BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10785

Length=645
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009598786.1|  PREDICTED: ubiquitin domain-containing prote...    185   7e-56   Nicotiana tomentosiformis
ref|XP_010242133.1|  PREDICTED: ubiquitin domain-containing prote...    181   2e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010248381.1|  PREDICTED: ubiquitin domain-containing prote...    178   3e-53   Nelumbo nucifera [Indian lotus]
ref|XP_002285516.1|  PREDICTED: ubiquitin domain-containing prote...    178   3e-53   Vitis vinifera
gb|KDO51501.1|  hypothetical protein CISIN_1g033388mg                   177   6e-53   Citrus sinensis [apfelsine]
ref|XP_006442424.1|  hypothetical protein CICLE_v10022935mg             177   8e-53   Citrus clementina [clementine]
ref|XP_012091829.1|  PREDICTED: ubiquitin domain-containing prote...    176   2e-52   Jatropha curcas
ref|XP_002267858.1|  PREDICTED: ubiquitin domain-containing prote...    176   2e-52   Vitis vinifera
emb|CDO96864.1|  unnamed protein product                                176   2e-52   Coffea canephora [robusta coffee]
gb|AFK44107.1|  unknown                                                 176   3e-52   Lotus japonicus
ref|XP_010106574.1|  hypothetical protein L484_002639                   175   5e-52   Morus notabilis
ref|XP_006356096.1|  PREDICTED: ubiquitin domain-containing prote...    174   7e-52   Solanum tuberosum [potatoes]
ref|XP_004234078.1|  PREDICTED: ubiquitin domain-containing prote...    174   1e-51   Solanum lycopersicum
ref|XP_008226386.1|  PREDICTED: ubiquitin domain-containing prote...    174   1e-51   Prunus mume [ume]
emb|CDP06030.1|  unnamed protein product                                174   1e-51   Coffea canephora [robusta coffee]
gb|AFK43379.1|  unknown                                                 174   2e-51   Lotus japonicus
ref|XP_011085320.1|  PREDICTED: ubiquitin domain-containing prote...    173   2e-51   Sesamum indicum [beniseed]
ref|NP_001238246.1|  uncharacterized protein LOC100306399               173   3e-51   Glycine max [soybeans]
ref|XP_002522262.1|  DNA binding protein, putative                      177   3e-51   
ref|XP_003596315.1|  Ubiquitin domain-containing protein                173   4e-51   Medicago truncatula
ref|XP_003540499.1|  PREDICTED: ubiquitin domain-containing prote...    173   4e-51   Glycine max [soybeans]
ref|XP_007021914.1|  Ubiquitin domain-containing protein                172   5e-51   
ref|XP_002317449.1|  hypothetical protein POPTR_0011s10900g             172   7e-51   Populus trichocarpa [western balsam poplar]
ref|XP_009342907.1|  PREDICTED: ubiquitin domain-containing prote...    172   9e-51   Pyrus x bretschneideri [bai li]
ref|XP_011101437.1|  PREDICTED: ubiquitin domain-containing prote...    171   1e-50   Sesamum indicum [beniseed]
ref|XP_012074542.1|  PREDICTED: ubiquitin domain-containing prote...    171   1e-50   Jatropha curcas
ref|XP_006358096.1|  PREDICTED: ubiquitin domain-containing prote...    171   1e-50   Solanum tuberosum [potatoes]
ref|XP_007213986.1|  hypothetical protein PRUPE_ppa013589mg             171   1e-50   Prunus persica
gb|KJB13007.1|  hypothetical protein B456_002G050900                    171   3e-50   Gossypium raimondii
ref|XP_010924711.1|  PREDICTED: ubiquitin domain-containing prote...    171   3e-50   Elaeis guineensis
ref|XP_007149564.1|  hypothetical protein PHAVU_005G080900g             171   3e-50   Phaseolus vulgaris [French bean]
ref|XP_002524525.1|  Ubiquitin domain-containing protein, putative      171   3e-50   Ricinus communis
ref|XP_009334023.1|  PREDICTED: ubiquitin domain-containing prote...    170   3e-50   Pyrus x bretschneideri [bai li]
ref|XP_009410882.1|  PREDICTED: ubiquitin domain-containing prote...    169   9e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG06553.1|  Ubiquitin domain-containing 1                           169   1e-49   Gossypium arboreum [tree cotton]
gb|ACD56622.1|  predicted protein                                       169   1e-49   Gossypium raimondii
ref|XP_008463752.1|  PREDICTED: ubiquitin domain-containing prote...    168   2e-49   Cucumis melo [Oriental melon]
ref|XP_009778950.1|  PREDICTED: ubiquitin domain-containing prote...    168   2e-49   Nicotiana sylvestris
ref|XP_006392791.1|  hypothetical protein EUTSA_v10011877mg             168   3e-49   Eutrema salsugineum [saltwater cress]
ref|XP_004233078.1|  PREDICTED: ubiquitin domain-containing prote...    168   3e-49   Solanum lycopersicum
ref|XP_004294149.1|  PREDICTED: ubiquitin domain-containing prote...    168   3e-49   Fragaria vesca subsp. vesca
ref|XP_004146021.1|  PREDICTED: ubiquitin domain-containing prote...    168   3e-49   Cucumis sativus [cucumbers]
ref|XP_009590966.1|  PREDICTED: ubiquitin domain-containing prote...    167   4e-49   Nicotiana tomentosiformis
ref|XP_004137230.1|  PREDICTED: ubiquitin domain-containing prote...    167   5e-49   Cucumis sativus [cucumbers]
ref|XP_010916698.1|  PREDICTED: ubiquitin domain-containing prote...    167   5e-49   Elaeis guineensis
emb|CDY60203.1|  BnaCnng35820D                                          167   6e-49   Brassica napus [oilseed rape]
ref|XP_006370109.1|  hypothetical protein POPTR_0001s39570g             167   6e-49   Populus trichocarpa [western balsam poplar]
ref|XP_008792318.1|  PREDICTED: ubiquitin domain-containing prote...    167   6e-49   Phoenix dactylifera
ref|XP_009590967.1|  PREDICTED: ubiquitin domain-containing prote...    167   8e-49   Nicotiana tomentosiformis
ref|XP_009778951.1|  PREDICTED: ubiquitin domain-containing prote...    167   8e-49   Nicotiana sylvestris
ref|XP_006304315.1|  hypothetical protein CARUB_v10010694mg             166   1e-48   Capsella rubella
ref|XP_009590969.1|  PREDICTED: ubiquitin domain-containing prote...    166   2e-48   Nicotiana tomentosiformis
ref|XP_011082777.1|  PREDICTED: ubiquitin domain-containing prote...    166   2e-48   
ref|XP_011002754.1|  PREDICTED: ubiquitin domain-containing prote...    166   2e-48   Populus euphratica
ref|XP_008451743.1|  PREDICTED: ubiquitin domain-containing prote...    166   2e-48   
ref|XP_009778952.1|  PREDICTED: ubiquitin domain-containing prote...    166   2e-48   Nicotiana sylvestris
ref|XP_009144772.1|  PREDICTED: ubiquitin domain-containing prote...    166   2e-48   Brassica rapa
ref|XP_007025303.1|  DNA binding protein, putative                      165   4e-48   
ref|XP_004489012.1|  PREDICTED: ubiquitin domain-containing prote...    165   6e-48   Cicer arietinum [garbanzo]
ref|XP_010462233.1|  PREDICTED: ubiquitin domain-containing prote...    164   7e-48   Camelina sativa [gold-of-pleasure]
ref|NP_564630.1|  ubiquitin domain-containing protein                   164   9e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010057131.1|  PREDICTED: ubiquitin domain-containing prote...    164   1e-47   Eucalyptus grandis [rose gum]
gb|ABK21076.1|  unknown                                                 163   2e-47   Picea sitchensis
ref|XP_010542324.1|  PREDICTED: ubiquitin domain-containing prote...    163   2e-47   Tarenaya hassleriana [spider flower]
ref|XP_009394161.1|  PREDICTED: ubiquitin domain-containing prote...    162   4e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB61567.1|  hypothetical protein B456_009G366700                    162   5e-47   Gossypium raimondii
ref|XP_011082776.1|  PREDICTED: ubiquitin domain-containing prote...    162   7e-47   Sesamum indicum [beniseed]
ref|XP_009590968.1|  PREDICTED: ubiquitin domain-containing prote...    161   1e-46   Nicotiana tomentosiformis
gb|KFK35732.1|  hypothetical protein AALP_AA4G029400                    161   1e-46   Arabis alpina [alpine rockcress]
ref|XP_009590970.1|  PREDICTED: ubiquitin domain-containing prote...    161   1e-46   Nicotiana tomentosiformis
ref|XP_012091830.1|  PREDICTED: ubiquitin domain-containing prote...    160   2e-46   Jatropha curcas
ref|NP_001288925.1|  ubiquitin domain-containing protein 1-like         160   4e-46   Brassica rapa
emb|CDY24099.1|  BnaA06g00970D                                          157   4e-45   Brassica napus [oilseed rape]
gb|KJB57379.1|  hypothetical protein B456_009G160000                    157   5e-45   Gossypium raimondii
ref|XP_009394159.1|  PREDICTED: ubiquitin domain-containing prote...    157   5e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB61568.1|  hypothetical protein B456_009G366700                    157   6e-45   Gossypium raimondii
ref|XP_004956627.1|  PREDICTED: ubiquitin domain-containing prote...    156   9e-45   Setaria italica
gb|ACG32626.1|  ubiquitin domain containing 1                           155   2e-44   Zea mays [maize]
ref|XP_008359363.1|  PREDICTED: ubiquitin domain-containing prote...    156   2e-44   
ref|NP_001151929.1|  ubiquitin domain containing 1                      155   3e-44   Zea mays [maize]
gb|KHN36901.1|  Ubiquitin domain-containing protein 2                   156   4e-44   Glycine soja [wild soybean]
gb|KJB13011.1|  hypothetical protein B456_002G050900                    154   5e-44   Gossypium raimondii
ref|XP_006660552.1|  PREDICTED: ubiquitin domain-containing prote...    154   7e-44   Oryza brachyantha
ref|XP_010665504.1|  PREDICTED: ubiquitin domain-containing prote...    154   1e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001771101.1|  predicted protein                                  154   1e-43   
ref|XP_003568047.1|  PREDICTED: ubiquitin domain-containing prote...    153   1e-43   Brachypodium distachyon [annual false brome]
gb|KJB57380.1|  hypothetical protein B456_009G160000                    152   3e-43   Gossypium raimondii
ref|NP_199386.2|  ubiquitin domain-containing protein                   152   3e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114392.1|  PREDICTED: ubiquitin domain-containing prote...    152   4e-43   Brassica rapa
ref|XP_009605607.1|  PREDICTED: ubiquitin domain-containing prote...    152   4e-43   Nicotiana tomentosiformis
ref|XP_003578004.1|  PREDICTED: ubiquitin domain-containing prote...    152   5e-43   Brachypodium distachyon [annual false brome]
ref|XP_001781153.1|  predicted protein                                  152   6e-43   
ref|XP_010529214.1|  PREDICTED: ubiquitin domain-containing prote...    150   1e-42   Tarenaya hassleriana [spider flower]
ref|XP_010518821.1|  PREDICTED: ubiquitin domain-containing prote...    150   2e-42   Tarenaya hassleriana [spider flower]
ref|XP_010542322.1|  PREDICTED: ubiquitin domain-containing prote...    151   2e-42   Tarenaya hassleriana [spider flower]
ref|NP_001062935.1|  Os09g0345000                                       150   3e-42   
gb|KJB61569.1|  hypothetical protein B456_009G366700                    150   5e-42   Gossypium raimondii
ref|XP_009803993.1|  PREDICTED: ubiquitin domain-containing prote...    149   7e-42   Nicotiana sylvestris
ref|XP_009388696.1|  PREDICTED: ubiquitin domain-containing prote...    149   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW74164.1|  hypothetical protein EUGRSUZ_E02802                     149   2e-41   Eucalyptus grandis [rose gum]
ref|XP_002462254.1|  hypothetical protein SORBIDRAFT_02g022530          147   3e-41   Sorghum bicolor [broomcorn]
ref|XP_006348320.1|  PREDICTED: ubiquitin domain-containing prote...    147   3e-41   Solanum tuberosum [potatoes]
ref|NP_001152582.1|  dendritic cell-derived ubiquitin-like protein      147   5e-41   Zea mays [maize]
ref|XP_009147606.1|  PREDICTED: ubiquitin domain-containing prote...    145   1e-40   Brassica rapa
dbj|BAK00036.1|  predicted protein                                      145   2e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU29533.1|  hypothetical protein MIMGU_mgv1a016597mg                144   4e-40   Erythranthe guttata [common monkey flower]
ref|XP_002863459.1|  hypothetical protein ARALYDRAFT_916885             144   4e-40   
ref|XP_009114393.1|  PREDICTED: ubiquitin domain-containing prote...    144   6e-40   Brassica rapa
ref|XP_004244286.1|  PREDICTED: ubiquitin domain-containing prote...    144   6e-40   Solanum lycopersicum
gb|KJB68830.1|  hypothetical protein B456_011G036700                    142   2e-39   Gossypium raimondii
dbj|BAB09216.1|  unnamed protein product                                139   2e-38   Arabidopsis thaliana [mouse-ear cress]
gb|KCW74157.1|  hypothetical protein EUGRSUZ_E02790                     139   2e-38   Eucalyptus grandis [rose gum]
ref|XP_010498035.1|  PREDICTED: ubiquitin domain-containing prote...    140   3e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006416755.1|  hypothetical protein EUTSA_v10009149mg             139   4e-38   Eutrema salsugineum [saltwater cress]
ref|NP_173140.1|  ubiquitin domain-containing protein                   139   5e-38   Arabidopsis thaliana [mouse-ear cress]
gb|KFK43908.1|  hypothetical protein AALP_AA1G189600                    139   7e-38   Arabis alpina [alpine rockcress]
ref|XP_006304316.1|  hypothetical protein CARUB_v10010695mg             139   7e-38   Capsella rubella
ref|XP_010459254.1|  PREDICTED: ubiquitin domain-containing prote...    139   8e-38   Camelina sativa [gold-of-pleasure]
gb|AFW78775.1|  hypothetical protein ZEAMMB73_124051                    139   8e-38   
ref|XP_004961420.1|  PREDICTED: ubiquitin domain-containing prote...    138   1e-37   Setaria italica
emb|CDX96797.1|  BnaA08g23400D                                          138   1e-37   
emb|CDX83930.1|  BnaC08g17150D                                          138   2e-37   
ref|XP_010494699.1|  PREDICTED: ubiquitin domain-containing prote...    138   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009110431.1|  PREDICTED: ubiquitin domain-containing prote...    137   2e-37   Brassica rapa
ref|XP_006398257.1|  hypothetical protein EUTSA_v10001078mg             137   2e-37   Eutrema salsugineum [saltwater cress]
ref|XP_001777174.1|  predicted protein                                  136   3e-37   
ref|XP_002890195.1|  predicted protein                                  137   4e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_006377742.1|  hypothetical protein POPTR_0011s10900g             135   5e-37   
ref|XP_006442423.1|  hypothetical protein CICLE_v10022935mg             136   6e-37   
ref|XP_006282209.1|  hypothetical protein CARUB_v10028475mg             136   9e-37   Capsella rubella
ref|XP_010481536.1|  PREDICTED: ubiquitin domain-containing prote...    135   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010537717.1|  PREDICTED: ubiquitin domain-containing prote...    135   2e-36   Tarenaya hassleriana [spider flower]
ref|XP_002440118.1|  hypothetical protein SORBIDRAFT_09g026390          135   2e-36   
ref|XP_010441674.1|  PREDICTED: ubiquitin domain-containing prote...    135   2e-36   Camelina sativa [gold-of-pleasure]
ref|NP_001044147.2|  Os01g0731000                                       134   3e-36   
ref|XP_004969844.1|  PREDICTED: ubiquitin domain-containing prote...    133   1e-35   Setaria italica
emb|CDM84088.1|  unnamed protein product                                130   8e-35   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002965986.1|  hypothetical protein SELMODRAFT_84425              130   8e-35   
ref|XP_002458445.1|  hypothetical protein SORBIDRAFT_03g033670          129   3e-34   Sorghum bicolor [broomcorn]
ref|XP_006654689.1|  PREDICTED: ubiquitin domain-containing prote...    129   5e-34   Oryza brachyantha
ref|XP_011629384.1|  PREDICTED: ubiquitin domain-containing prote...    127   8e-33   Amborella trichopoda
gb|EAY98782.1|  hypothetical protein OsI_20722                          125   1e-32   Oryza sativa Indica Group [Indian rice]
ref|NP_001056122.1|  Os05g0529400                                       124   2e-32   
ref|XP_006442422.1|  hypothetical protein CICLE_v10022935mg             121   2e-31   
ref|XP_002863457.1|  hypothetical protein ARALYDRAFT_356432             122   2e-31   Arabidopsis lyrata subsp. lyrata
gb|EMS59669.1|  hypothetical protein TRIUR3_28938                       122   3e-31   Triticum urartu
gb|ACF83822.1|  unknown                                                 119   7e-31   Zea mays [maize]
gb|EMT14520.1|  hypothetical protein F775_02090                         120   2e-30   
gb|EPS62363.1|  hypothetical protein M569_12428                         119   3e-30   Genlisea aurea
ref|XP_008775886.1|  PREDICTED: ubiquitin domain-containing prote...    117   4e-30   
emb|CDX81793.1|  BnaC08g38080D                                          117   3e-29   
gb|KDO51503.1|  hypothetical protein CISIN_1g033388mg                   115   5e-29   Citrus sinensis [apfelsine]
gb|KCW74156.1|  hypothetical protein EUGRSUZ_E02789                     113   2e-28   Eucalyptus grandis [rose gum]
gb|EMS50772.1|  hypothetical protein TRIUR3_13144                       115   4e-27   Triticum urartu
gb|KDD73802.1|  hypothetical protein H632_c1825p0                       108   8e-26   Helicosporidium sp. ATCC 50920
ref|XP_010057132.1|  PREDICTED: ubiquitin domain-containing prote...    105   2e-25   Eucalyptus grandis [rose gum]
ref|XP_004961419.1|  PREDICTED: ubiquitin domain-containing prote...    106   8e-25   
ref|XP_005648130.1|  hypothetical protein COCSUDRAFT_53398              105   9e-25   Coccomyxa subellipsoidea C-169
ref|XP_002950807.1|  hypothetical protein VOLCADRAFT_117710             103   2e-24   Volvox carteri f. nagariensis
ref|XP_001692964.1|  predicted protein                                  102   4e-24   Chlamydomonas reinhardtii
ref|XP_010057136.1|  PREDICTED: ubiquitin domain-containing prote...    100   2e-23   
ref|XP_005849198.1|  hypothetical protein CHLNCDRAFT_15068            97.8    2e-22   Chlorella variabilis
tpg|DAA57774.1|  TPA: hypothetical protein ZEAMMB73_055287            96.3    7e-22   
ref|XP_008386272.1|  PREDICTED: ubiquitin domain-containing prote...  94.0    4e-21   
emb|CDY23106.1|  BnaC09g18600D                                        94.7    9e-21   Brassica napus [oilseed rape]
ref|XP_011396424.1|  Ubiquitin domain-containing protein 2            94.0    1e-19   Auxenochlorella protothecoides
ref|XP_005100742.1|  PREDICTED: ubiquitin domain-containing prote...  90.5    2e-18   Aplysia californica
ref|XP_005809738.1|  PREDICTED: ubiquitin domain-containing prote...  90.5    2e-18   Xiphophorus maculatus
gb|KDO51505.1|  hypothetical protein CISIN_1g033388mg                 86.7    3e-18   Citrus sinensis [apfelsine]
gb|EPS61683.1|  hypothetical protein M569_13111                       85.5    4e-18   Genlisea aurea
gb|EMT14035.1|  hypothetical protein F775_17688                       85.5    6e-18   
gb|EMS54409.1|  hypothetical protein TRIUR3_08628                     85.5    6e-18   Triticum urartu
ref|XP_011438543.1|  PREDICTED: ubiquitin domain-containing prote...  88.6    8e-18   Crassostrea gigas
emb|CDQ66769.1|  unnamed protein product                              88.2    1e-17   Oncorhynchus mykiss
ref|XP_009061457.1|  hypothetical protein LOTGIDRAFT_219753           87.8    2e-17   Lottia gigantea
ref|XP_003814039.2|  PREDICTED: ubiquitin domain-containing prote...  87.8    2e-17   Pan paniscus [bonobo]
ref|XP_008436137.1|  PREDICTED: ubiquitin domain-containing prote...  87.4    3e-17   Poecilia reticulata
ref|XP_007560140.1|  PREDICTED: ubiquitin domain-containing prote...  87.0    3e-17   Poecilia formosa
gb|KIY94710.1|  Ubiquitin domain-containing protein 1                 84.7    4e-17   Monoraphidium neglectum
gb|ERM97652.1|  hypothetical protein AMTR_s00130p00065830             84.7    5e-17   Amborella trichopoda
ref|XP_011471780.1|  PREDICTED: ubiquitin domain-containing prote...  86.7    5e-17   Oryzias latipes [Japanese rice fish]
ref|XP_011438542.1|  PREDICTED: ubiquitin domain-containing prote...  86.7    5e-17   Crassostrea gigas
ref|XP_011952113.1|  PREDICTED: ubiquitin domain-containing prote...  86.3    5e-17   
ref|XP_010863435.1|  PREDICTED: ubiquitin domain-containing prote...  86.3    6e-17   Esox lucius
ref|XP_007249616.1|  PREDICTED: ubiquitin domain-containing prote...  86.3    6e-17   Astyanax mexicanus [blind cave fish]
gb|EPQ15870.1|  Ubiquitin domain-containing protein 2                 85.9    1e-16   Myotis brandtii
ref|NP_001025436.1|  ubiquitin domain-containing protein 1            85.5    1e-16   Danio rerio [leopard danio]
gb|AAI52595.1|  Zgc:114107 protein                                    85.5    1e-16   Danio rerio [leopard danio]
ref|XP_004086848.1|  PREDICTED: ubiquitin domain-containing prote...  85.5    1e-16   Oryzias latipes [Japanese rice fish]
ref|XP_008508047.1|  PREDICTED: ubiquitin domain-containing prote...  85.5    1e-16   Equus przewalskii [Przewalski horse]
ref|XP_009572659.1|  PREDICTED: ubiquitin domain-containing prote...  83.6    2e-16   Fulmarus glacialis
ref|XP_004342961.2|  ubiquitin domain-containing protein 1            85.5    2e-16   Capsaspora owczarzaki ATCC 30864
ref|XP_006630307.1|  PREDICTED: ubiquitin domain-containing prote...  84.7    2e-16   Lepisosteus oculatus
gb|ELT93596.1|  hypothetical protein CAPTEDRAFT_211288                84.7    2e-16   Capitella teleta
ref|XP_005156917.1|  PREDICTED: ubiquitin domain-containing prote...  84.7    2e-16   Danio rerio [leopard danio]
ref|XP_008345167.1|  PREDICTED: uncharacterized protein LOC103408081  83.6    2e-16   
ref|XP_002194670.1|  PREDICTED: ubiquitin domain-containing prote...  84.3    3e-16   Taeniopygia guttata
ref|XP_005474203.1|  PREDICTED: ubiquitin domain-containing prote...  84.3    3e-16   
emb|CAF92823.1|  unnamed protein product                              84.0    3e-16   Tetraodon nigroviridis
pdb|2KSN|A  Chain A, Solution Structure Of The N-Terminal Domain ...  82.4    3e-16   Homo sapiens [man]
ref|NP_001082870.1|  ubiquitin domain-containing protein 1            84.3    3e-16   Danio rerio [leopard danio]
ref|NP_001002718.1|  ubiquitin domain-containing protein 2            84.3    3e-16   
emb|CDQ74823.1|  unnamed protein product                              84.3    3e-16   Oncorhynchus mykiss
ref|XP_005743936.1|  PREDICTED: ubiquitin domain-containing prote...  84.3    3e-16   Pundamilia nyererei
ref|XP_004555914.1|  PREDICTED: ubiquitin domain-containing prote...  84.3    4e-16   Maylandia zebra
ref|XP_005727904.1|  PREDICTED: ubiquitin domain-containing prote...  84.3    4e-16   Pundamilia nyererei
ref|XP_012009408.1|  PREDICTED: ubiquitin domain-containing prote...  84.0    4e-16   Ovis aries musimon
ref|XP_007419961.1|  PREDICTED: ubiquitin domain-containing prote...  84.0    4e-16   Python bivittatus
ref|XP_005926421.1|  PREDICTED: ubiquitin domain-containing prote...  84.3    4e-16   Haplochromis burtoni
ref|XP_003441085.2|  PREDICTED: ubiquitin domain-containing prote...  84.3    4e-16   Oreochromis niloticus
ref|XP_003218516.2|  PREDICTED: ubiquitin domain-containing prote...  84.0    4e-16   
gb|ETE68008.1|  Ubiquitin domain-containing protein 1                 84.0    4e-16   Ophiophagus hannah
ref|XP_011569817.1|  PREDICTED: ubiquitin domain-containing prote...  84.0    4e-16   Aquila chrysaetos canadensis
ref|XP_007231764.1|  PREDICTED: ubiquitin domain-containing prote...  84.0    4e-16   
gb|EPS68830.1|  hypothetical protein M569_05936                       80.1    4e-16   Genlisea aurea
gb|KFR13176.1|  Ubiquitin domain-containing protein 1                 82.8    4e-16   Opisthocomus hoazin [hoatzin]
gb|KCW74159.1|  hypothetical protein EUGRSUZ_E02796                   80.5    5e-16   Eucalyptus grandis [rose gum]
ref|XP_010590843.1|  PREDICTED: ubiquitin domain-containing prote...  83.6    5e-16   Loxodonta africana [African bush elephant]
gb|KFV14814.1|  Ubiquitin domain-containing protein 2                 82.4    6e-16   Tauraco erythrolophus
tpg|DAA52894.1|  TPA: hypothetical protein ZEAMMB73_802907            80.1    6e-16   
ref|XP_006053756.1|  PREDICTED: ubiquitin domain-containing prote...  83.6    6e-16   
ref|XP_010849608.1|  PREDICTED: ubiquitin domain-containing prote...  83.6    6e-16   Bison bison bison
ref|XP_002735307.1|  PREDICTED: ubiquitin domain-containing prote...  83.6    6e-16   Saccoglossus kowalevskii
ref|XP_005743937.1|  PREDICTED: ubiquitin domain-containing prote...  83.6    6e-16   Pundamilia nyererei
ref|XP_004550331.1|  PREDICTED: ubiquitin domain-containing prote...  84.3    6e-16   
ref|XP_004555915.1|  PREDICTED: ubiquitin domain-containing prote...  83.6    6e-16   Maylandia zebra
ref|XP_005743938.1|  PREDICTED: ubiquitin domain-containing prote...  83.2    6e-16   Pundamilia nyererei
ref|XP_004555916.1|  PREDICTED: ubiquitin domain-containing prote...  83.2    7e-16   Maylandia zebra
ref|XP_010867215.1|  PREDICTED: ubiquitin domain-containing prote...  83.2    7e-16   Esox lucius
ref|XP_005474204.1|  PREDICTED: ubiquitin domain-containing prote...  83.2    7e-16   Oreochromis niloticus
ref|XP_003447065.2|  PREDICTED: ubiquitin domain-containing prote...  84.3    7e-16   Oreochromis niloticus
ref|XP_006784976.1|  PREDICTED: ubiquitin domain-containing prote...  84.0    7e-16   Neolamprologus brichardi [lyretail cichlid]
ref|XP_010869485.1|  PREDICTED: ubiquitin domain-containing prote...  83.6    7e-16   Esox lucius
ref|XP_005474205.1|  PREDICTED: ubiquitin domain-containing prote...  83.2    7e-16   Oreochromis niloticus
ref|XP_003961581.1|  PREDICTED: ubiquitin domain-containing prote...  83.2    7e-16   Takifugu rubripes [tiger puffer]
ref|XP_010039800.1|  PREDICTED: uncharacterized protein LOC104428525  81.3    8e-16   
ref|XP_006138212.1|  PREDICTED: ubiquitin domain-containing prote...  83.2    8e-16   Pelodiscus sinensis [Chinese softshell turtle]
gb|KFV70528.1|  Ubiquitin domain-containing protein 2                 82.8    8e-16   Picoides pubescens
ref|NP_001005656.1|  ubiquitin domain-containing protein 1            83.2    9e-16   Xenopus tropicalis [western clawed frog]
ref|XP_003217388.1|  PREDICTED: ubiquitin domain-containing prote...  82.8    9e-16   Anolis carolinensis [Carolina anole]
ref|XP_005053812.1|  PREDICTED: ubiquitin domain-containing prote...  83.2    9e-16   
gb|KFP89545.1|  Ubiquitin domain-containing protein 2                 82.0    9e-16   Apaloderma vittatum
ref|XP_003971101.1|  PREDICTED: ubiquitin domain-containing prote...  83.2    9e-16   
ref|XP_008331476.1|  PREDICTED: ubiquitin domain-containing prote...  83.2    9e-16   Cynoglossus semilaevis [half-smooth tongue sole]
gb|KFQ09525.1|  Ubiquitin domain-containing protein 1                 82.4    1e-15   Leptosomus discolor
ref|XP_008320190.1|  PREDICTED: ubiquitin domain-containing prote...  83.2    1e-15   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_004076193.1|  PREDICTED: ubiquitin domain-containing prote...  83.2    1e-15   Oryzias latipes [Japanese rice fish]
ref|XP_008145831.1|  PREDICTED: ubiquitin domain-containing prote...  82.8    1e-15   Eptesicus fuscus
gb|KFO81424.1|  Ubiquitin domain-containing protein 2                 82.4    1e-15   Cuculus canorus
ref|XP_006270927.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
ref|XP_005418978.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
gb|KFM11925.1|  Ubiquitin domain-containing protein 2                 82.4    1e-15   Aptenodytes forsteri
ref|XP_006978936.1|  PREDICTED: ubiquitin domain-containing prote...  82.8    1e-15   Peromyscus maniculatus bairdii
gb|KFP22811.1|  Ubiquitin domain-containing protein 2                 82.4    1e-15   Egretta garzetta
gb|KFV43150.1|  Ubiquitin domain-containing protein 1                 82.4    1e-15   Tyto alba [Schleiereule]
gb|ELK28912.1|  Ubiquitin domain-containing protein 2                 82.4    1e-15   Myotis davidii
ref|XP_011481537.1|  PREDICTED: ubiquitin domain-containing prote...  83.2    1e-15   Oryzias latipes [Japanese rice fish]
gb|KFW03358.1|  Ubiquitin domain-containing protein 2                 82.4    1e-15   Eurypyga helias
ref|XP_009089942.1|  PREDICTED: ubiquitin domain-containing prote...  82.8    1e-15   
ref|XP_005520722.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   Pseudopodoces humilis [Tibetan ground-jay]
gb|KFP77975.1|  Ubiquitin domain-containing protein 2                 82.0    1e-15   Acanthisitta chloris
ref|XP_005492969.1|  PREDICTED: ubiquitin domain-containing prote...  82.8    1e-15   
ref|XP_005879430.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   Myotis brandtii
gb|KFO93307.1|  Ubiquitin domain-containing protein 2                 82.0    1e-15   Buceros rhinoceros silvestris
ref|XP_005298104.1|  PREDICTED: ubiquitin domain-containing prote...  82.8    1e-15   Chrysemys picta bellii
ref|XP_008930161.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
ref|XP_007553444.1|  PREDICTED: ubiquitin domain-containing prote...  82.8    1e-15   Poecilia formosa
gb|KFO55577.1|  Ubiquitin domain-containing protein 2                 82.0    1e-15   Corvus brachyrhynchos
ref|XP_429403.3|  PREDICTED: ubiquitin domain-containing protein 1    82.8    1e-15   Gallus gallus [bantam]
ref|XP_009670015.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   Struthio camelus australis
gb|KFV06570.1|  Ubiquitin domain-containing protein 2                 82.0    1e-15   Pterocles gutturalis
gb|KFO14907.1|  Ubiquitin domain-containing protein 2                 82.0    1e-15   Balearica regulorum gibbericeps
ref|XP_005938084.1|  PREDICTED: ubiquitin domain-containing prote...  82.8    1e-15   Haplochromis burtoni
ref|XP_005721830.1|  PREDICTED: ubiquitin domain-containing prote...  82.8    1e-15   Pundamilia nyererei
ref|XP_006884413.1|  PREDICTED: ubiquitin domain-containing prote...  82.8    1e-15   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|KFV72925.1|  Ubiquitin domain-containing protein 2                 82.0    1e-15   Struthio camelus australis
gb|KFQ39247.1|  Ubiquitin domain-containing protein 1                 82.4    1e-15   Mesitornis unicolor
ref|XP_008297192.1|  PREDICTED: ubiquitin domain-containing prote...  82.8    1e-15   Stegastes partitus
gb|KGL80339.1|  Ubiquitin domain-containing protein 2                 82.0    1e-15   Tinamus guttatus
gb|KFZ54299.1|  Ubiquitin domain-containing protein 1                 82.4    1e-15   
ref|XP_008253612.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
gb|EPY72618.1|  ubiquitin domain-containing protein 2                 82.4    1e-15   
ref|XP_007903901.1|  PREDICTED: ubiquitin domain-containing prote...  82.8    1e-15   
gb|KFO86395.1|  Ubiquitin domain-containing protein 1                 82.0    1e-15   
ref|XP_009070531.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
ref|XP_007437745.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
ref|XP_005523739.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
ref|XP_006021152.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
gb|AEZ68581.1|  UBTD1-like protein                                    82.8    1e-15   
gb|EOB08344.1|  Ubiquitin domain-containing protein 2                 82.4    1e-15   
ref|XP_005879429.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
ref|XP_006765454.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
gb|KFQ39815.1|  Ubiquitin domain-containing protein 2                 82.0    1e-15   
ref|XP_002407333.1|  ubiquitin domain-containing protein, putative    82.4    1e-15   
ref|XP_006807330.1|  PREDICTED: ubiquitin domain-containing prote...  82.8    1e-15   
ref|XP_003438588.1|  PREDICTED: ubiquitin domain-containing prote...  82.8    1e-15   
gb|KFO98304.1|  Ubiquitin domain-containing protein 1                 82.0    1e-15   
gb|KFP67580.1|  Ubiquitin domain-containing protein 1                 82.0    1e-15   
gb|KFP39592.1|  Ubiquitin domain-containing protein 1                 82.0    1e-15   
ref|XP_008425700.1|  PREDICTED: ubiquitin domain-containing prote...  82.8    1e-15   
ref|XP_010768236.1|  PREDICTED: ubiquitin domain-containing prote...  82.8    1e-15   
gb|KFV74627.1|  Ubiquitin domain-containing protein 1                 82.0    1e-15   
gb|KFQ73465.1|  Ubiquitin domain-containing protein 1                 82.0    1e-15   
ref|XP_008301257.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
ref|XP_010752847.1|  PREDICTED: ubiquitin domain-containing prote...  82.8    1e-15   
ref|XP_004557669.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
ref|XP_004644899.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
gb|KFM06535.1|  Ubiquitin domain-containing protein 1                 82.0    1e-15   
gb|KFQ91195.1|  Ubiquitin domain-containing protein 1                 82.0    1e-15   
ref|XP_008938866.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin do...  82.0    1e-15   
gb|EMC82610.1|  Ubiquitin domain-containing protein 2                 82.0    1e-15   
gb|KFU91484.1|  Ubiquitin domain-containing protein 1                 82.0    1e-15   
ref|XP_004665063.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
ref|XP_011253512.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
ref|XP_007520898.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
ref|XP_007937965.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
gb|KGL95466.1|  Ubiquitin domain-containing protein 1                 82.0    1e-15   
gb|KFO11994.1|  Ubiquitin domain-containing protein 1                 82.0    1e-15   
ref|XP_006159010.1|  PREDICTED: ubiquitin domain-containing prote...  83.2    1e-15   
ref|XP_006864873.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
ref|NP_001015679.1|  ubiquitin domain-containing protein 2            82.4    1e-15   
gb|KFW02053.1|  Ubiquitin domain-containing protein 1                 82.0    1e-15   
ref|XP_006631757.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
ref|XP_003781989.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
ref|XP_005509518.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
ref|XP_006053755.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
ref|XP_004428578.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
ref|XP_003404706.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
ref|NP_001087919.1|  ubiquitin domain-containing protein 1            82.4    1e-15   
gb|KFB44604.1|  hypothetical protein ZHAS_00012486                    81.6    1e-15   
ref|XP_001499678.3|  PREDICTED: ubiquitin domain-containing prote...  82.4    1e-15   
ref|XP_546238.2|  PREDICTED: ubiquitin domain-containing protein 2    82.4    1e-15   
ref|XP_005087054.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    2e-15   
gb|KFV03986.1|  Ubiquitin domain-containing protein 1                 82.0    2e-15   
ref|XP_007171416.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    2e-15   
ref|XP_005376395.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    2e-15   
ref|XP_005239075.1|  PREDICTED: ubiquitin domain-containing prote...  82.0    2e-15   
gb|ABN14992.1|  dendritic cell-derived ubiquitin                      82.0    2e-15   
ref|XP_004786589.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    2e-15   
ref|XP_971672.1|  PREDICTED: ubiquitin domain-containing protein 2    82.4    2e-15   
ref|XP_004272049.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    2e-15   
ref|XP_005350423.1|  PREDICTED: ubiquitin domain-containing prote...  82.0    2e-15   
gb|KFQ59180.1|  Ubiquitin domain-containing protein 1                 81.6    2e-15   
ref|NP_689490.2|  ubiquitin domain-containing protein 2               82.0    2e-15   
gb|KFP51166.1|  Ubiquitin domain-containing protein 1                 81.6    2e-15   
ref|XP_004890698.1|  PREDICTED: ubiquitin domain-containing prote...  82.0    2e-15   
gb|ETE71496.1|  Ubiquitin domain-containing protein 2                 82.4    2e-15   
ref|XP_011369272.1|  PREDICTED: ubiquitin domain-containing prote...  82.0    2e-15   
ref|XP_004738159.1|  PREDICTED: ubiquitin domain-containing prote...  82.0    2e-15   
ref|XP_008848988.1|  PREDICTED: ubiquitin domain-containing prote...  82.0    2e-15   
dbj|BAC36536.1|  unnamed protein product                              82.0    2e-15   
gb|EFN70128.1|  Ubiquitin domain-containing protein 2                 82.4    2e-15   
ref|XP_007899453.1|  PREDICTED: ubiquitin domain-containing prote...  82.0    2e-15   
ref|XP_010590842.1|  PREDICTED: ubiquitin domain-containing prote...  82.0    2e-15   
ref|XP_010620616.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    2e-15   
gb|EHH27031.1|  hypothetical protein EGK_17132                        82.0    2e-15   
ref|NP_776145.2|  ubiquitin domain-containing protein 2               82.0    2e-15   
ref|XP_011220232.1|  PREDICTED: ubiquitin domain-containing prote...  82.4    2e-15   
gb|ERE69520.1|  ubiquitin domain-containing protein 2                 82.4    2e-15   
ref|XP_007627894.1|  PREDICTED: ubiquitin domain-containing prote...  81.6    2e-15   
ref|XP_004679277.1|  PREDICTED: ubiquitin domain-containing prote...  82.0    2e-15   
ref|XP_010712905.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin do...  82.4    2e-15   
gb|ELR46551.1|  Ubiquitin domain-containing protein 2                 81.6    2e-15   
ref|XP_001945250.1|  PREDICTED: ubiquitin domain-containing prote...  82.0    2e-15   
ref|XP_003500877.1|  PREDICTED: ubiquitin domain-containing prote...  82.0    2e-15   
gb|EFB26818.1|  hypothetical protein PANDA_005111                     81.6    2e-15   
ref|XP_003473386.1|  PREDICTED: ubiquitin domain-containing prote...  82.0    2e-15   
ref|XP_429110.4|  PREDICTED: ubiquitin domain-containing protein ...  82.0    2e-15   
gb|KFP21470.1|  Ubiquitin domain-containing protein 1                 81.6    2e-15   
gb|EMC85443.1|  Ubiquitin domain-containing protein 1                 81.6    2e-15   
ref|XP_008690926.1|  PREDICTED: ubiquitin domain-containing prote...  82.0    2e-15   
gb|ELW48021.1|  Ubiquitin domain-containing protein 2                 83.2    2e-15   
ref|XP_005558582.1|  PREDICTED: ubiquitin domain-containing prote...  82.0    2e-15   
ref|XP_008320191.1|  PREDICTED: ubiquitin domain-containing prote...  82.0    2e-15   
ref|XP_005010060.1|  PREDICTED: ubiquitin domain-containing prote...  82.0    2e-15   
gb|KFO54343.1|  Ubiquitin domain-containing protein 1                 81.6    2e-15   
ref|XP_005992558.1|  PREDICTED: ubiquitin domain-containing prote...  82.0    2e-15   
ref|XP_003759042.1|  PREDICTED: ubiquitin domain-containing prote...  81.6    2e-15   
ref|NP_001095277.1|  ubiquitin domain containing 2                    82.0    2e-15   
ref|XP_008280607.1|  PREDICTED: ubiquitin domain-containing prote...  82.0    2e-15   
ref|XP_003359865.2|  PREDICTED: ubiquitin domain-containing prote...  82.0    2e-15   
ref|XP_009276326.1|  PREDICTED: ubiquitin domain-containing prote...  82.0    2e-15   
ref|XP_791272.1|  PREDICTED: ubiquitin domain-containing protein 2    81.6    2e-15   
gb|EHH54763.1|  hypothetical protein EGM_15660                        81.6    2e-15   
ref|XP_005048717.1|  PREDICTED: ubiquitin domain-containing prote...  81.3    2e-15   
gb|ETN60019.1|  ubiquitin domain-containing protein 1                 81.6    2e-15   
ref|XP_011143890.1|  PREDICTED: ubiquitin domain-containing prote...  81.6    3e-15   
ref|XP_011285021.1|  PREDICTED: ubiquitin domain-containing prote...  81.6    3e-15   
ref|XP_321338.3|  AGAP001747-PA                                       81.6    3e-15   
ref|XP_011871477.1|  PREDICTED: ubiquitin domain-containing prote...  81.6    3e-15   
ref|XP_011641207.1|  PREDICTED: ubiquitin domain-containing prote...  81.6    3e-15   
ref|XP_011702295.1|  PREDICTED: ubiquitin domain-containing prote...  81.6    3e-15   
ref|XP_011059627.1|  PREDICTED: ubiquitin domain-containing prote...  81.6    3e-15   
ref|XP_006221052.1|  PREDICTED: ubiquitin domain-containing prote...  82.0    3e-15   
ref|XP_012054244.1|  PREDICTED: ubiquitin domain-containing prote...  81.6    3e-15   
ref|XP_011166906.1|  PREDICTED: ubiquitin domain-containing prote...  81.6    3e-15   
ref|XP_008546181.1|  PREDICTED: ubiquitin domain-containing prote...  81.6    3e-15   
ref|XP_003490546.1|  PREDICTED: ubiquitin domain-containing prote...  81.6    3e-15   
ref|XP_625226.1|  PREDICTED: ubiquitin domain-containing protein ...  81.3    3e-15   
ref|XP_008765851.1|  PREDICTED: ubiquitin domain-containing prote...  81.6    3e-15   
ref|XP_005481653.1|  PREDICTED: ubiquitin domain-containing prote...  81.3    3e-15   
ref|XP_008488687.1|  PREDICTED: ubiquitin domain-containing prote...  81.6    3e-15   
ref|XP_003695877.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin do...  81.3    3e-15   
gb|KFQ55932.1|  Ubiquitin domain-containing protein 1                 80.9    4e-15   
ref|XP_010741207.1|  PREDICTED: ubiquitin domain-containing prote...  81.3    4e-15   
ref|XP_011329497.1|  PREDICTED: ubiquitin domain-containing prote...  81.3    4e-15   
ref|XP_001866797.1|  ubiquitin domain-containing protein 1            81.3    4e-15   
emb|CAG09366.1|  unnamed protein product                              81.3    4e-15   
gb|KFW76433.1|  Ubiquitin domain-containing protein 1                 80.9    4e-15   
ref|XP_002119609.1|  PREDICTED: ubiquitin domain-containing prote...  80.9    4e-15   
ref|XP_009078109.1|  PREDICTED: ubiquitin domain-containing prote...  80.5    4e-15   
emb|CDJ02761.1|  dendritic cell derived ubiquitin                     82.4    4e-15   
ref|XP_002096050.1|  GE25467                                          81.3    4e-15   
gb|KFP71012.1|  Ubiquitin domain-containing protein 1                 80.5    4e-15   
ref|XP_009085906.1|  PREDICTED: ubiquitin domain-containing prote...  81.6    4e-15   
gb|EZA60079.1|  Ubiquitin domain-containing protein                   80.9    4e-15   
emb|CDS15205.1|  dendritic cell derived ubiquitin                     82.4    4e-15   
ref|XP_001370505.2|  PREDICTED: ubiquitin domain-containing prote...  82.0    5e-15   
ref|XP_011302890.1|  PREDICTED: ubiquitin domain-containing prote...  80.9    5e-15   
ref|XP_001978921.1|  GG12804                                          80.9    5e-15   
ref|XP_003964183.2|  PREDICTED: ubiquitin domain-containing prote...  80.9    5e-15   
ref|XP_003708582.1|  PREDICTED: ubiquitin domain-containing prote...  80.9    5e-15   
ref|XP_002038403.1|  GM10807                                          80.9    5e-15   
ref|NP_649534.1|  CG1172, isoform A                                   80.9    5e-15   
ref|XP_005507094.1|  PREDICTED: ubiquitin domain-containing prote...  81.3    5e-15   
gb|KFO76581.1|  Ubiquitin domain-containing protein 1                 80.5    5e-15   
ref|XP_008932352.1|  PREDICTED: ubiquitin domain-containing prote...  80.5    5e-15   
ref|XP_008313028.1|  PREDICTED: ubiquitin domain-containing prote...  80.9    5e-15   
ref|XP_008642163.1|  PREDICTED: ubiquitin domain-containing prote...  80.5    7e-15   
ref|XP_001641344.1|  predicted protein                                80.1    7e-15   
ref|XP_003743671.1|  PREDICTED: ubiquitin domain-containing prote...  80.1    8e-15   
ref|XP_002072446.1|  GK22324                                          80.1    9e-15   
ref|XP_002591585.1|  hypothetical protein BRAFLDRAFT_271783           79.7    1e-14   
ref|XP_005417408.1|  PREDICTED: ubiquitin domain-containing prote...  80.1    1e-14   
ref|XP_011184001.1|  PREDICTED: ubiquitin domain-containing prote...  79.7    1e-14   
ref|XP_008427924.1|  PREDICTED: ubiquitin domain-containing prote...  79.7    1e-14   
ref|XP_001953346.1|  GF17251                                          79.7    1e-14   
ref|XP_007572697.1|  PREDICTED: ubiquitin domain-containing prote...  79.3    1e-14   
ref|XP_001994026.1|  GH17866                                          79.7    1e-14   
gb|EUB59162.1|  Ubiquitin domain-containing protein 2                 82.8    1e-14   
ref|XP_001998411.1|  GI23952                                          79.7    1e-14   
ref|XP_010735865.1|  PREDICTED: ubiquitin domain-containing prote...  79.7    1e-14   
ref|XP_011203782.1|  PREDICTED: ubiquitin domain-containing prote...  79.3    2e-14   
ref|XP_002056753.1|  GJ11109                                          79.3    2e-14   
ref|XP_005800473.1|  PREDICTED: ubiquitin domain-containing prote...  79.3    2e-14   
ref|XP_009030035.1|  hypothetical protein HELRODRAFT_186188           81.6    2e-14   
ref|XP_002426140.1|  ubiquitin domain-containing protein, putative    79.3    2e-14   
gb|KDR08629.1|  Ubiquitin domain-containing protein 1                 79.3    2e-14   
ref|XP_005189140.1|  PREDICTED: ubiquitin domain-containing prote...  79.3    2e-14   
ref|XP_008427923.1|  PREDICTED: ubiquitin domain-containing prote...  79.3    2e-14   
ref|XP_003429346.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin do...  79.0    2e-14   
dbj|GAA49415.1|  ubiquitin domain-containing protein 2                80.5    2e-14   
emb|CDQ77494.1|  unnamed protein product                              79.0    2e-14   
ref|XP_007572696.1|  PREDICTED: ubiquitin domain-containing prote...  79.3    2e-14   
ref|XP_002017185.1|  GL21661                                          79.0    2e-14   
ref|XP_004518059.1|  PREDICTED: ubiquitin domain-containing prote...  79.0    2e-14   
ref|XP_004518060.1|  PREDICTED: ubiquitin domain-containing prote...  79.0    2e-14   
gb|EHJ73620.1|  hypothetical protein KGM_03338                        78.6    3e-14   
ref|XP_003755275.1|  PREDICTED: ubiquitin domain-containing prote...  78.6    3e-14   
ref|XP_010735866.1|  PREDICTED: ubiquitin domain-containing prote...  78.6    3e-14   
ref|XP_011482789.1|  PREDICTED: ubiquitin domain-containing prote...  78.6    3e-14   
emb|CDS26142.1|  ubiquitin domain containing protein 2                82.0    3e-14   
gb|ERL84807.1|  hypothetical protein D910_02231                       78.6    3e-14   
gb|AEE62982.1|  unknown                                               78.6    3e-14   
gb|AGM32270.1|  ubiquitin domain-containing-like protein              77.8    3e-14   
gb|KGB35677.1|  Ubiquitin domain-containing protein 2                 81.6    4e-14   
emb|CCD79239.1|  hypothetical protein Smp_126810                      78.2    4e-14   
gb|AFW78774.1|  hypothetical protein ZEAMMB73_124051                  75.1    4e-14   
ref|XP_004077210.2|  PREDICTED: ubiquitin domain-containing prote...  78.2    4e-14   
ref|XP_004927142.1|  PREDICTED: ubiquitin domain-containing prote...  78.2    4e-14   
ref|XP_010042450.1|  PREDICTED: ubiquitin domain-containing prote...  75.1    5e-14   
ref|XP_004701082.1|  PREDICTED: ubiquitin domain-containing prote...  77.8    5e-14   
ref|XP_007874246.1|  hypothetical protein PNEG_02257                  77.8    5e-14   
ref|XP_007615410.1|  PREDICTED: ubiquitin domain-containing prote...  77.4    6e-14   
ref|XP_011558995.1|  PREDICTED: ubiquitin domain-containing prote...  77.4    7e-14   
ref|NP_001142458.1|  hypothetical protein                             75.1    7e-14   
ref|XP_002114581.1|  hypothetical protein TRIADDRAFT_28315            77.0    9e-14   
ref|XP_004332438.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin do...  76.6    1e-13   
ref|XP_005335372.1|  PREDICTED: ubiquitin domain-containing prote...  76.3    1e-13   
ref|XP_005885471.1|  PREDICTED: ubiquitin domain-containing prote...  76.3    1e-13   
ref|XP_005352345.1|  PREDICTED: ubiquitin domain-containing prote...  76.3    1e-13   
ref|XP_006090039.1|  PREDICTED: ubiquitin domain-containing prote...  76.3    1e-13   
gb|KFO34869.1|  Ubiquitin domain-containing protein 1                 76.3    1e-13   
ref|XP_008700789.1|  PREDICTED: ubiquitin domain-containing prote...  76.3    1e-13   
ref|XP_006738375.1|  PREDICTED: ubiquitin domain-containing prote...  76.3    2e-13   
ref|XP_004669963.1|  PREDICTED: ubiquitin domain-containing prote...  76.3    2e-13   
ref|XP_006157399.1|  PREDICTED: ubiquitin domain-containing prote...  76.3    2e-13   
ref|XP_005698442.1|  PREDICTED: ubiquitin domain-containing prote...  76.3    2e-13   
ref|XP_006756669.1|  PREDICTED: ubiquitin domain-containing prote...  76.3    2e-13   
ref|XP_008530075.1|  PREDICTED: ubiquitin domain-containing prote...  76.6    2e-13   
ref|XP_004457049.1|  PREDICTED: ubiquitin domain-containing prote...  76.3    2e-13   
ref|XP_007637685.1|  PREDICTED: ubiquitin domain-containing prote...  76.3    2e-13   
ref|XP_007938235.1|  PREDICTED: ubiquitin domain-containing prote...  76.3    2e-13   
ref|XP_004749613.1|  PREDICTED: ubiquitin domain-containing prote...  76.3    2e-13   
gb|EHH19272.1|  hypothetical protein EGK_19949                        76.3    2e-13   
ref|XP_010618716.1|  PREDICTED: ubiquitin domain-containing prote...  76.3    2e-13   
ref|XP_007187475.1|  PREDICTED: ubiquitin domain-containing prote...  76.3    2e-13   
ref|XP_004680625.1|  PREDICTED: ubiquitin domain-containing prote...  76.3    2e-13   
dbj|BAD96317.1|  ubiquitin domain containing 1 variant                76.3    2e-13   
ref|XP_004016916.1|  PREDICTED: ubiquitin domain-containing prote...  75.9    2e-13   



>ref|XP_009598786.1| PREDICTED: ubiquitin domain-containing protein 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009802295.1| PREDICTED: ubiquitin domain-containing protein 1-like [Nicotiana 
sylvestris]
Length=114

 Score =   185 bits (469),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SSRSKGD+TVKKIRKPKPWKHSEPITR QLVQMR+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSRSKGDETVKKIRKPKPWKHSEPITRAQLVQMRDEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            AAAEAD++LAQA VD AGIIVQ PDLT+CYDERGAKYELP+YVLSEPTNLI
Sbjct  61   AAAEADVSLAQAFVDSAGIIVQVPDLTICYDERGAKYELPKYVLSEPTNLI  111



>ref|XP_010242133.1| PREDICTED: ubiquitin domain-containing protein 1-like [Nelumbo 
nucifera]
Length=114

 Score =   181 bits (460),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS+SKGD+T+KKIRKPKPWKHS+PITR QL QMR+EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCAGSSQSKGDETIKKIRKPKPWKHSQPITRAQLAQMRDEFWDTAPHYGGQKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEADL LAQAIVD AG+IV + DLT CYDERGAKYELP+YVLSEPTNLIR+
Sbjct  61   AAAEADLTLAQAIVDSAGVIVTSADLTTCYDERGAKYELPKYVLSEPTNLIRN  113



>ref|XP_010248381.1| PREDICTED: ubiquitin domain-containing protein 1-like [Nelumbo 
nucifera]
Length=114

 Score =   178 bits (451),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS+SKGD++ KKIRKPKPWKHS+P+TR QL QMR EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCAGSSQSKGDESTKKIRKPKPWKHSQPLTRTQLRQMREEFWDTAPHYGGQKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEADL LAQAIVD AG+IV + DLT CYDERGAKYELP+YVLSEPTNLIRD
Sbjct  61   AAAEADLTLAQAIVDSAGVIVTSADLTTCYDERGAKYELPKYVLSEPTNLIRD  113



>ref|XP_002285516.1| PREDICTED: ubiquitin domain-containing protein 1 [Vitis vinifera]
 emb|CAN66729.1| hypothetical protein VITISV_025684 [Vitis vinifera]
 emb|CBI20170.3| unnamed protein product [Vitis vinifera]
Length=114

 Score =   178 bits (451),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS++KGD TVKKIRKPKPWK+ +P+T+ QL+QMR+EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCAGSSQTKGDGTVKKIRKPKPWKNPQPLTKTQLMQMRDEFWDTAPHYGGQKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG  179
            AAAEADL LAQAIVD AG+IVQ+ DLT+CYDERGAKYELP YVLSEPTNLIRDG
Sbjct  61   AAAEADLTLAQAIVDSAGVIVQSADLTICYDERGAKYELPHYVLSEPTNLIRDG  114



>gb|KDO51501.1| hypothetical protein CISIN_1g033388mg [Citrus sinensis]
Length=120

 Score =   177 bits (450),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS+SK D TVKKIRKPKPWKH +PIT+ QL+Q+R+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQSKADGTVKKIRKPKPWKHPQPITKSQLMQLRDEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG  179
            AAAEADL+LAQAIVD AG+IVQ+ DLT+CYDERGAKYELP+YVLSEPTNLIR+G
Sbjct  61   AAAEADLSLAQAIVDSAGVIVQSADLTICYDERGAKYELPKYVLSEPTNLIREG  114



>ref|XP_006442424.1| hypothetical protein CICLE_v10022935mg [Citrus clementina]
 ref|XP_006477863.1| PREDICTED: ubiquitin domain-containing protein 1-like [Citrus 
sinensis]
 gb|ESR55664.1| hypothetical protein CICLE_v10022935mg [Citrus clementina]
 gb|KDO51502.1| hypothetical protein CISIN_1g033388mg [Citrus sinensis]
Length=114

 Score =   177 bits (449),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS+SK D TVKKIRKPKPWKH +PIT+ QL+Q+R+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQSKADGTVKKIRKPKPWKHPQPITKSQLMQLRDEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG  179
            AAAEADL+LAQAIVD AG+IVQ+ DLT+CYDERGAKYELP+YVLSEPTNLIR+G
Sbjct  61   AAAEADLSLAQAIVDSAGVIVQSADLTICYDERGAKYELPKYVLSEPTNLIREG  114



>ref|XP_012091829.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X1 [Jatropha curcas]
 gb|KDP21140.1| hypothetical protein JCGZ_21611 [Jatropha curcas]
Length=115

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 106/114 (93%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDD-TVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDal  344
            MGC+ SSR+KGD+ T KKIRKPKPWKHSEPITR QL+Q+R+EFWDTAPHYGG+KEIWDAL
Sbjct  1    MGCSGSSRAKGDEQTKKKIRKPKPWKHSEPITRTQLLQLRDEFWDTAPHYGGRKEIWDAL  60

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
             AAAEADL LAQAIVD AG+IVQ+ DLT+CYDERGAKYELP+YVLSEPTNLIRD
Sbjct  61   HAAAEADLTLAQAIVDSAGVIVQSEDLTICYDERGAKYELPKYVLSEPTNLIRD  114



>ref|XP_002267858.1| PREDICTED: ubiquitin domain-containing protein 1 [Vitis vinifera]
 emb|CBI30724.3| unnamed protein product [Vitis vinifera]
Length=114

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGC  SSR+KGD++ KKIR+PKPWKHS+ +TR QL QMR+EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCTGSSRAKGDESSKKIRRPKPWKHSQALTRTQLKQMRDEFWDTAPHYGGQKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AA EADL LAQAIVD AG+IVQ+ DLT CYDERGAKYELP+YVLSEPTNLIRD
Sbjct  61   AATEADLTLAQAIVDSAGVIVQSADLTTCYDERGAKYELPKYVLSEPTNLIRD  113



>emb|CDO96864.1| unnamed protein product [Coffea canephora]
Length=113

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 104/113 (92%), Gaps = 1/113 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA  SR+K ++ VKKIRKPKPWKHSEPITR QLVQMR+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCA-GSRAKKEEPVKKIRKPKPWKHSEPITRAQLVQMRDEFWDTAPHYGGRKEIWDALR  59

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEADL LAQAI+D AGIIVQ PDLT+CYDERGAKYELPRYVLSEPTNLIR+
Sbjct  60   AAAEADLTLAQAIIDSAGIIVQNPDLTICYDERGAKYELPRYVLSEPTNLIRE  112



>gb|AFK44107.1| unknown [Lotus japonicus]
Length=114

 Score =   176 bits (445),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS+SK D T KKIRKPKPWKH +PITR QL+Q+R+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQSKADGTEKKIRKPKPWKHPQPITRTQLIQLRDEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEADL LAQAIVD AG+IVQ+ DLTVCYDERGAKYELP+YVLSEPTNLIRD
Sbjct  61   AAAEADLTLAQAIVDSAGVIVQSSDLTVCYDERGAKYELPKYVLSEPTNLIRD  113



>ref|XP_010106574.1| hypothetical protein L484_002639 [Morus notabilis]
 gb|EXC10785.1| hypothetical protein L484_002639 [Morus notabilis]
Length=114

 Score =   175 bits (444),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS++KGD TVKKIRKPKPWKH +PIT+ QL+Q+R EFWDTAPHYGG KEIWDAL 
Sbjct  1    MGCAGSSQAKGDGTVKKIRKPKPWKHPQPITKTQLMQLREEFWDTAPHYGGTKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEADL+LAQAIVD AG+IVQ+ DLT+CYDERGAKYELP+YVLSEPTNLI+D
Sbjct  61   AAAEADLSLAQAIVDSAGVIVQSADLTICYDERGAKYELPKYVLSEPTNLIQD  113



>ref|XP_006356096.1| PREDICTED: ubiquitin domain-containing protein 1-like [Solanum 
tuberosum]
Length=111

 Score =   174 bits (442),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 103/113 (91%), Gaps = 3/113 (3%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGC   S SK ++  K+IRKPKPWKHSEPITR QLVQMR+EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGC---SGSKENEAAKQIRKPKPWKHSEPITRAQLVQMRDEFWDTAPHYGGQKEIWDALR  57

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAE+D++LAQAIVD AGIIVQAPDLT+CYDERGAKYELP+YVLSEPTNLIRD
Sbjct  58   AAAESDISLAQAIVDSAGIIVQAPDLTICYDERGAKYELPKYVLSEPTNLIRD  110



>ref|XP_004234078.1| PREDICTED: ubiquitin domain-containing protein 1-like [Solanum 
lycopersicum]
Length=111

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 103/113 (91%), Gaps = 3/113 (3%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGC   S SK +D  K+IRKPKPWKHSEPITR QLVQMR+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGC---SGSKENDAAKQIRKPKPWKHSEPITRAQLVQMRDEFWDTAPHYGGRKEIWDALR  57

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAE+D++LAQAIVD AGIIVQAPDLT+CYDERGAKYELP+YVLSEPTNLIRD
Sbjct  58   AAAESDISLAQAIVDSAGIIVQAPDLTICYDERGAKYELPKYVLSEPTNLIRD  110



>ref|XP_008226386.1| PREDICTED: ubiquitin domain-containing protein 1 [Prunus mume]
Length=114

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS++KGD  +KK+RKPKPWKH +P+T+ QL+QMR EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQTKGDGALKKVRKPKPWKHPQPLTKSQLLQMREEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG  179
            AAAEADL+LAQAIVD AG+IVQ+ DLT+CYDERGAKYELP+YVLSEPTNLIR+G
Sbjct  61   AAAEADLSLAQAIVDSAGVIVQSVDLTICYDERGAKYELPKYVLSEPTNLIREG  114



>emb|CDP06030.1| unnamed protein product [Coffea canephora]
Length=114

 Score =   174 bits (440),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS++KGD + KKIRKPKPWKH +PIT  QLVQ+R EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQAKGDGSAKKIRKPKPWKHPQPITNSQLVQLREEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG  179
            AAAEAD+ LAQAIVD AG+I+Q PD+TVCYDERGAKYELP+YVLSEPTNLI++G
Sbjct  61   AAAEADINLAQAIVDSAGVIIQNPDMTVCYDERGAKYELPKYVLSEPTNLIQEG  114



>gb|AFK43379.1| unknown [Lotus japonicus]
Length=114

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS+SK D T KKIRKPKPWKH +PITR QL+Q+R+EFWDTAPH+GG+KEIWDAL 
Sbjct  1    MGCAGSSQSKADGTEKKIRKPKPWKHPQPITRTQLIQLRDEFWDTAPHHGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEADL LAQAIVD AG+IVQ+ DLTVCYDERGAKYELP+YVLSEPTNLIRD
Sbjct  61   AAAEADLTLAQAIVDSAGVIVQSSDLTVCYDERGAKYELPKYVLSEPTNLIRD  113



>ref|XP_011085320.1| PREDICTED: ubiquitin domain-containing protein 1-like [Sesamum 
indicum]
Length=113

 Score =   173 bits (439),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 102/113 (90%), Gaps = 1/113 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA  SR KGD++ KKIRKPK WKHSEPITR QL+QMR EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCA-GSRDKGDESSKKIRKPKAWKHSEPITRAQLMQMREEFWDTAPHYGGRKEIWDALR  59

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEADL+LAQAIVD AG+IVQ PDLTVCYDERGAKYELP+YVLSEPTNLI D
Sbjct  60   AAAEADLSLAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIHD  112



>ref|NP_001238246.1| uncharacterized protein LOC100306399 [Glycine max]
 gb|ACU14552.1| unknown [Glycine max]
Length=114

 Score =   173 bits (439),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS+SK D  VKKIRKPKPWKH +PIT+ QL Q+R+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQSKPDGAVKKIRKPKPWKHPQPITKTQLTQLRDEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEADL LAQAIVD AG+IVQ+ DLTVCYDERGAKYELP+YVLSEPTNLIRD
Sbjct  61   AAAEADLTLAQAIVDSAGVIVQSSDLTVCYDERGAKYELPKYVLSEPTNLIRD  113



>ref|XP_002522262.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF40120.1| DNA binding protein, putative [Ricinus communis]
Length=219

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGC+ SSR+KGDD  KKIRKPKPWKHSEPITR QL+QMR+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCSGSSRAKGDDHSKKIRKPKPWKHSEPITRTQLLQMRDEFWDTAPHYGGRKEIWDALH  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNL  191
            AAAEADL LAQAIVD AG+IVQ+ D+T+CYDERGAKYELP+YVLSEPTNL
Sbjct  61   AAAEADLTLAQAIVDSAGVIVQSEDMTICYDERGAKYELPKYVLSEPTNL  110



>ref|XP_003596315.1| Ubiquitin domain-containing protein [Medicago truncatula]
 gb|AES66566.1| ubiquitin domain protein [Medicago truncatula]
 gb|AFK45238.1| unknown [Medicago truncatula]
Length=114

 Score =   173 bits (438),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS++K D TVKKIRKPKPWKH +PIT+ QL+Q+R+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQAKADGTVKKIRKPKPWKHPQPITKTQLIQLRDEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEADL+LAQAIVD AG+IVQ+ DLTVCYDERGAKYELP+YVLSEPTN+I++
Sbjct  61   AAAEADLSLAQAIVDSAGVIVQSSDLTVCYDERGAKYELPKYVLSEPTNMIQE  113



>ref|XP_003540499.1| PREDICTED: ubiquitin domain-containing protein 1-like [Glycine 
max]
Length=114

 Score =   173 bits (438),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS+SK D  VKKIRKPKPWKH +PIT+ QL Q+R+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQSKPDGAVKKIRKPKPWKHPQPITKTQLTQLRDEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEADL LAQ IVD AG+IVQ+ DLTVCYDERGAKYELP+YVLSEPTNLIRD
Sbjct  61   AAAEADLTLAQVIVDSAGVIVQSSDLTVCYDERGAKYELPKYVLSEPTNLIRD  113



>ref|XP_007021914.1| Ubiquitin domain-containing protein [Theobroma cacao]
 gb|EOY13439.1| Ubiquitin domain-containing protein [Theobroma cacao]
Length=114

 Score =   172 bits (436),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S+ +KGD  VKKIRKPKPWKH +PIT+ QLVQMR EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSTPAKGDGNVKKIRKPKPWKHPQPITKSQLVQMREEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEADL LAQAIVD AG+IVQ  DLT+CYDERGAKYELP+YVLSEPTNLI+D
Sbjct  61   AAAEADLTLAQAIVDSAGVIVQNADLTICYDERGAKYELPKYVLSEPTNLIQD  113



>ref|XP_002317449.1| hypothetical protein POPTR_0011s10900g [Populus trichocarpa]
 ref|XP_011044053.1| PREDICTED: ubiquitin domain-containing protein 1-like [Populus 
euphratica]
 gb|EEE98061.1| hypothetical protein POPTR_0011s10900g [Populus trichocarpa]
Length=114

 Score =   172 bits (436),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS++K D  VKKIRKPKPWKH +PIT+ QL+QMR+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQAKSDGNVKKIRKPKPWKHPQPITKSQLMQMRDEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAA+A+L+LAQAIVD AG+IVQ  DLT+CYDERGAKYELP+YVLSEPTNLIR+
Sbjct  61   AAADAELSLAQAIVDSAGVIVQNADLTICYDERGAKYELPKYVLSEPTNLIRE  113



>ref|XP_009342907.1| PREDICTED: ubiquitin domain-containing protein 1-like [Pyrus 
x bretschneideri]
Length=114

 Score =   172 bits (435),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS++KGD  +KKIRKPKPWKH +P+T+ QL+QMR EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQTKGDGALKKIRKPKPWKHPQPLTKSQLLQMREEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AA+EADL+LAQAIVD AG+IVQ+ DLT+CYDERGAKYELP+YVLSEPTNLI++
Sbjct  61   AASEADLSLAQAIVDSAGVIVQSADLTICYDERGAKYELPKYVLSEPTNLIQE  113



>ref|XP_011101437.1| PREDICTED: ubiquitin domain-containing protein 2-like [Sesamum 
indicum]
 ref|XP_011101439.1| PREDICTED: ubiquitin domain-containing protein 2-like [Sesamum 
indicum]
Length=113

 Score =   171 bits (434),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA  SR K D+T KKIRKPK WKHSE ITR+QL QMR EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCA-GSRDKVDETSKKIRKPKSWKHSEAITREQLTQMREEFWDTAPHYGGRKEIWDALR  59

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEADL LAQAIVD AG+IVQ PDLT+CYDERGAKYELP+YVLSEPTNLIRD
Sbjct  60   AAAEADLTLAQAIVDSAGVIVQNPDLTICYDERGAKYELPKYVLSEPTNLIRD  112



>ref|XP_012074542.1| PREDICTED: ubiquitin domain-containing protein 1 [Jatropha curcas]
 gb|KDP46036.1| hypothetical protein JCGZ_13482 [Jatropha curcas]
Length=114

 Score =   171 bits (434),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS++K D  VKKIRKPKPWKH +PIT+ QL+QMR+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQAKEDGAVKKIRKPKPWKHPQPITKSQLIQMRDEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AA EAD+ LAQAIVD AG+IVQ  DLT+CYDERGAKYELP+YVLSEPTNLI+D
Sbjct  61   AAVEADITLAQAIVDSAGVIVQNADLTICYDERGAKYELPKYVLSEPTNLIQD  113



>ref|XP_006358096.1| PREDICTED: ubiquitin domain-containing protein 1-like [Solanum 
tuberosum]
Length=114

 Score =   171 bits (434),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGC  SSR+KGD+TV+KIRKPKPW+HSEPITR QL++MR EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCVGSSRTKGDETVRKIRKPKPWRHSEPITRAQLLKMREEFWDTAPHYGGKKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNL  191
            AAAEA++ LAQ IV  AGIIVQ+ DLTVCYDERGAKY+LP+YVLSEPTNL
Sbjct  61   AAAEAEIGLAQTIVTSAGIIVQSADLTVCYDERGAKYDLPQYVLSEPTNL  110



>ref|XP_007213986.1| hypothetical protein PRUPE_ppa013589mg [Prunus persica]
 gb|EMJ15185.1| hypothetical protein PRUPE_ppa013589mg [Prunus persica]
Length=114

 Score =   171 bits (434),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS++KGD  +KK+RKPKPWKH +P+T+ QL+Q+R EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQTKGDGALKKVRKPKPWKHPQPLTKSQLLQLREEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEADL+LAQAIVD AG+IVQ+ DLT+CYDERGAKYELP+YVLSEPTNLIR+
Sbjct  61   AAAEADLSLAQAIVDSAGVIVQSADLTICYDERGAKYELPKYVLSEPTNLIRE  113



>gb|KJB13007.1| hypothetical protein B456_002G050900 [Gossypium raimondii]
 gb|KJB13008.1| hypothetical protein B456_002G050900 [Gossypium raimondii]
 gb|KJB13009.1| hypothetical protein B456_002G050900 [Gossypium raimondii]
 gb|KJB13010.1| hypothetical protein B456_002G050900 [Gossypium raimondii]
Length=114

 Score =   171 bits (432),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S+ +KGD  VKKIRKPKPWKH +PIT+ QL QMR EFWDTAPHYGG KEIWDAL 
Sbjct  1    MGCAGSTPAKGDGNVKKIRKPKPWKHPQPITKSQLEQMREEFWDTAPHYGGSKEIWDALK  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AA + DL  AQAIVD AG+IVQ+ DLT+CYDERGAKYELP+YVLSEPTNLIR+
Sbjct  61   AATKQDLTFAQAIVDSAGVIVQSADLTICYDERGAKYELPKYVLSEPTNLIRE  113



>ref|XP_010924711.1| PREDICTED: ubiquitin domain-containing protein 1-like [Elaeis 
guineensis]
 ref|XP_010924712.1| PREDICTED: ubiquitin domain-containing protein 1-like [Elaeis 
guineensis]
 ref|XP_010924713.1| PREDICTED: ubiquitin domain-containing protein 1-like [Elaeis 
guineensis]
Length=115

 Score =   171 bits (432),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 104/114 (91%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDD-TVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDal  344
            MGCA S++SKG++ T +K+RKPKPWKH++PITR QL+QMR+EFWDTAPHYGGQKEIWDAL
Sbjct  1    MGCAGSTQSKGEENTTRKLRKPKPWKHNQPITRTQLIQMRDEFWDTAPHYGGQKEIWDAL  60

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
             AAAEADL LAQAIVD AGIIV   D+T+CYDERGAKYELP+YVLSEPTNLIRD
Sbjct  61   RAAAEADLTLAQAIVDSAGIIVSNVDMTLCYDERGAKYELPKYVLSEPTNLIRD  114



>ref|XP_007149564.1| hypothetical protein PHAVU_005G080900g [Phaseolus vulgaris]
 gb|ESW21558.1| hypothetical protein PHAVU_005G080900g [Phaseolus vulgaris]
Length=114

 Score =   171 bits (432),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS+SK D  VKKIRKPK WKH +PIT+ QL Q+R+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQSKPDGAVKKIRKPKSWKHPQPITKTQLTQLRDEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEADL LAQAIVD AG+IVQ+ DLTVCYDERGAKYELP+YVLSEPTNLIRD
Sbjct  61   AAAEADLTLAQAIVDSAGVIVQSSDLTVCYDERGAKYELPKYVLSEPTNLIRD  113



>ref|XP_002524525.1| Ubiquitin domain-containing protein, putative [Ricinus communis]
 gb|EEF37852.1| Ubiquitin domain-containing protein, putative [Ricinus communis]
Length=114

 Score =   171 bits (432),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGC  SS +KGD T+KKIRKPKPWKH +PIT+ QLVQMR+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCVGSSHAKGDGTMKKIRKPKPWKHPQPITKSQLVQMRDEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR  185
            AAAEA+L+LAQAIVD AG+IVQ  DLT+CYDERGAKYELP+YVLSEPTNLIR
Sbjct  61   AAAEAELSLAQAIVDSAGVIVQNADLTICYDERGAKYELPKYVLSEPTNLIR  112



>ref|XP_009334023.1| PREDICTED: ubiquitin domain-containing protein 1-like [Pyrus 
x bretschneideri]
Length=114

 Score =   170 bits (431),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS++KGD T+KK+RKPKPWKH +P+T+ QL+Q+R EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQTKGDGTLKKVRKPKPWKHPQPLTKSQLLQLREEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AA+EAD++LAQAIVD AG+IVQ  DLT+CYDERGAKYELP+YVLSEPTNLI++
Sbjct  61   AASEADISLAQAIVDSAGVIVQNADLTICYDERGAKYELPKYVLSEPTNLIQE  113



>ref|XP_009410882.1| PREDICTED: ubiquitin domain-containing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=114

 Score =   169 bits (428),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S+ +KG++  KK+RKPKPWKH+EPITR  L QMR+EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCAGSTLTKGEENTKKLRKPKPWKHNEPITRTHLKQMRDEFWDTAPHYGGQKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEAD+ LAQAIVD AGII+   D+T+CYDERGAKYELP+YVLSEPTNLIRD
Sbjct  61   AAAEADINLAQAIVDSAGIIISNADMTLCYDERGAKYELPKYVLSEPTNLIRD  113



>gb|KHG06553.1| Ubiquitin domain-containing 1 [Gossypium arboreum]
Length=114

 Score =   169 bits (428),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S+ +KGD  VKKIRKPKPWKH +PIT+ QL QMR EFWDTAPHYGG KEIWDAL 
Sbjct  1    MGCAGSTPAKGDGNVKKIRKPKPWKHPQPITKSQLEQMREEFWDTAPHYGGSKEIWDALK  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AA + DL  AQAIVD AG+IVQ+ DLT+CYDERGAKYELP+YVLSEPTNLI++
Sbjct  61   AATKQDLTFAQAIVDSAGVIVQSADLTICYDERGAKYELPKYVLSEPTNLIQE  113



>gb|ACD56622.1| predicted protein [Gossypium raimondii]
 gb|KJB68829.1| hypothetical protein B456_011G036700 [Gossypium raimondii]
Length=114

 Score =   169 bits (427),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGC  S R++GD+ VKKIRKPKPWKHSEPITR QL QMR+EFWDTAPHYGGQ+EIWDAL 
Sbjct  1    MGCTGSKRTRGDENVKKIRKPKPWKHSEPITRTQLKQMRDEFWDTAPHYGGQREIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
             AAE++L  AQAI++ AG+IVQ  DLT+CYDERGAKYELP+YVLSEP N+I +
Sbjct  61   VAAESELTHAQAIINSAGVIVQNDDLTICYDERGAKYELPKYVLSEPINMIHE  113



>ref|XP_008463752.1| PREDICTED: ubiquitin domain-containing protein 1-like [Cucumis 
melo]
Length=111

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS++KGD +VKKIRKPKPWK+ +PIT+  LV+MR+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQAKGDGSVKKIRKPKPWKNPQPITKTDLVRMRDEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            AAAEADL LAQAIVD AGIIVQ+ DLT+CYDERGAKYELP+YVLSEPTNLI
Sbjct  61   AAAEADLTLAQAIVDSAGIIVQSADLTICYDERGAKYELPKYVLSEPTNLI  111



>ref|XP_009778950.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X1 [Nicotiana sylvestris]
Length=111

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 103/113 (91%), Gaps = 3/113 (3%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S   K ++  K+IRKPKPWKHSE ITRDQLV+MR+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGS---KENEAAKQIRKPKPWKHSESITRDQLVRMRDEFWDTAPHYGGRKEIWDALR  57

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAE+D++LAQAIVD AG+IVQAPDLTVCYDERGAKY+LP+YVLSEPTNLIR+
Sbjct  58   AAAESDISLAQAIVDSAGVIVQAPDLTVCYDERGAKYDLPKYVLSEPTNLIRE  110



>ref|XP_006392791.1| hypothetical protein EUTSA_v10011877mg [Eutrema salsugineum]
 gb|ESQ30077.1| hypothetical protein EUTSA_v10011877mg [Eutrema salsugineum]
Length=114

 Score =   168 bits (425),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S++S+G+ +VKKIRKPKPWKH++PIT+ QL+Q+R EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSTQSQGEGSVKKIRKPKPWKHTQPITKAQLMQLREEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEAD++LAQAIVD AG+IVQ  DLT CYDERGAKYELP+YVLSEPTNL+ +
Sbjct  61   AAAEADISLAQAIVDSAGVIVQNTDLTTCYDERGAKYELPKYVLSEPTNLVEE  113



>ref|XP_004233078.1| PREDICTED: ubiquitin domain-containing protein 1-like [Solanum 
lycopersicum]
Length=114

 Score =   168 bits (425),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGC  SSR+KGD++V+KIRKPKPW+H+EPITR QL++MR EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCVGSSRTKGDESVRKIRKPKPWRHTEPITRAQLLKMREEFWDTAPHYGGKKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNL  191
            AAAEA++ LAQ IV+ AGIIVQ  DLTVCYDERGAKY+LP YVLSEPTNL
Sbjct  61   AAAEAEIGLAQTIVNSAGIIVQTTDLTVCYDERGAKYDLPLYVLSEPTNL  110



>ref|XP_004294149.1| PREDICTED: ubiquitin domain-containing protein 1-like [Fragaria 
vesca subsp. vesca]
Length=114

 Score =   168 bits (425),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGC  SS+SK D  +KKIRKPKPWKH +P+T+ QL+Q+R EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCTGSSQSKEDGALKKIRKPKPWKHPQPLTKTQLLQLREEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEADL+LAQAIVD AG+IVQ+ DLT+CYDERGAKYELP+YVLSEPTNLIR+
Sbjct  61   AAAEADLSLAQAIVDSAGVIVQSADLTICYDERGAKYELPKYVLSEPTNLIRE  113



>ref|XP_004146021.1| PREDICTED: ubiquitin domain-containing protein 1-like [Cucumis 
sativus]
 gb|KGN55055.1| hypothetical protein Csa_4G626080 [Cucumis sativus]
Length=111

 Score =   168 bits (425),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS++KGD +VKKIRKPKPWK+ +PIT+  LV+MR+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQAKGDGSVKKIRKPKPWKNPQPITKTDLVRMRDEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            AAAEADL LAQAIVD AGIIVQ+ DLT+CYDERGAKYELP+YVLSEPTNL+
Sbjct  61   AAAEADLTLAQAIVDSAGIIVQSADLTICYDERGAKYELPKYVLSEPTNLV  111



>ref|XP_009590966.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=111

 Score =   167 bits (424),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 101/113 (89%), Gaps = 3/113 (3%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S  S   +  K+IRKPKPWKHSEPITRDQLV++R+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSKES---EAAKQIRKPKPWKHSEPITRDQLVRLRDEFWDTAPHYGGRKEIWDALR  57

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAE+D+ LAQAIVD AG+IVQAPDLTVCYDERGAKYELP+YVLSEPTNL R+
Sbjct  58   AAAESDINLAQAIVDSAGVIVQAPDLTVCYDERGAKYELPKYVLSEPTNLNRE  110



>ref|XP_004137230.1| PREDICTED: ubiquitin domain-containing protein 1-like [Cucumis 
sativus]
 gb|KGN53573.1| hypothetical protein Csa_4G083480 [Cucumis sativus]
Length=115

 Score =   167 bits (424),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS++K D ++KKIRKPK WKH +PITR QL Q+R+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQTKADGSIKKIRKPKSWKHPQPITRSQLTQLRDEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEA+L+LAQAIVD AG+IVQ  DLT+CYDERGAKYELP YVLSEPTNLIRD
Sbjct  61   AAAEAELSLAQAIVDSAGVIVQNADLTICYDERGAKYELPNYVLSEPTNLIRD  113



>ref|XP_010916698.1| PREDICTED: ubiquitin domain-containing protein 1-like [Elaeis 
guineensis]
Length=115

 Score =   167 bits (423),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDD-TVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDal  344
            MGC  S++SKG++ T KK+RKPKPWKH++PITR QL QMR+EFWDTAPHYGGQKEIWDAL
Sbjct  1    MGCVGSTQSKGEENTTKKLRKPKPWKHTQPITRTQLRQMRDEFWDTAPHYGGQKEIWDAL  60

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
             AAAEADL LAQAIVD AGIIV   D+T+CYDERGAKYELP+YVLSEPTNL RD
Sbjct  61   RAAAEADLTLAQAIVDSAGIIVSNADMTLCYDERGAKYELPKYVLSEPTNLTRD  114



>emb|CDY60203.1| BnaCnng35820D [Brassica napus]
Length=114

 Score =   167 bits (423),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S++S+G+ +VKKIRKPKPWKH++PIT+ +L+++R EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSTQSQGEGSVKKIRKPKPWKHTQPITKAELMKLREEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEAD++LAQAIVD AG+IVQ  DLTVCYDERGAKYELP+YVLSEPTNL+ D
Sbjct  61   AAAEADISLAQAIVDSAGVIVQNNDLTVCYDERGAKYELPKYVLSEPTNLVED  113



>ref|XP_006370109.1| hypothetical protein POPTR_0001s39570g [Populus trichocarpa]
 gb|ERP66678.1| hypothetical protein POPTR_0001s39570g [Populus trichocarpa]
Length=114

 Score =   167 bits (423),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS++K D + KKIRKPKPWKH +PIT+ QL+QMR EFWDT+PHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQAKADGSAKKIRKPKPWKHPQPITKSQLLQMREEFWDTSPHYGGRKEIWDALQ  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEA+L+LAQAIVD AG+I+Q  DLTVCYDERGAKYELP+YVLSEPTNLIR+
Sbjct  61   AAAEAELSLAQAIVDSAGVIIQNADLTVCYDERGAKYELPKYVLSEPTNLIRE  113



>ref|XP_008792318.1| PREDICTED: ubiquitin domain-containing protein 1-like [Phoenix 
dactylifera]
 ref|XP_008792319.1| PREDICTED: ubiquitin domain-containing protein 1-like [Phoenix 
dactylifera]
Length=115

 Score =   167 bits (423),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDD-TVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDal  344
            MGCA S++SK ++ T +K++KPKPWKH++PITR QL+QMR+EFWDTAPHYGGQKEIWDAL
Sbjct  1    MGCAGSTQSKDEENTTRKLQKPKPWKHTQPITRTQLIQMRDEFWDTAPHYGGQKEIWDAL  60

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
             AAAEADL LAQAIVD AGIIV   D+T+CYDERGAKYELP+YVLSEPTNLIRD
Sbjct  61   RAAAEADLTLAQAIVDSAGIIVSNADMTLCYDERGAKYELPKYVLSEPTNLIRD  114



>ref|XP_009590967.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=110

 Score =   167 bits (422),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 100/113 (88%), Gaps = 4/113 (4%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S  S      K+IRKPKPWKHSEPITRDQLV++R+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSKES----AAKQIRKPKPWKHSEPITRDQLVRLRDEFWDTAPHYGGRKEIWDALR  56

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAE+D+ LAQAIVD AG+IVQAPDLTVCYDERGAKYELP+YVLSEPTNL R+
Sbjct  57   AAAESDINLAQAIVDSAGVIVQAPDLTVCYDERGAKYELPKYVLSEPTNLNRE  109



>ref|XP_009778951.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X2 [Nicotiana sylvestris]
Length=110

 Score =   167 bits (422),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 102/113 (90%), Gaps = 4/113 (4%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S     ++  K+IRKPKPWKHSE ITRDQLV+MR+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSK----ENAAKQIRKPKPWKHSESITRDQLVRMRDEFWDTAPHYGGRKEIWDALR  56

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAE+D++LAQAIVD AG+IVQAPDLTVCYDERGAKY+LP+YVLSEPTNLIR+
Sbjct  57   AAAESDISLAQAIVDSAGVIVQAPDLTVCYDERGAKYDLPKYVLSEPTNLIRE  109



>ref|XP_006304315.1| hypothetical protein CARUB_v10010694mg [Capsella rubella]
 ref|XP_010500987.1| PREDICTED: ubiquitin domain-containing protein 1-like [Camelina 
sativa]
 ref|XP_010479900.1| PREDICTED: ubiquitin domain-containing protein 1-like [Camelina 
sativa]
 gb|EOA37213.1| hypothetical protein CARUB_v10010694mg [Capsella rubella]
Length=114

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S++S+GD +VKKIRKPKPWKH++PIT+ +L+++R EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSTQSQGDGSVKKIRKPKPWKHTQPITKAELMKLREEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEAD++LAQAIVD AG+IVQ  DLTVCYDERGAKYELP+YVLSEPTN + +
Sbjct  61   AAAEADISLAQAIVDSAGVIVQNTDLTVCYDERGAKYELPKYVLSEPTNFVEE  113



>ref|XP_009590969.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X4 [Nicotiana tomentosiformis]
Length=109

 Score =   166 bits (420),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 100/113 (88%), Gaps = 5/113 (4%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S  S      K+IRKPKPWKHSEPITRDQLV++R+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSKES-----AKQIRKPKPWKHSEPITRDQLVRLRDEFWDTAPHYGGRKEIWDALR  55

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAE+D+ LAQAIVD AG+IVQAPDLTVCYDERGAKYELP+YVLSEPTNL R+
Sbjct  56   AAAESDINLAQAIVDSAGVIVQAPDLTVCYDERGAKYELPKYVLSEPTNLNRE  108



>ref|XP_011082777.1| PREDICTED: ubiquitin domain-containing protein 1 isoform X2 [Sesamum 
indicum]
Length=114

 Score =   166 bits (420),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS++K + T KKIRKPK WKH +PIT+ QL+Q+R EFWDTAPHYGG KEIWDAL 
Sbjct  1    MGCAGSSQTKAEGTAKKIRKPKAWKHPQPITKSQLIQLREEFWDTAPHYGGTKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR  185
            AAAEADL LAQAIVD AGIIVQ PDLTVC+DERGA+YELP+YVLSEP NLIR
Sbjct  61   AAAEADLTLAQAIVDSAGIIVQNPDLTVCFDERGARYELPKYVLSEPKNLIR  112



>ref|XP_011002754.1| PREDICTED: ubiquitin domain-containing protein 1-like [Populus 
euphratica]
Length=114

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS++K D   KKIRKPKPWKH +PIT+ QL+QMR EFWDT+PHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQAKTDGNAKKIRKPKPWKHPQPITKSQLLQMREEFWDTSPHYGGRKEIWDALQ  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEA+L+LAQAIVD AG+I+Q  DLTVCYDERGAKYELP+YVLSEPTNLIR+
Sbjct  61   AAAEAELSLAQAIVDSAGVIIQNADLTVCYDERGAKYELPKYVLSEPTNLIRE  113



>ref|XP_008451743.1| PREDICTED: ubiquitin domain-containing protein 2-like [Cucumis 
melo]
 ref|XP_008451744.1| PREDICTED: ubiquitin domain-containing protein 2-like [Cucumis 
melo]
 ref|XP_008451745.1| PREDICTED: ubiquitin domain-containing protein 2-like [Cucumis 
melo]
Length=114

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS +K D ++KKIRKPK WKH +PITR QL Q+R+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSLTKADGSIKKIRKPKSWKHPQPITRSQLTQLRDEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEA+L+LAQ IVD AG+IVQ  DLT+CYDERGAKYELP YVLSEPTNLIRD
Sbjct  61   AAAEAELSLAQVIVDSAGVIVQNADLTICYDERGAKYELPNYVLSEPTNLIRD  113



>ref|XP_009778952.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X3 [Nicotiana sylvestris]
Length=109

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 101/113 (89%), Gaps = 5/113 (4%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S      +  K+IRKPKPWKHSE ITRDQLV+MR+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSK-----ENAKQIRKPKPWKHSESITRDQLVRMRDEFWDTAPHYGGRKEIWDALR  55

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAE+D++LAQAIVD AG+IVQAPDLTVCYDERGAKY+LP+YVLSEPTNLIR+
Sbjct  56   AAAESDISLAQAIVDSAGVIVQAPDLTVCYDERGAKYDLPKYVLSEPTNLIRE  108



>ref|XP_009144772.1| PREDICTED: ubiquitin domain-containing protein 2-like [Brassica 
rapa]
Length=114

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S++S+G+ +VKKIRKPKPWKH++PIT+ +L+++R EFWDT+PHYGG+KEIWDAL 
Sbjct  1    MGCAGSTQSQGEGSVKKIRKPKPWKHTQPITKAELMKLREEFWDTSPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEAD++LAQAIVD AG+IVQ  DLTVCYDERGAKYELP+YVLSEPTN++ D
Sbjct  61   AAAEADISLAQAIVDSAGVIVQNNDLTVCYDERGAKYELPKYVLSEPTNMVED  113



>ref|XP_007025303.1| DNA binding protein, putative [Theobroma cacao]
 gb|EOY27925.1| DNA binding protein, putative [Theobroma cacao]
Length=114

 Score =   165 bits (418),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGC+ S R++GD+  KKIR+PKPWKHSEPITR QL+QMR+EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCSGSKRTRGDEAAKKIRRPKPWKHSEPITRTQLMQMRDEFWDTAPHYGGQKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEA+L LAQAI+D AG+IVQ  DLT+CYDERGAKYELP+YVLS+P NL  +
Sbjct  61   AAAEAELILAQAIIDSAGVIVQNDDLTICYDERGAKYELPKYVLSDPINLTHE  113



>ref|XP_004489012.1| PREDICTED: ubiquitin domain-containing protein 2-like [Cicer 
arietinum]
Length=117

 Score =   165 bits (417),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 102/116 (88%), Gaps = 3/116 (3%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEI---WD  350
            MGCA SS SK D TVKKIRKPKPWKH +PIT+ QL+Q+R+EFWDTAPHYGG+K I   W+
Sbjct  1    MGCAGSSHSKPDGTVKKIRKPKPWKHPQPITKTQLIQLRDEFWDTAPHYGGRKGIIATWE  60

Query  349  alcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
             + AAAEADL+LAQAIVD AG+IVQ+ DLTVCYDERGAKYELP+YVLSEPTNLI+D
Sbjct  61   KMAAAAEADLSLAQAIVDSAGVIVQSSDLTVCYDERGAKYELPKYVLSEPTNLIQD  116



>ref|XP_010462233.1| PREDICTED: ubiquitin domain-containing protein 1-like [Camelina 
sativa]
Length=114

 Score =   164 bits (416),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S++S+GD  VKKIRKPKPWKH++PIT+ +L+++R EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSTQSQGDGPVKKIRKPKPWKHTQPITKAELMKLREEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEAD++LAQAIVD AG+IVQ  DLTVCYDERGAKYELP+YVLSEPTN + +
Sbjct  61   AAAEADISLAQAIVDSAGVIVQNTDLTVCYDERGAKYELPKYVLSEPTNFVEE  113



>ref|NP_564630.1| ubiquitin domain-containing protein [Arabidopsis thaliana]
 ref|XP_002891751.1| hypothetical protein ARALYDRAFT_474470 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AAF69541.1|AC008007_16 F12M16.29 [Arabidopsis thaliana]
 gb|AAK43979.1|AF370164_1 unknown protein [Arabidopsis thaliana]
 gb|AAL15232.1| unknown protein [Arabidopsis thaliana]
 gb|EFH68010.1| hypothetical protein ARALYDRAFT_474470 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE32937.1| ubiquitin domain-containing protein [Arabidopsis thaliana]
Length=114

 Score =   164 bits (415),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S++S+ D +VKKIRKPKPWKH++PIT+ +L+++R EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSTQSQADGSVKKIRKPKPWKHTQPITKAELMKLREEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNL  191
            AAAEAD++LAQAIVD AG+IVQ  DLTVCYDERGAKYELP+YVLSEPTNL
Sbjct  61   AAAEADISLAQAIVDSAGVIVQNTDLTVCYDERGAKYELPKYVLSEPTNL  110



>ref|XP_010057131.1| PREDICTED: ubiquitin domain-containing protein 1-like [Eucalyptus 
grandis]
 gb|KCW74155.1| hypothetical protein EUGRSUZ_E02789 [Eucalyptus grandis]
Length=113

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 1/111 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA  SR KGDD+ KKIRKPKPWKH E ITR QL++MR EFWDTAPHYGG++EIWDAL 
Sbjct  1    MGCA-GSRPKGDDSSKKIRKPKPWKHPEAITRTQLMKMREEFWDTAPHYGGRQEIWDALH  59

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            AAAEADL LAQAIVD AG+IVQ  DLT+CYDERGAKYELP+YVLSEPTNLI
Sbjct  60   AAAEADLTLAQAIVDSAGVIVQRADLTICYDERGAKYELPKYVLSEPTNLI  110



>gb|ABK21076.1| unknown [Picea sitchensis]
Length=114

 Score =   163 bits (413),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGC  SS    D   KKIRKPKPWKHSEPITR QL QMR+EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCVGSSEKAVDGHSKKIRKPKPWKHSEPITRAQLKQMRDEFWDTAPHYGGQKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEADL LA+AIVD AGIIV + D+T CYDERGAKY+LP+YVLSEPTNLI+D
Sbjct  61   AAAEADLGLARAIVDSAGIIVTSDDMTTCYDERGAKYDLPKYVLSEPTNLIKD  113



>ref|XP_010542324.1| PREDICTED: ubiquitin domain-containing protein 2 isoform X2 [Tarenaya 
hassleriana]
Length=114

 Score =   163 bits (412),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGC  SS+S GD  VK I+KPKPWKH +PIT+ +L+Q+R EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCVGSSQSNGDGAVKTIKKPKPWKHPQPITKTRLLQLREEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEA+L LAQAIV+ AG+IVQ PDLTVCYDERGAKYELP+YVLSEPTNL++D
Sbjct  61   AAAEAELPLAQAIVESAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLVQD  113



>ref|XP_009394161.1| PREDICTED: ubiquitin domain-containing protein 2-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=114

 Score =   162 bits (410),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S+ +KGD+  KK++KPKPWKH++ +TR QL QMR+EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCAGSTPAKGDENTKKLQKPKPWKHTQQMTRAQLKQMRDEFWDTAPHYGGQKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEADL LAQAIVD AGII+   D+T+CYDERGAKYELP+YVLSEPTNLIRD
Sbjct  61   AAAEADLDLAQAIVDSAGIIIPNADMTLCYDERGAKYELPKYVLSEPTNLIRD  113



>gb|KJB61567.1| hypothetical protein B456_009G366700 [Gossypium raimondii]
Length=115

 Score =   162 bits (410),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGC  S+ +KGD   KKIRKPKPWKH +PIT+ +L QMR+EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCVGSTPAKGDGNAKKIRKPKPWKHPQPITKSELEQMRDEFWDTAPHYGGQKEIWDALR  60

Query  340  aaaea-dlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAA   DL+ AQ IVD AG+IVQ  DLT+CYDERGAKYELP+YVLSEPTN+IRD
Sbjct  61   AAAAEPDLSQAQVIVDCAGVIVQNTDLTICYDERGAKYELPKYVLSEPTNMIRD  114



>ref|XP_011082776.1| PREDICTED: ubiquitin domain-containing protein 1 isoform X1 [Sesamum 
indicum]
Length=115

 Score =   162 bits (409),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS++K + T KKIRKPK WKH +PIT+ QL+Q+R EFWDTAPHYGG KEIWDAL 
Sbjct  1    MGCAGSSQTKAEGTAKKIRKPKAWKHPQPITKSQLIQLREEFWDTAPHYGGTKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDER-GAKYELPRYVLSEPTNLIR  185
            AAAEADL LAQAIVD AGIIVQ PDLTVC+DER GA+YELP+YVLSEP NLIR
Sbjct  61   AAAEADLTLAQAIVDSAGIIVQNPDLTVCFDERAGARYELPKYVLSEPKNLIR  113



>ref|XP_009590968.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X3 [Nicotiana tomentosiformis]
Length=110

 Score =   161 bits (408),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -3

Query  484  DTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqA  305
            +  K+IRKPKPWKHSEPITRDQLV++R+EFWDTAPHYGG+KEIWDAL AAAE+D+ LAQA
Sbjct  9    EAAKQIRKPKPWKHSEPITRDQLVRLRDEFWDTAPHYGGRKEIWDALRAAAESDINLAQA  68

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG  179
            IVD AG+IVQAPDLTVCYDERGAKYELP+YVLSEPTNL R+ 
Sbjct  69   IVDSAGVIVQAPDLTVCYDERGAKYELPKYVLSEPTNLNRES  110



>gb|KFK35732.1| hypothetical protein AALP_AA4G029400 [Arabis alpina]
Length=116

 Score =   161 bits (408),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 102/115 (89%), Gaps = 2/115 (2%)
 Frame = -3

Query  520  MGCAESSRSKG--DDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa  347
            MGCA SS+S+G  + +VKKI KPKPWKH +PIT+ QL+Q+R EFWDTAPHYGG+KEIWDA
Sbjct  1    MGCAGSSQSQGGGEGSVKKISKPKPWKHPQPITKAQLMQLREEFWDTAPHYGGRKEIWDA  60

Query  346  lcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            L AAAEAD++LAQAIVD AG+IVQ  DLTVCYDERGAKYELP+YVLSEPTNL+ +
Sbjct  61   LRAAAEADISLAQAIVDSAGVIVQNTDLTVCYDERGAKYELPKYVLSEPTNLVEE  115



>ref|XP_009590970.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X5 [Nicotiana tomentosiformis]
Length=109

 Score =   161 bits (407),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = -3

Query  487  DDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaq  308
            +   K+IRKPKPWKHSEPITRDQLV++R+EFWDTAPHYGG+KEIWDAL AAAE+D+ LAQ
Sbjct  7    ESAAKQIRKPKPWKHSEPITRDQLVRLRDEFWDTAPHYGGRKEIWDALRAAAESDINLAQ  66

Query  307  AIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG  179
            AIVD AG+IVQAPDLTVCYDERGAKYELP+YVLSEPTNL R+ 
Sbjct  67   AIVDSAGVIVQAPDLTVCYDERGAKYELPKYVLSEPTNLNRES  109



>ref|XP_012091830.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X2 [Jatropha curcas]
Length=102

 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = -3

Query  481  TVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAI  302
            T KKIRKPKPWKHSEPITR QL+Q+R+EFWDTAPHYGG+KEIWDAL AAAEADL LAQAI
Sbjct  2    TKKKIRKPKPWKHSEPITRTQLLQLRDEFWDTAPHYGGRKEIWDALHAAAEADLTLAQAI  61

Query  301  VDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            VD AG+IVQ+ DLT+CYDERGAKYELP+YVLSEPTNLIRD
Sbjct  62   VDSAGVIVQSEDLTICYDERGAKYELPKYVLSEPTNLIRD  101



>ref|NP_001288925.1| ubiquitin domain-containing protein 1-like [Brassica rapa]
 gb|ABL97984.1| unknown [Brassica rapa]
 emb|CDY24097.1| BnaA06g00950D [Brassica napus]
Length=114

 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S++S+ +  VKKIRKPKPWKH++PI++ +LV+MR EFWDTAPHYGG KEIWDAL 
Sbjct  1    MGCAGSTQSQAEGPVKKIRKPKPWKHTQPISKAELVKMREEFWDTAPHYGGTKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEAD++LAQ IVD AG+IVQ  DLT CYDERGAKY+LP+YVLSEPTNL+ +
Sbjct  61   AAAEADISLAQTIVDSAGVIVQNNDLTTCYDERGAKYDLPKYVLSEPTNLVEE  113



>emb|CDY24099.1| BnaA06g00970D [Brassica napus]
Length=114

 Score =   157 bits (397),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S++S+ +  VK+IRKP+PWKH++PI++ +LV+MR EFWDTAPHYGG K++WDAL 
Sbjct  1    MGCAGSTQSQAEVAVKRIRKPEPWKHTQPISKAELVKMREEFWDTAPHYGGTKDLWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEAD++LAQAIVD AG+IVQ  DLT CYDERGAKYELP+YVLSEPTNL+ +
Sbjct  61   AAAEADISLAQAIVDSAGVIVQNNDLTTCYDERGAKYELPKYVLSEPTNLVEE  113



>gb|KJB57379.1| hypothetical protein B456_009G160000 [Gossypium raimondii]
Length=114

 Score =   157 bits (397),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGC ES  +K D+ VKKIRKPKPWKHSEPITR QL ++R+EFWDTAP+ GG+KEIWDAL 
Sbjct  1    MGCNESKPTKDDENVKKIRKPKPWKHSEPITRAQLAKIRDEFWDTAPYNGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG  179
            AAAEA+L LAQAI+D AG+IVQ  DLT+CYDERGAKYELP+YVLSEP NL +D 
Sbjct  61   AAAEAELILAQAIIDSAGVIVQNDDLTICYDERGAKYELPKYVLSEPINLTQDN  114



>ref|XP_009394159.1| PREDICTED: ubiquitin domain-containing protein 2-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=117

 Score =   157 bits (397),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 100/116 (86%), Gaps = 3/116 (3%)
 Frame = -3

Query  520  MGCAESSRSKGD---DTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWD  350
            MGCA S+ +KGD   +  KK++KPKPWKH++ +TR QL QMR+EFWDTAPHYGGQKEIWD
Sbjct  1    MGCAGSTPAKGDVILENTKKLQKPKPWKHTQQMTRAQLKQMRDEFWDTAPHYGGQKEIWD  60

Query  349  alcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AL AAAEADL LAQAIVD AGII+   D+T+CYDERGAKYELP+YVLSEPTNLIRD
Sbjct  61   ALRAAAEADLDLAQAIVDSAGIIIPNADMTLCYDERGAKYELPKYVLSEPTNLIRD  116



>gb|KJB61568.1| hypothetical protein B456_009G366700 [Gossypium raimondii]
Length=117

 Score =   157 bits (396),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 96/116 (83%), Gaps = 3/116 (3%)
 Frame = -3

Query  520  MGCAESSRSKGDD--TVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa  347
            MGC  S+ +KGD     KKIRKPKPWKH +PIT+ +L QMR+EFWDTAPHYGGQKEIWDA
Sbjct  1    MGCVGSTPAKGDGDGNAKKIRKPKPWKHPQPITKSELEQMRDEFWDTAPHYGGQKEIWDA  60

Query  346  lcaaaea-dlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            L AAA   DL+ AQ IVD AG+IVQ  DLT+CYDERGAKYELP+YVLSEPTN+IRD
Sbjct  61   LRAAAAEPDLSQAQVIVDCAGVIVQNTDLTICYDERGAKYELPKYVLSEPTNMIRD  116



>ref|XP_004956627.1| PREDICTED: ubiquitin domain-containing protein 1-like [Setaria 
italica]
Length=119

 Score =   156 bits (395),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 97/118 (82%), Gaps = 5/118 (4%)
 Frame = -3

Query  520  MGCAESSRSKGD-----DTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEI  356
            MGCA S+ +  +     D+ KK+RKPKPWKH +PIT  QL QMR+EFWDTAPHYGGQKEI
Sbjct  1    MGCAGSTPATKETGGSSDSTKKVRKPKPWKHPQPITVAQLRQMRDEFWDTAPHYGGQKEI  60

Query  355  WDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            WDAL  A+E++++ AQAIV+ AGIIV   DLT+CYDERGAKYELP+YVLSEPTNLIRD
Sbjct  61   WDALRVASESEVSHAQAIVESAGIIVSNADLTLCYDERGAKYELPKYVLSEPTNLIRD  118



>gb|ACG32626.1| ubiquitin domain containing 1 [Zea mays]
 gb|AFW78776.1| ubiquitin domain containing 1 [Zea mays]
Length=113

 Score =   155 bits (392),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S+  K D+  KK+++PK WKH++PIT  +L QMR+EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCAGST-PKVDENSKKLKRPKAWKHTQPITPARLKQMRDEFWDTAPHYGGQKEIWDALR  59

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG  179
             AAE+DLALAQ IVD AGIIV  PD+T+CYDERGAKYELP+YVLSEP NLIRDG
Sbjct  60   VAAESDLALAQTIVDSAGIIVSNPDMTLCYDERGAKYELPKYVLSEPANLIRDG  113



>ref|XP_008359363.1| PREDICTED: ubiquitin domain-containing protein 1-like [Malus 
domestica]
Length=136

 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  481  TVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAI  302
            T+KKIRKPKPWKH +P+T+ QL+QMR EFWDTAPHYGG+KEIWDAL AA+EADL+LAQAI
Sbjct  36   TLKKIRKPKPWKHPQPLTKSQLLQMREEFWDTAPHYGGRKEIWDALRAASEADLSLAQAI  95

Query  301  VDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG  179
            VD AG+IVQ+ DLT+CYDERGAKYELP+YVLSEPTNLI++ 
Sbjct  96   VDSAGVIVQSADLTICYDERGAKYELPKYVLSEPTNLIQES  136



>ref|NP_001151929.1| ubiquitin domain containing 1 [Zea mays]
 gb|ACG45053.1| ubiquitin domain containing 1 [Zea mays]
Length=113

 Score =   155 bits (391),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S+  K DD  K ++KPKPWKH++ IT  QL QMR+EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCAGST-PKTDDNGKNLKKPKPWKHTQAITPAQLRQMRDEFWDTAPHYGGQKEIWDALR  59

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG  179
            AAA++DLALAQ IVD AGIIV   D+T+CYDERGAKYELP+YVLSEPTNLIRDG
Sbjct  60   AAADSDLALAQTIVDSAGIIVSNSDMTLCYDERGAKYELPKYVLSEPTNLIRDG  113



>gb|KHN36901.1| Ubiquitin domain-containing protein 2 [Glycine soja]
Length=161

 Score =   156 bits (395),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = -3

Query  481  TVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAI  302
             VKKIRKPKPWKH +PIT+ QL Q+R+EFWDTAPHYGG+KEIWDAL AAAEADL LAQAI
Sbjct  61   AVKKIRKPKPWKHPQPITKTQLTQLRDEFWDTAPHYGGRKEIWDALRAAAEADLTLAQAI  120

Query  301  VDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            VD AG+IVQ+ DLTVCYDERGAKYELP+YVLSEPTNLIRD
Sbjct  121  VDSAGVIVQSSDLTVCYDERGAKYELPKYVLSEPTNLIRD  160



>gb|KJB13011.1| hypothetical protein B456_002G050900 [Gossypium raimondii]
Length=115

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -3

Query  478  VKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIV  299
            VKKIRKPKPWKH +PIT+ QL QMR EFWDTAPHYGG KEIWDAL AA + DL  AQAIV
Sbjct  16   VKKIRKPKPWKHPQPITKSQLEQMREEFWDTAPHYGGSKEIWDALKAATKQDLTFAQAIV  75

Query  298  DGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            D AG+IVQ+ DLT+CYDERGAKYELP+YVLSEPTNLIR+
Sbjct  76   DSAGVIVQSADLTICYDERGAKYELPKYVLSEPTNLIRE  114



>ref|XP_006660552.1| PREDICTED: ubiquitin domain-containing protein 1-like [Oryza 
brachyantha]
Length=115

 Score =   154 bits (389),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  MGCAESSRSKGD-DTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDal  344
            MGCA S+    + DT KKIRKPKPWKH +PIT  QL +MR EFWDTAPHYGG+KEIWDAL
Sbjct  1    MGCAGSTPMGAEADTTKKIRKPKPWKHPQPITMVQLSKMREEFWDTAPHYGGRKEIWDAL  60

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
              AAE++++LAQAIV+ AGIIV   DLT+CYDERGAKYELP+YVLSEPTNLI+D
Sbjct  61   RVAAESEVSLAQAIVESAGIIVSNTDLTLCYDERGAKYELPKYVLSEPTNLIQD  114



>ref|XP_010665504.1| PREDICTED: ubiquitin domain-containing protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=117

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = -3

Query  520  MGCAESSRSKGD-DTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDal  344
            MGC  SSR KG   + K++RKPKPW+H+E ITR QL +MR EFWDTAPHYGG +EIWDAL
Sbjct  1    MGCV-SSRDKGAAGSTKRVRKPKPWRHTEAITRTQLNRMREEFWDTAPHYGGTREIWDAL  59

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
             AAAEA+L++AQ I+D AG+IVQ PDLT+CYDERGA+Y+LP+YVLSEPTNLIRD
Sbjct  60   RAAAEAELSMAQTIIDSAGVIVQNPDLTLCYDERGARYDLPKYVLSEPTNLIRD  113



>ref|XP_001771101.1| predicted protein [Physcomitrella patens]
 gb|EDQ64102.1| predicted protein [Physcomitrella patens]
Length=114

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 94/111 (85%), Gaps = 1/111 (1%)
 Frame = -3

Query  520  MGCAESSRSKG-DDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDal  344
            MGC  S   KG D   K+I++PKPWKH+EPITR QL QMR+EFWDTAPHYGG+KEIWDAL
Sbjct  1    MGCVGSKAVKGVDRNQKRIKRPKPWKHTEPITRTQLKQMRDEFWDTAPHYGGKKEIWDAL  60

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNL  191
             AA EAD+ LAQ IVD AGIIVQ+ DL++CYDERGAKY+LP+YVLSEPTN+
Sbjct  61   KAAVEADVNLAQVIVDSAGIIVQSEDLSICYDERGAKYDLPKYVLSEPTNI  111



>ref|XP_003568047.1| PREDICTED: ubiquitin domain-containing protein 1-like [Brachypodium 
distachyon]
Length=113

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA  S+ + D++ KK+RKPKPWKH++P+T  QL QMR+EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCA-GSKPRVDESGKKLRKPKPWKHTQPLTPAQLKQMRDEFWDTAPHYGGQKEIWDALR  59

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG  179
            AA EADL LAQ IVD AG+IV   DLT+CYDERGAKYELP+YVLSEPTNLI  G
Sbjct  60   AATEADLPLAQTIVDSAGVIVSNSDLTLCYDERGAKYELPKYVLSEPTNLIPVG  113



>gb|KJB57380.1| hypothetical protein B456_009G160000 [Gossypium raimondii]
Length=115

 Score =   152 bits (385),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQK-EIWDal  344
            MGC ES  +K D+ VKKIRKPKPWKHSEPITR QL ++R+EFWDTAP+ GG+K EIWDAL
Sbjct  1    MGCNESKPTKDDENVKKIRKPKPWKHSEPITRAQLAKIRDEFWDTAPYNGGRKAEIWDAL  60

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG  179
             AAAEA+L LAQAI+D AG+IVQ  DLT+CYDERGAKYELP+YVLSEP NL +D 
Sbjct  61   RAAAEAELILAQAIIDSAGVIVQNDDLTICYDERGAKYELPKYVLSEPINLTQDN  115



>ref|NP_199386.2| ubiquitin domain-containing protein [Arabidopsis thaliana]
 gb|AED95291.1| ubiquitin domain-containing protein [Arabidopsis thaliana]
Length=118

 Score =   152 bits (385),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 95/115 (83%), Gaps = 2/115 (2%)
 Frame = -3

Query  520  MGCAESS--RSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa  347
            MGC  SS  R++G    KKI KPKPW H+EPITR QL  MR EFWDT+PHYGGQ+EIW+A
Sbjct  1    MGCIGSSQARNEGGAKRKKIMKPKPWAHTEPITRAQLTNMREEFWDTSPHYGGQREIWEA  60

Query  346  lcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            L AAAEADL LAQ IVD AG+IVQ  DLT+C+DERGA+YELPRYVLSEPTNLIR+
Sbjct  61   LRAAAEADLKLAQTIVDSAGVIVQNRDLTLCWDERGARYELPRYVLSEPTNLIRE  115



>ref|XP_009114392.1| PREDICTED: ubiquitin domain-containing protein 1 isoform X1 [Brassica 
rapa]
 emb|CDY60536.1| BnaAnng16980D [Brassica napus]
Length=118

 Score =   152 bits (384),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 97/115 (84%), Gaps = 2/115 (2%)
 Frame = -3

Query  520  MGCAESS--RSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa  347
            MGC  SS  R++G    +KI+KPKPW H+EPITR QL+ MR EFWDT+PHYGGQ+EIWDA
Sbjct  1    MGCIGSSHARNEGGARREKIKKPKPWAHTEPITRAQLMNMREEFWDTSPHYGGQREIWDA  60

Query  346  lcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            L AAAEA+L LAQ I+D AG+IVQ  DLT+C+DERGAKYELPRYVLSEPTNLIR+
Sbjct  61   LRAAAEAELTLAQTIIDSAGVIVQGRDLTLCWDERGAKYELPRYVLSEPTNLIRE  115



>ref|XP_009605607.1| PREDICTED: ubiquitin domain-containing protein 2-like [Nicotiana 
tomentosiformis]
Length=128

 Score =   152 bits (385),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 1/113 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKI-RKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDal  344
            MGC+ SS +K +  VKKI RKPKPWKH +PITR QL+Q+R EFWDTAPHYGG+KEIWDAL
Sbjct  14   MGCSGSSHAKPNRIVKKIIRKPKPWKHPQPITRSQLMQLREEFWDTAPHYGGKKEIWDAL  73

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR  185
             AAAE DL LAQAIVD  GIIV   D+TVCYDE G KYELP+YVLSEPTN+IR
Sbjct  74   RAAAETDLDLAQAIVDSGGIIVHNTDMTVCYDETGTKYELPKYVLSEPTNMIR  126



>ref|XP_003578004.1| PREDICTED: ubiquitin domain-containing protein 1-like [Brachypodium 
distachyon]
Length=116

 Score =   152 bits (384),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 97/115 (84%), Gaps = 2/115 (2%)
 Frame = -3

Query  520  MGCAESS--RSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa  347
            MGCA S+   S   +  KK+RKPKPWKH +PIT  QL QMR+EFWDTAPHYGGQKEIWDA
Sbjct  1    MGCAGSTPKGSPEGEATKKVRKPKPWKHPQPITIGQLRQMRDEFWDTAPHYGGQKEIWDA  60

Query  346  lcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            L AAAEAD++LAQAIV+ AG+IV   DLT+CYDERGAKYELP+YVLSEPTNL++D
Sbjct  61   LRAAAEADVSLAQAIVESAGVIVSNADLTLCYDERGAKYELPKYVLSEPTNLVQD  115



>ref|XP_001781153.1| predicted protein [Physcomitrella patens]
 gb|EDQ54021.1| predicted protein [Physcomitrella patens]
Length=115

 Score =   152 bits (383),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDT-VKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDal  344
            MGC  S   KG D   KK+++PKPWKH E ITR QL QMR+EFWDTAPHYGG+KEIWDAL
Sbjct  1    MGCVGSKAVKGSDRHQKKVKRPKPWKHIEAITRTQLKQMRDEFWDTAPHYGGKKEIWDAL  60

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
             AAAEAD+ LAQ IVD AGIIVQ+ DL+ CYDERGAKY+LP+YVLSEPTN+I++
Sbjct  61   RAAAEADINLAQLIVDSAGIIVQSEDLSTCYDERGAKYDLPKYVLSEPTNIIKE  114



>ref|XP_010529214.1| PREDICTED: ubiquitin domain-containing protein 1-like [Tarenaya 
hassleriana]
Length=116

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 95/115 (83%), Gaps = 2/115 (2%)
 Frame = -3

Query  520  MGCAESS--RSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa  347
            MGC  SS  +S G +  KKI KPKPW HSEPIT   LV+MR EFWDTAPHYGG++EIWDA
Sbjct  1    MGCIGSSLAKSDGGERKKKIEKPKPWAHSEPITWAHLVKMREEFWDTAPHYGGRREIWDA  60

Query  346  lcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            L AAAEADL +AQA+VD AG+IVQ  DLT CYDERGA+YELP+YVLSEPTNLI++
Sbjct  61   LRAAAEADLTMAQAVVDSAGVIVQNSDLTTCYDERGARYELPKYVLSEPTNLIKE  115



>ref|XP_010518821.1| PREDICTED: ubiquitin domain-containing protein 1-like [Tarenaya 
hassleriana]
Length=115

 Score =   150 bits (380),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 94/114 (82%), Gaps = 2/114 (2%)
 Frame = -3

Query  520  MGCAESS--RSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa  347
            MGC  SS  +S+G +   KIRKPKPW H EPITR +L  MR EFWDTAPHYGGQ+EIWDA
Sbjct  1    MGCISSSLAKSEGGERKIKIRKPKPWVHPEPITRTRLESMREEFWDTAPHYGGQREIWDA  60

Query  346  lcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR  185
            L AAAEADL +AQAIVD AG+IVQ  DLT+CYDERGA+YELP YVLSEP+NLIR
Sbjct  61   LRAAAEADLTMAQAIVDSAGVIVQNRDLTICYDERGARYELPNYVLSEPSNLIR  114



>ref|XP_010542322.1| PREDICTED: ubiquitin domain-containing protein 1 isoform X1 [Tarenaya 
hassleriana]
Length=137

 Score =   151 bits (381),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 101/136 (74%), Gaps = 23/136 (17%)
 Frame = -3

Query  520  MGCAESSRSKGDDT-----------------------VKKIRKPKPWKHSEPITRDQLVQ  410
            MGC  SS+S GD +                       VK I+KPKPWKH +PIT+ +L+Q
Sbjct  1    MGCVGSSQSNGDVSQNLIVMESSALQDVFDYLAYMWAVKTIKKPKPWKHPQPITKTRLLQ  60

Query  409  MRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKY  230
            +R EFWDTAPHYGG+KEIWDAL AAAEA+L LAQAIV+ AG+IVQ PDLTVCYDERGAKY
Sbjct  61   LREEFWDTAPHYGGRKEIWDALRAAAEAELPLAQAIVESAGVIVQNPDLTVCYDERGAKY  120

Query  229  ELPRYVLSEPTNLIRD  182
            ELP+YVLSEPTNL++D
Sbjct  121  ELPKYVLSEPTNLVQD  136



>ref|NP_001062935.1| Os09g0345000 [Oryza sativa Japonica Group]
 dbj|BAD29098.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF24849.1| Os09g0345000 [Oryza sativa Japonica Group]
 gb|EEC84402.1| hypothetical protein OsI_30979 [Oryza sativa Indica Group]
 gb|EEE69520.1| hypothetical protein OsJ_28981 [Oryza sativa Japonica Group]
Length=116

 Score =   150 bits (379),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = -3

Query  520  MGCAESS--RSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa  347
            MGCA S+   +   D  KKIRKPKPWKH +PIT  QL +MR EFWDTAPHYGG+KEIWDA
Sbjct  1    MGCAGSTPMGAPESDATKKIRKPKPWKHPQPITMVQLTKMREEFWDTAPHYGGRKEIWDA  60

Query  346  lcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            L  AAE++++LAQAIV+ A IIV   DLT+CYDERGAKYELP+YVLSEPTNLI+D
Sbjct  61   LRVAAESEVSLAQAIVESAAIIVSNTDLTLCYDERGAKYELPKYVLSEPTNLIQD  115



>gb|KJB61569.1| hypothetical protein B456_009G366700 [Gossypium raimondii]
Length=130

 Score =   150 bits (378),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 96/127 (76%), Gaps = 12/127 (9%)
 Frame = -3

Query  556  LLVNQFSGELHTMGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPH  377
            +LVN    +L  +G A           KKIRKPKPWKH +PIT+ +L QMR+EFWDTAPH
Sbjct  15   ILVNHILNDLVLIGNA-----------KKIRKPKPWKHPQPITKSELEQMRDEFWDTAPH  63

Query  376  YGGQKEIWDalcaaaea-dlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEP  200
            YGGQKEIWDAL AAA   DL+ AQ IVD AG+IVQ  DLT+CYDERGAKYELP+YVLSEP
Sbjct  64   YGGQKEIWDALRAAAAEPDLSQAQVIVDCAGVIVQNTDLTICYDERGAKYELPKYVLSEP  123

Query  199  TNLIRDG  179
            TN+IRD 
Sbjct  124  TNMIRDN  130



>ref|XP_009803993.1| PREDICTED: ubiquitin domain-containing protein 2-like [Nicotiana 
sylvestris]
Length=115

 Score =   149 bits (376),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 95/113 (84%), Gaps = 1/113 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKI-RKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDal  344
            MGC+ SS +K    VKKI RKPKPWKH +PITR QL+Q+R EFWDTAPHYGG+KEIWDAL
Sbjct  1    MGCSGSSHAKPKRIVKKIIRKPKPWKHPQPITRSQLMQLREEFWDTAPHYGGKKEIWDAL  60

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR  185
             AAAEADL LAQAIVD AG+IV   D+T+C+DE G KYELP+YVLSEPTN+IR
Sbjct  61   RAAAEADLDLAQAIVDSAGVIVHNTDMTICFDETGTKYELPKYVLSEPTNMIR  113



>ref|XP_009388696.1| PREDICTED: ubiquitin domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=114

 Score =   149 bits (375),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGC  SSR K  +  KK++KP+ W H++P+T  QL +MR EFWDTAP+YGG+KEIWDAL 
Sbjct  1    MGCGGSSRKKAQEINKKLKKPEAWTHAQPLTEAQLKKMREEFWDTAPYYGGEKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAE+DL  AQ IVD AGI+V + D+T CYDERGAKYELP++VLSEP NLIRD
Sbjct  61   AAAESDLKFAQTIVDSAGIVVTSADMTTCYDERGAKYELPKFVLSEPINLIRD  113



>gb|KCW74164.1| hypothetical protein EUGRSUZ_E02802 [Eucalyptus grandis]
Length=140

 Score =   149 bits (375),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = -3

Query  559  ILLVNQFSGELHTMGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAP  380
            ++ +  F   +  M    SS     D+ KKIRKPKPWKH E ITR QL++MR EFWDTAP
Sbjct  14   LMRITHFDQTVILMEPVNSSTFYSVDSSKKIRKPKPWKHPEAITRTQLMKMREEFWDTAP  73

Query  379  HYGGQKEIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEP  200
            HYGG++EI DAL AAAEADL LAQAIVD AG+IVQ  DLT+CYDERGAKYELP+YVLSEP
Sbjct  74   HYGGRQEICDALHAAAEADLMLAQAIVDSAGVIVQRADLTICYDERGAKYELPKYVLSEP  133

Query  199  TNLIRDG  179
            TNLI + 
Sbjct  134  TNLIDEN  140



>ref|XP_002462254.1| hypothetical protein SORBIDRAFT_02g022530 [Sorghum bicolor]
 gb|EER98775.1| hypothetical protein SORBIDRAFT_02g022530 [Sorghum bicolor]
Length=122

 Score =   147 bits (372),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 91/121 (75%), Gaps = 8/121 (7%)
 Frame = -3

Query  520  MGCAESS--------RSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQ  365
            MGC  S+         S G+   KK+RKPK WKH +PIT  QL QMR EFWDTAPHYGGQ
Sbjct  1    MGCVGSTPANKDAGGSSDGNHGTKKVRKPKAWKHPQPITMAQLRQMREEFWDTAPHYGGQ  60

Query  364  KEIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR  185
            K IWDAL  A+E++++ AQ +V+ AGIIV   DLT+CYDERGAKYELP+YVLSEPTNLIR
Sbjct  61   KVIWDALRVASESEVSHAQVVVESAGIIVSNADLTLCYDERGAKYELPKYVLSEPTNLIR  120

Query  184  D  182
            D
Sbjct  121  D  121



>ref|XP_006348320.1| PREDICTED: ubiquitin domain-containing protein 2-like [Solanum 
tuberosum]
Length=115

 Score =   147 bits (371),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 94/115 (82%), Gaps = 1/115 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKI-RKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDal  344
            MG   SS  K + T KKI RKPKPWKH +PITR QL+Q+R EFWDTAPHYGG+KEIWDAL
Sbjct  1    MGSCGSSHVKPNRTGKKIIRKPKPWKHPQPITRSQLMQLREEFWDTAPHYGGKKEIWDAL  60

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG  179
             AAAEADL LAQAIVD AGII Q  D+T+CYDE G KYELP+YVLSEPTN+IR G
Sbjct  61   RAAAEADLELAQAIVDSAGIIAQNTDMTICYDESGTKYELPKYVLSEPTNMIRFG  115



>ref|NP_001152582.1| dendritic cell-derived ubiquitin-like protein [Zea mays]
 gb|ACG48345.1| dendritic cell-derived ubiquitin-like protein [Zea mays]
 tpg|DAA39928.1| TPA: dendritic cell-derived ubiquitin-like protein [Zea mays]
Length=122

 Score =   147 bits (371),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 92/121 (76%), Gaps = 8/121 (7%)
 Frame = -3

Query  520  MGCAESSRSKGD--------DTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQ  365
            MGC  S+ +  D           K++RKPK WKH +PIT  QL QMR EFWDTAPHYGGQ
Sbjct  1    MGCVGSTPATKDAGGSSDVNHGTKRVRKPKAWKHPQPITMAQLRQMREEFWDTAPHYGGQ  60

Query  364  KEIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR  185
            KEIWDAL  A+E++++ AQA+V+ AGIIV   DLT+CYDERGAKYELP+YVLSEPTNLIR
Sbjct  61   KEIWDALRVASESEVSHAQAVVESAGIIVSNADLTLCYDERGAKYELPKYVLSEPTNLIR  120

Query  184  D  182
            D
Sbjct  121  D  121



>ref|XP_009147606.1| PREDICTED: ubiquitin domain-containing protein 1-like [Brassica 
rapa]
Length=108

 Score =   145 bits (367),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S++S+ +  VK+IRKP+PWKH++PI++ +LV+MR EFWDTAPHYGG K++WDAL 
Sbjct  1    MGCAGSTQSQAEGAVKRIRKPEPWKHTQPISKAELVKMREEFWDTAPHYGGTKDLWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLS  206
            AAAEAD++LAQAIVD AG+IVQ  DLT CYDERGAKYELP+YVLS
Sbjct  61   AAAEADISLAQAIVDSAGVIVQNNDLTTCYDERGAKYELPKYVLS  105



>dbj|BAK00036.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=118

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 97/117 (83%), Gaps = 4/117 (3%)
 Frame = -3

Query  520  MGCAESS----RSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIW  353
            MGC  S+     + G +  KK+RKPKPWKH +PIT  QL QMR+EFWDTAPHYGG+KEIW
Sbjct  1    MGCVGSTPKGAGAAGGEATKKVRKPKPWKHPQPITIAQLRQMRDEFWDTAPHYGGRKEIW  60

Query  352  DalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            DAL AA+EAD+ALAQAIV+ AG+IV   DLT+CYDERGAKYELP+YVLSEPTNL++D
Sbjct  61   DALRAASEADVALAQAIVESAGVIVSNADLTLCYDERGAKYELPKYVLSEPTNLVQD  117



>gb|EYU29533.1| hypothetical protein MIMGU_mgv1a016597mg [Erythranthe guttata]
Length=115

 Score =   144 bits (364),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDT-VKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDal  344
            MGCA SS++K + T  KKIRKP+ WKH +PITR QL+Q+R EFWDTAPHYGG++EIWDAL
Sbjct  1    MGCAGSSQTKSEGTGKKKIRKPRAWKHPQPITRSQLIQLREEFWDTAPHYGGRQEIWDAL  60

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
             AAAEAD  L QAI++ AGI+V   D+TVC+DE GA+YELP+YVLSEP NLI
Sbjct  61   RAAAEADPTLVQAILENAGIVVHNADMTVCFDETGARYELPKYVLSEPKNLI  112



>ref|XP_002863459.1| hypothetical protein ARALYDRAFT_916885 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39718.1| hypothetical protein ARALYDRAFT_916885 [Arabidopsis lyrata subsp. 
lyrata]
Length=104

 Score =   144 bits (363),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -3

Query  478  VKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIV  299
             +KIRKPKPW H+EPITR QL  MR EFWDT+PHYGGQ+EIW+AL AAAEADL LAQ IV
Sbjct  3    AEKIRKPKPWAHTEPITRAQLTNMREEFWDTSPHYGGQREIWEALRAAAEADLKLAQTIV  62

Query  298  DGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            D AG+IVQ  DLT+C+DERGA+YELPRYVLS+PTNLIR+
Sbjct  63   DSAGVIVQNRDLTLCWDERGARYELPRYVLSDPTNLIRE  101



>ref|XP_009114393.1| PREDICTED: ubiquitin domain-containing protein 1 isoform X2 [Brassica 
rapa]
Length=106

 Score =   144 bits (362),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -3

Query  475  KKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVD  296
            +KI+KPKPW H+EPITR QL+ MR EFWDT+PHYGGQ+EIWDAL AAAEA+L LAQ I+D
Sbjct  6    EKIKKPKPWAHTEPITRAQLMNMREEFWDTSPHYGGQREIWDALRAAAEAELTLAQTIID  65

Query  295  GAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
             AG+IVQ  DLT+C+DERGAKYELPRYVLSEPTNLIR+
Sbjct  66   SAGVIVQGRDLTLCWDERGAKYELPRYVLSEPTNLIRE  103



>ref|XP_004244286.1| PREDICTED: ubiquitin domain-containing protein 2 [Solanum lycopersicum]
Length=115

 Score =   144 bits (363),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 92/115 (80%), Gaps = 1/115 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKI-RKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDal  344
            MG   SS  K +   K+I RKPKPWKH +PITR QL+Q+R EFWDTAPHYGG+KEIWDAL
Sbjct  1    MGACGSSHVKPNRIGKRIIRKPKPWKHPQPITRSQLMQLREEFWDTAPHYGGKKEIWDAL  60

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG  179
              AAEADL LAQAIVD AGII Q  ++T+CYDE G KYELP+YVLSEPTN+IR G
Sbjct  61   RGAAEADLELAQAIVDSAGIIAQNTNMTICYDESGTKYELPKYVLSEPTNMIRFG  115



>gb|KJB68830.1| hypothetical protein B456_011G036700 [Gossypium raimondii]
Length=100

 Score =   142 bits (358),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGC  S R++GD+ VKKIRKPKPWKHSEPITR QL QMR+EFWDTAPHYGGQ+EIWDAL 
Sbjct  1    MGCTGSKRTRGDENVKKIRKPKPWKHSEPITRTQLKQMRDEFWDTAPHYGGQREIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAK  233
             AAE++L  AQAI++ AG+IVQ  DLT+CYDERGAK
Sbjct  61   VAAESELTHAQAIINSAGVIVQNDDLTICYDERGAK  96



>dbj|BAB09216.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABN04771.1| At5g45740 [Arabidopsis thaliana]
Length=98

 Score =   139 bits (351),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -3

Query  463  KPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVDGAGI  284
            KPKPW H+EPITR QL  MR EFWDT+PHYGGQ+EIW+AL AAAEADL LAQ IVD AG+
Sbjct  2    KPKPWAHTEPITRAQLTNMREEFWDTSPHYGGQREIWEALRAAAEADLKLAQTIVDSAGV  61

Query  283  IVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            IVQ  DLT+C+DERGA+YELPRYVLSEPTNLIR+
Sbjct  62   IVQNRDLTLCWDERGARYELPRYVLSEPTNLIRE  95



>gb|KCW74157.1| hypothetical protein EUGRSUZ_E02790, partial [Eucalyptus grandis]
Length=101

 Score =   139 bits (351),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = -3

Query  475  KKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVD  296
            KKIRKPKPWKH E ITR QL++MR EFWDTAPHYGG++EIWDAL AAAEADL LAQAIVD
Sbjct  3    KKIRKPKPWKHPEAITRTQLMKMREEFWDTAPHYGGRQEIWDALHAAAEADLTLAQAIVD  62

Query  295  GAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
              G+IVQ   LT+CYDERGAKYELP+ VLSEPTNLI
Sbjct  63   SVGVIVQRAHLTICYDERGAKYELPKNVLSEPTNLI  98



>ref|XP_010498035.1| PREDICTED: ubiquitin domain-containing protein 2-like [Camelina 
sativa]
 ref|XP_010476831.1| PREDICTED: ubiquitin domain-containing protein 2-like [Camelina 
sativa]
Length=114

 Score =   140 bits (352),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 92/113 (81%), Gaps = 2/113 (2%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa-l  344
            MGC+ SSR+  +   +KIR+PK WKH +PI+R +L QMR EFWDTAPHYGG+KEIWDA  
Sbjct  1    MGCS-SSRTIAEGKKEKIRRPKTWKHPQPISRAELTQMREEFWDTAPHYGGKKEIWDALR  59

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR  185
             AA E DL+LAQ I++ AG+IVQ  DLT+CYDE+G+KYELP+YVL +P+NLIR
Sbjct  60   AAAEEEDLSLAQTIIESAGVIVQNTDLTICYDEKGSKYELPKYVLRDPSNLIR  112



>ref|XP_006416755.1| hypothetical protein EUTSA_v10009149mg [Eutrema salsugineum]
 gb|ESQ35108.1| hypothetical protein EUTSA_v10009149mg [Eutrema salsugineum]
Length=114

 Score =   139 bits (351),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 92/113 (81%), Gaps = 2/113 (2%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa-l  344
            MGC+ SSR+  +   +KIR+PK WKH +PI+R +L QMR EFWDTAPHYGG+KEIWDA  
Sbjct  1    MGCS-SSRTMTEGRKEKIRRPKSWKHPQPISRAELTQMREEFWDTAPHYGGKKEIWDALR  59

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR  185
             AA E DL+LAQ I++ AG+IVQ  DLT+CYDE+G+KYELP+YVL +P+NLIR
Sbjct  60   AAAEEEDLSLAQTIIESAGVIVQNTDLTICYDEKGSKYELPKYVLRDPSNLIR  112



>ref|NP_173140.1| ubiquitin domain-containing protein [Arabidopsis thaliana]
 gb|AAF99836.1|AC051629_3 Hypothetical protein [Arabidopsis thaliana]
 gb|AAT41777.1| At1g16960 [Arabidopsis thaliana]
 gb|AAT70467.1| At1g16960 [Arabidopsis thaliana]
 gb|AEE29526.1| ubiquitin domain-containing protein [Arabidopsis thaliana]
Length=114

 Score =   139 bits (350),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa-l  344
            MGC+ SSR+  +   +KIR+PK WKH +PI+RD+L QMR EFWDTAPHYGG+KEIWDA  
Sbjct  1    MGCS-SSRTIAEGKKEKIRRPKTWKHPQPISRDELTQMREEFWDTAPHYGGKKEIWDALR  59

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
             AA E DL+LAQ I++ AG+IVQ  DLT+CYDE+G+KYELP+YVL +P+NLI
Sbjct  60   AAAEEDDLSLAQTILESAGVIVQNTDLTICYDEKGSKYELPKYVLRDPSNLI  111



>gb|KFK43908.1| hypothetical protein AALP_AA1G189600 [Arabis alpina]
Length=114

 Score =   139 bits (349),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 92/113 (81%), Gaps = 2/113 (2%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa-l  344
            MGC+ SSR+  +   +KIR+PK WKH +PI+R +L QMR EFWDTAPHYGG+KEIWDA  
Sbjct  1    MGCS-SSRTITEGRKEKIRRPKSWKHPQPISRAELTQMREEFWDTAPHYGGKKEIWDALR  59

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR  185
             AA E DL+LAQ I++ AG+IVQ  DLT+CYDE+G+KYELP+YVL +P+NLIR
Sbjct  60   AAAEEEDLSLAQTIIESAGVIVQNTDLTICYDEKGSKYELPKYVLRDPSNLIR  112



>ref|XP_006304316.1| hypothetical protein CARUB_v10010695mg [Capsella rubella]
 gb|EOA37214.1| hypothetical protein CARUB_v10010695mg [Capsella rubella]
Length=114

 Score =   139 bits (349),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 92/113 (81%), Gaps = 2/113 (2%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa-l  344
            MGC+ SSR+  +   +KIR+P+ WKH +PI+R +L QMR EFWDTAPHYGG+KEIWDA  
Sbjct  1    MGCS-SSRTIAEGKKEKIRRPRTWKHPQPISRAELTQMREEFWDTAPHYGGKKEIWDALR  59

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR  185
             AA E DL+LAQ I++ AG+IVQ  DLT+CYDE+G+KYELP+YVL +P+NLIR
Sbjct  60   AAAEEEDLSLAQTIIESAGVIVQNTDLTICYDEKGSKYELPKYVLRDPSNLIR  112



>ref|XP_010459254.1| PREDICTED: ubiquitin domain-containing protein 2-like [Camelina 
sativa]
Length=128

 Score =   139 bits (350),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 95/116 (82%), Gaps = 2/116 (2%)
 Frame = -3

Query  529  LHTMGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWD  350
            +  MGC+ SSR+  +   +KIR+PK WKH +PI+R +L QMR EFWDTAPHYGG+KEIWD
Sbjct  12   IQIMGCS-SSRTIVEGKKEKIRRPKTWKHPQPISRAELTQMREEFWDTAPHYGGKKEIWD  70

Query  349  alcaaaead-lalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR  185
            AL AAAE + L+LAQ I++ AG+IVQ  DLT+CYDE+G+KYELP+YVL +P+NLIR
Sbjct  71   ALRAAAEEEDLSLAQTIIESAGVIVQNTDLTICYDEKGSKYELPKYVLRDPSNLIR  126



>gb|AFW78775.1| hypothetical protein ZEAMMB73_124051 [Zea mays]
Length=145

 Score =   139 bits (351),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 97/146 (66%), Gaps = 33/146 (23%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S+  K D+  KK+++PK WKH++PIT  +L QMR+EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCAGST-PKVDENSKKLKRPKAWKHTQPITPARLKQMRDEFWDTAPHYGGQKEIWDALR  59

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDER---------------------------  242
             AAE+DLALAQ IVD AGIIV  PD+T+CYDER                           
Sbjct  60   VAAESDLALAQTIVDSAGIIVSNPDMTLCYDERGEQGLATPHFHDSLYRPVVHARPMSKT  119

Query  241  -----GAKYELPRYVLSEPTNLIRDG  179
                 GAKYELP+YVLSEP NLIRDG
Sbjct  120  EDSVAGAKYELPKYVLSEPANLIRDG  145



>ref|XP_004961420.1| PREDICTED: ubiquitin domain-containing protein 2-like isoform 
X2 [Setaria italica]
Length=121

 Score =   138 bits (348),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = -3

Query  523  TMGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDal  344
             MGCA S+  K D+  KK++KPK WKH++PIT  QL QMR+EFWDTAPHYGGQKEIWDAL
Sbjct  8    AMGCAGST-PKVDENSKKLKKPKAWKHTQPITPAQLKQMRDEFWDTAPHYGGQKEIWDAL  66

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG  179
              AAE+DLALAQ IVD AGIIV  PD+T+CYDERGAKYELP+YVLSEPTNLIR G
Sbjct  67   KVAAESDLALAQTIVDSAGIIVSNPDMTLCYDERGAKYELPKYVLSEPTNLIRQG  121



>emb|CDX96797.1| BnaA08g23400D [Brassica napus]
Length=114

 Score =   138 bits (347),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 91/113 (81%), Gaps = 2/113 (2%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa-l  344
            MGC+ SS +K +   +KIR+PK WKH +PI+R +L QMR EFWDTAPHYGG+KEIWDA  
Sbjct  1    MGCS-SSTAKAEGRKEKIRRPKSWKHPQPISRAELTQMREEFWDTAPHYGGKKEIWDALR  59

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR  185
             AA E DL+LAQ I++ AG+IV   DLT+CYDE+G+KYELP+YVL +P+NLIR
Sbjct  60   AAAEEEDLSLAQTIIESAGVIVHNADLTICYDEKGSKYELPKYVLRDPSNLIR  112



>emb|CDX83930.1| BnaC08g17150D [Brassica napus]
Length=114

 Score =   138 bits (347),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 91/113 (81%), Gaps = 2/113 (2%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa-l  344
            MGC+ SS +K +   +KIR+PK WKH +PI+R +L QMR EFWDTAPHYGG+KEIWDA  
Sbjct  1    MGCS-SSTAKAEGRKEKIRRPKSWKHPQPISRAELTQMREEFWDTAPHYGGKKEIWDALR  59

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR  185
             AA E DL+LAQ I++ AG+IV   DLT+CYDE+G+KYELP+YVL +P+NLIR
Sbjct  60   AAAEEEDLSLAQTIIESAGVIVHNTDLTICYDEKGSKYELPKYVLRDPSNLIR  112



>ref|XP_010494699.1| PREDICTED: ubiquitin domain-containing protein 1-like [Camelina 
sativa]
Length=118

 Score =   138 bits (347),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKP--WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa  347
            MGC  SS++  +  VK+ +  KP  W H+EPITR QL  MR EFWDT+PHYGGQ+EIWDA
Sbjct  1    MGCIGSSQANNEGGVKRKKLRKPKPWAHTEPITRAQLTNMREEFWDTSPHYGGQREIWDA  60

Query  346  lcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            L AAAEADL LAQ IVD AG+IVQ  DLT+C+DERGA+YELPRYVLSEPTNLIR+
Sbjct  61   LRAAAEADLKLAQTIVDSAGVIVQNSDLTLCWDERGARYELPRYVLSEPTNLIRE  115



>ref|XP_009110431.1| PREDICTED: ubiquitin domain-containing protein 2 [Brassica rapa]
Length=114

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 91/113 (81%), Gaps = 2/113 (2%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa-l  344
            MGC+ SS +K +   +KIR+PK WKH +PI+R +L QMR EFWDTAPHYGG+KEIWDA  
Sbjct  1    MGCS-SSTAKAEGRKEKIRRPKSWKHPQPISRAELTQMREEFWDTAPHYGGKKEIWDALR  59

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR  185
             AA E DL+LAQ I++ AG+IV   DLT+CYDE+G+KYELP+YVL +P+NLIR
Sbjct  60   AAAEEEDLSLAQTIIESAGVIVHNNDLTICYDEKGSKYELPKYVLRDPSNLIR  112



>ref|XP_006398257.1| hypothetical protein EUTSA_v10001078mg [Eutrema salsugineum]
 gb|ESQ39710.1| hypothetical protein EUTSA_v10001078mg [Eutrema salsugineum]
Length=118

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = -3

Query  520  MGCAESS--RSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa  347
            MGC  SS  R++G    KKIRKPKPW H+EPIT  QL  MR EFWDT+PHYGGQ+EIW+A
Sbjct  1    MGCIGSSQARNEGGAKRKKIRKPKPWAHTEPITMAQLTNMREEFWDTSPHYGGQREIWEA  60

Query  346  lcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            L AAAEADL LAQ I+D AG+IVQ PDLT+C+DERGA+YELPRYVLSEPTNLIR+
Sbjct  61   LRAAAEADLKLAQTIIDSAGVIVQNPDLTLCWDERGARYELPRYVLSEPTNLIRE  115



>ref|XP_001777174.1| predicted protein [Physcomitrella patens]
 gb|EDQ57954.1| predicted protein, partial [Physcomitrella patens]
Length=101

 Score =   136 bits (343),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -3

Query  475  KKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVD  296
            K  RKP+ WKH+E ITR QL QMR+EFWDTA HYGGQKEIWDAL AAA A++ LAQ IVD
Sbjct  4    KNFRKPRSWKHTEAITRAQLKQMRDEFWDTALHYGGQKEIWDALRAAAGAEINLAQLIVD  63

Query  295  GAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
             AGIIVQ+ DL+ CYDERGAKY+LP YVLSEPTN+  D
Sbjct  64   SAGIIVQSEDLSTCYDERGAKYDLPTYVLSEPTNIKED  101



>ref|XP_002890195.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66454.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=114

 Score =   137 bits (344),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 91/113 (81%), Gaps = 2/113 (2%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa-l  344
            MGC+ SSR+  +   +KIR+PK WKH +PI+  +L QMR EFWDTAPHYGG+KEIWDA  
Sbjct  1    MGCS-SSRTIAEGKKEKIRRPKTWKHPQPISSAELTQMREEFWDTAPHYGGKKEIWDALR  59

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR  185
             AA E DL+LAQ I++ AG+IVQ  DLT+CYDE+G+KYELP+YVL +P+NLIR
Sbjct  60   AAAEEEDLSLAQTILESAGVIVQNTDLTICYDEKGSKYELPKYVLRDPSNLIR  112



>ref|XP_006377742.1| hypothetical protein POPTR_0011s10900g [Populus trichocarpa]
 gb|ERP55539.1| hypothetical protein POPTR_0011s10900g [Populus trichocarpa]
Length=95

 Score =   135 bits (341),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS++K D  VKKIRKPKPWKH +PIT+ QL+QMR+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQAKSDGNVKKIRKPKPWKHPQPITKSQLMQMRDEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERG  239
            AAA+A+L+LAQAIVD AG+IVQ  DLT+CYDERG
Sbjct  61   AAADAELSLAQAIVDSAGVIVQNADLTICYDERG  94



>ref|XP_006442423.1| hypothetical protein CICLE_v10022935mg [Citrus clementina]
 gb|ESR55663.1| hypothetical protein CICLE_v10022935mg [Citrus clementina]
Length=108

 Score =   136 bits (342),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS+SK D TVKKIRKPKPWKH +PIT+ QL+Q+R+EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSSQSKADGTVKKIRKPKPWKHPQPITKSQLMQLRDEFWDTAPHYGGRKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDER  242
            AAAEADL+LAQAIVD AG+IVQ+ DLT+CYDER
Sbjct  61   AAAEADLSLAQAIVDSAGVIVQSADLTICYDER  93



>ref|XP_006282209.1| hypothetical protein CARUB_v10028475mg [Capsella rubella]
 gb|EOA15107.1| hypothetical protein CARUB_v10028475mg [Capsella rubella]
Length=118

 Score =   136 bits (342),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKP--WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa  347
            MGC  SS++  +  V+K +  KP  W H+EPITR QLV MR EFWDT+PHYGGQ+EIW+A
Sbjct  1    MGCIGSSQANNEGGVRKKKIRKPKPWAHTEPITRAQLVNMREEFWDTSPHYGGQREIWEA  60

Query  346  lcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            L AAAEADL LAQ IV+ AG+IVQ  DLT+C+DERGA+YELPRYVLSEPTNLIR+
Sbjct  61   LRAAAEADLKLAQTIVESAGVIVQNRDLTLCWDERGARYELPRYVLSEPTNLIRE  115



>ref|XP_010481536.1| PREDICTED: ubiquitin domain-containing protein 1-like [Camelina 
sativa]
Length=118

 Score =   135 bits (340),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKP--WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa  347
            MGC  SS++  +  VK+ +  KP  W H+EPITR QL  MR EFWDT+PHYGGQ+EIWDA
Sbjct  1    MGCIGSSQANNEGGVKRKKLRKPKPWPHTEPITRAQLTNMREEFWDTSPHYGGQREIWDA  60

Query  346  lcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            L AAAEADL LAQ IVD AG+IVQ  DL++C+DERGA+YELPRYVLSEPTNLIR+
Sbjct  61   LRAAAEADLKLAQTIVDSAGVIVQNSDLSLCWDERGARYELPRYVLSEPTNLIRE  115



>ref|XP_010537717.1| PREDICTED: ubiquitin domain-containing protein 1 [Tarenaya hassleriana]
Length=114

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S         + +R+PK WKH  PI++ +LVQMR EFWDTAPHYGG+KEIWDAL 
Sbjct  1    MGCAGSRPKTDGQRERSLRRPKSWKHPSPISKAELVQMREEFWDTAPHYGGKKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            AAAEAD  LAQAIV+ AG+IV   DL++CYD++GAKYELP+YVLSEP+NLI
Sbjct  61   AAAEADACLAQAIVESAGVIVHNTDLSICYDQKGAKYELPKYVLSEPSNLI  111



>ref|XP_002440118.1| hypothetical protein SORBIDRAFT_09g026390 [Sorghum bicolor]
 gb|EES18548.1| hypothetical protein SORBIDRAFT_09g026390 [Sorghum bicolor]
Length=105

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = -3

Query  445  HSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVDGAGIIVQAPD  266
            H++PIT  QL QMR+EFWDTAPHYGGQKEIWDAL  AAE+DLALAQ IVD AGII+  PD
Sbjct  17   HTQPITPAQLKQMRDEFWDTAPHYGGQKEIWDALRVAAESDLALAQTIVDSAGIIISNPD  76

Query  265  LTVCYDERGAKYELPRYVLSEPTNLIRDG  179
            +T+CYDERGAKYELP+YVLSEPTNLIRDG
Sbjct  77   MTLCYDERGAKYELPKYVLSEPTNLIRDG  105



>ref|XP_010441674.1| PREDICTED: ubiquitin domain-containing protein 1-like [Camelina 
sativa]
Length=118

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKP--WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa  347
            MGC  SS++  +  VK+ +  KP  W H+EPITR QL  MR EFWDT+PHYGGQ+EIWDA
Sbjct  1    MGCIGSSQANNEGGVKRKKLRKPKPWAHTEPITRAQLTNMREEFWDTSPHYGGQREIWDA  60

Query  346  lcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            L AAAEADL LAQ IVD AG+IVQ  DL++C DERGA+YELPRYVLSEPTNLIR+
Sbjct  61   LRAAAEADLKLAQTIVDSAGVIVQNSDLSLCGDERGARYELPRYVLSEPTNLIRE  115



>ref|NP_001044147.2| Os01g0731000 [Oryza sativa Japonica Group]
 dbj|BAB63530.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEC71431.1| hypothetical protein OsI_03626 [Oryza sativa Indica Group]
 gb|EEE55337.1| hypothetical protein OsJ_03349 [Oryza sativa Japonica Group]
 dbj|BAF06061.2| Os01g0731000 [Oryza sativa Japonica Group]
Length=113

 Score =   134 bits (338),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 98/114 (86%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S+  K DD  KK++KPKPWKH++ IT  QL QMR+EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCAGST-PKTDDNSKKLKKPKPWKHNQAITTTQLKQMRDEFWDTAPHYGGQKEIWDALR  59

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG  179
            AAAEA+L+LAQ IVD AGIIV   D+T+CYDERGAKYELP+YVLSEPTNLIR+G
Sbjct  60   AAAEAELSLAQTIVDSAGIIVSNSDMTICYDERGAKYELPKYVLSEPTNLIREG  113



>ref|XP_004969844.1| PREDICTED: ubiquitin domain-containing protein 1-like [Setaria 
italica]
Length=113

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 98/114 (86%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S+  K DD  KK++KPKPWKH++ IT  QL QMR+EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCAGST-PKTDDNGKKLKKPKPWKHTQAITLAQLRQMRDEFWDTAPHYGGQKEIWDALR  59

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG  179
            AAA++DLALAQ IVD AGIIV   D+T+CYDERGAKYELP+YVLSEPTNLIR+G
Sbjct  60   AAADSDLALAQTIVDSAGIIVSNSDMTLCYDERGAKYELPKYVLSEPTNLIREG  113



>emb|CDM84088.1| unnamed protein product [Triticum aestivum]
Length=113

 Score =   130 bits (328),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 94/113 (83%), Gaps = 1/113 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S+  K DD+ KK++K KPWKH++ IT  QL QMR EFWDT PHYGGQKEIWDAL 
Sbjct  1    MGCAGST-PKSDDSSKKLKKTKPWKHTQSITPAQLKQMREEFWDTTPHYGGQKEIWDALR  59

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEADL+LAQ IVD AGIIV   D+T+CYDERGAKYELP+YVLSEPTN IR+
Sbjct  60   AAAEADLSLAQTIVDSAGIIVSNSDMTLCYDERGAKYELPKYVLSEPTNFIRE  112



>ref|XP_002965986.1| hypothetical protein SELMODRAFT_84425, partial [Selaginella moellendorffii]
 ref|XP_002989241.1| hypothetical protein SELMODRAFT_129453, partial [Selaginella 
moellendorffii]
 gb|EFJ09679.1| hypothetical protein SELMODRAFT_129453, partial [Selaginella 
moellendorffii]
 gb|EFJ33406.1| hypothetical protein SELMODRAFT_84425, partial [Selaginella moellendorffii]
Length=95

 Score =   130 bits (327),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = -3

Query  463  KPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVDGAGI  284
            KPKPWKH E ITR QL +MR EFWDTAPHYGGQ+EIWDAL AAAEADL+LAQ IVD AGI
Sbjct  1    KPKPWKHPEAITRGQLKKMREEFWDTAPHYGGQREIWDALKAAAEADLSLAQTIVDSAGI  60

Query  283  IVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            IV   DL+ CYDERG+KY+LP+ VLSEP N+++D
Sbjct  61   IVTTDDLSTCYDERGSKYDLPKIVLSEPLNMVKD  94



>ref|XP_002458445.1| hypothetical protein SORBIDRAFT_03g033670 [Sorghum bicolor]
 gb|EES03565.1| hypothetical protein SORBIDRAFT_03g033670 [Sorghum bicolor]
Length=113

 Score =   129 bits (325),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 98/114 (86%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S+  K +D  KK++KPKPWKH++ IT  QL QMR+EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCAGSTL-KPEDNGKKLKKPKPWKHTQAITPAQLRQMRDEFWDTAPHYGGQKEIWDALR  59

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG  179
            AAA++DLALAQ IVD AGII+   D+T+CYDERGAKYELP+YVLSEPTNLI+DG
Sbjct  60   AAADSDLALAQTIVDSAGIIISNSDMTLCYDERGAKYELPKYVLSEPTNLIKDG  113



>ref|XP_006654689.1| PREDICTED: ubiquitin domain-containing protein 1-like [Oryza 
brachyantha]
Length=113

 Score =   129 bits (323),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA  S  K D+  KK++KPKPWKH++ IT  QL QMR EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCA-GSTPKVDEHGKKLKKPKPWKHTQAITPAQLSQMREEFWDTAPHYGGQKEIWDALR  59

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG  179
            AAAEA+L+LAQ IV+ AGIIV   D+T+CYDERGAKYELP+YVLSEPTNLIRDG
Sbjct  60   AAAEAELSLAQTIVESAGIIVSNSDMTLCYDERGAKYELPKYVLSEPTNLIRDG  113



>ref|XP_011629384.1| PREDICTED: ubiquitin domain-containing protein 1 [Amborella trichopoda]
Length=149

 Score =   127 bits (318),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA SS+   + TVKK+RKPKPWKH++ ITR QL QMR+EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCAGSSQKSSEGTVKKLRKPKPWKHTQSITRMQLRQMRDEFWDTAPHYGGQKEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERG  239
            AAAEAD++LAQAIVD AG+IV + D++ CYDER 
Sbjct  61   AAAEADMSLAQAIVDSAGVIVTSADMSTCYDERA  94



>gb|EAY98782.1| hypothetical protein OsI_20722 [Oryza sativa Indica Group]
Length=113

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 95/113 (84%), Gaps = 1/113 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S+  K D+  KK++KPKPWKH++ IT  QL +MR EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCAGST-PKVDENSKKLKKPKPWKHTQAITPTQLSKMREEFWDTAPHYGGQKEIWDALR  59

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEA+L LAQ IV+ AGIIV   D+T+CYDERGAKYELP+YVLSEPTNLIR+
Sbjct  60   AAAEAELPLAQTIVNSAGIIVSNSDMTLCYDERGAKYELPKYVLSEPTNLIRE  112



>ref|NP_001056122.1| Os05g0529400 [Oryza sativa Japonica Group]
 gb|AAS72343.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAU43969.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18036.1| Os05g0529400 [Oryza sativa Japonica Group]
 dbj|BAG88889.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64448.1| hypothetical protein OsJ_19294 [Oryza sativa Japonica Group]
Length=113

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 1/113 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S+  K D+  KK++KPKPWKH++ IT  QL +MR EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCAGST-PKVDENSKKLKKPKPWKHTQAITPTQLSKMREEFWDTAPHYGGQKEIWDALR  59

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAAEA+L LAQ IV+ AGI+V   D+T+CYDERGAKYELP+YVLSEPTNLIR+
Sbjct  60   AAAEAELPLAQTIVNSAGIVVSNSDMTLCYDERGAKYELPKYVLSEPTNLIRE  112



>ref|XP_006442422.1| hypothetical protein CICLE_v10022935mg [Citrus clementina]
 gb|ESR55662.1| hypothetical protein CICLE_v10022935mg [Citrus clementina]
 gb|KDO51504.1| hypothetical protein CISIN_1g033388mg [Citrus sinensis]
Length=79

 Score =   121 bits (303),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = -3

Query  415  VQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGA  236
            +Q+R+EFWDTAPHYGG+KEIWDAL AAAEADL+LAQAIVD AG+IVQ+ DLT+CYDERGA
Sbjct  1    MQLRDEFWDTAPHYGGRKEIWDALRAAAEADLSLAQAIVDSAGVIVQSADLTICYDERGA  60

Query  235  KYELPRYVLSEPTNLIRDG  179
            KYELP+YVLSEPTNLIR+G
Sbjct  61   KYELPKYVLSEPTNLIREG  79



>ref|XP_002863457.1| hypothetical protein ARALYDRAFT_356432 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39716.1| hypothetical protein ARALYDRAFT_356432 [Arabidopsis lyrata subsp. 
lyrata]
Length=122

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = -3

Query  520  MGCAESS--RSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa  347
            MGC  SS  R++G    KKIRKPKPW H+EPITR QL  MR EFWDT+PHYGGQ+EIW+A
Sbjct  1    MGCIGSSHARNEGGVKKKKIRKPKPWAHTEPITRAQLTNMREEFWDTSPHYGGQREIWEA  60

Query  346  lcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            L AAAEADL LAQ IVD AG+IVQ  DLT+C+DERGA+YELPRYVL     L+
Sbjct  61   LRAAAEADLKLAQTIVDSAGVIVQNRDLTLCWDERGARYELPRYVLRASPTLV  113



>gb|EMS59669.1| hypothetical protein TRIUR3_28938 [Triticum urartu]
Length=129

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -3

Query  445  HSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVDGAGIIVQAPD  266
            H++ IT  QL QMR EFWDT PHYGGQKEIWDAL AAAEADLALAQ IVD AGIIV   D
Sbjct  41   HTQSITPAQLKQMREEFWDTTPHYGGQKEIWDALRAAAEADLALAQTIVDSAGIIVTNSD  100

Query  265  LTVCYDERGAKYELPRYVLSEPTNLIRD  182
            +T+CYDERGAKYELP+YVLSEPTNLIR+
Sbjct  101  MTLCYDERGAKYELPKYVLSEPTNLIRE  128



>gb|ACF83822.1| unknown [Zea mays]
Length=77

 Score =   119 bits (299),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = -3

Query  409  MRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKY  230
            MR+EFWDTAPHYGGQKEIWDAL  AAE+DLALAQ IVD AGIIV  PD+T+CYDERGAKY
Sbjct  1    MRDEFWDTAPHYGGQKEIWDALRVAAESDLALAQTIVDSAGIIVSNPDMTLCYDERGAKY  60

Query  229  ELPRYVLSEPTNLIRDG  179
            ELP+YVLSEP NLIRDG
Sbjct  61   ELPKYVLSEPANLIRDG  77



>gb|EMT14520.1| hypothetical protein F775_02090 [Aegilops tauschii]
Length=125

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -3

Query  445  HSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVDGAGIIVQAPD  266
            H++ IT  QL QMR EFWDT PHYGGQKEIWDAL AAAEADL+LAQ IVD AGIIV   D
Sbjct  37   HTQSITPAQLKQMREEFWDTTPHYGGQKEIWDALRAAAEADLSLAQPIVDSAGIIVSNSD  96

Query  265  LTVCYDERGAKYELPRYVLSEPTNLI  188
            +T+CYDERGAKYELP+YVLSEPTNLI
Sbjct  97   MTLCYDERGAKYELPKYVLSEPTNLI  122



>gb|EPS62363.1| hypothetical protein M569_12428, partial [Genlisea aurea]
Length=110

 Score =   119 bits (297),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGC  SS +K       +RKP+PW + +P+ R  L+Q+R+EFWD+AP  GG++EIWDAL 
Sbjct  1    MGCVGSSEAKTPTAKGMMRKPRPWSYPQPMARTHLIQLRDEFWDSAPRCGGRQEIWDALR  60

Query  340  aaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNL  191
            AAAE D   A  ++D AGI V   DL+VCYD  G +YELP YVLS+PTNL
Sbjct  61   AAAEGDPTQAHTVLDSAGITVHRADLSVCYDRAGVRYELPNYVLSDPTNL  110



>ref|XP_008775886.1| PREDICTED: ubiquitin domain-containing protein 2-like [Phoenix 
dactylifera]
Length=77

 Score =   117 bits (293),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  409  MRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKY  230
            MR+EFWDTAPHYGGQKEIWDAL A AEADL LAQAIVD AGIIV   D+T+CYDERGAKY
Sbjct  1    MRDEFWDTAPHYGGQKEIWDALRATAEADLTLAQAIVDSAGIIVSNADMTLCYDERGAKY  60

Query  229  ELPRYVLSEPTNLIRD  182
            ELP+YVLSEPTNLIRD
Sbjct  61   ELPKYVLSEPTNLIRD  76



>emb|CDX81793.1| BnaC08g38080D [Brassica napus]
Length=124

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 85/109 (78%), Gaps = 7/109 (6%)
 Frame = -3

Query  493  KGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaea-dla  317
            + D   +KIR+PK WKH +PI+R +L QM  EFWDTAPHYGG+KEIWDAL AAAE  DL+
Sbjct  13   EADGRKEKIRRPKTWKHPQPISRAELTQMGEEFWDTAPHYGGKKEIWDALRAAAEEDDLS  72

Query  316  laqAIVDGAGIIVQAPDLTVCYDER------GAKYELPRYVLSEPTNLI  188
            LAQ +++ AG++VQ  DLT+CYDE+      G+KY+LP+YVL +P+NLI
Sbjct  73   LAQTVIESAGVVVQNADLTICYDEKVIFFWLGSKYKLPKYVLRDPSNLI  121



>gb|KDO51503.1| hypothetical protein CISIN_1g033388mg [Citrus sinensis]
Length=80

 Score =   115 bits (287),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 76/80 (95%), Gaps = 1/80 (1%)
 Frame = -3

Query  415  VQMRNEFWDTAPHYGGQK-EIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERG  239
            +Q+R+EFWDTAPHYGG+K +IWDAL AAAEADL+LAQAIVD AG+IVQ+ DLT+CYDERG
Sbjct  1    MQLRDEFWDTAPHYGGRKGKIWDALRAAAEADLSLAQAIVDSAGVIVQSADLTICYDERG  60

Query  238  AKYELPRYVLSEPTNLIRDG  179
            AKYELP+YVLSEPTNLIR+G
Sbjct  61   AKYELPKYVLSEPTNLIREG  80



>gb|KCW74156.1| hypothetical protein EUGRSUZ_E02789 [Eucalyptus grandis]
Length=79

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  415  VQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGA  236
            ++MR EFWDTAPHYGG++EIWDAL AAAEADL LAQAIVD AG+IVQ  DLT+CYDERGA
Sbjct  1    MKMREEFWDTAPHYGGRQEIWDALHAAAEADLTLAQAIVDSAGVIVQRADLTICYDERGA  60

Query  235  KYELPRYVLSEPTNLI  188
            KYELP+YVLSEPTNLI
Sbjct  61   KYELPKYVLSEPTNLI  76



>gb|EMS50772.1| hypothetical protein TRIUR3_13144 [Triticum urartu]
Length=292

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 80/100 (80%), Gaps = 4/100 (4%)
 Frame = -3

Query  520  MGCAESS----RSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIW  353
            MGCA S+     + G +  KK+RKPKPWKH +PIT  QL QMR+EFWDTAPHYGG+KEIW
Sbjct  178  MGCAGSTPKGAAAAGGEATKKVRKPKPWKHPQPITIAQLRQMRDEFWDTAPHYGGRKEIW  237

Query  352  DalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAK  233
            DAL AA+EAD+ALAQAIV+ AG+IV   DLT+CYDER AK
Sbjct  238  DALRAASEADVALAQAIVESAGVIVSNADLTLCYDERDAK  277



>gb|KDD73802.1| hypothetical protein H632_c1825p0 [Helicosporidium sp. ATCC 50920]
Length=128

 Score =   108 bits (269),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 80/117 (68%), Gaps = 7/117 (6%)
 Frame = -3

Query  517  GCAESSRS---KGDD---TVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEI  356
             C ++ R+   K DD         KPK WK SEP+T ++L  MR EFWDT PHY G + +
Sbjct  4    SCCKAQRTDATKDDDLDANATNFVKPK-WKSSEPLTEEKLKAMREEFWDTEPHYSGARVV  62

Query  355  WDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR  185
            WDAL AAAEADLA A+ IV  AGI+V +PDLT+CYD +G+KY LP+YVLS P NL R
Sbjct  63   WDALRAAAEADLATARLIVSSAGIVVSSPDLTLCYDVKGSKYLLPKYVLSNPVNLAR  119



>ref|XP_010057132.1| PREDICTED: ubiquitin domain-containing protein 2-like [Eucalyptus 
grandis]
Length=79

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  415  VQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGA  236
            ++MR EFWDTAPHYGG++EIWDAL AAAEADL LAQAIVD  G+IVQ   LT+CYDERGA
Sbjct  1    MKMREEFWDTAPHYGGRQEIWDALHAAAEADLTLAQAIVDSVGVIVQRAHLTICYDERGA  60

Query  235  KYELPRYVLSEPTNLI  188
            KYELP+ VLSEPTNLI
Sbjct  61   KYELPKNVLSEPTNLI  76



>ref|XP_004961419.1| PREDICTED: ubiquitin domain-containing protein 2-like isoform 
X1 [Setaria italica]
Length=162

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 84/105 (80%), Gaps = 1/105 (1%)
 Frame = -3

Query  523  TMGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDal  344
             MGCA S+  K D+  KK++KPK WKH++PIT  QL QMR+EFWDTAPHYGGQKEIWDAL
Sbjct  8    AMGCAGST-PKVDENSKKLKKPKAWKHTQPITPAQLKQMRDEFWDTAPHYGGQKEIWDAL  66

Query  343  caaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVL  209
              AAE+DLALAQ IVD AGIIV  PD+T+CYDERG    +P++++
Sbjct  67   KVAAESDLALAQTIVDSAGIIVSNPDMTLCYDERGEHAIIPKFLI  111



>ref|XP_005648130.1| hypothetical protein COCSUDRAFT_53398 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23586.1| hypothetical protein COCSUDRAFT_53398 [Coccomyxa subellipsoidea 
C-169]
Length=142

 Score =   105 bits (262),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = -3

Query  475  KKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVD  296
            KK ++P  WK  EP T   L   R EFWDT PHYGG + IWDAL AA E+DL  A+ I+D
Sbjct  20   KKFKRPV-WKSEEPCTESDLQAKREEFWDTQPHYGGDRVIWDALKAACESDLQTAKLILD  78

Query  295  GAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNL  191
             AG++V + D++VCYDERG KYELP+YVL+ P+NL
Sbjct  79   SAGVVVASDDMSVCYDERGGKYELPKYVLNAPSNL  113



>ref|XP_002950807.1| hypothetical protein VOLCADRAFT_117710 [Volvox carteri f. nagariensis]
 gb|EFJ48122.1| hypothetical protein VOLCADRAFT_117710 [Volvox carteri f. nagariensis]
Length=84

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -3

Query  433  ITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVC  254
            +T  QL + R EFWDT PHYGG + IWDAL AA +AD    + +++ AGIIV A D++VC
Sbjct  1    MTSAQLQKKREEFWDTQPHYGGDRNIWDALKAACDADPETCKLVIESAGIIVAAADMSVC  60

Query  253  YDERGAKYELPRYVLSEPTNLIRD  182
            YDERGAKYELP+YVLS+P NLI++
Sbjct  61   YDERGAKYELPKYVLSDPVNLIKE  84



>ref|XP_001692964.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03533.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=91

 Score =   102 bits (254),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -3

Query  427  RDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYD  248
            R +L + R EFWDT P+YGG + IWDAL AA EAD    + I++ AGIIV APD+T+CYD
Sbjct  9    RCELQKKREEFWDTQPYYGGDRVIWDALKAACEADQETCKLIIESAGIIVAAPDMTICYD  68

Query  247  ERGAKYELPRYVLSEPTNLIRD  182
            ERGAKYELP+YVL+EP NL +D
Sbjct  69   ERGAKYELPKYVLAEPVNLTKD  90



>ref|XP_010057136.1| PREDICTED: ubiquitin domain-containing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010057138.1| PREDICTED: ubiquitin domain-containing protein 2-like [Eucalyptus 
grandis]
Length=89

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 69/86 (80%), Gaps = 10/86 (12%)
 Frame = -3

Query  415  VQMRNEFWDTAPHYGGQK----------EIWDalcaaaeadlalaqAIVDGAGIIVQAPD  266
            ++MR EFWDTAPHYGG++          EI DAL AAAEADL LAQAIVD AG+IVQ  D
Sbjct  1    MKMREEFWDTAPHYGGRQDWLSNLILLSEICDALHAAAEADLMLAQAIVDSAGVIVQRAD  60

Query  265  LTVCYDERGAKYELPRYVLSEPTNLI  188
            LT+CYDERGAKYELP+YVLSEPTNLI
Sbjct  61   LTICYDERGAKYELPKYVLSEPTNLI  86



>ref|XP_005849198.1| hypothetical protein CHLNCDRAFT_15068, partial [Chlorella variabilis]
 gb|EFN57096.1| hypothetical protein CHLNCDRAFT_15068, partial [Chlorella variabilis]
Length=78

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  418  LVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERG  239
            L +M++EFWDT PHYGG + IWDAL AA EADL  A+ I+D AG+IV A D+T+CYDERG
Sbjct  1    LQRMKDEFWDTEPHYGGDRVIWDALRAACEADLETARIILDSAGVIVAAADMTICYDERG  60

Query  238  AKYELPRYVLSEPTNLIR  185
             KYELPRYV+S P+NL R
Sbjct  61   RKYELPRYVISPPSNLQR  78



>tpg|DAA57774.1| TPA: hypothetical protein ZEAMMB73_055287, partial [Zea mays]
Length=89

 Score = 96.3 bits (238),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            MGCA S+  K DD  K ++KPKPWKH++ IT  QL QMR+EFWDTAPHYGGQKEIWDAL 
Sbjct  1    MGCAGST-PKTDDNGKNLKKPKPWKHTQAITPAQLRQMRDEFWDTAPHYGGQKEIWDALR  59

Query  340  aaaeadlalaqAIVDGAGIIV  278
            AAA++DLALAQ IVD AGIIV
Sbjct  60   AAADSDLALAQTIVDSAGIIV  80



>ref|XP_008386272.1| PREDICTED: ubiquitin domain-containing protein 1-like [Malus 
domestica]
Length=73

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQK  362
            MGCA SS++KGD T+KKIRKPKPWKH +P+T+ QL+QMR EFWDTAPHYGG+K
Sbjct  1    MGCAGSSQTKGDGTLKKIRKPKPWKHPQPLTKSQLLQMREEFWDTAPHYGGRK  53



>emb|CDY23106.1| BnaC09g18600D [Brassica napus]
Length=132

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  415  VQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGA  236
            + MR EFWDT+PHYGGQ+EIWDAL AAAEA+L LAQ I+D AG+IVQ  DLT+C+DERGA
Sbjct  1    MNMREEFWDTSPHYGGQREIWDALRAAAEAELTLAQTIIDSAGVIVQGRDLTLCWDERGA  60

Query  235  KYELPRYVL  209
            KYELPRYVL
Sbjct  61   KYELPRYVL  69



>ref|XP_011396424.1| Ubiquitin domain-containing protein 2 [Auxenochlorella protothecoides]
 gb|KFM23550.1| Ubiquitin domain-containing protein 2 [Auxenochlorella protothecoides]
Length=229

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 69/101 (68%), Gaps = 0/101 (0%)
 Frame = -3

Query  448  KHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVDGAGIIVQAP  269
            K  E   +++   MR EFWDT PHYGG + IWDAL AAAEADL  A+ I+  AGI+V AP
Sbjct  118  KTPEDFEKERWQSMREEFWDTEPHYGGDRVIWDALRAAAEADLRTAKLILQSAGIVVAAP  177

Query  268  DLTVCYDERGAKYELPRYVLSEPTNLIRDG*SSGTGKTIDA  146
            D+T  YDERG  Y LP+YVLS PTN++R     G+ K+ +A
Sbjct  178  DMTTYYDERGRMYVLPKYVLSLPTNILRTSSIMGSRKSANA  218



>ref|XP_005100742.1| PREDICTED: ubiquitin domain-containing protein 2-like [Aplysia 
californica]
Length=236

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 71/115 (62%), Gaps = 5/115 (4%)
 Frame = -3

Query  472  KIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadla----laqA  305
            K  KP+ WK+  P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A       +AQA
Sbjct  36   KAEKPR-WKNDVPLTEGQLKSKRDEFWDTAPAFDGRKEIWDALKAAAYALETGDHTMAQA  94

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG*SSGTGKTIDASL  140
            IVDGA I +    L  CYDE G +Y+LP YVLS P NLI +   S T    D +L
Sbjct  95   IVDGASISLPHGTLLDCYDELGNRYKLPEYVLSAPVNLIEEASESDTAPDTDTNL  149



>ref|XP_005809738.1| PREDICTED: ubiquitin domain-containing protein 1-like [Xiphophorus 
maculatus]
Length=242

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 75/127 (59%), Gaps = 5/127 (4%)
 Frame = -3

Query  550  VNQFSGELHTMGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYG  371
            V ++ G+ H  G A +    G +   K  +PK WK   P+T  QL   R+EFWDTAP + 
Sbjct  5    VGRYWGDSHNRGSARNGGRGGRNEPLKKDRPK-WKSEYPMTEGQLRSKRDEFWDTAPAFE  63

Query  370  GQKEIWDalcaaaeadlal----aqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSE  203
            G+KEIWDAL AAA A        AQAIVDGA I +    LT CYDE G +Y+LP Y L+ 
Sbjct  64   GRKEIWDALKAAAVALECNDHELAQAIVDGASITLPHGTLTECYDELGNRYQLPVYCLAP  123

Query  202  PTNLIRD  182
            P NLI +
Sbjct  124  PVNLISE  130



>gb|KDO51505.1| hypothetical protein CISIN_1g033388mg [Citrus sinensis]
Length=75

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  364  KEIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR  185
            K IWDAL AAAEADL+LAQAIVD AG+IVQ+ DLT+CYDERGAKYELP+YVLSEPTNLIR
Sbjct  14   KVIWDALRAAAEADLSLAQAIVDSAGVIVQSADLTICYDERGAKYELPKYVLSEPTNLIR  73

Query  184  DG  179
            +G
Sbjct  74   EG  75



>gb|EPS61683.1| hypothetical protein M569_13111 [Genlisea aurea]
Length=58

 Score = 85.5 bits (210),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEI  356
            MGCA  SR K +++ K++RKPKPWKH EP+TR QL QMR+EFWDTAPHYGG+K I
Sbjct  1    MGCA-GSRDKVEESSKRVRKPKPWKHQEPLTRAQLTQMRDEFWDTAPHYGGRKGI  54



>gb|EMT14035.1| hypothetical protein F775_17688 [Aegilops tauschii]
Length=80

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -3

Query  361  EIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            EIWDAL AA +ADL LAQ IVD AGIIV  PDLT+CYDERGAKYELP YVLSEPTNLIRD
Sbjct  20   EIWDALRAATDADLTLAQTIVDSAGIIVSNPDLTLCYDERGAKYELPNYVLSEPTNLIRD  79

Query  181  G  179
            G
Sbjct  80   G  80



>gb|EMS54409.1| hypothetical protein TRIUR3_08628 [Triticum urartu]
Length=80

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -3

Query  361  EIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            EIWDAL AA +ADL LAQ IVD AGIIV  PDLT+CYDERGAKYELP YVLSEPTNLIRD
Sbjct  20   EIWDALRAATDADLTLAQTIVDSAGIIVSNPDLTLCYDERGAKYELPNYVLSEPTNLIRD  79

Query  181  G  179
            G
Sbjct  80   G  80



>ref|XP_011438543.1| PREDICTED: ubiquitin domain-containing protein 2-like isoform 
X2 [Crassostrea gigas]
 gb|EKC42910.1| Ubiquitin domain-containing protein 2 [Crassostrea gigas]
Length=227

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 81/133 (61%), Gaps = 6/133 (5%)
 Frame = -3

Query  511  AESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaa  332
             ESS + G +   K  KPK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA
Sbjct  16   GESSEAAGRNQPLKPEKPK-WKSEVPLTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAA  74

Query  331  eadl----alaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD-G*SSG  167
             A      +LAQAI+DGA I +    L   YDE G +Y+LP YVLS PTNLI D   S  
Sbjct  75   YALETGDHSLAQAIIDGANISLPHGTLMDSYDELGNRYQLPVYVLSAPTNLIEDISESEA  134

Query  166  TGKTIDASLGMKI  128
             G + + S G++I
Sbjct  135  GGDSENQSPGLEI  147



>emb|CDQ66769.1| unnamed protein product [Oncorhynchus mykiss]
Length=232

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 81/143 (57%), Gaps = 6/143 (4%)
 Frame = -3

Query  547  NQFSGELHTMGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGG  368
             Q  G   + G A   R   ++ +KK  KPK WK   P+T  QL   R+EFWDTAP + G
Sbjct  12   TQDHGASRSSGRAHRKRGSRNEPLKK-DKPK-WKSDYPMTEGQLRSKRDEFWDTAPAFEG  69

Query  367  QKEIWDalcaaaeadl----alaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEP  200
            +KEIWDAL AA  A       LAQAIVDGA I +    LT CYDE G++Y+LP Y L+ P
Sbjct  70   RKEIWDALKAATVALECNDHELAQAIVDGASITLPHGSLTECYDELGSRYQLPVYCLAPP  129

Query  199  TNLIRDG*SSGTGKTIDASLGMK  131
             NLI +      G + +A+   K
Sbjct  130  VNLISERSDEDPGDSPEATAAPK  152



>ref|XP_009061457.1| hypothetical protein LOTGIDRAFT_219753 [Lottia gigantea]
 gb|ESO87853.1| hypothetical protein LOTGIDRAFT_219753 [Lottia gigantea]
Length=229

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 73/114 (64%), Gaps = 5/114 (4%)
 Frame = -3

Query  472  KIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadl----alaqA  305
            K  KPK WK    +T  QL   R+EFWDTAP + G+KEIWDAL AAA A      A+AQA
Sbjct  32   KPEKPK-WKSDIALTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYALETGDHAMAQA  90

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG*SSGTGKTIDAS  143
            IVDGA I +    L  CYDE G +Y+LP YVLS PTNLI +   S TG+  DA+
Sbjct  91   IVDGANISLPHGTLMDCYDELGNRYQLPVYVLSAPTNLIDELSESDTGQETDAN  144



>ref|XP_003814039.2| PREDICTED: ubiquitin domain-containing protein 2 [Pan paniscus]
 ref|XP_009239556.1| PREDICTED: ubiquitin domain-containing protein 2 isoform X2 [Pongo 
abelii]
Length=218

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 71/117 (61%), Gaps = 5/117 (4%)
 Frame = -3

Query  520  MGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc  341
            M C E   + G +   K  KPK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL 
Sbjct  1    MACQEGPVALGRNQPLKKEKPK-WKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALK  59

Query  340  aaaeadlal----aqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AAA A  +     AQAI+DGA I +    LT CYDE G +Y+LP Y L+ P N+I +
Sbjct  60   AAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEE  116



>ref|XP_008436137.1| PREDICTED: ubiquitin domain-containing protein 1 [Poecilia reticulata]
 ref|XP_008436138.1| PREDICTED: ubiquitin domain-containing protein 1 [Poecilia reticulata]
 ref|XP_008436139.1| PREDICTED: ubiquitin domain-containing protein 1 [Poecilia reticulata]
Length=242

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 74/125 (59%), Gaps = 5/125 (4%)
 Frame = -3

Query  550  VNQFSGELHTMGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYG  371
            V ++  + H  G A +    G +   K  +PK WK   P+T  QL   R+EFWDTAP + 
Sbjct  5    VGRYWEDSHNRGSARNGGRGGRNEPLKKDRPK-WKSDYPMTEGQLRSKRDEFWDTAPAFE  63

Query  370  GQKEIWDalcaaaeadl----alaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSE  203
            G+KEIWDAL AAA A       LAQAIVDGA I +    LT CYDE G +Y+LP Y L+ 
Sbjct  64   GRKEIWDALKAAAVALECNDHELAQAIVDGANITLPHGTLTECYDELGNRYQLPVYCLAP  123

Query  202  PTNLI  188
            P NLI
Sbjct  124  PVNLI  128



>ref|XP_007560140.1| PREDICTED: ubiquitin domain-containing protein 1 [Poecilia formosa]
Length=242

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 74/125 (59%), Gaps = 5/125 (4%)
 Frame = -3

Query  550  VNQFSGELHTMGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYG  371
            V ++  + H  G A +    G +   K  +PK WK   P+T  QL   R+EFWDTAP + 
Sbjct  5    VGRYWEDSHNRGSARNGGRGGRNEPLKKDRPK-WKSDYPMTEGQLRSKRDEFWDTAPAFE  63

Query  370  GQKEIWDalcaaaeadl----alaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSE  203
            G+KEIWDAL AAA A       LAQAIVDGA I +    LT CYDE G +Y+LP Y L+ 
Sbjct  64   GRKEIWDALKAAAVALECNDHELAQAIVDGASITLPHGTLTECYDELGNRYQLPVYCLAP  123

Query  202  PTNLI  188
            P NLI
Sbjct  124  PVNLI  128



>gb|KIY94710.1| Ubiquitin domain-containing protein 1 [Monoraphidium neglectum]
Length=122

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -3

Query  451  WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVDGAGIIVQA  272
            W+  EP+    L + R EFWDT P+YGG +EIWDAL AA  +D  +A+ ++D A + V  
Sbjct  34   WRSEEPLDAAALQRKREEFWDTQPYYGGSREIWDALKAACASDPEMAKVLLDAAEVKVMK  93

Query  271  PDLTVCYDERGAKYELPRYVLSEPTNL  191
             D++V YD RG +YELP +VL++P+NL
Sbjct  94   ADMSVSYDARGFRYELPPFVLADPSNL  120



>gb|ERM97652.1| hypothetical protein AMTR_s00130p00065830 [Amborella trichopoda]
Length=129

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -3

Query  421  QLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDER  242
            QL QMR+EFWDTAPHYGGQKEIWDAL AAAEAD++LAQAIVD AG+IV + D++ CYDER
Sbjct  2    QLRQMRDEFWDTAPHYGGQKEIWDALRAAAEADMSLAQAIVDSAGVIVTSADMSTCYDER  61

Query  241  G  239
            G
Sbjct  62   G  62



>ref|XP_011471780.1| PREDICTED: ubiquitin domain-containing protein 1 isoform X2 [Oryzias 
latipes]
Length=232

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 72/113 (64%), Gaps = 5/113 (4%)
 Frame = -3

Query  508  ESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaae  329
            + S+S+G +   K  +PK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA 
Sbjct  13   DESQSRGRNEPLKRDRPK-WKSDYPMTEGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAV  71

Query  328  adl----alaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            A       LAQAIVDGA I +    LT CYDE G +Y+LP Y L+ P NLI +
Sbjct  72   ALECNDHELAQAIVDGASITLPHGTLTECYDELGTRYQLPVYCLAPPINLISE  124



>ref|XP_011438542.1| PREDICTED: ubiquitin domain-containing protein 2-like isoform 
X1 [Crassostrea gigas]
Length=230

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 82/133 (62%), Gaps = 6/133 (5%)
 Frame = -3

Query  511  AESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaa  332
            +E++ S G +   K  KPK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA
Sbjct  19   SEAAVSIGRNQPLKPEKPK-WKSEVPLTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAA  77

Query  331  eadl----alaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD-G*SSG  167
             A      +LAQAI+DGA I +    L   YDE G +Y+LP YVLS PTNLI D   S  
Sbjct  78   YALETGDHSLAQAIIDGANISLPHGTLMDSYDELGNRYQLPVYVLSAPTNLIEDISESEA  137

Query  166  TGKTIDASLGMKI  128
             G + + S G++I
Sbjct  138  GGDSENQSPGLEI  150



>ref|XP_011952113.1| PREDICTED: ubiquitin domain-containing protein 2 isoform X1 [Ovis 
aries]
Length=219

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 78/123 (63%), Gaps = 8/123 (7%)
 Frame = -3

Query  505  SSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaea  326
            SS + G +   K  KPK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A
Sbjct  7    SSVALGRNQPLKKEKPK-WKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHA  65

Query  325  dlal----aqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG*SSGTGK  158
              +     AQAI+DGA I +    LT CYDE G++Y+LP Y L+ P N+I +   SGT +
Sbjct  66   FESNDHELAQAIIDGANITLPHGALTECYDELGSRYQLPVYCLAPPVNMIEE--KSGT-E  122

Query  157  TID  149
            T+D
Sbjct  123  TLD  125



>ref|XP_010863435.1| PREDICTED: ubiquitin domain-containing protein 1 [Esox lucius]
 ref|XP_010863442.1| PREDICTED: ubiquitin domain-containing protein 1 [Esox lucius]
Length=232

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 73/124 (59%), Gaps = 6/124 (5%)
 Frame = -3

Query  547  NQFSGELHTMGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGG  368
             Q  G     G A   R   ++ +KK  KPK WK   P+T  QL   R+EFWDTAP + G
Sbjct  12   TQGHGSSRNGGRAHRKRGARNEPLKK-DKPK-WKSDYPMTEGQLRSKRDEFWDTAPAFEG  69

Query  367  QKEIWDalcaaaeadl----alaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEP  200
            +KEIWDAL AAA A       LAQAIVDGA I +    LT CYDE G +Y+LP Y L+ P
Sbjct  70   RKEIWDALKAAAVALECNDHELAQAIVDGASITLPHGSLTECYDELGNRYQLPVYCLAPP  129

Query  199  TNLI  188
             NLI
Sbjct  130  VNLI  133



>ref|XP_007249616.1| PREDICTED: ubiquitin domain-containing protein 1-like [Astyanax 
mexicanus]
Length=222

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 73/122 (60%), Gaps = 11/122 (9%)
 Frame = -3

Query  520  MGCAESSRSKGDDTV------KKIRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQK  362
            MG A S  +    TV      + ++K KP WK   P+T  QL   R+EFWDTAP + G+K
Sbjct  1    MGVANSRDAYTSVTVLLKRRNEPLKKDKPKWKSDYPMTEGQLRSKRDEFWDTAPAFDGRK  60

Query  361  EIWDalcaaaeadl----alaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTN  194
            EIWDAL AAA A       LAQAIVDGA I +    LT CYDE G +Y+LP Y L+ P N
Sbjct  61   EIWDALKAAAVAIECNDHELAQAIVDGASITLPHGSLTECYDELGNRYQLPAYCLAPPVN  120

Query  193  LI  188
            LI
Sbjct  121  LI  122



>gb|EPQ15870.1| Ubiquitin domain-containing protein 2 [Myotis brandtii]
Length=238

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 71/115 (62%), Gaps = 5/115 (4%)
 Frame = -3

Query  514  CAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaa  335
            C+ S+   G +   K  KPK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AA
Sbjct  23   CSSSAPVVGRNQPLKKEKPK-WKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAA  81

Query  334  aeadlal----aqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            A A  +     AQAI+DGA I +    LT CYDE G +Y+LP Y L+ P N+I +
Sbjct  82   AHAFESNDHELAQAIIDGANITLPHGSLTECYDELGNRYQLPVYCLAPPINMIEE  136



>ref|NP_001025436.1| ubiquitin domain-containing protein 1 [Danio rerio]
 sp|Q4V8W7.1|UBTD1_DANRE RecName: Full=Ubiquitin domain-containing protein 1 [Danio rerio]
 gb|AAH97167.1| Zgc:114107 [Danio rerio]
Length=227

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 72/117 (62%), Gaps = 12/117 (10%)
 Frame = -3

Query  502  SRSKGDDTVKK-------IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa  347
            +R +G  T +K       ++K KP WK   P+T  QL   R+EFWDTAP + G+KEIWDA
Sbjct  12   TRGRGSRTQRKRGGRNEPLKKDKPKWKSDYPMTEGQLRSKRDEFWDTAPAFEGRKEIWDA  71

Query  346  lcaaaeadl----alaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            L AAA A       LAQAIVDGA I +    LT CYDE G +Y+LP Y L+ P NLI
Sbjct  72   LKAAAVALECSDHELAQAIVDGANITLPHGSLTECYDELGNRYQLPVYCLAPPVNLI  128



>gb|AAI52595.1| Zgc:114107 protein [Danio rerio]
Length=227

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 72/117 (62%), Gaps = 12/117 (10%)
 Frame = -3

Query  502  SRSKGDDTVKK-------IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDa  347
            +R +G  T +K       ++K KP WK   P+T  QL   R+EFWDTAP + G+KEIWDA
Sbjct  12   TRGRGSRTQRKRGGRNEPLKKDKPKWKSDYPMTEGQLRSKRDEFWDTAPAFEGRKEIWDA  71

Query  346  lcaaaeadl----alaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            L AAA A       LAQAIVDGA I +    LT CYDE G +Y+LP Y L+ P NLI
Sbjct  72   LKAAAVALECSDHELAQAIVDGANITLPHGSLTECYDELGNRYQLPVYCLAPPVNLI  128



>ref|XP_004086848.1| PREDICTED: ubiquitin domain-containing protein 1 isoform X1 [Oryzias 
latipes]
Length=237

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 73/115 (63%), Gaps = 5/115 (4%)
 Frame = -3

Query  511  AESSRSKGDDTVKKIRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaa  335
            ++S  S G+   + +++ +P WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AA
Sbjct  15   SQSRGSSGNGRNEPLKRDRPKWKSDYPMTEGQLRSKRDEFWDTAPAFEGRKEIWDALKAA  74

Query  334  aeadl----alaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            A A       LAQAIVDGA I +    LT CYDE G +Y+LP Y L+ P NLI +
Sbjct  75   AVALECNDHELAQAIVDGASITLPHGTLTECYDELGTRYQLPVYCLAPPINLISE  129



>ref|XP_008508047.1| PREDICTED: ubiquitin domain-containing protein 2 [Equus przewalskii]
Length=245

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 79/133 (59%), Gaps = 7/133 (5%)
 Frame = -3

Query  562  LILLVNQFSGELHTMGCAE--SSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWD  389
            + L +  FSG +H+   A+     + G +   K  KPK WK   P+T  QL   R+EFWD
Sbjct  12   ITLELRGFSGTVHSWHPAQWLDHIALGRNQPLKKEKPK-WKSDYPMTDGQLRSKRDEFWD  70

Query  388  TAPHYGGQKEIWDalcaaaeadlal----aqAIVDGAGIIVQAPDLTVCYDERGAKYELP  221
            TAP + G+KEIWDAL AAA A  +     AQAI+DGA I +    LT CYDE G +Y+LP
Sbjct  71   TAPAFEGRKEIWDALKAAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLP  130

Query  220  RYVLSEPTNLIRD  182
             Y L+ P N+I +
Sbjct  131  VYCLAPPINMIEE  143



>ref|XP_009572659.1| PREDICTED: ubiquitin domain-containing protein 1-like, partial 
[Fulmarus glacialis]
Length=142

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 72/120 (60%), Gaps = 6/120 (5%)
 Frame = -3

Query  535  GELHTMGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEI  356
            GE H +   +   S G +   K  +PK WK   P+T  QL   R+EFWDTAP + G+KEI
Sbjct  8    GEPH-LSAEDPPPSPGRNEPLKKERPK-WKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEI  65

Query  355  WDalcaaaeadlal----aqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            WDAL AAA A  A     AQAI+DGA I +    LT CYDE G +Y+LP Y L+ P NLI
Sbjct  66   WDALKAAAYAVEANDHSLAQAILDGASITLPHGSLTECYDELGNRYQLPVYCLAPPVNLI  125



>ref|XP_004342961.2| ubiquitin domain-containing protein 1 [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE97774.1| ubiquitin domain-containing protein 1 [Capsaspora owczarzaki 
ATCC 30864]
Length=255

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 86/162 (53%), Gaps = 15/162 (9%)
 Frame = -3

Query  466  RKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalc-aaaeadlalaqAIVDGA  290
            R+P  W     + R  L   R EFW TAP +GGQ+EIW AL  AA  +D ALAQAIVDGA
Sbjct  66   RQPPSWAAEVHVNRAMLAHKREEFWSTAPEFGGQREIWQALKGAAETSDHALAQAIVDGA  125

Query  289  GIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD-------G*SSGTGKTIDASLGMK  131
            GI +    LT  YDERG KY +P + LS+P+NL  D         +  T +T+D +L ++
Sbjct  126  GISLPLGQLTDAYDERGYKYTVPLFCLSDPSNLAADDQPDPANAIALDTQRTLDKTLRLR  185

Query  130  IL*IGFISFPLFNSFCFLGSIHPL-------VVMKKLVLSGK  26
            +  +  +  P  +    L   H L       V  ++  +SGK
Sbjct  186  LSTMKDVKLPYNDQDTVLELKHRLAAAENIPVASQRFFMSGK  227



>ref|XP_006630307.1| PREDICTED: ubiquitin domain-containing protein 1-like [Lepisosteus 
oculatus]
Length=227

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadl----alaqA  305
            ++K KP WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A       LAQA
Sbjct  30   LKKDKPKWKSDYPMTEGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAIAIECNDHELAQA  89

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            IVDGA I +    LT CYDE G +Y+LP Y L+ P NLI
Sbjct  90   IVDGASITLPHGSLTECYDELGNRYQLPVYCLAPPVNLI  128



>gb|ELT93596.1| hypothetical protein CAPTEDRAFT_211288 [Capitella teleta]
Length=235

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 63/94 (67%), Gaps = 4/94 (4%)
 Frame = -3

Query  451  WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqAIVDGAGI  284
            WK   P+T  QL   R+EFW+TAP + G+KEIWDAL AA+ A  +     AQAIVDGA I
Sbjct  40   WKSDVPLTDGQLRSKRDEFWETAPAFEGRKEIWDALRAASCALESGDHQLAQAIVDGASI  99

Query  283  IVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
             + A  L  CYDE G +Y+LP YVLS P+NLI D
Sbjct  100  SLPAGSLMDCYDELGNRYQLPIYVLSAPSNLIED  133



>ref|XP_005156917.1| PREDICTED: ubiquitin domain-containing protein 1 isoform X1 [Danio 
rerio]
Length=230

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 64/99 (65%), Gaps = 5/99 (5%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadl----alaqA  305
            ++K KP WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A       LAQA
Sbjct  33   LKKDKPKWKSDYPMTEGQLRSKRDEFWDTAPAFDGRKEIWDALKAAAVAIECNDHQLAQA  92

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            IVDGA I +    L  CYDE G +Y+LP Y LS P NL+
Sbjct  93   IVDGASITLPHGSLMECYDELGNRYQLPAYCLSPPVNLV  131



>ref|XP_008345167.1| PREDICTED: uncharacterized protein LOC103408081 [Malus domestica]
Length=170

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -3

Query  361  EIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            EIWDAL AA+EAD++LAQAIVD AG+IVQ  DLT+CYDERGAKYELP+YVLSEPTNLIR+
Sbjct  110  EIWDALRAASEADISLAQAIVDSAGVIVQNADLTICYDERGAKYELPKYVLSEPTNLIRE  169

Query  181  G  179
             
Sbjct  170  S  170



>ref|XP_002194670.1| PREDICTED: ubiquitin domain-containing protein 1 [Taeniopygia 
guttata]
Length=227

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 73/125 (58%), Gaps = 15/125 (12%)
 Frame = -3

Query  517  GCAESSR----SKGDDTVKKIRKPKP-------WKHSEPITRDQLVQMRNEFWDTAPHYG  371
            GCA   R    + G +T K+  + +P       WK   P+T  QL   R+EFWDTAP + 
Sbjct  3    GCAGRQRRERPAAGGNTRKRAGRNEPLKKECPKWKSDYPMTDGQLRSKRDEFWDTAPAFE  62

Query  370  GQKEIWDalcaaaeadlal----aqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSE  203
            G+KEIWDAL AAA A  A     AQAI+DGA I +    LT CYDE G +Y+LP Y L+ 
Sbjct  63   GRKEIWDALKAAAYAVEANDHSLAQAILDGASITLPHGSLTECYDELGNRYQLPVYCLAP  122

Query  202  PTNLI  188
            P NLI
Sbjct  123  PVNLI  127



>ref|XP_005474203.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X2 [Oreochromis niloticus]
Length=235

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 72/124 (58%), Gaps = 5/124 (4%)
 Frame = -3

Query  547  NQFSGELHTMGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGG  368
            ++  G+        S +  G +   K  +PK WK   P+T  QL   R+EFWDTAP + G
Sbjct  8    SRMDGQGSARSSTRSKKRGGRNEPLKKERPK-WKSEYPMTEGQLRSKRDEFWDTAPAFDG  66

Query  367  QKEIWDalcaaaeadl----alaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEP  200
            +KEIWDAL AAA A       LAQAIVDGA I +    LT CYDE G +Y+LP Y L+ P
Sbjct  67   RKEIWDALRAAALAAECNDLELAQAIVDGACITLPHGSLTECYDELGNRYQLPAYTLAPP  126

Query  199  TNLI  188
             NLI
Sbjct  127  VNLI  130



>emb|CAF92823.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=199

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 64/99 (65%), Gaps = 5/99 (5%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            ++K +P WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A        AQA
Sbjct  7    LKKERPKWKSDYPMTEGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAVALEGSDHELAQA  66

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            IVDGA I +    LT CYDE G +Y+LP Y L+ P NLI
Sbjct  67   IVDGASITLPHGSLTECYDELGNRYQLPVYCLAPPVNLI  105



>pdb|2KSN|A Chain A, Solution Structure Of The N-Terminal Domain Of Dc-UbpUBTD2
Length=137

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 66/101 (65%), Gaps = 5/101 (5%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            ++K KP WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  +     AQA
Sbjct  20   LKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQA  79

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            I+DGA I +    LT CYDE G +Y+LP Y L+ P N+I +
Sbjct  80   IIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEE  120



>ref|NP_001082870.1| ubiquitin domain-containing protein 1 [Danio rerio]
 gb|AAI39663.1| Ubtd1 protein [Danio rerio]
Length=221

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 64/99 (65%), Gaps = 5/99 (5%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadl----alaqA  305
            ++K KP WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A       LAQA
Sbjct  24   LKKDKPKWKSDYPMTEGQLRSKRDEFWDTAPAFDGRKEIWDALKAAAVAIECNDHQLAQA  83

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            IVDGA I +    L  CYDE G +Y+LP Y LS P NL+
Sbjct  84   IVDGASITLPHGSLMECYDELGNRYQLPAYCLSPPVNLV  122



>ref|NP_001002718.1| ubiquitin domain-containing protein 2 [Danio rerio]
 sp|Q6DG43.1|UBTD2_DANRE RecName: Full=Ubiquitin domain-containing protein 2 [Danio rerio]
 gb|AAH76510.1| Ubiquitin domain containing 2 [Danio rerio]
 gb|AAI65087.1| Ubtd2 protein [Danio rerio]
Length=240

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 66/101 (65%), Gaps = 5/101 (5%)
 Frame = -3

Query  472  KIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            K  KPK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA+A  +     AQA
Sbjct  33   KREKPK-WKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAQAFESNDHELAQA  91

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            I+DGA I +    LT CYDE G +Y+LP Y LS P N+I +
Sbjct  92   IIDGASITLPHGALTECYDELGNRYQLPVYCLSPPVNMIEE  132



>emb|CDQ74823.1| unnamed protein product [Oncorhynchus mykiss]
Length=254

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 68/107 (64%), Gaps = 5/107 (5%)
 Frame = -3

Query  490  GDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal-  314
            G +   K  KPK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA+A  +  
Sbjct  27   GRNQALKREKPK-WKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALRAAAQAFESND  85

Query  313  ---aqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
               AQAI+DGA I +    LT CYDE G +Y+LP Y LS P N+I +
Sbjct  86   HELAQAIIDGASITLPHGALTECYDELGNRYQLPVYCLSPPVNMIEE  132



>ref|XP_005743936.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X1 [Pundamilia nyererei]
Length=255

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 72/124 (58%), Gaps = 5/124 (4%)
 Frame = -3

Query  547  NQFSGELHTMGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGG  368
            ++  G+        S +  G +   K  +PK WK   P+T  QL   R+EFWDTAP + G
Sbjct  28   SRMDGQGSARNSTRSKKRGGRNEPLKKERPK-WKSEYPMTEGQLRSKRDEFWDTAPAFDG  86

Query  367  QKEIWDalcaaaeadl----alaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEP  200
            +KEIWDAL AAA A       LAQAIVDGA I +    LT CYDE G +Y+LP Y L+ P
Sbjct  87   RKEIWDALRAAALAAECNDLELAQAIVDGACITLPHGSLTECYDELGNRYQLPAYTLAPP  146

Query  199  TNLI  188
             NLI
Sbjct  147  VNLI  150



>ref|XP_004555914.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X1 [Maylandia zebra]
 ref|XP_005940720.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X1 [Haplochromis burtoni]
 ref|XP_006808041.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X1 [Neolamprologus brichardi]
Length=255

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 72/124 (58%), Gaps = 5/124 (4%)
 Frame = -3

Query  547  NQFSGELHTMGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGG  368
            ++  G+        S +  G +   K  +PK WK   P+T  QL   R+EFWDTAP + G
Sbjct  28   SRMDGQGSARNSTRSKKRGGRNEPLKKERPK-WKSEYPMTEGQLRSKRDEFWDTAPAFDG  86

Query  367  QKEIWDalcaaaeadl----alaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEP  200
            +KEIWDAL AAA A       LAQAIVDGA I +    LT CYDE G +Y+LP Y L+ P
Sbjct  87   RKEIWDALRAAALAAECNDLELAQAIVDGACITLPHGSLTECYDELGNRYQLPAYTLAPP  146

Query  199  TNLI  188
             NLI
Sbjct  147  VNLI  150



>ref|XP_005727904.1| PREDICTED: ubiquitin domain-containing protein 2-like [Pundamilia 
nyererei]
Length=268

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 73/122 (60%), Gaps = 12/122 (10%)
 Frame = -3

Query  472  KIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            K  +PK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  +     AQA
Sbjct  33   KRERPK-WKSDYPMTEGQLRSKRDEFWDTAPAFEGRKEIWDALRAAASAFESNDHLLAQA  91

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR------DG*SSGTGKTIDAS  143
            I+DGA I +    LT CYDE G +Y+LP Y LS P N+I       DG    +G T D S
Sbjct  92   ILDGASITLPHGALTECYDELGNRYQLPVYCLSPPVNMIEERSDEPDGSDPDSG-TTDPS  150

Query  142  LG  137
            LG
Sbjct  151  LG  152



>ref|XP_012009408.1| PREDICTED: ubiquitin domain-containing protein 2 isoform X2 [Ovis 
aries musimon]
Length=234

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 73/112 (65%), Gaps = 8/112 (7%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            ++K KP WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  +     AQA
Sbjct  32   LKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQA  91

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG*SSGTGKTID  149
            I+DGA I +    LT CYDE G +Y+LP Y L+ P N+I +   SGT +T+D
Sbjct  92   IIDGANITLPHGALTECYDELGNRYQLPVYCLAPPVNMIEE--KSGT-ETLD  140



>ref|XP_007419961.1| PREDICTED: ubiquitin domain-containing protein 1 [Python bivittatus]
Length=227

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 71/108 (66%), Gaps = 6/108 (6%)
 Frame = -3

Query  499  RSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadl  320
            R+  ++ +KK R PK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  
Sbjct  22   RAGRNEPLKKDR-PK-WKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAVE  79

Query  319  al----aqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            A     AQAI+DGAG+ +    LT CYDE G +Y+LP Y L+ P NLI
Sbjct  80   ANDHGLAQAIIDGAGVTLPHGSLTECYDELGNRYQLPVYCLAPPVNLI  127



>ref|XP_005926421.1| PREDICTED: ubiquitin domain-containing protein 2-like [Haplochromis 
burtoni]
Length=268

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 73/122 (60%), Gaps = 12/122 (10%)
 Frame = -3

Query  472  KIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            K  +PK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  +     AQA
Sbjct  33   KRERPK-WKSDYPMTEGQLRSKRDEFWDTAPAFEGRKEIWDALRAAASAFESNDHLLAQA  91

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR------DG*SSGTGKTIDAS  143
            I+DGA I +    LT CYDE G +Y+LP Y LS P N+I       DG    +G T D S
Sbjct  92   ILDGASITLPHGALTECYDELGNRYQLPVYCLSPPVNMIEERSDEPDGSDPDSG-TTDPS  150

Query  142  LG  137
            LG
Sbjct  151  LG  152



>ref|XP_003441085.2| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X1 [Oreochromis niloticus]
Length=255

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 72/124 (58%), Gaps = 5/124 (4%)
 Frame = -3

Query  547  NQFSGELHTMGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGG  368
            ++  G+        S +  G +   K  +PK WK   P+T  QL   R+EFWDTAP + G
Sbjct  28   SRMDGQGSARSSTRSKKRGGRNEPLKKERPK-WKSEYPMTEGQLRSKRDEFWDTAPAFDG  86

Query  367  QKEIWDalcaaaeadl----alaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEP  200
            +KEIWDAL AAA A       LAQAIVDGA I +    LT CYDE G +Y+LP Y L+ P
Sbjct  87   RKEIWDALRAAALAAECNDLELAQAIVDGACITLPHGSLTECYDELGNRYQLPAYTLAPP  146

Query  199  TNLI  188
             NLI
Sbjct  147  VNLI  150



>ref|XP_003218516.2| PREDICTED: ubiquitin domain-containing protein 1, partial [Anolis 
carolinensis]
Length=235

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 66/99 (67%), Gaps = 5/99 (5%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            ++K +P WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  +     AQA
Sbjct  37   LKKDRPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAVESNDHGLAQA  96

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            I+DGAG+ +    LT CYDE G +Y+LP Y L+ P NLI
Sbjct  97   IIDGAGVTLPHGSLTECYDELGNRYQLPVYCLAPPVNLI  135



>gb|ETE68008.1| Ubiquitin domain-containing protein 1 [Ophiophagus hannah]
Length=227

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 71/108 (66%), Gaps = 6/108 (6%)
 Frame = -3

Query  499  RSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadl  320
            R+  ++ +KK R PK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  
Sbjct  22   RAGRNEPLKKDR-PK-WKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAVE  79

Query  319  al----aqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            A     AQAI+DGAG+ +    LT CYDE G +Y+LP Y L+ P NLI
Sbjct  80   ANDHGLAQAIIDGAGVTLPHGSLTECYDELGNRYQLPVYCLAPPINLI  127



>ref|XP_011569817.1| PREDICTED: ubiquitin domain-containing protein 2 [Aquila chrysaetos 
canadensis]
Length=221

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 79/131 (60%), Gaps = 9/131 (7%)
 Frame = -3

Query  529  LHTMGCAESSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWD  350
            LH +  A S+ + G +   K  KPK WK   P+T  QL   R+EFWDTAP + G+KEIWD
Sbjct  2    LHDIPSA-STVALGRNQPLKKEKPK-WKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWD  59

Query  349  alcaaaeadlal----aqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            AL AAA A  +     AQAI+DGA I +    LT CYDE G +Y+LP Y L+ P N+I +
Sbjct  60   ALKAAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEE  119

Query  181  G*SSGTGKTID  149
                G  +T+D
Sbjct  120  ---KGDLETLD  127



>ref|XP_007231764.1| PREDICTED: ubiquitin domain-containing protein 2-like [Astyanax 
mexicanus]
Length=240

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 66/101 (65%), Gaps = 5/101 (5%)
 Frame = -3

Query  472  KIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            K  KPK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA+A  +     AQA
Sbjct  33   KREKPK-WKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAQAFESNDHELAQA  91

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            I+DGA I +    LT CYDE G +Y+LP Y LS P N+I +
Sbjct  92   IIDGASITLPHGALTECYDELGNRYQLPVYCLSPPVNMIEE  132



>gb|EPS68830.1| hypothetical protein M569_05936, partial [Genlisea aurea]
Length=60

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -3

Query  361  EIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            EIWDAL AAAEADLA+AQ IV+ AG+IVQ PDLTVCYDERGA+YELP+YVLSEPTNLI D
Sbjct  1    EIWDALKAAAEADLAMAQVIVESAGVIVQNPDLTVCYDERGARYELPKYVLSEPTNLIHD  60



>gb|KFR13176.1| Ubiquitin domain-containing protein 1, partial [Opisthocomus 
hoazin]
Length=172

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            ++K +P WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  A     AQA
Sbjct  6    LKKERPKWKSDYPMTAGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAVEANDHSLAQA  65

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            I+DGA I +    LT CYDE G +Y+LP Y L+ P NLI
Sbjct  66   ILDGASITLPHGSLTECYDELGNRYQLPVYCLAPPVNLI  104



>gb|KCW74159.1| hypothetical protein EUGRSUZ_E02796 [Eucalyptus grandis]
Length=84

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -3

Query  367  QKEIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            + EIWDAL AAAEADL LAQAIVD AG+IVQ  DLT+CYDERGAKYELP+YVLSEPTNLI
Sbjct  22   EDEIWDALHAAAEADLTLAQAIVDTAGVIVQRADLTICYDERGAKYELPKYVLSEPTNLI  81



>ref|XP_010590843.1| PREDICTED: ubiquitin domain-containing protein 2 isoform X3 [Loxodonta 
africana]
Length=214

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 70/112 (63%), Gaps = 5/112 (4%)
 Frame = -3

Query  505  SSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaea  326
            SS + G +   K  KPK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A
Sbjct  2    SSVALGRNQPLKKEKPK-WKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHA  60

Query  325  dlal----aqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
              +     AQAI+DGA I +    LT CYDE G +Y+LP Y L+ P N+I +
Sbjct  61   FESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEE  112



>gb|KFV14814.1| Ubiquitin domain-containing protein 2, partial [Tauraco erythrolophus]
Length=162

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 71/112 (63%), Gaps = 8/112 (7%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            ++K KP WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  +     AQA
Sbjct  6    LKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQA  65

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG*SSGTGKTID  149
            I+DGA I +    LT CYDE G +Y+LP Y L+ P N+I +    G  +T+D
Sbjct  66   IIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEE---KGDLETLD  114



>tpg|DAA52894.1| TPA: hypothetical protein ZEAMMB73_802907 [Zea mays]
Length=74

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -3

Query  361  EIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            EIWDAL  AAE+DLALAQ IVD AGIIV  PD+T+CYDER +KYELP+YVLSEP NLIRD
Sbjct  14   EIWDALRVAAESDLALAQTIVDSAGIIVSNPDMTLCYDERDSKYELPKYVLSEPANLIRD  73

Query  181  G  179
            G
Sbjct  74   G  74



>ref|XP_006053756.1| PREDICTED: ubiquitin domain-containing protein 2 isoform X2 [Bubalus 
bubalis]
Length=234

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 70/112 (63%), Gaps = 5/112 (4%)
 Frame = -3

Query  505  SSRSKGDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaea  326
            SS + G +   K  KPK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A
Sbjct  22   SSVALGRNQPLKKEKPK-WKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAALA  80

Query  325  dlal----aqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
              +     AQAI+DGA I +    LT CYDE G +Y+LP Y L+ P N+I +
Sbjct  81   FESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEE  132



>ref|XP_010849608.1| PREDICTED: ubiquitin domain-containing protein 2 [Bison bison 
bison]
Length=243

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 73/124 (59%), Gaps = 11/124 (9%)
 Frame = -3

Query  523  TMGCAESSRSK------GDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQK  362
             +G   S+RS       G +   K  KPK WK   P+T  QL   R+EFWDTAP + G+K
Sbjct  19   VLGLQSSARSTPPPVALGRNQPLKKEKPK-WKSDYPMTDGQLRSKRDEFWDTAPAFEGRK  77

Query  361  EIWDalcaaaeadlal----aqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTN  194
            EIWDAL AAA A  +     AQAI+DGA I +    LT CYDE G +Y+LP Y L+ P N
Sbjct  78   EIWDALKAAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPIN  137

Query  193  LIRD  182
            +I +
Sbjct  138  MIEE  141



>ref|XP_002735307.1| PREDICTED: ubiquitin domain-containing protein 2-like [Saccoglossus 
kowalevskii]
Length=234

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 76/141 (54%), Gaps = 23/141 (16%)
 Frame = -3

Query  517  GCAESSRSKGDDTVK------------------KIRKPKPWKHSEPITRDQLVQMRNEFW  392
            GC  SS+ + D  V+                  K  KPK WK   P+T  QL   R+EFW
Sbjct  3    GCVSSSQDRSDGGVESSDNAVAGSMPLGRNQPLKQEKPK-WKSDVPLTVGQLRSKRDEFW  61

Query  391  DTAPHYGGQKEIWDalcaaaeadl----alaqAIVDGAGIIVQAPDLTVCYDERGAKYEL  224
            DTAP + G+KEIWDAL AAA+A      ALAQAI+DGA I      LT CYDE G +Y L
Sbjct  62   DTAPAFEGRKEIWDALKAAAQALENGDHALAQAIIDGANITCPNGTLTDCYDELGNRYVL  121

Query  223  PRYVLSEPTNLIRDG*SSGTG  161
            P Y LS P N+I +   S  G
Sbjct  122  PVYCLSPPINMIEETSESDAG  142



>ref|XP_005743937.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X2 [Pundamilia nyererei]
Length=233

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadl----alaqA  305
            ++K +P WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A       LAQA
Sbjct  30   LKKERPKWKSEYPMTEGQLRSKRDEFWDTAPAFDGRKEIWDALRAAALAAECNDLELAQA  89

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            IVDGA I +    LT CYDE G +Y+LP Y L+ P NLI
Sbjct  90   IVDGACITLPHGSLTECYDELGNRYQLPAYTLAPPVNLI  128



>ref|XP_004550331.1| PREDICTED: ubiquitin domain-containing protein 2-like [Maylandia 
zebra]
Length=337

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 73/122 (60%), Gaps = 12/122 (10%)
 Frame = -3

Query  472  KIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            K  +PK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  +     AQA
Sbjct  102  KRERPK-WKSDYPMTEGQLRSKRDEFWDTAPAFEGRKEIWDALRAAASAFESNDHLLAQA  160

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR------DG*SSGTGKTIDAS  143
            I+DGA I +    LT CYDE G +Y+LP Y LS P N+I       DG    +G T D S
Sbjct  161  ILDGASITLPHGALTECYDELGNRYQLPVYCLSPPVNMIEERSDEPDGSDPDSG-TTDPS  219

Query  142  LG  137
            LG
Sbjct  220  LG  221



>ref|XP_004555915.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X2 [Maylandia zebra]
 ref|XP_005940721.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X2 [Haplochromis burtoni]
 ref|XP_006808042.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X2 [Neolamprologus brichardi]
Length=233

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadl----alaqA  305
            ++K +P WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A       LAQA
Sbjct  30   LKKERPKWKSEYPMTEGQLRSKRDEFWDTAPAFDGRKEIWDALRAAALAAECNDLELAQA  89

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            IVDGA I +    LT CYDE G +Y+LP Y L+ P NLI
Sbjct  90   IVDGACITLPHGSLTECYDELGNRYQLPAYTLAPPVNLI  128



>ref|XP_005743938.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X3 [Pundamilia nyererei]
Length=226

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadl----alaqA  305
            ++K +P WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A       LAQA
Sbjct  23   LKKERPKWKSEYPMTEGQLRSKRDEFWDTAPAFDGRKEIWDALRAAALAAECNDLELAQA  82

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            IVDGA I +    LT CYDE G +Y+LP Y L+ P NLI
Sbjct  83   IVDGACITLPHGSLTECYDELGNRYQLPAYTLAPPVNLI  121



>ref|XP_004555916.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X3 [Maylandia zebra]
Length=226

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadl----alaqA  305
            ++K +P WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A       LAQA
Sbjct  23   LKKERPKWKSEYPMTEGQLRSKRDEFWDTAPAFDGRKEIWDALRAAALAAECNDLELAQA  82

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            IVDGA I +    LT CYDE G +Y+LP Y L+ P NLI
Sbjct  83   IVDGACITLPHGSLTECYDELGNRYQLPAYTLAPPVNLI  121



>ref|XP_010867215.1| PREDICTED: ubiquitin domain-containing protein 1-like [Esox lucius]
Length=236

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 69/101 (68%), Gaps = 5/101 (5%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaea----dlalaqA  305
            ++K +P WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A    +L LAQA
Sbjct  30   LKKERPKWKSEYPMTEGQLRSKRDEFWDTAPAFDGRKEIWDALRAAAVAIDLNNLELAQA  89

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            IVDGA I +    LT  YDE G +Y+LP Y+L+ PTNLI +
Sbjct  90   IVDGACITLPHGTLTESYDELGNRYQLPAYILAAPTNLISE  130



>ref|XP_005474204.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X3 [Oreochromis niloticus]
Length=233

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadl----alaqA  305
            ++K +P WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A       LAQA
Sbjct  30   LKKERPKWKSEYPMTEGQLRSKRDEFWDTAPAFDGRKEIWDALRAAALAAECNDLELAQA  89

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            IVDGA I +    LT CYDE G +Y+LP Y L+ P NLI
Sbjct  90   IVDGACITLPHGSLTECYDELGNRYQLPAYTLAPPVNLI  128



>ref|XP_003447065.2| PREDICTED: ubiquitin domain-containing protein 2-like [Oreochromis 
niloticus]
Length=339

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 73/122 (60%), Gaps = 12/122 (10%)
 Frame = -3

Query  472  KIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            K  +PK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  +     AQA
Sbjct  104  KRERPK-WKSDYPMTEGQLRSKRDEFWDTAPAFEGRKEIWDALRAAASAFESNDHLLAQA  162

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR------DG*SSGTGKTIDAS  143
            I+DGA I +    LT CYDE G +Y+LP Y LS P N+I       DG    +G T D S
Sbjct  163  ILDGASITLPHGALTECYDELGNRYQLPVYCLSPPVNMIEERSDEPDGSDPDSG-TADPS  221

Query  142  LG  137
            LG
Sbjct  222  LG  223



>ref|XP_006784976.1| PREDICTED: ubiquitin domain-containing protein 2-like [Neolamprologus 
brichardi]
Length=337

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 73/122 (60%), Gaps = 12/122 (10%)
 Frame = -3

Query  472  KIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            K  +PK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  +     AQA
Sbjct  102  KRERPK-WKSDYPMTEGQLRSKRDEFWDTAPAFEGRKEIWDALRAAASAFESNDHLLAQA  160

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIR------DG*SSGTGKTIDAS  143
            I+DGA I +    LT CYDE G +Y+LP Y LS P N+I       DG    +G T D S
Sbjct  161  ILDGASITLPHGALTECYDELGNRYQLPVYCLSPPVNMIEERSDEPDGSDPDSG-TADPS  219

Query  142  LG  137
            LG
Sbjct  220  LG  221



>ref|XP_010869485.1| PREDICTED: ubiquitin domain-containing protein 2 [Esox lucius]
Length=253

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 68/107 (64%), Gaps = 5/107 (5%)
 Frame = -3

Query  490  GDDTVKKIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal-  314
            G +   K  KPK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA+A  +  
Sbjct  27   GRNQALKREKPK-WKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAQAFESND  85

Query  313  ---aqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
               AQAI+DGA I +    LT CYDE G +Y+LP Y L+ P N+I +
Sbjct  86   HELAQAIIDGASITLPHGALTECYDELGNRYQLPVYCLAPPVNMIEE  132



>ref|XP_005474205.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X4 [Oreochromis niloticus]
Length=226

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadl----alaqA  305
            ++K +P WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A       LAQA
Sbjct  23   LKKERPKWKSEYPMTEGQLRSKRDEFWDTAPAFDGRKEIWDALRAAALAAECNDLELAQA  82

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            IVDGA I +    LT CYDE G +Y+LP Y L+ P NLI
Sbjct  83   IVDGACITLPHGSLTECYDELGNRYQLPAYTLAPPVNLI  121



>ref|XP_003961581.1| PREDICTED: ubiquitin domain-containing protein 1 [Takifugu rubripes]
Length=245

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadl----alaqA  305
            ++K +P WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A       LAQA
Sbjct  33   LKKDRPKWKSDYPMTEGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAVALECNDHELAQA  92

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            IVDGA I +    LT CYDE G +Y+LP Y L+ P NLI
Sbjct  93   IVDGASITLPHGTLTECYDELGNRYQLPVYCLAPPVNLI  131



>ref|XP_010039800.1| PREDICTED: uncharacterized protein LOC104428525 [Eucalyptus grandis]
Length=123

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -3

Query  364  KEIWDalcaaaeadlalaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
             EIWDAL AAAEADL LAQAIVD AG+IVQ  DLT+CYDERGAKYELP+YVLSEPTNLI
Sbjct  62   SEIWDALHAAAEADLTLAQAIVDSAGVIVQRADLTICYDERGAKYELPKYVLSEPTNLI  120



>ref|XP_006138212.1| PREDICTED: ubiquitin domain-containing protein 2 [Pelodiscus 
sinensis]
Length=239

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 80/146 (55%), Gaps = 13/146 (9%)
 Frame = -3

Query  556  LLVNQFSGELH-----TMGCAESSRSKGDDTVKKIRKPKP-WKHSEPITRDQLVQMRNEF  395
            L  +Q     H     T+ C  S         + ++K KP WK   P+T  QL   R+EF
Sbjct  3    LFFHQLPERFHQYAPCTLDCLPSLDFIALGRNQPLKKEKPKWKSDYPMTDGQLRSKRDEF  62

Query  394  WDTAPHYGGQKEIWDalcaaaeadlal----aqAIVDGAGIIVQAPDLTVCYDERGAKYE  227
            WDTAP + G+KEIWDAL AAA A  +     AQAI+DGA I +    LT CYDE G +Y+
Sbjct  63   WDTAPAFEGRKEIWDALKAAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQ  122

Query  226  LPRYVLSEPTNLIRDG*SSGTGKTID  149
            LP Y L+ P N+I +    G  +T+D
Sbjct  123  LPVYCLAPPINMIEE---KGDLETLD  145



>gb|KFV70528.1| Ubiquitin domain-containing protein 2, partial [Picoides pubescens]
Length=200

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 71/112 (63%), Gaps = 8/112 (7%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            ++K KP WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  +     AQA
Sbjct  6    LKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQA  65

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG*SSGTGKTID  149
            IVDGA I +    LT CYDE G +Y+LP Y L+ P N+I +    G  +T+D
Sbjct  66   IVDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEE---KGDLETLD  114



>ref|NP_001005656.1| ubiquitin domain-containing protein 1 [Xenopus (Silurana) tropicalis]
 sp|Q6GL38.1|UBTD1_XENTR RecName: Full=Ubiquitin domain-containing protein 1 [Xenopus 
(Silurana) tropicalis]
 gb|AAH74677.1| ubiquitin domain containing 1 [Xenopus (Silurana) tropicalis]
Length=240

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            ++K +P WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  A     AQA
Sbjct  33   LKKERPRWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAFAVEANDHELAQA  92

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            IVDGA I +    LT CYDE G +Y+LP Y L+ P NLI
Sbjct  93   IVDGASITLPHGSLTECYDELGTRYQLPVYCLAPPVNLI  131



>ref|XP_003217388.1| PREDICTED: ubiquitin domain-containing protein 2 [Anolis carolinensis]
Length=234

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 70/112 (63%), Gaps = 8/112 (7%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            ++K KP WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A        AQA
Sbjct  32   LKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFENNDHELAQA  91

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG*SSGTGKTID  149
            I+DGA I +    LT CYDE G +Y+LP Y L+ P N+I +    G  +T+D
Sbjct  92   IIDGANITLPHGSLTECYDELGNRYQLPVYCLAPPINMIEE---KGDLETLD  140



>ref|XP_005053812.1| PREDICTED: ubiquitin domain-containing protein 1-like [Ficedula 
albicollis]
Length=240

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 66/101 (65%), Gaps = 5/101 (5%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            ++K KP WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  +     AQA
Sbjct  38   LKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQA  97

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            I+DGA I +    LT CYDE G +Y+LP Y L+ P N+I +
Sbjct  98   IIDGANITLPHGALTECYDELGNRYQLPVYCLAPPVNMIEE  138



>gb|KFP89545.1| Ubiquitin domain-containing protein 2, partial [Apaloderma vittatum]
Length=182

 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 71/112 (63%), Gaps = 8/112 (7%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            ++K KP WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  +     AQA
Sbjct  6    LKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQA  65

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG*SSGTGKTID  149
            I+DGA I +    LT CYDE G +Y+LP Y L+ P N+I +    G  +T+D
Sbjct  66   IIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEE---KGDLETLD  114



>ref|XP_003971101.1| PREDICTED: ubiquitin domain-containing protein 2 [Takifugu rubripes]
Length=267

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 65/101 (64%), Gaps = 5/101 (5%)
 Frame = -3

Query  472  KIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            K  +PK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  +     AQA
Sbjct  33   KRERPK-WKSDYPMTEGQLRSKRDEFWDTAPAFEGRKEIWDALRAAASAFESNDHLLAQA  91

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            I+DGA I +    LT CYDE G +Y+LP Y LS P N+I +
Sbjct  92   ILDGASITLPHGALTECYDELGNRYQLPVYCLSPPVNMIEE  132



>ref|XP_008331476.1| PREDICTED: ubiquitin domain-containing protein 2 [Cynoglossus 
semilaevis]
Length=273

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 65/101 (64%), Gaps = 5/101 (5%)
 Frame = -3

Query  472  KIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            K  +PK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  +     AQA
Sbjct  33   KRERPK-WKSDYPMTEGQLRSKRDEFWDTAPAFDGRKEIWDALRAAASAFESSDHLLAQA  91

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            I+DGA I +    LT CYDE G +Y+LP Y LS P N+I +
Sbjct  92   ILDGASITLPHGALTECYDELGNRYQLPVYCLSPPVNMIEE  132



>gb|KFQ09525.1| Ubiquitin domain-containing protein 1, partial [Leptosomus discolor]
Length=204

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            ++K +P WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  A     AQA
Sbjct  6    LKKERPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAVEANDHSLAQA  65

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLI  188
            I+DGA I +    LT CYDE G +Y+LP Y L+ P NLI
Sbjct  66   ILDGASITLPHGSLTECYDELGNRYQLPVYCLAPPVNLI  104



>ref|XP_008320190.1| PREDICTED: ubiquitin domain-containing protein 1-like isoform 
X1 [Cynoglossus semilaevis]
Length=254

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 71/129 (55%), Gaps = 17/129 (13%)
 Frame = -3

Query  517  GCAESSRSKGDDTVKKIRKPK-------------PWKHSEPITRDQLVQMRNEFWDTAPH  377
            GC   SR+ G  + +  R  K              WK   P+T  QL   R+EFWDTAP 
Sbjct  23   GCVGRSRTDGSGSDRTTRSKKRGGRNEPLKKERPKWKSEYPMTEGQLRSKRDEFWDTAPA  82

Query  376  YGGQKEIWDalcaaaeadl----alaqAIVDGAGIIVQAPDLTVCYDERGAKYELPRYVL  209
            + G+KEIWDAL AAA A       LAQAIVDGA I +    LT  YDE G +Y+LP Y L
Sbjct  83   FDGRKEIWDALRAAALAAECNDLELAQAIVDGACITLPHGSLTESYDELGNRYQLPAYTL  142

Query  208  SEPTNLIRD  182
            + P NLIR+
Sbjct  143  APPVNLIRE  151



>ref|XP_004076193.1| PREDICTED: ubiquitin domain-containing protein 2 isoform X1 [Oryzias 
latipes]
Length=272

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 65/101 (64%), Gaps = 5/101 (5%)
 Frame = -3

Query  472  KIRKPKPWKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            K  +PK WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  +     AQA
Sbjct  33   KRERPK-WKSDYPMTEGQLRSKRDEFWDTAPAFEGRKEIWDALRAAASAFESNDHLLAQA  91

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            I+DGA I +    LT CYDE G +Y+LP Y LS P N+I +
Sbjct  92   ILDGASITLPHGALTECYDELGNRYQLPVYCLSPPVNMIEE  132



>ref|XP_008145831.1| PREDICTED: ubiquitin domain-containing protein 2 [Eptesicus fuscus]
Length=234

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 66/101 (65%), Gaps = 5/101 (5%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            ++K KP WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  +     AQA
Sbjct  32   LKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQA  91

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRD  182
            I+DGA I +    LT CYDE G +Y+LP Y L+ P N+I +
Sbjct  92   IIDGANITLPHGSLTECYDELGNRYQLPVYCLAPPINMIEE  132



>gb|KFO81424.1| Ubiquitin domain-containing protein 2, partial [Cuculus canorus]
 gb|KFQ42795.1| Ubiquitin domain-containing protein 2, partial [Nestor notabilis]
Length=200

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 71/112 (63%), Gaps = 8/112 (7%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            ++K KP WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  +     AQA
Sbjct  6    LKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQA  65

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG*SSGTGKTID  149
            I+DGA I +    LT CYDE G +Y+LP Y L+ P N+I +    G  +T+D
Sbjct  66   IIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEE---KGDLETLD  114



>ref|XP_006270927.1| PREDICTED: ubiquitin domain-containing protein 2 [Alligator mississippiensis]
Length=220

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 71/112 (63%), Gaps = 8/112 (7%)
 Frame = -3

Query  469  IRKPKP-WKHSEPITRDQLVQMRNEFWDTAPHYGGQKEIWDalcaaaeadlal----aqA  305
            ++K KP WK   P+T  QL   R+EFWDTAP + G+KEIWDAL AAA A  +     AQA
Sbjct  18   LKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQA  77

Query  304  IVDGAGIIVQAPDLTVCYDERGAKYELPRYVLSEPTNLIRDG*SSGTGKTID  149
            I+DGA I +    LT CYDE G +Y+LP Y L+ P N+I +    G  +T+D
Sbjct  78   IIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEE---KGDLETLD  126



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1012179015936