
Length=90

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -3

Query  548  ASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
            + +    EAVTC+P++L PC  AI++    PS  CC K+KEQ PC C Y+KDP  + FI 
Sbjct  10   SGETRTVEAVTCSPIELIPCLPAISTPPKPPSAACCRKVKEQLPCFCGYLKDPGAKPFID  69

Query  368  SPNAKKVANTCG  333
            +PN  KVA++CG
Sbjct  70   NPNIPKVASSCG  81



>dbj|BAA25680.1| Lipid transfer protein [Brassica rapa]
Length=86

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -3

Query  521  VTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVAN  342
              C+P QL PC  AIT     PS  CC+KLKEQ+PCLC + K+P   ++I+SPN++KV  
Sbjct  19   AACDPKQLQPCLAAITGGG-QPSGDCCAKLKEQQPCLCGFSKNPAFAQYISSPNSRKVLT  77

Query  341  TCGSPFPRC  315
             CG P+P C
Sbjct  78   ACGIPYPSC  86



>ref|XP_010034442.1| PREDICTED: non-specific lipid-transfer protein 2P-like [Eucalyptus 
grandis]
 gb|KCW52082.1| hypothetical protein EUGRSUZ_J01517 [Eucalyptus grandis]
Length=98

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = -3

Query  530  TEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKK  351
             EAV C+  +L PC  A  S    P+  CC +LKEQ+PCLC +MKDPR ++++ SP AK+
Sbjct  28   VEAV-CDASRLLPCLPAFGSPYVQPTAECCGRLKEQQPCLCDFMKDPRYRKYVDSPRAKE  86

Query  350  VANTCGSPFPRC  315
            +  TC  P+PRC
Sbjct  87   ILQTCQIPYPRC  98



>ref|NP_177519.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AAG52085.1|AC012679_23 putative lipid transfer protein; 71816-72112 [Arabidopsis thaliana]
 gb|AEE35508.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=98

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = -3

Query  548  ASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
            A +  V     CNP QLSPC   I    + PS +CCSK+KEQ+ C+C+Y+K+P  + F+ 
Sbjct  22   AQENRVAAVDPCNPAQLSPCLETIMKG-SEPSDLCCSKVKEQQHCICQYLKNPNFKSFLN  80

Query  368  SPNAKKVANTCGSPFPRC  315
            SPNAK +A  C  P+P+C
Sbjct  81   SPNAKIIATDCHCPYPKC  98



>gb|KGN53815.1| hypothetical protein Csa_4G141230 [Cucumis sativus]
Length=102

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 48/73 (66%), Gaps = 1/73 (1%)
 Frame = -3

Query  533  VTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAK  354
            + +AV CNP+++ PC  A+ SS   P+  CC KLKEQ PC C Y+K P  + ++ SPNAK
Sbjct  31   LADAVNCNPMEMRPCLPALESS-VPPTAECCEKLKEQEPCFCAYLKSPVFKPYLESPNAK  89

Query  353  KVANTCGSPFPRC  315
            K+A +C  P P C
Sbjct  90   KIATSCRVPIPTC  102



>ref|XP_002870865.1| hypothetical protein ARALYDRAFT_916549 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47124.1| hypothetical protein ARALYDRAFT_916549 [Arabidopsis lyrata subsp. 
lyrata]
Length=104

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = -3

Query  521  VTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVAN  342
            VTC+  +LS C    T+   SPS  CC+KLKEQ+PC C Y+KDP+  +++ +PNAKK   
Sbjct  36   VTCDANELSSCLLPFTT-GVSPSTTCCTKLKEQQPCFCTYIKDPKYSQYVGTPNAKKTLA  94

Query  341  TCGSPFP  321
            TCG P+P
Sbjct  95   TCGVPYP  101



>ref|XP_010528993.1| PREDICTED: non-specific lipid-transfer protein 2-like [Tarenaya 
hassleriana]
Length=92

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 59/94 (63%), Gaps = 2/94 (2%)
 Frame = -3

Query  596  MRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRP  417
            M++ AI  I L  +L      +TEA  C   +L+PC  AIT+   +PS  CC KLKEQ  
Sbjct  1    MKTTAIMFIALATLLLIKTAPLTEA-ACVVAELAPCLPAITTGG-NPSAECCGKLKEQES  58

Query  416  CLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            CLC Y+K+P   ++++SPNA+KV + CG P+P C
Sbjct  59   CLCGYIKNPAFAQYVSSPNARKVLSACGVPYPSC  92



>ref|XP_002887080.1| hypothetical protein ARALYDRAFT_475781 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63339.1| hypothetical protein ARALYDRAFT_475781 [Arabidopsis lyrata subsp. 
lyrata]
Length=103

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
             VTC+  QL PC  AIT     PS  CC+KL EQ+ CLC + K+P   ++I+SPNA+KV 
Sbjct  35   GVTCDARQLQPCLAAITGGG-QPSGACCAKLTEQQSCLCGFAKNPAFAQYISSPNARKVL  93

Query  344  NTCGSPFPRC  315
             TCG  +P C
Sbjct  94   VTCGVAYPTC  103



>ref|XP_010528501.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Tarenaya hassleriana]
Length=92

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 59/94 (63%), Gaps = 2/94 (2%)
 Frame = -3

Query  596  MRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRP  417
            M++ AI  I L  +L      +TEA  C   +L+PC  AIT+   +PS  CC KLKEQ  
Sbjct  1    MKTTAIMFIALATLLLIKTAPLTEAA-CVVTELAPCLPAITTGG-NPSAECCGKLKEQES  58

Query  416  CLCKYMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            CLC Y+K+P   ++++SPNA+KV + CG P+P C
Sbjct  59   CLCGYVKNPAFAQYVSSPNARKVLSACGVPYPSC  92



>emb|CDP02750.1| unnamed protein product [Coffea canephora]
Length=96

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 59/90 (66%), Gaps = 1/90 (1%)
 Frame = -3

Query  584  AICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCK  405
            A+ A L++LV+   +V+V+ AVTC+  +LSPC +AI   N  PS  CC+KLKEQRPC C 
Sbjct  8    AVAAWLVMLVVAVGEVQVSRAVTCSIAELSPCLSAINGPNP-PSAPCCAKLKEQRPCFCG  66

Query  404  YMKDPRLQRFIASPNAKKVANTCGSPFPRC  315
            Y+++P   +++ SP AK +A  C    P C
Sbjct  67   YIQNPTYAQYVNSPKAKGIAKACQVSIPNC  96



>ref|XP_008809159.1| PREDICTED: non-specific lipid-transfer protein 2 [Phoenix dactylifera]
Length=93

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = -3

Query  530  TEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKK  351
            T A TC+P +LSPCA AI  S + PS  CC++LK Q+PC C+Y K+P L  +I SPN++K
Sbjct  23   TTAATCDPSELSPCAGAILFS-SPPSSACCAELKAQQPCFCQYAKNPNLSGYINSPNSRK  81

Query  350  VANTCGSPFPRC  315
                CG   PRC
Sbjct  82   AVAACGVSIPRC  93



>ref|XP_007150889.1| hypothetical protein PHAVU_004G002700g [Phaseolus vulgaris]
 gb|ESW22883.1| hypothetical protein PHAVU_004G002700g [Phaseolus vulgaris]
Length=88

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = -3

Query  527  EAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKV  348
            E + C+P +LSPC  A++SS + P+ +CC K++EQRPCLC Y+K P ++ +  SP + ++
Sbjct  18   EGLNCSPAELSPCLEAMSSS-SPPTSICCQKVREQRPCLCGYLKSPSIKNYANSPGSIRI  76

Query  347  ANTCGSPFP  321
            A++CG PFP
Sbjct  77   ASSCGIPFP  85



>gb|EYU40788.1| hypothetical protein MIMGU_mgv1a025902mg, partial [Erythranthe 
guttata]
Length=98

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = -3

Query  521  VTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVAN  342
            V+CNP QLSPCA+AI  S + PS  CC++++ Q PCLC+Y  DP LQ FI S  A+K++ 
Sbjct  27   VSCNPAQLSPCASAIFFS-SQPSAACCTEIRRQIPCLCQYQSDPSLQGFINSLAAQKIST  85

Query  341  TCGSPFP  321
            +C  PFP
Sbjct  86   SCNVPFP  92



>emb|CDO98409.1| unnamed protein product [Coffea canephora]
Length=92

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 50/74 (68%), Gaps = 3/74 (4%)
 Frame = -3

Query  536  EVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNA  357
             V+ AVTC+P  LSPCA+A TSS    S  CC K+KEQ+PC C+Y  +P+ + F+ SP A
Sbjct  21   NVSIAVTCDPNALSPCASAFTSSV---SQTCCIKIKEQKPCFCEYATNPKYRAFLDSPIA  77

Query  356  KKVANTCGSPFPRC  315
            KK++  C  P P+C
Sbjct  78   KKISKACNIPIPKC  91



>ref|XP_003624381.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES80599.1| Lipid transfer protein [Medicago truncatula]
Length=95

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = -3

Query  596  MRSIAICAIllvlvLGASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRP  417
            M    +CA++L++VL      + EA  C+P +L PCA AI   N++PS  CCSKL+EQ P
Sbjct  2    MNMKVVCALMLMVVLMVEVATIAEAQNCDPNELLPCAGAIIF-NSTPSAECCSKLREQTP  60

Query  416  CLCKYMKDPRLQRFIASPNAKKVANTCGSPFP  321
            C C+Y++DP   +++ SP A++VA+ C    P
Sbjct  61   CFCEYIRDPDYSQYVNSPRAREVASACNVVIP  92



>gb|AAG60123.1|AC073555_7 lipid transfer protein, putative [Arabidopsis thaliana]
Length=87

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -3

Query  500  LSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVANTCGSPFP  321
            L+ CA A+TSS + PS  CC+KL+EQ+PCLC YM++P L+++++SPNA+KV+N+C  P P
Sbjct  27   LASCAAAMTSS-SPPSEACCTKLREQQPCLCGYMRNPTLRQYVSSPNARKVSNSCKIPSP  85

Query  320  RC  315
             C
Sbjct  86   SC  87



>ref|NP_001043932.1| Os01g0691100 [Oryza sativa Japonica Group]
 dbj|BAD82487.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF05846.1| Os01g0691100 [Oryza sativa Japonica Group]
 gb|EAZ13163.1| hypothetical protein OsJ_03082 [Oryza sativa Japonica Group]
 dbj|BAG88981.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00800.1| unnamed protein product [Oryza sativa Japonica Group]
Length=103

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -3

Query  551  GASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFI  372
            GAS+     A  C+PL L PCA AI     +PS  CC+ L+ Q+ CLC+Y K+P L+++I
Sbjct  26   GASRTAPAAATKCDPLALRPCAAAILWGE-APSTACCAGLRAQKRCLCRYAKNPDLRKYI  84

Query  371  ASPNAKKVANTCGSPFPRC  315
             S N++KVA  C  P PRC
Sbjct  85   NSQNSRKVAAACSVPAPRC  103



>ref|XP_002466001.1| hypothetical protein SORBIDRAFT_01g049830 [Sorghum bicolor]
 gb|EER92999.1| hypothetical protein SORBIDRAFT_01g049830 [Sorghum bicolor]
Length=92

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = -3

Query  536  EVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNA  357
            E   A +CN  QL+ CA+A+ S   +PS  CCS LK Q+ CLC++ K+P   R++ SPNA
Sbjct  20   ETASAASCNAGQLTVCASAMLS-GAAPSAACCSNLKAQQGCLCQFAKNPAYARYVNSPNA  78

Query  356  KKVANTCGSPFPRC  315
            +K   +CG   PRC
Sbjct  79   RKTVASCGVALPRC  92



>ref|XP_006301055.1| hypothetical protein CARUB_v10021448mg [Capsella rubella]
 gb|EOA33953.1| hypothetical protein CARUB_v10021448mg [Capsella rubella]
Length=98

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = -3

Query  548  ASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
            A +  V     C+P+QLSPC   I    + PS +CC K++EQ+ C+C+Y+++P  + F+ 
Sbjct  22   AQENRVAAEEPCDPMQLSPCLDTI-QKGSYPSNLCCKKVREQKHCVCQYLRNPNFKSFLN  80

Query  368  SPNAKKVANTCGSPFPRC  315
            SPNAKK+A  C  P+P+C
Sbjct  81   SPNAKKIATECDCPYPKC  98



>emb|CDY47738.1| BnaA02g16570D [Brassica napus]
Length=98

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = -3

Query  548  ASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
            A +  V    +C+P+QL PC  AI    + PS  CC++L +Q+ C+C+YMK+P  + F+ 
Sbjct  22   AQENRVVAGQSCDPMQLIPCEEAILKG-SKPSDTCCTRLNQQQHCVCQYMKNPNFKSFLD  80

Query  368  SPNAKKVANTCGSPFPRC  315
            SPNAKK+A  C  P P+C
Sbjct  81   SPNAKKIATDCHCPKPKC  98



>ref|XP_010317751.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=96

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = -3

Query  527  EAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKV  348
            +A+TC+  +LSPCA AI +    P+P CC  L EQ+PCLC Y+KDP+L+ ++  PN +K+
Sbjct  27   KAITCSVSELSPCAEAILT-GIPPTPTCCLVLIEQKPCLCGYIKDPKLKPYMEYPNTQKI  85

Query  347  ANTCGSPFPRC  315
               C  PFP+C
Sbjct  86   YIFCRVPFPQC  96



>ref|XP_009128011.1| PREDICTED: non-specific lipid-transfer protein 2 [Brassica rapa]
Length=98

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = -3

Query  548  ASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
            A +  V    +C+P+QL PC  AI    + PS  CC++L +Q+ C+C+YMK+P  + F+ 
Sbjct  22   AQENRVVAGQSCDPMQLIPCEEAILKG-SKPSDTCCTRLNQQQHCVCQYMKNPNFKSFLD  80

Query  368  SPNAKKVANTCGSPFPRC  315
            SPNAKK+A  C  P P+C
Sbjct  81   SPNAKKIATDCHCPKPKC  98



>emb|CDY45874.1| BnaC02g22460D [Brassica napus]
Length=98

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = -3

Query  548  ASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
            A +  V    +C+P+QL PC  AI    + PS  CC++L +Q+ C+C+YMK+P  + F+ 
Sbjct  22   AQENRVVAGQSCDPMQLIPCEEAILKG-SKPSDTCCTRLNQQQHCVCQYMKNPNFKSFLD  80

Query  368  SPNAKKVANTCGSPFPRC  315
            SPNAKK+A  C  P P+C
Sbjct  81   SPNAKKIATDCHCPKPKC  98



>gb|EMT21725.1| Putative non-specific lipid-transfer protein AKCS9 [Aegilops 
tauschii]
Length=97

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = -3

Query  536  EVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQ-RPCLCKYMKDPRLQRFIASPN  360
             + EA T +P QL+PCA AI   N +PS  CC KLK     CLCKY KDP LQR++ SPN
Sbjct  24   SMVEAATGSPTQLTPCAPAIIG-NAAPSAACCGKLKAHPASCLCKYKKDPNLQRYVNSPN  82

Query  359  AKKVANTCGSPFPRC  315
             KKV   C    PRC
Sbjct  83   GKKVFAACKLRLPRC  97



>ref|XP_010108881.1| hypothetical protein L484_027075 [Morus notabilis]
 gb|EXC20521.1| hypothetical protein L484_027075 [Morus notabilis]
Length=101

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -3

Query  533  VTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAK  354
            V EA TCN L L  C  A +  +T PS  CC+KLK Q PC C+Y K+P L+++  SPNA 
Sbjct  27   VWEAGTCNALDLISCQQAFSQGSTPPSATCCNKLKVQVPCFCEYAKNPNLRKYFDSPNAD  86

Query  353  KVANTCGSP  327
            KV++ CG P
Sbjct  87   KVSSACGVP  95



>ref|NP_001150566.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACF85955.1| unknown [Zea mays]
 gb|ACF88293.1| unknown [Zea mays]
 gb|ACG39591.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|AFW79027.1| nonspecific lipid-transfer protein [Zea mays]
Length=101

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = -3

Query  503  QLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVANTCGSPF  324
            QL+PCA AI  S + P+  CCS+L+EQ+PCLC Y +DP+LQR+++SPN K     C  P 
Sbjct  40   QLTPCAGAIIGS-SPPTAACCSRLREQQPCLCTYARDPKLQRYVSSPNGKNAMAACKVPV  98

Query  323  PRC  315
            P C
Sbjct  99   PSC  101



>ref|XP_002440195.1| hypothetical protein SORBIDRAFT_09g027590 [Sorghum bicolor]
 gb|EES18625.1| hypothetical protein SORBIDRAFT_09g027590 [Sorghum bicolor]
Length=97

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = -3

Query  503  QLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVANTCGSPF  324
            QL+PCA AI  S + P+  CCS+LKEQ+PCLC Y +DP LQR++ SPN KK    C  P 
Sbjct  36   QLTPCAGAIIGS-SPPTAACCSRLKEQQPCLCTYARDPNLQRYVNSPNGKKAMAACKVPV  94

Query  323  PRC  315
            P C
Sbjct  95   PSC  97



>ref|NP_001065005.1| Os10g0504900 [Oryza sativa Japonica Group]
 gb|ABB47857.1| Nonspecific lipid-transfer protein 2, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26919.1| Os10g0504900 [Oryza sativa Japonica Group]
Length=82

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = -3

Query  548  ASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
            A+ +E+   V C+P  LSPCA  I    T+PS  CCS LK Q+ C C+Y KDP    +I 
Sbjct  5    AAAMEMLLLVVCDPGLLSPCAAPIFF-GTAPSASCCSSLKAQQGCFCQYAKDPTYASYIN  63

Query  368  SPNAKKVANTCGSPFPRC  315
            S NA+K+   CG PFP C
Sbjct  64   STNARKMIAACGIPFPNC  81



>ref|XP_009596861.1| PREDICTED: non-specific lipid-transfer protein 2 {ECO:0000303|PubMed:23913675}-like 
[Nicotiana tomentosiformis]
Length=97

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 52/78 (67%), Gaps = 2/78 (3%)
 Frame = -3

Query  545  SKVEVTEA-VTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
             ++ VTEA V C+  +LSPCA A TSS   P+  CC KL EQ+PCLCKY+KDP L+ ++ 
Sbjct  21   GELLVTEAKVKCDVKELSPCAPAFTSSQ-PPTAKCCDKLNEQKPCLCKYVKDPNLRPYVK  79

Query  368  SPNAKKVANTCGSPFPRC  315
            SPNAK VA  C    P C
Sbjct  80   SPNAKNVARRCRILTPIC  97



>ref|XP_006304814.1| hypothetical protein CARUB_v10012448mg [Capsella rubella]
 gb|EOA37712.1| hypothetical protein CARUB_v10012448mg [Capsella rubella]
Length=95

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = -3

Query  548  ASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIA  369
             +K+ V E VTC   +L PCA A TSS + PS  CC+KL+EQ PC C Y+++P L+ +I 
Sbjct  19   VAKIPVAEGVTCTVSELFPCAPAYTSS-SPPSRTCCTKLREQTPCFCGYLRNPSLRGYIN  77

Query  368  SPNAKKVANTCGSPFPRC  315
            +PN++KV++ C    PRC
Sbjct  78   NPNSRKVSSICKISPPRC  95



>ref|NP_001148293.1| LOC100281901 precursor [Zea mays]
 gb|ACG30429.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACN28858.1| unknown [Zea mays]
 gb|AFW77366.1| nonspecific lipid-transfer protein [Zea mays]
Length=101

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = -3

Query  503  QLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVANTCGSPF  324
            QL+PCA AI     SPS  CCS+LKEQ+PCLC Y +DP LQR++ SPN KK    C  P 
Sbjct  40   QLTPCAGAIIIGR-SPSAACCSRLKEQQPCLCTYARDPNLQRYVNSPNGKKAMAACKVPV  98

Query  323  PRC  315
            P C
Sbjct  99   PSC  101



>emb|CDM81736.1| unnamed protein product [Triticum aestivum]
Length=98

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = -3

Query  530  TEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQ-RPCLCKYMKDPRLQRFIASPNAK  354
             EA TC+P QL+PCA AI   N +PS  CC KLK     CLCKY KDP LQR++ SP+ K
Sbjct  27   VEAATCSPTQLTPCAPAIIG-NAAPSAACCGKLKAHPASCLCKYKKDPNLQRYVNSPSGK  85

Query  353  KVANTCGSPFPRC  315
            KV   C    P C
Sbjct  86   KVFTACKLRLPSC  98



>ref|XP_010474155.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=102

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
             VTC+  QL PC  AIT     PS  CC+KL EQ+ CLC + K+P   ++I+SPN++KV 
Sbjct  34   GVTCDARQLQPCLAAITGGG-QPSGACCAKLTEQQSCLCGFAKNPAFAQYISSPNSRKVL  92

Query  344  NTCGSPFPRC  315
              CG  +P C
Sbjct  93   AACGVAYPTC  102



>ref|XP_003558992.1| PREDICTED: non-specific lipid-transfer protein 2P-like [Brachypodium 
distachyon]
Length=95

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = -3

Query  515  CNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVANTC  336
            CN  QLS CA AITS  + PS  CCS L+ Q+ CLC+Y KDP   R+I+SP A++   +C
Sbjct  30   CNAGQLSVCAVAITS-GSPPSAECCSNLRAQQGCLCQYAKDPNYGRYISSPYARQTVASC  88

Query  335  GSPFPRC  315
            G P P+C
Sbjct  89   GIPVPKC  95



>ref|XP_010511588.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=102

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
             VTC+  QL PC  AIT     PS  CC+KL EQ+ CLC + K+P   ++I+SPN++KV 
Sbjct  34   GVTCDARQLQPCLAAITGGG-QPSGACCAKLTEQQSCLCGFAKNPAFAQYISSPNSRKVL  92

Query  344  NTCGSPFPRC  315
              CG  +P C
Sbjct  93   AACGVAYPTC  102



>ref|XP_004961318.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Setaria italica]
Length=101

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQ-RPCLCKYMKDPRLQRFIASPNAKKV  348
            A TC P QL+PCA AI   N +PS  CC+KL+     C C+Y KDP ++R++ SPN KKV
Sbjct  32   ATTCTPTQLTPCAPAIV-GNAAPSAACCAKLRAHPASCFCQYKKDPNMKRYVNSPNGKKV  90

Query  347  ANTCGSPFPRC  315
               C  P PRC
Sbjct  91   FAACKVPLPRC  101



>gb|EAY75443.1| hypothetical protein OsI_03343 [Oryza sativa Indica Group]
Length=212

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -3

Query  551  GASKVEVTEAVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFI  372
            GAS+     A  C+PL L PCA AI     +PS  CC+ L+ Q+ CLC+Y K+P L+++I
Sbjct  135  GASRTAPAAATKCDPLALRPCAAAILWGE-APSTACCAGLRAQKRCLCRYAKNPDLRKYI  193

Query  371  ASPNAKKVANTCGSPFPRC  315
             S N++KVA  C  P PRC
Sbjct  194  NSQNSRKVAAACSVPAPRC  212


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = -3

Query  515  CNPLQLSPCATAITS-SNTSPSPVCCSKLKEQ-RPCLCKYMKDPRLQRFIASPNAKKVAN  342
            C+ +QLSPC +A +     SPS  CCSKLK Q   CLC Y  DP+++R ++S   K+V  
Sbjct  44   CDLMQLSPCVSAFSGVGQGSPSSACCSKLKAQGSSCLCLYKDDPKVKRIVSSNRTKRVFT  103

Query  341  TC  336
             C
Sbjct  104  AC  105



>gb|KFK41090.1| hypothetical protein AALP_AA2G084400 [Arabis alpina]
Length=102

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = -3

Query  518  TCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVANT  339
             C+  QL PC +AIT     PS  CC+KLKEQ+PCLC + K P   ++I+SPN++KV   
Sbjct  36   ACDASQLQPCLSAITGGG-QPSGACCAKLKEQQPCLCGFAKIPAFAQYISSPNSRKVLAA  94

Query  338  CGSPFPRC  315
            CG  +P C
Sbjct  95   CGVAYPSC  102



>ref|XP_010419026.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=102

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKKVA  345
             VTC+  QL PC  AIT     PS  CC+KL EQ+ CLC + K+P   ++I+SPN++KV 
Sbjct  34   GVTCDARQLQPCLAAITGGG-QPSGECCAKLTEQQSCLCGFAKNPAFAQYISSPNSRKVL  92

Query  344  NTCGSPFPRC  315
              CG  +P C
Sbjct  93   AACGVAYPTC  102



>gb|ACU14682.1| unknown [Glycine max]
Length=85

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -3

Query  524  AVTCNPLQLSPCATAITSSNTSPSPVCCSKLKEQRPCLCKYMKDPRLQRFIASPNAKK  351
            AVTCNP QL+P   AI S  ++PS  CC KLKEQ+PC C Y+K+P L++++ SPNAKK
Sbjct  27   AVTCNPTQLTPRLPAINSG-SAPSSACCQKLKEQKPCFCGYLKNPSLKQYVNSPNAKK  83



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1133412046677