BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10730

Length=851
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADB03784.1|  catalase                                                488   2e-168   Ipomoea batatas [batate]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          485   4e-167   Ipomoea batatas [batate]
gb|AIX10947.1|  putative catalase                                       431   6e-146   Gardenia jasminoides
gb|AAD50974.1|AF170272_1  catalase CAT1                                 431   8e-146   Manihot esculenta [manioc]
gb|AGE15298.2|  catalase 1                                              431   1e-145   Eriobotrya japonica [loquat]
gb|AGC65520.1|  catalase                                                431   1e-145   Eriobotrya japonica [loquat]
gb|ABB51561.1|  truncated catalase 2                                    427   2e-145   Avicennia marina
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     426   2e-145   Eucalyptus grandis [rose gum]
gb|AHF21552.1|  catalase                                                429   3e-145   Hylocereus undatus [dragon fruit]
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 429   4e-145   Eucalyptus grandis [rose gum]
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          429   5e-145   Avicennia marina
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      427   2e-144   Eucalyptus grandis [rose gum]
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 426   3e-144   Vitis vinifera
ref|NP_001268098.1|  catalase                                           426   4e-144   Vitis vinifera
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      426   7e-144   
gb|ACL27272.1|  catalase                                                425   1e-143   Nicotiana benthamiana
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      425   1e-143   Nicotiana sylvestris
gb|AAB71764.1|  catalase 1                                              425   2e-143   Nicotiana tabacum [American tobacco]
emb|CCP37650.1|  catalase-1                                             425   2e-143   Nicotiana tabacum [American tobacco]
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      422   3e-143   Nelumbo nucifera [Indian lotus]
ref|XP_006828714.1|  PREDICTED: catalase-1/2                            424   5e-143   Amborella trichopoda
gb|AFU48609.1|  catalase 1                                              423   9e-143   Nicotiana benthamiana
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      423   1e-142   Nelumbo nucifera [Indian lotus]
gb|ABM47415.1|  catalase                                                423   1e-142   Prunus avium [gean]
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 421   1e-142   
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      422   2e-142   Solanum tuberosum [potatoes]
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 421   2e-142   
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      422   2e-142   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAR84577.1|  catalase 1b                                             420   2e-142   Lotus japonicus
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      422   2e-142   Nicotiana tomentosiformis
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               422   3e-142   Ricinus communis
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 422   3e-142   Cucumis melo [Oriental melon]
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                422   3e-142   Erythranthe guttata [common monkey flower]
dbj|BAC79443.1|  catalase                                               421   3e-142   Acacia ampliceps
gb|AAC19397.1|  leaf catalase                                           421   4e-142   Mesembryanthemum crystallinum
ref|NP_001291326.1|  catalase isozyme 1                                 421   5e-142   Sesamum indicum [beniseed]
ref|XP_007046520.1|  Catalase 2                                         421   5e-142   Theobroma cacao [chocolate]
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      421   7e-142   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           421   7e-142   
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                421   7e-142   Erythranthe guttata [common monkey flower]
gb|AAR84578.1|  catalase 1a                                             421   8e-142   Lotus japonicus
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           421   8e-142   Sesamum indicum [beniseed]
ref|XP_007018034.1|  Catalase 2                                         421   8e-142   
gb|KEH36313.1|  catalase heme-binding enzyme                            418   9e-142   Medicago truncatula
gb|ABV55108.1|  catalase 2                                              420   1e-141   Musa acuminata AAA Group [Cavendish banana]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          420   1e-141   Soldanella alpina
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             418   1e-141   
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      421   2e-141   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB14250.1|  hypothetical protein B456_002G115900                    420   2e-141   Gossypium raimondii
gb|KJB17474.1|  hypothetical protein B456_003G002800                    418   2e-141   Gossypium raimondii
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             418   2e-141   
gb|AET97564.1|  catalase                                                419   2e-141   Ziziphus jujuba [Chinese jujube]
gb|KJB17473.1|  hypothetical protein B456_003G002800                    419   2e-141   Gossypium raimondii
gb|AJE26131.1|  catalase                                                419   3e-141   Salix matsudana [tortured willow]
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      419   3e-141   Nicotiana tomentosiformis
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      419   3e-141   Phoenix dactylifera
ref|NP_001289779.1|  catalase isozyme 1                                 419   3e-141   Nelumbo nucifera [Indian lotus]
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      419   3e-141   Nicotiana sylvestris
ref|NP_001234186.1|  catalase isozyme 2                                 419   4e-141   
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               419   4e-141   Gossypium hirsutum [American cotton]
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      419   4e-141   Fragaria vesca subsp. vesca
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             419   4e-141   Populus trichocarpa [western balsam poplar]
ref|XP_002306976.2|  catalase family protein                            419   5e-141   
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              419   5e-141   Cicer arietinum [garbanzo]
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      419   5e-141   Solanum lycopersicum
gb|KHG25152.1|  Catalase isozyme 1                                      418   5e-141   Gossypium arboreum [tree cotton]
gb|KHG12976.1|  Catalase isozyme 2                                      418   5e-141   Gossypium arboreum [tree cotton]
ref|NP_001235974.1|  catalase-3                                         418   6e-141   Glycine max [soybeans]
gb|ACJ76836.3|  catalase                                                418   7e-141   Dimocarpus longan [longan]
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             418   1e-140   Prunus persica
gb|KEH36312.1|  catalase heme-binding enzyme                            418   1e-140   Medicago truncatula
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    417   1e-140   
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 417   1e-140   Solanum tuberosum [potatoes]
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     417   1e-140   Eucalyptus grandis [rose gum]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      417   2e-140   Vitis vinifera
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      417   2e-140   Prunus mume [ume]
gb|ACJ11733.1|  catalase                                                417   2e-140   Gossypium hirsutum [American cotton]
gb|AIA61608.1|  catalase                                                417   2e-140   Gynostemma pentaphyllum [jiaogulan]
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              417   2e-140   Populus euphratica
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               417   2e-140   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|ABY21704.1|  catalase-1 precursor                                    417   2e-140   Panax ginseng [Asiatic ginseng]
dbj|BAH37035.1|  catalase 1                                             417   2e-140   Pisum sativum [garden pea]
gb|KJB57963.1|  hypothetical protein B456_009G187600                    417   2e-140   Gossypium raimondii
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             418   2e-140   
ref|XP_002301920.1|  catalase family protein                            417   2e-140   Populus trichocarpa [western balsam poplar]
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      417   2e-140   Elaeis guineensis
ref|XP_004144240.2|  PREDICTED: catalase isozyme 3                      417   2e-140   
emb|CAI43948.1|  catalase                                               417   3e-140   Populus deltoides
ref|XP_012073649.1|  PREDICTED: catalase isozyme 2                      417   3e-140   
gb|AAF61734.1|AF243519_1  catalase 4                                    417   3e-140   Helianthus annuus
emb|CAD42908.1|  catalase                                               416   3e-140   Prunus persica
gb|AAD17935.1|  catalase                                                416   3e-140   Brassica juncea [brown mustard]
gb|AAF71742.1|AF248491_1  catalase                                      416   4e-140   Raphanus sativus
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             416   4e-140   Phaseolus vulgaris [French bean]
gb|AAD17933.1|  catalase                                                416   5e-140   Brassica juncea [brown mustard]
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 416   5e-140   Populus euphratica
gb|AAO17721.1|  catalase                                                416   5e-140   Hypericum perforatum
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 416   5e-140   Prunus mume [ume]
gb|ACA50528.1|  putative catalase 2                                     416   5e-140   Brassica napus [oilseed rape]
gb|AFN81243.1|  catalase 1                                              416   6e-140   Brassica rapa subsp. pekinensis [bai cai]
gb|AFD29285.1|  catalase                                                416   6e-140   Vicia faba [broad bean]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             416   6e-140   Prunus persica
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      416   6e-140   Populus euphratica
emb|CDP07287.1|  unnamed protein product                                416   6e-140   Coffea canephora [robusta coffee]
ref|XP_009138342.1|  PREDICTED: catalase-2                              416   6e-140   Brassica rapa
emb|CAD42909.1|  catalase                                               416   7e-140   Prunus persica
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               415   8e-140   Ricinus communis
gb|AAG61140.2|AF332973_1  catalase 2                                    415   9e-140   Zantedeschia aethiopica [arum-lily]
gb|ABK24453.1|  unknown                                                 415   9e-140   Picea sitchensis
gb|ABF93811.1|  Catalase-1, putative, expressed                         411   9e-140   Oryza sativa Japonica Group [Japonica rice]
emb|CAA64220.1|  catalase                                               415   1e-139   Arabidopsis thaliana [mouse-ear cress]
gb|AAK96854.1|  catalase                                                415   1e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         415   1e-139   Tarenaya hassleriana [spider flower]
ref|NP_195235.1|  catalase 2                                            415   1e-139   Arabidopsis thaliana [mouse-ear cress]
gb|ADM96039.1|  catalase                                                415   1e-139   Cucumis sativus [cucumbers]
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             415   1e-139   
ref|XP_012073648.1|  PREDICTED: catalase isozyme 1                      415   1e-139   Jatropha curcas
ref|XP_010437527.1|  PREDICTED: catalase-2                              415   1e-139   Camelina sativa [gold-of-pleasure]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               415   1e-139   Gossypium hirsutum [American cotton]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         415   1e-139   Camelina sativa [gold-of-pleasure]
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      415   1e-139   
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          415   1e-139   Vigna radiata var. radiata [golden gram]
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      415   1e-139   Cucumis melo [Oriental melon]
ref|NP_001031791.1|  catalase 2                                         414   1e-139   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ33995.1|  unnamed protein product                                415   1e-139   Eutrema halophilum
gb|ACB11496.1|  catalase                                                415   1e-139   Pinus sylvestris [Scotch pine]
gb|ADZ45555.1|  catalase                                                415   2e-139   Vigna radiata [mung bean]
dbj|BAH19523.1|  AT4G35090                                              414   2e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         414   2e-139   Camelina sativa [gold-of-pleasure]
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             414   2e-139   Eutrema salsugineum [saltwater cress]
gb|AAD17936.1|  catalase                                                414   2e-139   Brassica juncea [brown mustard]
gb|ADZ45556.1|  catalase                                                414   2e-139   Vigna radiata [mung bean]
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              415   2e-139   Brassica rapa
ref|XP_012065377.1|  PREDICTED: catalase-2                              414   2e-139   Jatropha curcas
gb|AFU90822.1|  catalase                                                414   2e-139   Populus tomentosa [Chinese white poplar]
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             415   2e-139   Eutrema salsugineum [saltwater cress]
gb|AHF27430.1|  catalase                                                414   2e-139   Cucurbita moschata [ayote]
gb|AAB62892.1|  catalase-1                                              414   2e-139   Nicotiana glutinosa
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 414   3e-139   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001784759.1|  predicted protein                                  414   3e-139   
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      414   3e-139   
gb|KFK30147.1|  catalase                                                414   3e-139   Arabis alpina [alpine rockcress]
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      414   3e-139   Elaeis guineensis
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      414   3e-139   Phoenix dactylifera
gb|AAF61733.1|AF243518_1  catalase 3                                    414   4e-139   Helianthus annuus
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         414   4e-139   Tarenaya hassleriana [spider flower]
gb|EPS69543.1|  catalase                                                414   4e-139   Genlisea aurea
ref|XP_010692546.1|  PREDICTED: catalase                                414   4e-139   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              413   4e-139   
gb|AFR53082.1|  CAT                                                     414   5e-139   Anthurium andraeanum [flamingo-lily]
ref|XP_010530333.1|  PREDICTED: catalase-2                              413   5e-139   Tarenaya hassleriana [spider flower]
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             411   5e-139   
ref|XP_002521709.1|  catalase, putative                                 413   5e-139   Ricinus communis
gb|AHB72694.1|  catalase                                                413   5e-139   Beta vulgaris subsp. maritima [sea beet]
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              413   6e-139   
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      413   7e-139   
gb|ACL35349.1|  catalase                                                413   7e-139   Picea glauca
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       413   8e-139   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      413   8e-139   Cucumis melo [Oriental melon]
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             413   8e-139   Capsella rubella
gb|AAX88799.1|  catalase                                                413   9e-139   Euphorbia characias
gb|ACV92695.1|  catalase                                                413   9e-139   Brassica oleracea
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               413   9e-139   Cucurbita pepo
gb|AAC19398.1|  root catalase                                           412   1e-138   Mesembryanthemum crystallinum
ref|XP_011654267.1|  PREDICTED: catalase isozyme 1                      412   1e-138   Cucumis sativus [cucumbers]
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               412   1e-138   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 412   1e-138   Tarenaya hassleriana [spider flower]
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            412   1e-138   Pisum sativum [garden pea]
prf||1906388A  catalase                                                 412   1e-138
ref|NP_001237556.1|  catalase-1/2                                       412   1e-138   Glycine max [soybeans]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 412   1e-138   Phoenix dactylifera
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      412   1e-138   Citrus sinensis [apfelsine]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             412   1e-138   Citrus clementina [clementine]
gb|ADC95629.1|  catalase                                                412   1e-138   Bruguiera gymnorhiza [Burma mangrove]
emb|CAE82295.1|  catalase                                               412   2e-138   Homogyne alpina
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             412   2e-138   Eutrema salsugineum [saltwater cress]
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               412   2e-138   Cucurbita pepo
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             412   2e-138   Citrus clementina [clementine]
gb|ACH63223.1|  catalase                                                412   2e-138   Rheum australe [Himalayan rhubarb]
gb|AAF19965.1|AF207906_1  catalase 1                                    412   2e-138   Zantedeschia aethiopica [arum-lily]
ref|XP_009103333.1|  PREDICTED: catalase-1                              412   2e-138   Brassica rapa
gb|AHF27433.1|  catalase                                                412   2e-138   Cucurbita maxima [Boston marrow]
gb|AIZ77475.1|  catalase                                                412   2e-138   Triticum aestivum [Canadian hard winter wheat]
emb|CDY01363.1|  BnaA07g11360D                                          412   3e-138   
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             411   3e-138   
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              412   3e-138   
gb|AAM97542.1|  catalase 3                                              411   3e-138   Capsicum annuum
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      411   3e-138   
gb|ACJ71244.1|  catalase 2                                              408   3e-138   Vigna unguiculata
ref|XP_009106100.1|  PREDICTED: catalase-2                              411   3e-138   Brassica rapa
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      411   4e-138   Phoenix dactylifera
ref|NP_001237571.1|  catalase-4                                         411   4e-138   Glycine max [soybeans]
gb|ACJ71245.1|  catalase 2                                              407   4e-138   Vigna unguiculata
emb|CDY31877.1|  BnaC07g15270D                                          411   4e-138   Brassica napus [oilseed rape]
ref|XP_006828715.1|  PREDICTED: catalase-1/2                            411   4e-138   Amborella trichopoda
ref|XP_010061175.1|  PREDICTED: catalase-like                           411   4e-138   Eucalyptus grandis [rose gum]
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 410   4e-138   Phoenix dactylifera
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             411   5e-138   Selaginella moellendorffii
ref|NP_001240021.1|  catalase                                           411   5e-138   Glycine max [soybeans]
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    410   6e-138   Arabis alpina [alpine rockcress]
ref|NP_001048861.1|  Os03g0131200                                       410   8e-138   
ref|XP_010094556.1|  Catalase isozyme 1                                 410   9e-138   Morus notabilis
ref|XP_001752315.1|  predicted protein                                  410   1e-137   
gb|AEQ30070.1|  catalase                                                410   1e-137   Litchi chinensis [litchi]
emb|CAA45564.1|  catalase                                               410   1e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         410   1e-137   Oryza brachyantha
tpg|DAA43177.1|  TPA: catalase2                                         410   1e-137   
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     413   1e-137   Eucalyptus grandis [rose gum]
gb|AAB86582.2|  catalase                                                410   1e-137   Raphanus sativus
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      410   1e-137   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             407   1e-137   
gb|AIS20825.1|  CAT                                                     410   1e-137   Pyrus x bretschneideri [bai li]
dbj|BAA34714.1|  catalase                                               409   2e-137   Oryza sativa [red rice]
dbj|BAJ90861.1|  predicted protein                                      409   2e-137   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADU56198.1|  catalase                                                408   4e-137   Musa acuminata AAA Group [Cavendish banana]
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              409   5e-137   Populus euphratica
emb|CAG23920.1|  catalase                                               408   5e-137   Festuca arundinacea [tall fescue]
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 408   5e-137   Elaeis guineensis
emb|CDP01803.1|  unnamed protein product                                408   6e-137   Coffea canephora [robusta coffee]
gb|AAM97541.1|  catalase 2                                              408   6e-137   Capsicum annuum
tpg|DAA43178.1|  TPA: catalase2                                         409   6e-137   
ref|XP_003558892.1|  PREDICTED: catalase-1                              408   6e-137   Brachypodium distachyon [annual false brome]
ref|XP_009149539.1|  PREDICTED: catalase-3                              410   7e-137   Brassica rapa
ref|NP_973873.1|  catalase 3                                            405   9e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         407   9e-137   Tarenaya hassleriana [spider flower]
dbj|BAA34205.1|  catalase                                               407   1e-136   Oryza sativa Japonica Group [Japonica rice]
gb|AAK67359.2|AF390210_1  catalase                                      407   2e-136   Suaeda salsa
gb|AAD30291.2|AF139538_1  catalase 2                                    407   2e-136   Raphanus sativus
gb|ADU56199.1|  catalase                                                407   2e-136   Hevea brasiliensis [jebe]
emb|CDY29519.1|  BnaA06g14510D                                          407   2e-136   Brassica napus [oilseed rape]
gb|AIU99487.1|  catalase                                                407   2e-136   Saccharum hybrid cultivar ROC22
gb|AAD30292.1|AF139539_1  catalase 3                                    406   2e-136   Raphanus sativus
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             406   3e-136   Capsella rubella
gb|AGI65617.1|  catalase                                                405   3e-136   Fragaria x ananassa
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             406   3e-136   Phaseolus vulgaris [French bean]
ref|NP_001031073.1|  catalase 3                                         406   3e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009110221.1|  PREDICTED: catalase-3                              406   3e-136   Brassica rapa
emb|CDY33636.1|  BnaC08g19360D                                          406   4e-136   Brassica napus [oilseed rape]
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         406   4e-136   Brassica rapa
gb|AAM65021.1|  unknown                                                 406   4e-136   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH56915.1|  AT1G20620                                              406   4e-136   Arabidopsis thaliana [mouse-ear cress]
gb|AAF61732.1|AF243517_1  catalase 2                                    406   4e-136   Helianthus annuus
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          406   4e-136   
ref|NP_564120.1|  catalase 3                                            406   4e-136   Arabidopsis thaliana [mouse-ear cress]
emb|CDY31878.1|  BnaC07g15280D                                          406   5e-136   Brassica napus [oilseed rape]
gb|AIU99488.1|  catalase                                                405   5e-136   Saccharum hybrid cultivar ROC22
gb|AIU99480.1|  catalase                                                405   6e-136   Saccharum spontaneum [fodder cane]
ref|NP_001058635.1|  Os06g0727200                                       405   6e-136   
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      405   6e-136   Brachypodium distachyon [annual false brome]
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    405   6e-136   Arabis alpina [alpine rockcress]
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    405   7e-136   Oryza sativa Indica Group [Indian rice]
ref|NP_001241808.1|  catalase isozyme B                                 405   7e-136   Zea mays [maize]
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         405   7e-136   Setaria italica
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          405   8e-136   Helianthus annuus
gb|AIU99481.1|  catalase                                                405   1e-135   Saccharum spontaneum [fodder cane]
emb|CDY01364.1|  BnaA07g11370D                                          407   1e-135   
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      405   1e-135   
gb|AIP93616.1|  CAT1                                                    405   1e-135   Bassia scoparia [burning bush]
gb|AHA50082.1|  catalase                                                405   1e-135   Eleutherococcus senticosus
gb|AIM43584.1|  catalase                                                405   1e-135   Saccharum hybrid cultivar Yacheng05-179
gb|AIU99486.1|  catalase                                                405   1e-135   Saccharum spontaneum [fodder cane]
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               405   1e-135   Zea mays [maize]
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               404   1e-135   Zea mays [maize]
gb|AAC17731.1|  catalase 1                                              404   2e-135   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001105415.1|  catalase isozyme 1                                 404   2e-135   
ref|NP_564121.1|  catalase 1                                            404   2e-135   Arabidopsis thaliana [mouse-ear cress]
gb|AIU99479.1|  catalase                                                404   2e-135   Saccharum arundinaceum
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         404   2e-135   Camelina sativa [gold-of-pleasure]
emb|CAA42720.1|  catalase-1                                             404   3e-135   Zea mays [maize]
ref|XP_002510677.1|  catalase, putative                                 418   3e-135   
gb|AFW66787.1|  catalase3                                               404   4e-135   
prf||2104177A  catalase                                                 404   4e-135
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               404   4e-135   Cucurbita pepo
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      404   4e-135   Brachypodium distachyon [annual false brome]
gb|AAY59707.1|  catalase                                                403   6e-135   Oryza sativa Indica Group [Indian rice]
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    403   6e-135   Oryza brachyantha
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 403   6e-135   Oryza brachyantha
gb|AGT16310.1|  catalase                                                403   6e-135   Saccharum hybrid cultivar R570
gb|AFW66788.1|  catalase3                                               403   9e-135   
gb|ACL81498.1|  catalase                                                402   9e-135   
gb|AAG43363.1|AF151368_1  catalase                                      402   9e-135   
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     403   1e-134   
dbj|BAA34204.1|  catalase                                               402   1e-134   
gb|AAB07026.1|  catalase 1                                              402   2e-134   
ref|XP_010498496.1|  PREDICTED: catalase-3                              402   2e-134   
ref|NP_001234827.1|  catalase isozyme 1                                 402   2e-134   
emb|CDP07288.1|  unnamed protein product                                401   2e-134   
ref|XP_010477308.1|  PREDICTED: catalase-1                              401   2e-134   
prf||1803522A  catalase                                                 401   3e-134
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               401   3e-134   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         400   5e-134   
gb|AIU99484.1|  catalase                                                400   5e-134   
gb|ABC01913.1|  catalase isozyme 1-like protein                         400   6e-134   
gb|AII23739.1|  catalase                                                400   6e-134   
dbj|BAA05494.1|  catalase                                               400   7e-134   
gb|AIU99482.1|  catalase                                                400   8e-134   
gb|AIU99485.1|  catalase                                                400   8e-134   
ref|XP_010692544.1|  PREDICTED: catalase-like                           400   9e-134   
dbj|BAJ88747.1|  predicted protein                                      401   9e-134   
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 402   1e-133   
gb|AAC49807.1|  catalase 3                                              400   1e-133   
gb|AIU99483.1|  catalase                                                400   1e-133   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      400   1e-133   
gb|ABN71233.2|  catalase                                                399   1e-133   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      400   1e-133   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           399   1e-133
emb|CDY29518.1|  BnaA06g14520D                                          399   1e-133   
ref|NP_001045673.1|  Os02g0115700                                       399   2e-133   
gb|ADQ28492.1|  catalase                                                399   2e-133   
ref|XP_005645077.1|  catalase                                           399   3e-133   
ref|NP_001274863.1|  catalase isozyme 1                                 399   3e-133   
emb|CDY31488.1|  BnaC05g15970D                                          399   3e-133   
ref|XP_009149540.1|  PREDICTED: catalase-1                              399   3e-133   
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               399   3e-133   
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               398   5e-133   
gb|AFW66785.1|  catalase3 isoform 1                                     405   5e-133   
ref|NP_001105310.1|  catalase isozyme 2                                 398   5e-133   
gb|AHZ13843.1|  catalase                                                398   5e-133   
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    398   7e-133   
emb|CDY31490.1|  BnaC05g15990D                                          398   7e-133   
emb|CDY40645.1|  BnaA03g53180D                                          397   9e-133   
gb|ABB72796.1|  catalase isozyme 1-like protein                         397   1e-132   
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 397   1e-132   
emb|CAA43814.1|  catalase                                               397   1e-132   
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      397   1e-132   
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      397   2e-132   
gb|AAR97905.1|  catalase                                                397   2e-132   
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 396   2e-132   
dbj|BAJ92414.1|  predicted protein                                      396   3e-132   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               396   3e-132   
gb|ADY02963.1|  catalase                                                396   3e-132   
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               396   3e-132   
emb|CAA85470.1|  catalase                                               396   3e-132   
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    395   4e-132   
gb|AGV54297.1|  peroxisomal catalase                                    395   5e-132   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             395   6e-132   
gb|AFU90823.1|  catalase                                                393   8e-132   
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                394   1e-131   
gb|AGT16054.1|  catalase                                                394   1e-131   
gb|AGT16188.1|  catalase                                                394   1e-131   
gb|AGT16203.1|  catalase                                                394   2e-131   
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          394   3e-131   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         393   3e-131   
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          394   4e-131
emb|CAH61266.1|  catalase                                               393   5e-131   
gb|AAC48918.1|  salicylic acid binding catalase                         393   6e-131   
gb|AGT15888.1|  catalase                                                392   9e-131   
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               392   1e-130   
gb|EMT05040.1|  Catalase-1                                              393   1e-130   
gb|AJF34884.1|  catalase                                                392   2e-130   
gb|AAR14052.2|  catalase                                                391   2e-130   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   395   2e-130   
gb|AAP80622.1|AF475100_1  catalase isozyme                              383   2e-130   
gb|ABK24543.1|  unknown                                                 391   2e-130   
gb|EMS51034.1|  Catalase isozyme 2                                      392   2e-130   
gb|EMS61345.1|  Catalase isozyme 1                                      395   2e-130   
gb|ADN94253.1|  catalase                                                391   2e-130   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          392   3e-130   
dbj|BAF91369.1|  catalase                                               391   3e-130   
gb|ABK24449.1|  unknown                                                 390   6e-130   
ref|XP_001779509.1|  predicted protein                                  389   1e-129   
gb|AAB70006.1|  catalase                                                389   2e-129   
ref|XP_001696763.1|  catalase/peroxidase                                389   3e-129   
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             387   6e-129   
gb|KDD77132.1|  catalase                                                387   9e-129   
dbj|BAQ21275.1|  catalase                                               386   2e-128   
emb|CDX72514.1|  BnaC07g45360D                                          385   5e-128   
ref|NP_001105416.1|  catalase isozyme 3                                 385   9e-128   
emb|CAA73663.1|  catalase                                               384   2e-127   
emb|CDX69111.1|  BnaC01g03420D                                          383   3e-127   
gb|AAF79625.1|AC027665_26  F5M15.5                                      398   3e-127   
gb|EMT06167.1|  Catalase isozyme 2                                      389   6e-127   
ref|XP_002950455.1|  catalase                                           382   1e-126   
ref|XP_002890395.1|  F5M15.5                                            395   2e-126   
emb|CDY17510.1|  BnaC03g65530D                                          378   2e-125   
emb|CDX76313.1|  BnaA08g10870D                                          378   2e-125   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        379   2e-125   
emb|CDY52649.1|  BnaAnng11640D                                          376   5e-125   
gb|AKA94107.1|  catalase                                                373   3e-123   
ref|XP_011396830.1|  Catalase isozyme 2                                 370   4e-122   
gb|ABB88582.1|  catalase                                                370   4e-122   
gb|ABK41476.1|  catalase                                                369   1e-121   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          367   5e-121   
gb|AHG98056.1|  catalase                                                358   3e-120   
gb|AHF27432.1|  catalase                                                360   2e-118   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          360   3e-118   
gb|AHF27429.1|  catalase                                                358   1e-117   
gb|ADR01107.1|  catalase 3                                              354   2e-117   
dbj|BAH20307.1|  AT1G20620                                              355   1e-116   
ref|XP_011654421.1|  PREDICTED: catalase isozyme 1-like                 352   9e-116   
ref|XP_011022275.1|  PREDICTED: catalase-like                           351   8e-115   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              350   2e-114   
gb|AAL38024.1|AF443179_1  catalase                                      330   3e-110   
gb|AIR77003.1|  catalase                                                332   5e-110   
ref|XP_005708279.1|  catalase                                           339   5e-110   
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       336   5e-110   
gb|AAC84138.1|  catalase                                                327   1e-109   
ref|XP_005536240.1|  catalase                                           337   6e-109   
gb|ABR16304.1|  unknown                                                 333   4e-108   
gb|ACJ71242.1|  catalase 1                                              320   3e-106   
gb|AAD37788.1|AF149283_1  catalase 1                                    320   2e-103   
gb|ACY30463.1|  catalase                                                316   3e-103   
gb|AII80275.1|  catalase                                                315   6e-103   
gb|AEG89525.1|  catalase                                                312   2e-101   
gb|AEA86312.1|  catalase isozyme                                        302   8e-100   
emb|CAB16750.1|  catalase                                               303   4e-99    
gb|AFC01205.1|  catalase                                                299   1e-97    
gb|ADI58890.1|  catalase                                                295   2e-97    
gb|AEQ94083.1|  putative catalase                                       300   2e-97    
emb|CAB56850.1|  catalase                                               304   3e-97    
gb|KJB10391.1|  hypothetical protein B456_001G198700                    304   6e-97    
gb|AAN78323.1|  catalase1                                               293   2e-96    
gb|KHG11966.1|  Catalase isozyme 2                                      297   4e-96    
emb|CAC37634.1|  catalase 1                                             296   5e-96    
gb|ACJ71243.1|  catalase 2                                              292   2e-95    
ref|XP_005642928.1|  catalase                                           299   2e-94    
emb|CAP74531.1|  putative Td650 protein                                 289   1e-93    
gb|AAO12509.1|  catalase                                                286   2e-93    
gb|ABY74514.1|  catalase                                                286   4e-93    
emb|CDW92180.1|  putative catalase                                      287   2e-92    
ref|XP_005644653.1|  catalase-domain-containing protein                 295   4e-92    
emb|CDW92181.1|  putative catalase                                      285   1e-91    
emb|CDP01802.1|  unnamed protein product                                290   2e-91    
ref|WP_028402967.1|  catalase                                           290   9e-91    
emb|CBI29557.3|  unnamed protein product                                276   5e-90    
ref|XP_005647994.1|  catalase-domain-containing protein                 285   8e-89    
gb|EJF09706.1|  catalase                                                282   8e-88    
ref|WP_035405433.1|  catalase                                           281   1e-87    
ref|WP_040574212.1|  catalase                                           282   1e-87    
ref|XP_005712277.1|  unnamed protein product                            281   3e-87    
ref|WP_011983963.1|  catalase                                           280   6e-87    
emb|CAJ00337.1|  putative catalase                                      273   7e-87    
ref|WP_018669668.1|  catalase                                           278   3e-86    
ref|WP_043068684.1|  catalase                                           277   4e-86    
dbj|GAE06714.1|  catalase                                               270   4e-86    
ref|WP_026975362.1|  catalase                                           277   7e-86    
ref|WP_001069182.1|  MULTISPECIES: catalase                             276   1e-85    
ref|WP_043072359.1|  catalase                                           276   2e-85    
gb|AAS40190.1|  catalase                                                274   3e-85    
ref|WP_001069184.1|  MULTISPECIES: catalase                             275   3e-85    
ref|WP_001069181.1|  MULTISPECIES: catalase                             275   3e-85    
ref|WP_045670628.1|  catalase                                           275   3e-85    
ref|WP_001069183.1|  catalase                                           275   3e-85    
ref|WP_026798903.1|  catalase                                           275   4e-85    
ref|WP_001069180.1|  MULTISPECIES: catalase                             275   4e-85    
ref|WP_038413367.1|  catalase                                           275   4e-85    
ref|WP_016122096.1|  catalase                                           275   4e-85    
ref|WP_023521416.1|  catalase                                           275   4e-85    
ref|WP_001069177.1|  MULTISPECIES: catalase                             275   5e-85    
ref|WP_044741157.1|  catalase                                           275   5e-85    
ref|WP_001069176.1|  catalase                                           275   5e-85    
ref|WP_001069179.1|  MULTISPECIES: catalase                             275   5e-85    
ref|WP_001069185.1|  catalase                                           275   5e-85    
ref|WP_042982436.1|  catalase                                           275   6e-85    
ref|WP_001069190.1|  catalase                                           275   6e-85    
ref|WP_026590478.1|  catalase                                           274   6e-85    
ref|WP_002201400.1|  catalase                                           274   6e-85    
ref|WP_033673856.1|  catalase                                           274   7e-85    
ref|WP_001069178.1|  catalase                                           274   7e-85    
ref|WP_002134937.1|  catalase                                           274   7e-85    
ref|WP_002149880.1|  catalase                                           274   7e-85    
ref|WP_044306649.1|  catalase                                           274   7e-85    
ref|WP_016104158.1|  catalase                                           274   7e-85    
ref|WP_002194469.1|  catalase                                           274   8e-85    
ref|WP_001069189.1|  catalase                                           274   8e-85    
ref|WP_002011249.1|  catalase                                           274   8e-85    
ref|WP_016101561.1|  catalase                                           274   8e-85    
ref|WP_002202803.1|  catalase                                           274   8e-85    
ref|WP_001069170.1|  catalase                                           274   8e-85    
ref|WP_002087018.1|  catalase                                           274   8e-85    
ref|WP_002125906.1|  MULTISPECIES: catalase                             274   8e-85    
ref|WP_016113754.1|  catalase                                           274   9e-85    
ref|WP_031412803.1|  catalase                                           274   9e-85    
ref|WP_001069174.1|  catalase                                           274   9e-85    
ref|WP_001069169.1|  MULTISPECIES: catalase                             274   9e-85    
ref|WP_044437756.1|  catalase                                           274   9e-85    
gb|EOO14705.1|  catalase                                                274   9e-85    
ref|WP_001069173.1|  catalase                                           274   1e-84    
ref|WP_002188737.1|  catalase                                           274   1e-84    
ref|WP_002170801.1|  MULTISPECIES: catalase                             274   1e-84    
ref|WP_002030287.1|  MULTISPECIES: catalase                             274   1e-84    
ref|WP_030023914.1|  catalase                                           274   1e-84    
ref|WP_002158904.1|  catalase                                           274   1e-84    
ref|WP_001069171.1|  catalase                                           274   1e-84    
ref|WP_001069172.1|  catalase                                           274   1e-84    
ref|WP_001069157.1|  MULTISPECIES: catalase                             274   1e-84    
ref|WP_001069152.1|  catalase                                           274   1e-84    
ref|WP_001069158.1|  MULTISPECIES: catalase                             274   1e-84    
ref|WP_002168907.1|  catalase                                           274   1e-84    
ref|WP_001069156.1|  catalase                                           274   1e-84    
ref|WP_035435964.1|  catalase                                           273   1e-84    
ref|WP_044792704.1|  catalase                                           273   1e-84    
ref|WP_001069155.1|  catalase                                           273   1e-84    
ref|WP_001069154.1|  MULTISPECIES: catalase                             273   1e-84    
ref|WP_002186432.1|  MULTISPECIES: catalase                             273   1e-84    
ref|WP_001069153.1|  catalase                                           273   1e-84    
ref|WP_017152869.1|  catalase                                           273   1e-84    
ref|WP_001069164.1|  catalase                                           273   1e-84    
ref|WP_001069163.1|  catalase                                           273   2e-84    
ref|WP_002116977.1|  catalase                                           273   2e-84    



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   488 bits (1257),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 229/236 (97%), Positives = 233/236 (99%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDPSKYRPSSSFNTPFCTTN GAPVWNNTCALTVGSRGPILLEDYHL+EKIQNFTRERIP
Sbjct  1    MDPSKYRPSSSFNTPFCTTNSGAPVWNNTCALTVGSRGPILLEDYHLIEKIQNFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVKMYTREGN+DLVGNNFPVFFIRDG QFPDVIHAFKPNPKSHIQENWRILDYLSHLP
Sbjct  121  GFAVKMYTREGNWDLVGNNFPVFFIRDGTQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINK+GK NYVKFHWKPTCG+KCLL
Sbjct  181  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKEGKANYVKFHWKPTCGIKCLL  236



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   485 bits (1248),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 229/236 (97%), Positives = 232/236 (98%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDPSKYRPSSSFNTPFCTTN GAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP
Sbjct  1    MDPSKYRPSSSFNTPFCTTNSGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVKMYTR GN+DLVGNNFPVFFIRDG QFPDVIHAFKPNPKSHIQENWRILDYLSHLP
Sbjct  121  GFAVKMYTRGGNWDLVGNNFPVFFIRDGTQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINK+GK NYVKFHWKPTCGVKCLL
Sbjct  181  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKEGKANYVKFHWKPTCGVKCLL  236



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   431 bits (1108),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 218/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+FNTPF TTN G PVWNN  ALTVG+RGPILLEDYHLVEK+ N+TRERIP
Sbjct  1    MDPYKFRPSSAFNTPFWTTNAGGPVWNNDSALTVGTRGPILLEDYHLVEKLANWTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DLVGNNFPVFF+RD  +FPD IHA KPNPKSHIQE+WRILD+ SHLP
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVRDAMKFPDSIHALKPNPKSHIQESWRILDFFSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TFAWFYDDVGIP DYRHMEGFG+H +T+INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLSTFAWFYDDVGIPQDYRHMEGFGIHAYTLINKAGKAHYVKFHWKPTCGVKSLL  236



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   431 bits (1107),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 199/236 (84%), Positives = 218/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSSS NTPF TT+ GAPVWNN  ++TVG+RGPILLEDYH++EK+ NFTRERIP
Sbjct  1    MDPCKFRPSSSNNTPFWTTDAGAPVWNNNSSMTVGTRGPILLEDYHMIEKLANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARG +AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGMSAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFA K YTREGNFD+VGNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WRI D+LSH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRIFDFLSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TFAWF+DDVGIP DYRHMEGFGVHTFT INK GKV YVKFHWKPTCGVKCL+
Sbjct  181  ESLSTFAWFFDDVGIPQDYRHMEGFGVHTFTFINKAGKVTYVKFHWKPTCGVKCLM  236



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   431 bits (1107),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 220/236 (93%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGP+LLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHIQE WR+LD+LSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL TFA+ +DDVG+P DYRHMEGFGVH++T+I+K GKV+YVKFHWKPTCGVKCLL
Sbjct  181  ESLLTFAFLFDDVGVPQDYRHMEGFGVHSYTLISKAGKVHYVKFHWKPTCGVKCLL  236



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   431 bits (1107),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 220/236 (93%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGP+LLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHIQE WR+LD+LSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL TFA+ +DDVG+P DYRHMEGFGVH++T+I+K GKV+YVKFHWKPTCGVKCLL
Sbjct  181  ESLLTFAFLFDDVGVPQDYRHMEGFGVHSYTLISKAGKVHYVKFHWKPTCGVKCLL  236



>gb|ABB51561.1| truncated catalase 2 [Avicennia marina]
Length=424

 Score =   427 bits (1099),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 199/236 (84%), Positives = 219/236 (93%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KY PSSSFNTP  TTNGG PV+N+  +LTVG+RGP+LLEDY L++K+ +FTRERIP
Sbjct  1    MDPYKYCPSSSFNTPHTTTNGGHPVYNDNSSLTVGTRGPVLLEDYQLIDKLAHFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGATAKGFFEVTHD++HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFD+VGNNFPVFFIRD  +FPDVIHAFKPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDIVGNNFPVFFIRDAIKFPDVIHAFKPNPKSHIQESWRILDFCSHFP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL TFAWFYDDVGIP DYRHMEGFGVH++T+INK GKVNYVKFHWKPTCGVKCL+
Sbjct  181  ESLLTFAWFYDDVGIPQDYRHMEGFGVHSYTLINKAGKVNYVKFHWKPTCGVKCLM  236



>gb|KCW68093.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=399

 Score =   426 bits (1095),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVG NFPVFFIRD  +FPD IHAFKPNPKS+IQE WRI+D+LSH P
Sbjct  121  GFAVKFYTREGNFDLVGINFPVFFIRDAMKFPDAIHAFKPNPKSNIQEMWRIIDFLSHQP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TFAWF+DDVGIP DYRHMEGFGVH FT INK GK NYVKFHWKPTCGVKCLL
Sbjct  181  ESLSTFAWFFDDVGIPQDYRHMEGFGVHAFTFINKAGKTNYVKFHWKPTCGVKCLL  236



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   429 bits (1104),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSSSFNT F TTN GAPVWNNT A+T+G RGP+LLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKHRPSSSFNTTFWTTNSGAPVWNNTSAMTIGQRGPVLLEDYHLIEKITNFHRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ER+VHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFA K YTREGNFD+VGNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+LD+ SH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFIRDGMKFPDVIHAFKPNPKSHIQEYWRVLDFCSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLNTF W +DDVGIP DYRHMEGFGV+TF+ IN+DGKV+YVKFHWKPTCGVK LL
Sbjct  181  ESLNTFGWLFDDVGIPQDYRHMEGFGVNTFSFINRDGKVHYVKFHWKPTCGVKSLL  236



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   429 bits (1103),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 197/236 (83%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLIEKLANFERERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPD IHAFKPNPKS+IQE WRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIHAFKPNPKSNIQEMWRIIDFFSHQP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TFAWF+DDVGIP DYRHMEGFGVH FT INK GK NYVKFHWKPTCGVKCLL
Sbjct  181  ESLSTFAWFFDDVGIPQDYRHMEGFGVHAFTFINKTGKTNYVKFHWKPTCGVKCLL  236



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   429 bits (1102),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 199/236 (84%), Positives = 219/236 (93%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KY PSSSFNTP  TTNGG PV+N+  +LTVG+RGP+LLEDY L++K+ +FTRERIP
Sbjct  1    MDPYKYCPSSSFNTPHTTTNGGHPVYNDNSSLTVGTRGPVLLEDYQLIDKLAHFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGATAKGFFEVTHD++HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFD+VGNNFPVFFIRD  +FPDVIHAFKPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDIVGNNFPVFFIRDAIKFPDVIHAFKPNPKSHIQESWRILDFCSHFP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL TFAWFYDDVGIP DYRHMEGFGVH++T+INK GKVNYVKFHWKPTCGVKCL+
Sbjct  181  ESLLTFAWFYDDVGIPQDYRHMEGFGVHSYTLINKAGKVNYVKFHWKPTCGVKCLM  236



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   427 bits (1098),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVG NFPVFFIRD  +FPD IHAFKPNPKS+IQE WRI+D+LSH P
Sbjct  121  GFAVKFYTREGNFDLVGINFPVFFIRDAMKFPDAIHAFKPNPKSNIQEMWRIIDFLSHQP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TFAWF+DDVGIP DYRHMEGFGVH FT INK GK NYVKFHWKPTCGVKCLL
Sbjct  181  ESLSTFAWFFDDVGIPQDYRHMEGFGVHAFTFINKAGKTNYVKFHWKPTCGVKCLL  236



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   426 bits (1096),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 196/236 (83%), Positives = 219/236 (93%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N+P+ TTN GAPV+NN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFD+VGNNFPVFFIRD  +FPDVIHAFKPNPKSHIQE WR++D+LS+ P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIRDAMKFPDVIHAFKPNPKSHIQEYWRVVDFLSYHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TFA+ +DDVG+P DYRHMEGFGVHTFT+INK GK NYVKFHWKPTCGVKCLL
Sbjct  181  ESLSTFAFLFDDVGVPQDYRHMEGFGVHTFTLINKAGKANYVKFHWKPTCGVKCLL  236



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   426 bits (1096),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 196/236 (83%), Positives = 219/236 (93%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N+P+ TTN GAPV+NN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFD+VGNNFPVFFIRD  +FPDVIHAFKPNPKSHIQE WR++D+LS+ P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIRDAMKFPDVIHAFKPNPKSHIQEYWRVVDFLSYHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TFA+ +DDVGIP DYRHMEGFGVHTFT++NK GK NYVKFHWKPTCGVKCLL
Sbjct  181  ESLSTFAFLFDDVGIPQDYRHMEGFGVHTFTLLNKAGKANYVKFHWKPTCGVKCLL  236



>ref|XP_010061173.1| PREDICTED: catalase isozyme 2-like isoform X1 [Eucalyptus grandis]
Length=496

 Score =   426 bits (1095),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVG NFPVFFIRD  +FPD IHAFKPNPKS+IQE WRI+D+LSH P
Sbjct  121  GFAVKFYTREGNFDLVGINFPVFFIRDAMKFPDAIHAFKPNPKSNIQEMWRIIDFLSHQP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TFAWF+DDVGIP DYRHMEGFGVH FT INK GK NYVKFHWKPTCGVKCLL
Sbjct  181  ESLSTFAWFFDDVGIPQDYRHMEGFGVHAFTFINKAGKTNYVKFHWKPTCGVKCLL  236



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   425 bits (1093),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 195/236 (83%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHM+G GVHTFT+INK GK  YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLINKAGKSTYVKFHWKPTCGVKSLL  236



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   425 bits (1093),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 194/236 (82%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHM+G GVHTFT+INK GK  YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLINKAGKSTYVKFHWKPTCGVKSLL  236



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   425 bits (1092),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 194/236 (82%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHM+G GVHTFT+INK GK  YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLINKAGKSTYVKFHWKPTCGVKSLL  236



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   425 bits (1092),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 194/236 (82%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHM+G GVHTFT+INK GK  YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLINKAGKSTYVKFHWKPTCGVKSLL  236



>ref|XP_010242895.1| PREDICTED: catalase isozyme 1-like isoform X2 [Nelumbo nucifera]
Length=433

 Score =   422 bits (1085),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 195/236 (83%), Positives = 218/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PF +TN GAPVWNN  +LTVG+RGPI+LEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVGIP DYRHMEG GV+T+T+INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMEGSGVNTYTLINKTGKAHYVKFHWKPTCGVKCLL  236



>ref|XP_006828714.1| PREDICTED: catalase-1/2 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   424 bits (1089),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 196/235 (83%), Positives = 215/235 (91%), Gaps = 0/235 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N+PF TTN GAPVWN+  +LTVGSRGPILLEDYHL+EK+ +FTRER P
Sbjct  1    MDPYKYRPSSAYNSPFMTTNAGAPVWNDDSSLTVGSRGPILLEDYHLIEKLAHFTRERTP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ER+VHARGA+AKGFFEVTHDI+HLTCAD LRAPGVQTPLIVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHIQENWRILD+LSH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVRDPMKFPDVIHAFKPNPKSHIQENWRILDFLSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCL  846
            ESL+TFAWFYDDVGIPTDYRHMEGFGV  +T++NK GK    KFHWKPTCGVK L
Sbjct  181  ESLSTFAWFYDDVGIPTDYRHMEGFGVSAYTLLNKAGKATLAKFHWKPTCGVKSL  235



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   423 bits (1087),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 194/235 (83%), Positives = 216/235 (92%), Gaps = 0/235 (0%)
 Frame = +1

Query  145  DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPE  324
            DP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RER+PE
Sbjct  1    DPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVPE  60

Query  325  RVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRG  504
            RVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  505  FAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPE  684
            FAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+PE
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVPE  180

Query  685  SLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            SL+ F + +DD+GIP DYRHM+G GVHTFT+INK GK  YVKFHWKPTCGVK LL
Sbjct  181  SLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLINKAGKSTYVKFHWKPTCGVKSLL  235



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   423 bits (1087),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 195/236 (83%), Positives = 218/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PF +TN GAPVWNN  +LTVG+RGPI+LEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVGIP DYRHMEG GV+T+T+INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMEGSGVNTYTLINKTGKAHYVKFHWKPTCGVKCLL  236



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   423 bits (1087),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 196/236 (83%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+F+TPF TTN GAPVWNN  +LTVGSRGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDTPFWTTNSGAPVWNNDSSLTVGSRGPVLLEDYHLVEKLATFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPD I AFKPNPKSHIQENWRILD+ SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQENWRILDFFSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TFA+FYDD+GIP DYRHMEG  VH +T+I+K GKV+YVKFHWKPTCGVKCLL
Sbjct  181  ESLHTFAFFYDDLGIPQDYRHMEGSSVHAYTLISKAGKVHYVKFHWKPTCGVKCLL  236



>ref|XP_008348922.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=445

 Score =   421 bits (1082),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 196/236 (83%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHIQE WR+LD+LSH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL TFA+ +DDVG+P DYRHMEGFGVH +T+I+K GKV+YVKFHWKPTCGVKCLL
Sbjct  181  ESLLTFAFLFDDVGVPQDYRHMEGFGVHAYTLISKAGKVHYVKFHWKPTCGVKCLL  236



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   422 bits (1085),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PFCTTN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHM+G GVHTFT+IN+ GK  YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLINRAGKSTYVKFHWKPTCGVKSLL  236



>ref|XP_008382478.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=453

 Score =   421 bits (1081),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 196/236 (83%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHIQE WR+LD+LSH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL TFA+ +DDVG+P DYRHMEGFGVH +T+I+K GKV+YVKFHWKPTCGVKCLL
Sbjct  181  ESLLTFAFLFDDVGVPQDYRHMEGFGVHAYTLISKAGKVHYVKFHWKPTCGVKCLL  236



>ref|XP_009398521.1| PREDICTED: catalase isozyme A [Musa acuminata subsp. malaccensis]
Length=492

 Score =   422 bits (1084),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 196/236 (83%), Positives = 219/236 (93%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSSSF+T F TTN GAPVWN+  ALTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTVGSRGPILLEDYHLVEKIAHFARERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+I+RFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSH+QE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHVQEYWRVFDFLSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TF + +DDVG+P+DYRHMEGFGV+T+T +NK+GKVNYVKFHWKPTCGVKCLL
Sbjct  181  ESLHTFFFLFDDVGVPSDYRHMEGFGVNTYTFVNKEGKVNYVKFHWKPTCGVKCLL  236



>gb|AAR84577.1| catalase 1b [Lotus japonicus]
 gb|AAR84579.1| catalase 1b [Lotus japonicus]
Length=449

 Score =   420 bits (1080),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+FN+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DDVG+P DYRHM+GFGV+T+T+INK GKV YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDVGVPQDYRHMDGFGVNTYTLINKAGKVVYVKFHWKPTCGVKCLL  236



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   422 bits (1084),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+ FCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSTFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHM+G GVHTFT+INK GK  YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLINKAGKSTYVKFHWKPTCGVKSLL  236



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   422 bits (1084),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 195/236 (83%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP + RPSS FNTPF TTN GAPVWNN  +LTVGSRGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRNRPSSGFNTPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPDV+HAFKPNPKSH+QENWRI D+LSH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVVHAFKPNPKSHLQENWRIFDFLSHVP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+   +  DD+GIP DYRHMEG GV+T+T+INK GKV+YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMLTFLLDDLGIPQDYRHMEGSGVNTYTLINKAGKVHYVKFHWKPTCGVKCLL  236



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   422 bits (1084),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 194/236 (82%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K RPSS++NTPF TTN GAPVWNN  ALT+GSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKQRPSSAYNTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHM+G GV+T+ +INK+GKV+YVKFHW+PTCGVKCLL
Sbjct  181  ESLHMFTFLFDDLGIPQDYRHMDGSGVNTYNLINKEGKVHYVKFHWRPTCGVKCLL  236



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   422 bits (1084),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 196/236 (83%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DDVG+P DYRHM+G GV+T+T+INK GKVNYVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDVGVPQDYRHMDGSGVNTYTLINKAGKVNYVKFHWKPTCGVKNLL  236



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   421 bits (1083),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 199/236 (84%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FNTPF TTN G PV+NN  ALT+GSRGPILLEDYHLVEKI NFTRER P
Sbjct  1    MDPYKYRPSSTFNTPFWTTNSGTPVYNNDSALTIGSRGPILLEDYHLVEKIANFTRERTP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+LD+ S+LP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVIHAFKPNPKSHIQEYWRVLDFCSYLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TF + +DDVG+P DYRHMEG  V+T+T+INK GKV+YVKFHWKPT GVKCLL
Sbjct  181  ESLHTFMFLFDDVGVPQDYRHMEGSSVNTYTLINKAGKVHYVKFHWKPTLGVKCLL  236



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   421 bits (1083),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 219/236 (93%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+P+ TTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPYFTTNSGAPVYNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFD+VGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DDVG+PTDYRHMEG GV+T+T+I+K GKV+YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDVGVPTDYRHMEGSGVNTYTLISKSGKVHYVKFHWKPTCGVKCLL  236



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   421 bits (1082),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIMDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+G+P DYRHM+G GV+T+T+INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGVPQDYRHMDGSGVNTYTLINKAGKAHYVKFHWKPTCGVKSLL  236



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   421 bits (1082),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PF TTN GAPV+NN  +L+VG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYNNNSSLSVGARGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DDVG+P DYRHM+G GVHT+T+INK GK  YVKFHW+PTCGVKCLL
Sbjct  181  ESLHMFTFLFDDVGVPQDYRHMDGSGVHTYTLINKAGKAQYVKFHWRPTCGVKCLL  236



>ref|XP_009392261.1| PREDICTED: catalase isozyme A-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=492

 Score =   421 bits (1081),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 195/236 (83%), Positives = 219/236 (93%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSSSF+T F TTN GAPVWN+  ALT+GSRGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTMGSRGPILLEDYHLIEKVAHFARERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFE THD+THL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TF + +DDVG+P+DYRHMEGFGV+T+T INK+GKVNYVKFHWKPTCGVKCLL
Sbjct  181  ESLHTFFFLFDDVGVPSDYRHMEGFGVNTYTFINKEGKVNYVKFHWKPTCGVKCLL  236



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   421 bits (1081),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPS +FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVG+P DYRHM+G GV+T+T+INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGSGVNTYTLINKAGKAHYVKFHWKPTCGVKCLL  236



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   421 bits (1081),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 194/236 (82%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR PGVQTP+IVRFSTVIHERGSPE+IRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRGPGVQTPVIVRFSTVIHERGSPESIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GKVNYVKFHWKPTCGVKCL+
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKVNYVKFHWKPTCGVKCLI  236



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   421 bits (1081),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+FN+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DDVG+P DYRHM+GFGV+T+T+INK GKV YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDVGVPQDYRHMDGFGVNTYTLINKAGKVVYVKFHWKPTCGVKCLL  236



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   421 bits (1081),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPS +FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVG+P DYRHM+G GV+T+T+INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGSGVNTYTLINKAGKAHYVKFHWKPTCGVKCLL  236



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   421 bits (1081),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 194/236 (82%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GK  YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAQYVKFHWKPTCGVKCLL  236



>gb|KEH36313.1| catalase heme-binding enzyme [Medicago truncatula]
Length=430

 Score =   418 bits (1075),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+ DG  FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMNFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVG+P DYRHM+GFGV+T+++INK GK  YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGFGVNTYSLINKAGKAVYVKFHWKPTCGVKCLL  236



>gb|ABV55108.1| catalase 2 [Musa acuminata AAA Group]
Length=492

 Score =   420 bits (1080),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 195/236 (83%), Positives = 219/236 (93%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSSSF+T F TTN GAPVWN+  ALTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTVGSRGPILLEDYHLVEKIAHFARERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+I+RFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSH+QE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHVQEYWRVFDFLSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TF + +DDVG+P+DYRHMEGFGV+T+T ++K+GKVNYVKFHWKPTCGVKCLL
Sbjct  181  ESLHTFFFLFDDVGVPSDYRHMEGFGVNTYTFVSKEGKVNYVKFHWKPTCGVKCLL  236



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   420 bits (1080),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 194/236 (82%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYR SS+FNTPF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRSSSAFNTPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GK  YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAQYVKFHWKPTCGVKCLL  236



>ref|XP_006382987.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382988.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382989.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60784.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60785.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60786.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=434

 Score =   418 bits (1074),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 194/236 (82%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++  DD+G+P DYRHMEG GV+T+T+INK GK  YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFSFLLDDIGVPQDYRHMEGSGVNTYTLINKAGKAYYVKFHWKPTCGVKSLL  236



>ref|XP_009392260.1| PREDICTED: catalase isozyme A-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=511

 Score =   421 bits (1081),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 195/236 (83%), Positives = 219/236 (93%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSSSF+T F TTN GAPVWN+  ALT+GSRGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTMGSRGPILLEDYHLIEKVAHFARERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFE THD+THL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TF + +DDVG+P+DYRHMEGFGV+T+T INK+GKVNYVKFHWKPTCGVKCLL
Sbjct  181  ESLHTFFFLFDDVGVPSDYRHMEGFGVNTYTFINKEGKVNYVKFHWKPTCGVKCLL  236



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   420 bits (1079),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 194/236 (82%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAHYVKFHWKPTCGVKCLL  236



>gb|KJB17474.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=451

 Score =   418 bits (1075),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHM+G GVHT+T+INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVHTYTLINKAGKAHYVKFHWKPTCGVKSLL  236



>ref|XP_006382990.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382991.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60787.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60788.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=455

 Score =   418 bits (1075),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 194/236 (82%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++  DD+G+P DYRHMEG GV+T+T+INK GK  YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFSFLLDDIGVPQDYRHMEGSGVNTYTLINKAGKAYYVKFHWKPTCGVKSLL  236



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   419 bits (1078),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+P+ TTN GAP+WNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAHYVKFHWKPTCGVKCLL  236



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   419 bits (1078),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHM+G GVHT+T+INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVHTYTLINKAGKAHYVKFHWKPTCGVKSLL  236



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   419 bits (1077),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 195/236 (83%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+F+TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVG+P DYRHMEG GV+T+T+INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMEGSGVNTYTLINKAGKAHYVKFHWKPTCGVKCLL  236



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   419 bits (1077),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+G+P DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLINKAGKAHYVKFHWKPTCGVKCLL  236



>ref|XP_008812256.1| PREDICTED: catalase isozyme B [Phoenix dactylifera]
Length=478

 Score =   419 bits (1076),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+ N PF TTN GAPVWNN  +LTVGSRGP+ LEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPVFLEDYHLIEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSH+QENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHLQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVGIP+DYRHM+GFGV+T+++INKDGK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDVGIPSDYRHMDGFGVNTYSLINKDGKTHYVKFHWKPTCGVKCLL  236



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   419 bits (1077),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPS++F++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSTAFDSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DDVGIP DYRHM+G GV+T+T+INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDVGIPQDYRHMDGSGVNTYTLINKAGKAHYVKFHWKPTCGVKCLL  236



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   419 bits (1077),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+G+P DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLINKAGKAHYVKFHWKPTCGVKCLL  236



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   419 bits (1076),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHM+G GVHTFT+IN+ GK  YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLINRAGKSTYVKFHWKPTCGVKSLL  236



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   419 bits (1076),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHM+G GVHT+T+INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVHTYTLINKAGKSHYVKFHWKPTCGVKSLL  236



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score =   419 bits (1076),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++++PF TTN GAPVWNN  +LT+G+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHMEG GV+T+T+I+K GK  YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDLGIPQDYRHMEGSGVNTYTLISKTGKAYYVKFHWKPTCGVKCLL  236



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   419 bits (1076),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 194/236 (82%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++  DD+G+P DYRHMEG GV+T+T+INK GK  YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFSFLLDDIGVPQDYRHMEGSGVNTYTLINKAGKAYYVKFHWKPTCGVKSLL  236



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   419 bits (1076),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+FN+P+ TTN GA VWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++L+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+G+P DYRHMEG GV+T+T+INK GK NYVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGAGVNTYTLINKAGKANYVKFHWKPTCGVKCLL  236



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   419 bits (1076),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+ DG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVG+P DYRHM+GFGV+T+T+INK GK  YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGFGVNTYTLINKAGKALYVKFHWKPTCGVKSLL  236



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   419 bits (1076),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+ N+PF TTN GAPV+NN  +LTVG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+GIP DYRHM+GFGV+T+ +INK GK  YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMDGFGVNTYMLINKAGKAQYVKFHWKPTCGVKCLL  236



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   418 bits (1075),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAHYVKFHWKPTCGVKCLL  236



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   418 bits (1075),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHM+G GVHT+T+INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVHTYTLINKAGKSHYVKFHWKPTCGVKSLL  236



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   418 bits (1075),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 194/236 (82%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K RPSS+FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVGIP DYRHM+GFGV+T+T+INK GK  YVKFHWK TCG KCLL
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMDGFGVNTYTLINKAGKAVYVKFHWKTTCGEKCLL  236



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   418 bits (1075),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K  PSS+FN PF TTN GAPVWN+  ALTVG RGP+LLEDYHLVEK+ +F RER P
Sbjct  1    MDPYKPIPSSNFNAPFMTTNAGAPVWNDDNALTVGKRGPVLLEDYHLVEKLAHFARERTP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRD  +FPDV+HAFKPNPKSHIQE+WRILD+ +H+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDAIKFPDVVHAFKPNPKSHIQESWRILDFCAHIP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TF WFYDDVGIP DYRHMEGFGV T+T+INK GKV+YVKFHWKPTCGVK L+
Sbjct  181  ESLSTFTWFYDDVGIPQDYRHMEGFGVQTYTLINKAGKVHYVKFHWKPTCGVKSLM  236



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   418 bits (1074),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GKV YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKVQYVKFHWKPTCGVKCLL  236



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   418 bits (1074),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+ DG  FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMNFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVG+P DYRHM+GFGV+T+++INK GK  YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGFGVNTYSLINKAGKAVYVKFHWKPTCGVKCLL  236



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   417 bits (1073),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 194/236 (82%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FNT F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHMEG GV+T+T+INK GKV+YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLINKAGKVHYVKFHWKPTCGVKNLL  236



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   417 bits (1073),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+ N+PF TTN GAPV+NN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+GIP DYRHM+GFGV+T+ +INK GK  YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMDGFGVNTYMLINKAGKAQYVKFHWKPTCGVKCLL  236



>gb|KCW70315.1| hypothetical protein EUGRSUZ_F03557 [Eucalyptus grandis]
Length=479

 Score =   417 bits (1071),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 194/236 (82%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FNT F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHMEG GV+T+T+INK GKV+YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLINKAGKVHYVKFHWKPTCGVKNLL  236



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   417 bits (1072),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFE THDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFETTHDISNLTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVGIP DYRHMEG GV+T+T+INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMEGSGVNTYTLINKAGKAHYVKFHWKPTCGVKCLL  236



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   417 bits (1072),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GK  YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAQYVKFHWKPTCGVKCLL  236



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   417 bits (1072),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+H+TCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHVTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAHYVKFHWKPTCGVKCLL  236



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   417 bits (1072),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDIT+LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHM+G GV+T+T+INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMDGSGVNTYTLINKAGKAHYVKFHWKPTCGVKCLL  236



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   417 bits (1072),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHE GSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHELGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+G+P DYRHMEG GV+T+T+INK GK  YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFSFLFDDIGVPQDYRHMEGSGVNTYTLINKAGKAYYVKFHWKPTCGVKSLL  236



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   417 bits (1072),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+G+P DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLINKAGKAHYVKFHWKPTCGVKCLL  236



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score =   417 bits (1072),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP ++RPSS+FN+ + TTN GAPVWNN  +LTVG+RGPILLEDY LVEKI NF RERIP
Sbjct  1    MDPYQHRPSSAFNSSYWTTNSGAPVWNNNSSLTVGTRGPILLEDYQLVEKIANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIMDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHM+G GV+T+T+INKDGK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMDGSGVNTYTLINKDGKAHYVKFHWKPTCGVKCLL  236



>dbj|BAH37035.1| catalase 1 [Pisum sativum]
Length=494

 Score =   417 bits (1072),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DLVGNNFPVFF+ DG  FPD++HA KPNP++HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFFSHFP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVG+P DYRHM+GFGV+T+T+INK GK  YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGFGVNTYTLINKAGKSVYVKFHWKPTCGVKCLL  236



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   417 bits (1072),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+FN+PF TTN GAP+WNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAHYVKFHWKPTCGVKCLL  236



>ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60783.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=519

 Score =   418 bits (1074),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 194/236 (82%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++  DD+G+P DYRHMEG GV+T+T+INK GK  YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFSFLLDDIGVPQDYRHMEGSGVNTYTLINKAGKAYYVKFHWKPTCGVKSLL  236



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   417 bits (1071),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+G+P DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLINKAGKAHYVKFHWKPTCGVKCLL  236



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   417 bits (1071),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 218/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP ++RPSS+ N PF TTN GAPVWNN  +LTVGSRGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYRHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHVIEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVGIP+DYRHM+GFGV+T+++I+KDGK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDVGIPSDYRHMDGFGVNTYSLISKDGKAHYVKFHWKPTCGVKCLL  236



>ref|XP_004144240.2| PREDICTED: catalase isozyme 3 [Cucumis sativus]
 gb|KGN47533.1| Catalase isozyme 3 [Cucumis sativus]
Length=492

 Score =   417 bits (1071),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 211/236 (89%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFD+VGNNFPVFF+RD  QFPDVI AFKPNPKSHIQE WRILD+ S+ P
Sbjct  121  GFAVKFYTREGNFDIVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHIQEPWRILDFCSYHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL +FAWFYDDVGIP +YRHMEGFGV  +++INK GK   VKFHWKPTCGVK +L
Sbjct  181  ESLLSFAWFYDDVGIPINYRHMEGFGVQAYSLINKSGKARLVKFHWKPTCGVKSML  236



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   417 bits (1071),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+G+P DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLINKAGKAHYVKFHWKPTCGVKCLL  236



>ref|XP_012073649.1| PREDICTED: catalase isozyme 2 [Jatropha curcas]
 gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score =   417 bits (1071),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 194/235 (83%), Positives = 213/235 (91%), Gaps = 0/235 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+ PSS+ NTPF TTN GAPVWNN  ++TVG RGPILLEDYH++EK+ NF RERIP
Sbjct  1    MDPYKHCPSSAHNTPFWTTNAGAPVWNNNSSMTVGQRGPILLEDYHMLEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARG +AKGFFEVTH+I++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGMSAKGFFEVTHEISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFA K YTREGNFD+VGNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WRI D+LSH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRIFDFLSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCL  846
            ESL+TFAWF+DDVGIP DYRHMEGFGVHTF  +NK GKV YVKFHWKPTCGVKCL
Sbjct  181  ESLSTFAWFFDDVGIPQDYRHMEGFGVHTFCFLNKAGKVTYVKFHWKPTCGVKCL  235



>gb|AAF61734.1|AF243519_1 catalase 4 [Helianthus annuus]
Length=492

 Score =   417 bits (1071),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K RPSS+++TPF TTN GAPV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPSSAYDTPFWTTNAGAPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ER+VHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFA K YTREGNFD+VGNNFPVFF RD   FPDVIHAFKPNPKSHIQE+WRILD+LSH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTRDAMAFPDVIHAFKPNPKSHIQEDWRILDFLSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLNT  ++ DDVGIPTDYRHMEG  V+T T++NK+GK++YVKF WKPTCGVKCL+
Sbjct  181  ESLNTMTFWLDDVGIPTDYRHMEGSSVNTLTLVNKEGKIHYVKFTWKPTCGVKCLM  236



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   416 bits (1070),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GK  YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAQYVKFHWKPTCGVKCLL  236



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   416 bits (1070),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHYVKFHWKPTCGVKSLL  236



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   416 bits (1070),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHYVKFHWKPTCGVKSLL  236



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   416 bits (1069),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K RPS++FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSTAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVGIP DYRHM+GFGV+T+T+I+K GK +YVKFHWK TCG KCLL
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMDGFGVNTYTLISKAGKPHYVKFHWKATCGEKCLL  236



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   416 bits (1069),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHYVKFHWKPTCGVKSLL  236



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   416 bits (1069),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+F+TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+G+P DYRHMEG GV+T+ +INK GK  YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLINKAGKAYYVKFHWKPTCGVKCLL  236



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   416 bits (1069),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 218/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PF TTN GAPV++N  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYSNDHSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+GIP DYRHMEG GV+T+T++NK GKV+YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFSFLFDDIGIPQDYRHMEGSGVNTYTLVNKAGKVHYVKFHWKPTCGVKSLL  236



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   416 bits (1069),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPD I AFKPNPKSHIQE WRILD+ SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQETWRILDFFSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TFA+FYDD+G+P DYRHMEG  VH +T+I+K GKV+YVKFHWKPTCGVKCLL
Sbjct  181  ESLHTFAFFYDDLGVPQDYRHMEGSSVHAYTLISKAGKVHYVKFHWKPTCGVKCLL  236



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   416 bits (1069),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKSYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKAGKAHYVKFHWKPTCGVKSLL  236



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   416 bits (1069),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHYVKFHWKPTCGVKSLL  236



>gb|AFD29285.1| catalase [Vicia faba]
Length=494

 Score =   416 bits (1069),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DLVGNNFPVFF+ DG  FPD++HA KPNP++HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFFSHFP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVG+P DYRHM+GFGV+T+T++NK GK  YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGFGVNTYTLLNKAGKSVYVKFHWKPTCGVKCLL  236



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   416 bits (1069),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPD I AFKPNPKSHIQE WRILD+ SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQETWRILDFFSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TFA+FYDD+G+P DYRHMEG  VH +T+I+K GKV+YVKFHWKPTCGVKCLL
Sbjct  181  ESLHTFAFFYDDLGVPQDYRHMEGSSVHAYTLISKAGKVHYVKFHWKPTCGVKCLL  236



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   416 bits (1068),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+FN+P+ TTN GA VWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++L+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+G+P DYRHMEG GV+T+T+INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGAGVNTYTLINKAGKAHYVKFHWKPTCGVKCLL  236



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   416 bits (1068),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PF TTN GA VWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPCKYRPSSAFNSPFWTTNSGASVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DDVGIP DYRHMEGFGV+T+T+I+K GK +YVKFHWKP+CGVK LL
Sbjct  181  ESLHMFTFLFDDVGIPQDYRHMEGFGVNTYTLIDKAGKASYVKFHWKPSCGVKSLL  236



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   416 bits (1068),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKAGKAHYVKFHWKPTCGVKSLL  236



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   416 bits (1068),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPD I AFKPNPKSHIQE WRILD+ SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQETWRILDFFSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TFA+FYDD+G+P DYRHMEG  VH +T+I+K GKV+YVKFHWKPTCGVKCLL
Sbjct  181  ESLHTFAFFYDDLGVPQDYRHMEGSSVHAYTLISKAGKVHYVKFHWKPTCGVKCLL  236



>sp|P49318.1|CATA2_RICCO RecName: Full=Catalase isozyme 2 [Ricinus communis]
 gb|AAB31538.1| catalase 2 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04698.1| catalase CAT2 [Ricinus communis]
Length=492

 Score =   415 bits (1067),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSSS +TPF TTN G PV NN  ++TVG RGPILLEDYH++EK+ NFTRERIP
Sbjct  1    MDPYKFRPSSSNDTPFWTTNAGDPVSNNNSSMTVGPRGPILLEDYHMIEKLANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARG +AKGFFEVTHD+T LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGMSAKGFFEVTHDVTDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFA K YTREGNFD+VGNNFPVFFIRDG +FPDV+HAFKPNPKSHIQE WRI D+ SH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFIRDGIKFPDVVHAFKPNPKSHIQEYWRIFDFCSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TFAWF+DDVGIP DYRHMEGFGVHT+ +INK GKV YVKFHWKPTCGVKCL+
Sbjct  181  ESLSTFAWFFDDVGIPQDYRHMEGFGVHTYCLINKAGKVTYVKFHWKPTCGVKCLM  236



>gb|AAG61140.2|AF332973_1 catalase 2 [Zantedeschia aethiopica]
Length=492

 Score =   415 bits (1067),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSSS++  F TTN G PVWN+  ALTVGSRGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPCKYRPSSSYDASFTTTNAGGPVWNDDVALTVGSRGPILLEDYHLIEKVAHFARERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFE THD+THLT ADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTFADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKS++QE WR+LD+LSHLP
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSNVQEYWRVLDFLSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TF + YDDVG+P +YRHMEGFGV+T+T INK GK NYVKFHWKPTCGVKC+L
Sbjct  181  ESLHTFCFLYDDVGVPLNYRHMEGFGVNTYTFINKAGKTNYVKFHWKPTCGVKCML  236



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   415 bits (1067),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCAD LRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVG+P +YRHM+G GVHTFT++NK G+  YVKFHW+PTCGVKCLL
Sbjct  181  ESLHMFSFLFDDVGVPLNYRHMDGSGVHTFTLVNKAGRQTYVKFHWRPTCGVKCLL  236



>gb|ABF93811.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
Length=382

 Score =   411 bits (1057),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSH+QENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHM+G GV+T+T++N+ GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVNRAGKSHYVKFHWKPTCGVKSLL  236



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   415 bits (1067),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFHWKPTCGVKSLL  236



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   415 bits (1067),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFHWKPTCGVKSLL  236



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   415 bits (1067),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+ ++PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAHSSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHER SPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERASPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+G+P DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLINKAGKAHYVKFHWKPTCGVKCLL  236



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   415 bits (1067),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFHWKPTCGVKSLL  236



>gb|ADM96039.1| catalase [Cucumis sativus]
Length=492

 Score =   415 bits (1067),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 210/236 (89%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKG FEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGLFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFD+VGNNFPVFF+RD  QFPDVI AFKPNPKSHIQE WRILD+ S+ P
Sbjct  121  GFAVKFYTREGNFDIVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHIQEPWRILDFCSYHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL +FAWFYDDVGIP +YRHMEGFGV  +++INK GK   VKFHWKPTCGVK +L
Sbjct  181  ESLLSFAWFYDDVGIPINYRHMEGFGVQAYSLINKSGKARLVKFHWKPTCGVKSML  236



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   415 bits (1067),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFHWKPTCGVKSLL  236



>ref|XP_012073648.1| PREDICTED: catalase isozyme 1 [Jatropha curcas]
Length=492

 Score =   415 bits (1066),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K RPSS+F+TPF TTN GAP+WNN  ++TVG RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFDTPFWTTNSGAPIWNNNSSMTVGQRGPILLEDYHLIEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HAFKPNPKSHIQE+WRI D+LSH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDLVHAFKPNPKSHIQESWRIFDFLSHVP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+   + +DD+GIP DYRHMEG GV+T+T+INK GKV+YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMLTFLFDDLGIPQDYRHMEGSGVNTYTLINKAGKVHYVKFHWKPTCGVKCLL  236



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   415 bits (1066),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFHW+PTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFHWRPTCGVKSLL  236



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   415 bits (1066),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RG  LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGQYLLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAHYVKFHWKPTCGVKCLL  236



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   415 bits (1066),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFHW+PTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFHWRPTCGVKSLL  236



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score =   415 bits (1066),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+F+T + TTN G PVWN+  ALTVGSRGPILLEDYHL+EKI +F RERIP
Sbjct  1    MDPYKFRPSSAFDTAYTTTNAGGPVWNDDQALTVGSRGPILLEDYHLIEKIAHFARERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFE THD+T+LTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TF + +DDVG+PTDYRHMEGFGV+T+T INK+GKV+YVKFHWKPTCGV CLL
Sbjct  181  ESLHTFFFLFDDVGVPTDYRHMEGFGVNTYTFINKEGKVHYVKFHWKPTCGVSCLL  236



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   415 bits (1066),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+G+P DYRHM+GFGV+T+T+INK GK  YVKFHWK T GVKCLL
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMDGFGVNTYTLINKAGKAVYVKFHWKTTSGVKCLL  236



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score =   415 bits (1066),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 210/236 (89%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RD  QFP+VI AFKPNPKSHIQE WR LD+ S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPEVIRAFKPNPKSHIQEPWRFLDFCSYHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL +FAWFYDDVGIP +YRHMEGFGV  +++INK GK   VKFHWKPTCGVK +L
Sbjct  181  ESLLSFAWFYDDVGIPINYRHMEGFGVQAYSLINKSGKARLVKFHWKPTCGVKSML  236



>ref|NP_001031791.1| catalase 2 [Arabidopsis thaliana]
 gb|AEE86463.1| catalase 2 [Arabidopsis thaliana]
Length=474

 Score =   414 bits (1064),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFHWKPTCGVKSLL  236



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   415 bits (1066),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYVLINKAGKAHYVKFHWKPTCGVKSLL  236



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   415 bits (1066),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKYRPSSAYNSPFWTTNAGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRA GVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAAGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP +YRHM+G GVHTFT++NK G+  YVKFHW+PTCGVKCLL
Sbjct  181  ESLHMFTFLFDDLGIPLNYRHMDGSGVHTFTLVNKAGRQTYVKFHWRPTCGVKCLL  236



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   415 bits (1066),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+G+P DYRHM+GFGV+T+T+INK GK  YVKFHWK T GVKCLL
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMDGFGVNTYTLINKAGKAVYVKFHWKTTSGVKCLL  236



>dbj|BAH19523.1| AT4G35090 [Arabidopsis thaliana]
Length=474

 Score =   414 bits (1064),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFHWKPTCGVKSLL  236



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   414 bits (1065),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFHW+PTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFHWRPTCGVKSLL  236



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   414 bits (1065),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFHWKPTCGVKSLL  236



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   414 bits (1065),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNFGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHYVKFHWKPTCGVKSLL  236



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   414 bits (1065),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+G+P DYRHM+GFGV+T+T+INK GK  YVKFHWK T GVKCLL
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMDGFGVNTYTLINKAGKAVYVKFHWKTTSGVKCLL  236



>ref|XP_009108682.1| PREDICTED: catalase-2-like isoform X1 [Brassica rapa]
Length=514

 Score =   415 bits (1067),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 212/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHYVKFHWKPTCGVKSLL  236



>ref|XP_012065377.1| PREDICTED: catalase-2 [Jatropha curcas]
 gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   414 bits (1065),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+ N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQESWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F +  DD+GIP DYRHM+G GV+T+T+INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLLDDIGIPQDYRHMDGSGVNTYTLINKAGKAHYVKFHWKPTCGVKSLL  236



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   414 bits (1064),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 192/235 (82%), Positives = 214/235 (91%), Gaps = 0/235 (0%)
 Frame = +1

Query  145  DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPE  324
            DP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  325  RVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRG  504
            RVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  505  FAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPE  684
            FAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH PE
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPE  180

Query  685  SLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            SL+ F++ +DD+G+P DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  SLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLINKAGKAHYVKFHWKPTCGVKCLL  235



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   415 bits (1067),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFHWKPTCGVKSLL  236



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   414 bits (1065),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 210/236 (89%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++NTPFCTTN GAPVWNNT  +++G RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSIGERGPILLEDYQLIEKIATFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RD  QFPDVI AFKPNPKSH+QE WR LD+ S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHLQEPWRYLDFCSYHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL +FAWFYDDVGIP +YRHMEGFGV  +++INK GK   VKFHWKPTCGVK ++
Sbjct  181  ESLLSFAWFYDDVGIPINYRHMEGFGVQAYSLINKSGKARLVKFHWKPTCGVKSMM  236



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   414 bits (1065),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 212/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PFCTTN GAP  NN   LTVG+RG +LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPEKNNNSYLTVGARGLVLLEDYHLVEKLANFDRERVP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHM+G GVHTFT+INK GK  Y KFHWKPTCGV+ LL
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLINKAGKSTYAKFHWKPTCGVQSLL  236



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   414 bits (1064),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSNYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHLVEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVG+P +YRHM+G GVHTFT++N++GK  YVKFHW+PT GVKCLL
Sbjct  181  ESLHMFSFLFDDVGVPLNYRHMDGSGVHTFTLLNREGKATYVKFHWRPTSGVKCLL  236



>ref|XP_001784759.1| predicted protein [Physcomitrella patens]
 gb|EDQ50419.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   414 bits (1064),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 209/236 (89%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS +NTPF TTN G+PVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSQYNTPFWTTNQGSPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPE IRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPEAIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFD+VGNN PVFFIRDG +FPD+IHA KPNPKSHIQE WRI+D+ SH+P
Sbjct  121  GFAVKFYTREGNFDMVGNNIPVFFIRDGIKFPDMIHALKPNPKSHIQEAWRIMDFFSHVP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ES N F + +DD+GIP DYRHMEGFGVHTF +INK GK  YVKFHWKPTCGVK LL
Sbjct  181  ESCNMFTFLFDDIGIPADYRHMEGFGVHTFKLINKAGKETYVKFHWKPTCGVKNLL  236



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   414 bits (1064),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F +  DD+G+P DYRHMEG GV+T+T+I+K GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLLDDLGVPQDYRHMEGSGVNTYTLISKXGKAHYVKFHWKPTCGVKCLL  236



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   414 bits (1064),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFHW+PTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFHWRPTCGVKSLL  236



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   414 bits (1063),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHVIEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DDVG+P DYRHM+G GV+T+T+INK+GK +YVKFHW+PTCGVKCLL
Sbjct  181  ESLHMFTFLFDDVGVPADYRHMDGSGVNTYTLINKEGKAHYVKFHWRPTCGVKCLL  236



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   414 bits (1063),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSSSF+T + TTN G PVWN+  ALTVG+RGPILLEDYHL+EKI +F RERIP
Sbjct  1    MDPYKFRPSSSFDTTYTTTNAGGPVWNDDQALTVGARGPILLEDYHLIEKIAHFARERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+I+RFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TF + +DDVG+P+DYRHMEGFGV+T+T IN++GKV+YVKFHWKPTCGV CLL
Sbjct  181  ESLHTFFFLFDDVGVPSDYRHMEGFGVNTYTFINREGKVHYVKFHWKPTCGVSCLL  236



>gb|AAF61733.1|AF243518_1 catalase 3 [Helianthus annuus]
Length=492

 Score =   414 bits (1063),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K RPSS++N PF TTN G PV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPSSAYNAPFWTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ER+VHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFA K YTREGNFD+VGNNFPVFF RD   FPDVIHAFKPNPKSHIQE+WRILD+LSH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTRDAMAFPDVIHAFKPNPKSHIQEDWRILDFLSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLNT  ++ DDVGIPTDYRHMEG  V+T T++NK+GK++YVKF WKPTCGVKCL+
Sbjct  181  ESLNTMTFWLDDVGIPTDYRHMEGSSVNTLTLVNKEGKIHYVKFTWKPTCGVKCLM  236



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   414 bits (1063),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 212/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSSS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHMEG GV+T+ +INK GK  YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMEGSGVNTYMLINKAGKAVYVKFHWKPTCGVKSLL  236



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   414 bits (1063),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNHSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLT ADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTSADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNP+SHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPRSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHM+G GV+T+++INK GK +YVKFHW+PTCGVKCLL
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMDGSGVNTYSLINKAGKAHYVKFHWRPTCGVKCLL  236



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   414 bits (1063),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+ N P+CTTN GAPVWNN  +LTV  RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADF+RAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWR++D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVMDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P +YRHMEG GV+T+T+INK GKV+YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGVPANYRHMEGSGVNTYTLINKAGKVHYVKFHWKPTCGVKSLL  236



>ref|XP_009108684.1| PREDICTED: catalase-2-like isoform X3 [Brassica rapa]
Length=474

 Score =   413 bits (1061),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 212/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHYVKFHWKPTCGVKSLL  236



>gb|AFR53082.1| CAT [Anthurium andraeanum]
Length=492

 Score =   414 bits (1063),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++++ F TTN G PVWN+  ALT+G+RGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPYKYRPSSAYDSNFTTTNAGGPVWNDDVALTIGTRGPILLEDYHLIEKVAHFARERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNP+S+IQE WR+LD LSHLP
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPRSNIQEYWRVLDILSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ES++TF + +DDVG+PTDYRHMEGFGV+T+T I+K GK  YVKFHWKPTCGVKCLL
Sbjct  181  ESMHTFCFLFDDVGVPTDYRHMEGFGVNTYTFIHKSGKTRYVKFHWKPTCGVKCLL  236



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   413 bits (1062),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 212/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSSS N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSHNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHMEG GV+T+ ++NK GK  YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYMLVNKAGKAVYVKFHWKPTCGVKSLL  236



>ref|XP_006435362.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 gb|ESR48602.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=425

 Score =   411 bits (1056),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K  PS++ N PF TTN GAPVWN+  +LTVGSRGP+LLEDYHLVEK+ +F RERIP
Sbjct  1    MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFE THDI+HLTCAD  RAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DL+GN+ PVFFIRD  +FPDVIHAFKPNPKSHIQE WRILD+ SHLP
Sbjct  121  GFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAFKPNPKSHIQEYWRILDFCSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TF+WF+DDVGIP DYRHMEGFGV TFT++NK+GKV+YVKFHWKPTCGVKCL+
Sbjct  181  ESLSTFSWFFDDVGIPQDYRHMEGFGVQTFTLVNKNGKVHYVKFHWKPTCGVKCLI  236



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   413 bits (1062),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTH+I+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHNISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHM+G GV+T+T+INK GK  YVKFHWK TCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVNTYTLINKAGKARYVKFHWKATCGVKSLL  236



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   413 bits (1062),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+ N P+CTTN GAPVWNN  +LTV  RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADF+RAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWR++D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVMDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P +YRHMEG GV+T+T+INK GKV+YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGVPANYRHMEGSGVNTYTLINKAGKVHYVKFHWKPTCGVKSLL  236



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   413 bits (1062),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 212/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHYVKFHWKPTCGVKSLL  236



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   413 bits (1061),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFP FF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPXFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F +  DD+G+P DYRHMEG GV+T+T+I+K GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLLDDLGVPQDYRHMEGSGVNTYTLISKAGKAHYVKFHWKPTCGVKCLL  236



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   413 bits (1061),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCAD LRAPGVQTPLIVRFSTVIHERGSPET RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETPRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVG+P +YRHM+G GVHTFT++NK G+  YVKFHW+PTCGVKCLL
Sbjct  181  ESLHMFSFLFDDVGVPLNYRHMDGSGVHTFTLVNKAGRQTYVKFHWRPTCGVKCLL  236



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   413 bits (1061),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGATAKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHM+G GV+T+T++N+ GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGVPADYRHMDGSGVNTYTLVNRAGKAHYVKFHWKPTCGVKSLL  236



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   413 bits (1061),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP ++RPSS +NTPF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHM+G GV+T+T+INK GK +YVKFHW+PTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYTLINKAGKAHYVKFHWRPTCGVKSLL  236



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   413 bits (1061),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFHWKPTCGVKSLL  236



>gb|AAX88799.1| catalase [Euphorbia characias]
Length=493

 Score =   413 bits (1061),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS++N+ F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSGFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFF+VTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFQVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHM+G GV+T+T+INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVNTYTLINKAGKAHYVKFHWKPTCGVKSLL  236



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   413 bits (1061),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENW +LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWGVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+G+P DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGVPQDYRHMEGSGVNTYMLINKSGKAHYVKFHWKPTCGVKSLL  236



>sp|P48352.1|CATA3_CUCPE RecName: Full=Catalase isozyme 3 [Cucurbita pepo]
 dbj|BAA09508.1| catalase [Cucurbita pepo]
Length=492

 Score =   413 bits (1061),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 210/236 (89%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVH RGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHRRGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RD  QFPDVI AFKPNPKSH+QE WR LD+ S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHLQEPWRYLDFCSYHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL +FAWFYDDVGIP +YRHMEGFGV  +++INK GK   VKFHWKPTCGVK ++
Sbjct  181  ESLLSFAWFYDDVGIPINYRHMEGFGVQAYSLINKSGKARLVKFHWKPTCGVKSMM  236



>gb|AAC19398.1| root catalase [Mesembryanthemum crystallinum]
Length=493

 Score =   412 bits (1060),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSSS+NT F TT  G PVWN+  +LTVG+RGPILLEDYHL+EKI ++ RERIP
Sbjct  1    MDPYKYRPSSSYNTSFMTTKTGQPVWNDDSSLTVGARGPILLEDYHLLEKIASWDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVT+DITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETMRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFA+K YTREGNFDLVGNNFPVFF RD  +FPDV+ AFKPNPKSHIQE WRILD+ SHLP
Sbjct  121  GFALKFYTREGNFDLVGNNFPVFFNRDAMKFPDVVRAFKPNPKSHIQEMWRILDFCSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TFAWF+DDVGIP +YRHMEGFGVHTFTM+N+ GK  YVKFHWKPTCGVK ++
Sbjct  181  ESLHTFAWFFDDVGIPINYRHMEGFGVHTFTMLNRAGKETYVKFHWKPTCGVKSIV  236



>ref|XP_011654267.1| PREDICTED: catalase isozyme 1 [Cucumis sativus]
 gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   412 bits (1060),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP ++RPSS +NTPF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDIT+L+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHM+G GV+T+T+INK GK +YVKFHW+PTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYTLINKAGKAHYVKFHWRPTCGVKSLL  236



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   412 bits (1060),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 188/229 (82%), Positives = 211/229 (92%), Gaps = 0/229 (0%)
 Frame = +1

Query  163  PSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVHAR  342
            PSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+PERVVHAR
Sbjct  1    PSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVPERVVHAR  60

Query  343  GATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMY  522
            GA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAVK Y
Sbjct  61   GASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFY  120

Query  523  TREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLNTFA  702
            TREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+PESL+ F 
Sbjct  121  TREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVPESLHMFT  180

Query  703  WFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            + +DD+GIP DYRHM+G GVHTFT+INK GK  YVKFHWKPTCGVK LL
Sbjct  181  FLFDDIGIPQDYRHMDGSGVHTFTLINKAGKSTYVKFHWKPTCGVKSLL  229



>ref|XP_010534184.1| PREDICTED: catalase isozyme 3-like [Tarenaya hassleriana]
Length=492

 Score =   412 bits (1060),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 212/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSSS ++P+ TTNGGAPV+NN  +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKFRPSSSHDSPYYTTNGGAPVYNNISSLTVGTRGPILLEDYHLIEKVANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARG +AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RD R
Sbjct  61   ERVVHARGFSAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETMRDIR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFA K YTREGNFDLVGNNFPVFF RDG QFPD IHA KPNP ++IQENWRILDY SH P
Sbjct  121  GFATKFYTREGNFDLVGNNFPVFFTRDGVQFPDTIHALKPNPVTNIQENWRILDYFSHFP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TFA+ YDDVG+P +YRHMEGFGVH +  INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHTFAFMYDDVGVPLNYRHMEGFGVHAYQFINKAGKAHYVKFHWKPTCGVKCLL  236



>sp|P25890.1|CATA_PEA RecName: Full=Catalase [Pisum sativum]
 emb|CAA42736.1| catalase [Pisum sativum]
Length=494

 Score =   412 bits (1060),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DLVGNNFPVFF+ DG  FPD++HA KPNP++HIQENWRILD+  + P
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFFYNFP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVG+P DYRHM+GFGV+T+T+INK GK  YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGFGVNTYTLINKAGKSVYVKFHWKPTCGVKCLL  236



>prf||1906388A catalase
Length=492

 Score =   412 bits (1060),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RG ILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDIVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFHWKPTCGVKSLL  236



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   412 bits (1060),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K RPSS+FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVGIP DYRHM+GFGV+T+T+INK GK  YVKFHWK T G K LL
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMDGFGVNTYTLINKAGKALYVKFHWKTTSGEKSLL  236



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   412 bits (1059),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVT+D++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DDVG+P DYRHM+G GV+T+T INK+GK +YVKFHW+PTCGVKCLL
Sbjct  181  ESLHMFTFLFDDVGVPADYRHMDGSGVNTYTFINKEGKAHYVKFHWRPTCGVKCLL  236



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   412 bits (1059),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RP+SSFN PF TTN GAPVWNN  ++T+G RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD+++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVG+P DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDVGVPRDYRHMEGSGVNTYMLINKAGKAHYVKFHWKPTCGVKCLL  236



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   412 bits (1059),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RP+SSFN PF TTN GAPVWNN  ++T+G RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD+++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVG+P DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDVGVPRDYRHMEGSGVNTYMLINKAGKAHYVKFHWKPTCGVKCLL  236



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   412 bits (1059),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N+PF T N GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTANSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVG+P DYRHM+G GV+T+T+INK GK +YVKFHW+PTCGVK LL
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGSGVNTYTLINKAGKAHYVKFHWRPTCGVKNLL  236



>emb|CAE82295.1| catalase [Homogyne alpina]
Length=492

 Score =   412 bits (1059),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K RP+S++N+PF TTN G PV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPASAYNSPFLTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ER+VHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFA K YTREGNFD+VGNNFPVFF RD   FPDVIHAFKPNPKSHIQE+WRILD+LSH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTRDAMAFPDVIHAFKPNPKSHIQEDWRILDFLSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLNT  ++ DD+GIPTDYRHMEG  V+  T++NK+GK++YVKF WKPTCGVKCL+
Sbjct  181  ESLNTMTFWLDDIGIPTDYRHMEGSSVNALTLVNKEGKMHYVKFTWKPTCGVKCLM  236



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score =   412 bits (1059),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP ++RPSS+ ++PF TTN GAPVWNN  +L+VG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYRHRPSSAHDSPFFTTNSGAPVWNNNSSLSVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+I RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIARFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMEGAGVNTYMLINKAGKAHYVKFHWKPTCGVKCLL  236



>sp|P48351.1|CATA2_CUCPE RecName: Full=Catalase isozyme 2 [Cucurbita pepo]
 dbj|BAA09507.1| catalase [Cucurbita pepo]
Length=492

 Score =   412 bits (1059),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 210/236 (89%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++ L+CADFLRAPGVQTP+IVRFSTVIHER SPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLSCADFLRAPGVQTPVIVRFSTVIHERVSPETVRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RD  QFPDVI AFKPNPKSH+QE+WR LD+ S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHLQESWRFLDFCSYHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL +FAWFYDDVGIP +YRHMEGFGV  +++INK GK   VKFHWKPTCGVK +L
Sbjct  181  ESLLSFAWFYDDVGIPINYRHMEGFGVQAYSLINKAGKARLVKFHWKPTCGVKSML  236



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   412 bits (1059),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K  PS++ N PF TTN GAPVWN+  +LTVGSRGP+LLEDYHLVEK+ +F RERIP
Sbjct  1    MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFE THDI+HLTCAD  RAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DL+GN+ PVFFIRD  +FPDVIHAFKPNPKSHIQE WRILD+ SHLP
Sbjct  121  GFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAFKPNPKSHIQEYWRILDFCSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TF+WF+DDVGIP DYRHMEGFGV TFT++NK+GKV+YVKFHWKPTCGVKCL+
Sbjct  181  ESLSTFSWFFDDVGIPQDYRHMEGFGVQTFTLVNKNGKVHYVKFHWKPTCGVKCLI  236



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score =   412 bits (1058),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+ ++P+ TTN GAPVWNN  +LTVG RGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKFRPSSAHDSPYWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKIVNFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKVFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHM+G GV+T+T++NK GKV+YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYTLVNKVGKVHYVKFHWKPTCGVKSLL  236



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   412 bits (1058),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP + RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYRQRPSSAFNSPFWTTNSGAPVWNNNNSLTVGARGPILLEDYHLLEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIPTDYRHM+G GVHT+T+++K+GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPTDYRHMDGSGVHTYTLVSKEGKAHYVKFHWKPTCGVKSLL  236



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   412 bits (1058),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP + RPSS+ ++PF TTN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+GIP DYRHM+GFGV+T+ +INK GK +YVKFHWKP+CGVKCLL
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMDGFGVNTYMLINKAGKAHYVKFHWKPSCGVKCLL  236



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   412 bits (1058),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 210/236 (89%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RD  QFPDVI AFKPNPKSH+QE WR LD+ S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHLQEPWRYLDFCSYHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL +FAWFYDDVGIP +Y HMEGFGV  +++INK GK   VKFHWKPTCGVK ++
Sbjct  181  ESLLSFAWFYDDVGIPINYCHMEGFGVQAYSLINKSGKARLVKFHWKPTCGVKSMM  236



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score =   412 bits (1058),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHM+G GV+T+T++N+ GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGVPADYRHMDGSGVNTYTLVNRAGKAHYVKFHWKPTCGVKSLL  236



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score =   412 bits (1058),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP + RPSS+ ++PF TTN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+GIP DYRHM+GFGV+T+ +INK GK +YVKFHWKP+CGVKCLL
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMDGFGVNTYMLINKAGKAHYVKFHWKPSCGVKCLL  236



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   411 bits (1057),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 190/232 (82%), Positives = 212/232 (91%), Gaps = 0/232 (0%)
 Frame = +1

Query  154  KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  333
            +YRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  3    QYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  62

Query  334  HARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  513
            HARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAV
Sbjct  63   HARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  122

Query  514  KMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLN  693
            K YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH PESL+
Sbjct  123  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLH  182

Query  694  TFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
             F++  DD+G+P DYRHMEG GV+T+T+INK GK  YVKFHWKPTCGVK LL
Sbjct  183  MFSFLLDDIGVPQDYRHMEGSGVNTYTLINKAGKAYYVKFHWKPTCGVKSLL  234



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   412 bits (1058),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 188/232 (81%), Positives = 213/232 (92%), Gaps = 0/232 (0%)
 Frame = +1

Query  154  KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  333
            ++RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  6    QHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  65

Query  334  HARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  513
            HARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAV
Sbjct  66   HARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  125

Query  514  KMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLN  693
            K YTREGNFDLVGNNFPVFF+ DG +FPD++HA KPNPKSHIQENWRILD+ SH PESL+
Sbjct  126  KFYTREGNFDLVGNNFPVFFVHDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFPESLH  185

Query  694  TFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
             F++ +DDVG+P DYRHM+GFGV+T+T+INK GK  YVKFHWKPTCGVK LL
Sbjct  186  MFSFLFDDVGVPQDYRHMDGFGVNTYTLINKAGKALYVKFHWKPTCGVKSLL  237



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   411 bits (1057),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+ N+P+ TTN GAPV+NN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKHRPSSAANSPYWTTNSGAPVYNNNSSLTVGARGPILLEDYHLLEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDIT LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITRLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+GIP DYRHMEG GV+T+T+INK GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMEGSGVNTYTLINKAGKAHYVKFHWKPTCGVKCLL  236



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   411 bits (1057),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HL CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLXCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFP FF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPXFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F +  DD+G+P DYRHMEG GV+T+T+I+K GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLLDDLGVPQDYRHMEGSGVNTYTLISKAGKAHYVKFHWKPTCGVKCLL  236



>gb|ACJ71244.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   408 bits (1048),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 185/236 (78%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD G+P DYRHM+GFGV+T++++NK GK  YVKFHWK   GVKCLL
Sbjct  181  ESLHMFSFLFDDWGVPQDYRHMDGFGVNTYSLVNKAGKAVYVKFHWKTVSGVKCLL  236



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   411 bits (1057),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 212/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG +FPD++HA KPNPKSHIQENWR++D+ S  P
Sbjct  121  GFAVKFYTREGNFDLVGNNIPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVMDFFSPHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHYVKFHWKPTCGVKSLL  236



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   411 bits (1057),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 186/236 (79%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+ N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DDVG+P DYRHM+G GV+T+T+IN++GK +YVKFHW+PTCGVKCLL
Sbjct  181  ESLHMFTFLFDDVGVPADYRHMDGSGVNTYTLINREGKTHYVKFHWRPTCGVKCLL  236



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   411 bits (1057),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+FN+PF TTN GAP+WNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHM+GFGV+T+T+INK GK  YVKFHWK T G+KCLL
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMDGFGVNTYTLINKAGKAVYVKFHWKTTSGIKCLL  236



>gb|ACJ71245.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   407 bits (1047),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 185/236 (78%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD G+P DYRHM+GFGV+T++++NK GK  YVKFHWK   GVKCLL
Sbjct  181  ESLHMFSFLFDDWGVPQDYRHMDGFGVNTYSLVNKAGKAVYVKFHWKTVSGVKCLL  236



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score =   411 bits (1056),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP + RPSS+ ++PF TTN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+GIP DYRHM+GFGV+T+ +INK GK +YVKFHWKP+CGVKCLL
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMDGFGVNTYMLINKAGKAHYVKFHWKPSCGVKCLL  236



>ref|XP_006828715.1| PREDICTED: catalase-1/2 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   411 bits (1056),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+ N PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAHNCPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFD+VGNNFPVFF+RDG +FPD++H+ KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHSLKPNPKTHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DDVGIP DYRHM+GFGV+T+T+INK GK   VKFHW+P+CGVK LL
Sbjct  181  ESLHMFTFLFDDVGIPMDYRHMDGFGVNTYTLINKAGKATLVKFHWRPSCGVKSLL  236



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   411 bits (1056),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+ ++ F TTN GAPVWNN  +LTVG+RGP+LLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVG+P DYRHMEGFGV+T+T++N+ GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMEGFGVNTYTLLNESGKAHYVKFHWKPTCGVKSLL  236



>ref|XP_008778560.1| PREDICTED: catalase isozyme 2-like [Phoenix dactylifera]
Length=482

 Score =   410 bits (1055),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 190/235 (81%), Positives = 216/235 (92%), Gaps = 0/235 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+F+  + TTN GAPVWN+  ALTVG RGPILLEDYHL+EKI +F RERIP
Sbjct  1    MDPYKFRPSSAFDPTYTTTNAGAPVWNDDQALTVGPRGPILLEDYHLIEKIAHFARERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCL  846
            ESL+TF + +DDVG+P+DYRHMEGFGV+T+T +NK+GKV+YVKFHWKPTCGV+CL
Sbjct  181  ESLHTFFFLFDDVGVPSDYRHMEGFGVNTYTFVNKEGKVHYVKFHWKPTCGVRCL  235



>ref|XP_002980247.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
 gb|EFJ18507.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
Length=492

 Score =   411 bits (1056),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 186/236 (79%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N+   TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFD+VGNNFPVFF+RDG +FPD++HA KPNP++HIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHALKPNPRTHIQENWRIMDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F +  DD+GIP +YRHMEGFGVHTFT++N+ GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLLDDIGIPLNYRHMEGFGVHTFTLVNRAGKCSYVKFHWKPTCGVKSLL  236



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   411 bits (1056),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKLRPSSAFNSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHM+GFGV+T+T+INK GK  YVKFHWK T G+KCLL
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMDGFGVNTYTLINKAGKAVYVKFHWKTTSGIKCLL  236



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   410 bits (1055),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 188/235 (80%), Positives = 213/235 (91%), Gaps = 0/235 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP ++RPSS+ ++PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYRFRPSSANDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCL  846
            ESL+ F++ +DD+GIP DYRHMEG  V+T+ +INK GK +YVKFHWKPTCG+KCL
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMEGASVNTYMLINKAGKAHYVKFHWKPTCGIKCL  235



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   410 bits (1054),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSH+QENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHM+G GV+T+T++N+ GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVNRAGKSHYVKFHWKPTCGVKSLL  236



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   410 bits (1054),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFFTTNSGAPVWNNNSSLTVGQRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQE WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHIQEFWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHM+G GV+T+T+I+K GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVNTYTLIDKAGKAHYVKFHWKPTCGVKSLL  236



>ref|XP_001752315.1| predicted protein [Physcomitrella patens]
 gb|EDQ83048.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   410 bits (1054),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 209/236 (89%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS ++TPF TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSQYDTPFWTTNQGAPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFD+VGNN PVFFIRDG +FPD+IHA KPNPKSHIQE WRI+D+ SH+P
Sbjct  121  GFAVKFYTREGNFDMVGNNIPVFFIRDGIKFPDMIHALKPNPKSHIQEPWRIMDFFSHVP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            E+ N F + +DD+GIP DYRHMEGFGVHTF +I K GK  YVKFHWKPTCGVK LL
Sbjct  181  EACNMFTFVFDDIGIPADYRHMEGFGVHTFKLITKAGKETYVKFHWKPTCGVKSLL  236



>gb|AEQ30070.1| catalase, partial [Litchi chinensis]
Length=487

 Score =   410 bits (1053),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 188/229 (82%), Positives = 210/229 (92%), Gaps = 0/229 (0%)
 Frame = +1

Query  163  PSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVHAR  342
            PSS+FN PF TTN GAPVWN+  ALTVG RGP+LLEDYHLVEK+ +F R R PERVVHAR
Sbjct  3    PSSNFNAPFMTTNAGAPVWNDDNALTVGKRGPVLLEDYHLVEKLAHFARGRTPERVVHAR  62

Query  343  GATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMY  522
            GA+AKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPRGFAVK Y
Sbjct  63   GASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFY  122

Query  523  TREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLNTFA  702
            TREGNFDLVGNNFPVFFIRD  +FPDV+HAFKPNPKSH+QE+WRILD+ SH+PESL+TF 
Sbjct  123  TREGNFDLVGNNFPVFFIRDAIKFPDVVHAFKPNPKSHVQESWRILDFCSHIPESLSTFT  182

Query  703  WFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            WFYDDVGIP DYRHMEGFGV T+T+INK GKV+YVKFHWKPTCGVK L+
Sbjct  183  WFYDDVGIPQDYRHMEGFGVQTYTLINKAGKVHYVKFHWKPTCGVKSLM  231



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   410 bits (1053),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 212/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RG ILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIH RGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHARGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDIVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFHWKPTCGVKSLL  236



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   410 bits (1053),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHM+G GV+T+T++N+ GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVNRAGKSHYVKFHWKPTCGVKSLL  236



>tpg|DAA43177.1| TPA: catalase2 [Zea mays]
Length=493

 Score =   410 bits (1053),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 185/236 (78%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNP++HIQ+NWRILD+ SH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVGIP DYRHM+G GVHT+T++++ G V YVKFHW+PTCGV+ L+
Sbjct  181  ESLHMFSFLFDDVGIPADYRHMDGSGVHTYTLVSRAGTVTYVKFHWRPTCGVRSLM  236



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   413 bits (1061),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 188/240 (78%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = +1

Query  130  PLISMDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTR  309
            P  +MDP KYRPSS+ ++ F TTN GAPVWNN  +LTVG+RGP+LLEDYHL+EKI NF R
Sbjct  89   PPTAMDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDR  148

Query  310  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  489
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  149  ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  208

Query  490  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYL  669
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ 
Sbjct  209  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFF  268

Query  670  SHLPESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            SH PESL+ F++ +DDVG+P DYRHMEGFGV+T+T++N+ GK +YVKFHWKPTCGVK LL
Sbjct  269  SHHPESLHMFSFLFDDVGVPQDYRHMEGFGVNTYTLLNESGKAHYVKFHWKPTCGVKSLL  328



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   410 bits (1053),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 213/236 (90%), Gaps = 1/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRP+SS+N+PF T N GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFT-NSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  59

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  120  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  179

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFHWKPTCGVK LL
Sbjct  180  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHYVKFHWKPTCGVKSLL  235



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   410 bits (1053),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 185/236 (78%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS++N+PF TTN GAPVWNN  ++TVGSRGPILLEDYHLVEKI  F RERIP
Sbjct  1    MDPYKFRPSSNYNSPFWTTNSGAPVWNNNASITVGSRGPILLEDYHLVEKIAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSRLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFD+VGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P +YRHM+G GVHTFT+I+++GK  YVKFHW+PTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGVPLNYRHMDGSGVHTFTLISREGKATYVKFHWRPTCGVKSLL  236



>ref|XP_006416379.1| hypothetical protein EUTSA_v10007795mg [Eutrema salsugineum]
 gb|ESQ34732.1| hypothetical protein EUTSA_v10007795mg [Eutrema salsugineum]
Length=405

 Score =   407 bits (1045),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 187/235 (80%), Positives = 212/235 (90%), Gaps = 0/235 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCL  846
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+++K GKV +VKFHWKPTCG+K L
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVSKSGKVLFVKFHWKPTCGIKNL  235



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   410 bits (1053),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVSNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHE GSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHEHGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F +  DD+G+P DYRHMEG GV+T+T+I+K GK +YVKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLSDDLGVPQDYRHMEGSGVNTYTLISKTGKAHYVKFHWKPTCGVKCLL  236



>dbj|BAA34714.1| catalase [Oryza sativa]
Length=492

 Score =   409 bits (1052),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKGRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSH+QENWRILD+LSH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFLSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHM+G GV+T+T++N+ GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVNRAGKSHYVKFHWKPTCGVKSLL  236



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   409 bits (1051),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 185/236 (78%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSSSFN+P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKHRPSSSFNSPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPK+HIQENWR+LD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHM+G GV+T+T++N+ GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGVPADYRHMDGSGVNTYTLVNRAGKAHYVKFHWKPTCGVKSLL  236



>gb|ADU56198.1| catalase [Musa acuminata AAA Group]
Length=492

 Score =   408 bits (1049),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+F T + TTN G PVWN+  ALTVG RGPILLEDYHL+EKI +F RERIP
Sbjct  1    MDPYKFRPSSAFGTTYTTTNAGGPVWNDNEALTVGPRGPILLEDYHLIEKIAHFARERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFE THD+T LTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TF + +DDVG+PTDYRHMEGFGV+T+T IN+ GK +YVKFHWKPTCGVKCL+
Sbjct  181  ESLHTFCFLFDDVGVPTDYRHMEGFGVNTYTFINRAGKAHYVKFHWKPTCGVKCLM  236



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   409 bits (1051),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 189/232 (81%), Positives = 212/232 (91%), Gaps = 0/232 (0%)
 Frame = +1

Query  154  KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  333
            +YRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  24   QYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  83

Query  334  HARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  513
            HARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHE GSPET+RDPRGFAV
Sbjct  84   HARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHELGSPETLRDPRGFAV  143

Query  514  KMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLN  693
            K YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH PESL+
Sbjct  144  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLH  203

Query  694  TFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
             F++ +DD+G+P DYRHMEG GV+T+T+INK GK  YVKFHWKPTCGVK LL
Sbjct  204  MFSFLFDDIGVPQDYRHMEGSGVNTYTLINKAGKAYYVKFHWKPTCGVKSLL  255



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   408 bits (1049),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNGPQWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFA+K YTREGN+DL GNNFPVFFIRDG +FPD++HA KPNPK+HIQENWR+LD+ SH P
Sbjct  121  GFAIKFYTREGNWDLAGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRVLDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHM+G GV+T+T++N+ GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVNRAGKTHYVKFHWKPTCGVKSLL  236



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   408 bits (1049),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 185/236 (78%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+ N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKFRPSSANNSPFWTTNSGAPVWNNNSSLTVGNRGPILLEDYHVIEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFL APGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLHAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DDVG+P DYRHM+G GV+T+T+INK+GK  YVKFHW+PTCGVKCLL
Sbjct  181  ESLHMFTFLFDDVGVPADYRHMDGSGVNTYTLINKEGKARYVKFHWRPTCGVKCLL  236



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   408 bits (1049),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 186/236 (79%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS++N+ F TTN GAPVWNN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSTFFTTNSGAPVWNNNSSLTVGSRGPVLLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRTPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRIVDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+G+P DYRHM+G GV+T+T+INK GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVNTYTLINKAGKAHYVKFHWKPTCGVKSLL  236



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   408 bits (1048),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 186/228 (82%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = +1

Query  166  SSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVHARG  345
            SS+FN+PFCTTN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERI ERVVHARG
Sbjct  1    SSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIAERVVHARG  60

Query  346  ATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMYT  525
            A+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAVK YT
Sbjct  61   ASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYT  120

Query  526  REGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLNTFAW  705
            REGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWR+LD+ SH PESL+ F +
Sbjct  121  REGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVLDFFSHHPESLHMFTF  180

Query  706  FYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
             +DD+GIP DYRHM+G GVHTFT+INK GK  YVKFHW+PTCGVK LL
Sbjct  181  LFDDIGIPQDYRHMDGSGVHTFTLINKAGKSTYVKFHWRPTCGVKSLL  228



>tpg|DAA43178.1| TPA: catalase2 [Zea mays]
Length=531

 Score =   409 bits (1052),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 185/236 (78%), Positives = 215/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNP++HIQ+NWRILD+ SH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVGIP DYRHM+G GVHT+T++++ G V YVKFHW+PTCGV+ L+
Sbjct  181  ESLHMFSFLFDDVGIPADYRHMDGSGVHTYTLVSRAGTVTYVKFHWRPTCGVRSLM  236



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   408 bits (1048),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVG RGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPMWSTNSGAPVWNNDNSLTVGPRGPILLEDYHLVEKIANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHM+G GV+T+T++N+ GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVNRAGKSHYVKFHWKPTCGVKSLL  236



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score =   410 bits (1053),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 188/238 (79%), Positives = 215/238 (90%), Gaps = 0/238 (0%)
 Frame = +1

Query  133  LISMDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRE  312
             I+MDP KYRPSS++N+PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRE
Sbjct  49   FITMDPYKYRPSSAYNSPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRE  108

Query  313  RIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIR  492
            RIPERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+R
Sbjct  109  RIPERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMR  168

Query  493  DPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLS  672
            D RGFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+S
Sbjct  169  DIRGFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMS  228

Query  673  HLPESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCL  846
            HLPESL T+ W +DDVGIP DYRHMEGFGVHT+T+++K GKV +VKFHWKPTCG+K L
Sbjct  229  HLPESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVSKSGKVLFVKFHWKPTCGIKNL  286



>ref|NP_973873.1| catalase 3 [Arabidopsis thaliana]
 gb|AEE29994.1| catalase 3 [Arabidopsis thaliana]
Length=427

 Score =   405 bits (1041),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 188/235 (80%), Positives = 211/235 (90%), Gaps = 0/235 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCL  846
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+I K GKV +VKFHWKPTCG+K L
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLIAKSGKVLFVKFHWKPTCGIKNL  235



>ref|XP_010536468.1| PREDICTED: catalase-3-like [Tarenaya hassleriana]
Length=492

 Score =   407 bits (1047),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 210/236 (89%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSSS +TP+ TTNGGAPV+NN  +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKFRPSSSHDTPYYTTNGGAPVYNNISSLTVGTRGPILLEDYHLIEKVANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARG +AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RD R
Sbjct  61   ERVVHARGFSAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETMRDIR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFA K YTREGNFD+VGNNFPVFF RDG QFPD IHA KPNP ++IQENWRILDY SH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTRDGVQFPDTIHALKPNPVTNIQENWRILDYFSHFP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+TFA+ YDDVG+P +YRHMEGFGVH +  INK GK   VKFHWKPTCG+KCLL
Sbjct  181  ESLHTFAFLYDDVGVPLNYRHMEGFGVHAYQFINKSGKSLLVKFHWKPTCGIKCLL  236



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   407 bits (1046),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
             FA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSH+QENWRILD+ SH P
Sbjct  121  VFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHM+G GV+T+T++N+ GK +YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVNRAGKSHYVKFHWKPTCGVKSLL  236



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score =   407 bits (1046),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 212/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+ N+P+ T N GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNSPYFTANSGAPVWNNNNSLTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR+PGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRIMDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP +YRHMEG GV+T+T+INK GK  YVKFHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPANYRHMEGSGVNTYTLINKAGKTYYVKFHWKPTCGVKSLL  236



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score =   407 bits (1045),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 187/235 (80%), Positives = 212/235 (90%), Gaps = 0/235 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCL  846
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+++K GKV +VKFHWKPTCG+K L
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVSKSGKVLFVKFHWKPTCGIKNL  235



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   407 bits (1045),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 211/236 (89%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+ N+ F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAHNSSFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA++KGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASSKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQE WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHIQETWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DD+GIP DYRHM+G G++T+T+INK GK  YV FHWKPTCGVK LL
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGINTYTLINKAGKAYYVNFHWKPTCGVKSLL  236



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score =   407 bits (1045),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 187/235 (80%), Positives = 213/235 (91%), Gaps = 0/235 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N+PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNSPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCL  846
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+++K GKV +VKFHWKPTCG+K L
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVSKSGKVLFVKFHWKPTCGIKNL  235



>gb|AIU99487.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   407 bits (1045),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 186/236 (79%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS  N+ F TTN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK+YTREGNFDLVGNN PVFFIRDG +FPD++HAFKPNPK+++QENWRI+D+ SH P
Sbjct  121  GFAVKLYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DDVGIP +YRHMEGFGV+T+T+IN+DGK + VKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMEGFGVNTYTLINRDGKPHLVKFHWKPTCGVKCLL  236



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score =   406 bits (1044),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 187/235 (80%), Positives = 212/235 (90%), Gaps = 0/235 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCL  846
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+++K GKV +VKFHWKPTCG+K L
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVSKSGKVLFVKFHWKPTCGIKNL  235



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score =   406 bits (1044),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 188/235 (80%), Positives = 211/235 (90%), Gaps = 0/235 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N PF TTNGGAPV NN  +LTVG RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTVGERGPVLLEDYHLIEKVANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCL  846
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T++ K GKV +VKFHWKPTCG+K L
Sbjct  181  ESLLTWTWMFDDVGIPQDYRHMEGFGVHTYTLVAKSGKVLFVKFHWKPTCGIKNL  235



>gb|AGI65617.1| catalase, partial [Fragaria x ananassa]
Length=467

 Score =   405 bits (1042),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 185/229 (81%), Positives = 210/229 (92%), Gaps = 0/229 (0%)
 Frame = +1

Query  163  PSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVHAR  342
            PSS++++PF TTN GAPVWNN  +LT+G+RGPILLEDYHLVEK+ NF RERIPERVVHAR
Sbjct  1    PSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIPERVVHAR  60

Query  343  GATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMY  522
            GA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAVK Y
Sbjct  61   GASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFY  120

Query  523  TREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLNTFA  702
            TREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH PESL+ F 
Sbjct  121  TREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFT  180

Query  703  WFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            + +DD+GIP DYRHMEG GV+T+T+I+K GK  YVKFHWKPTCGVKCLL
Sbjct  181  FLFDDLGIPQDYRHMEGSGVNTYTLISKTGKAYYVKFHWKPTCGVKCLL  229



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   406 bits (1044),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 185/236 (78%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS+FN+PF TTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DD+G+P DYRHM+GFGV+T+T+I+K GK  YVKFHWK   GVKCLL
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMDGFGVNTYTLISKAGKAVYVKFHWKTVSGVKCLL  236



>ref|NP_001031073.1| catalase 3 [Arabidopsis thaliana]
 dbj|BAH19685.1| AT1G20620 [Arabidopsis thaliana]
 gb|AEE29997.1| catalase 3 [Arabidopsis thaliana]
Length=485

 Score =   406 bits (1043),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 188/235 (80%), Positives = 211/235 (90%), Gaps = 0/235 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCL  846
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+I K GKV +VKFHWKPTCG+K L
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLIAKSGKVLFVKFHWKPTCGIKNL  235



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score =   406 bits (1044),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 187/235 (80%), Positives = 212/235 (90%), Gaps = 0/235 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCL  846
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+++K GKV +VKFHWKPTCG+K L
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVSKSGKVLFVKFHWKPTCGIKNL  235



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score =   406 bits (1043),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 187/235 (80%), Positives = 212/235 (90%), Gaps = 0/235 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCL  846
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+++K GKV +VKFHWKPTCG+K L
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVSKSGKVLFVKFHWKPTCGIKNL  235



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score =   406 bits (1043),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 187/235 (80%), Positives = 212/235 (90%), Gaps = 0/235 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCL  846
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+++K GKV +VKFHWKPTCG+K L
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVSKSGKVLFVKFHWKPTCGIKNL  235



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score =   406 bits (1043),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 188/235 (80%), Positives = 211/235 (90%), Gaps = 0/235 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCL  846
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+I K GKV +VKFHWKPTCG+K L
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLIAKSGKVLFVKFHWKPTCGIKNL  235



>dbj|BAH56915.1| AT1G20620 [Arabidopsis thaliana]
Length=493

 Score =   406 bits (1043),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 188/235 (80%), Positives = 211/235 (90%), Gaps = 0/235 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCL  846
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+I K GKV +VKFHWKPTCG+K L
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLIAKSGKVLFVKFHWKPTCGIKNL  235



>gb|AAF61732.1|AF243517_1 catalase 2 [Helianthus annuus]
Length=492

 Score =   406 bits (1043),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N PF TTN GAPV+NN  +LTVG+RGPILLEDYH VEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNAPFWTTNYGAPVYNNDSSLTVGTRGPILLEDYHFVEKLANFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISALTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++H+ KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHSLKPNPKSHIQEDWRILDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F +  DDVG+P DYRHM+G GV+T+T+INK GK +YVKFHW+PTCGVKCLL
Sbjct  181  ESLHMFTFLQDDVGVPQDYRHMDGSGVNTYTLINKTGKTHYVKFHWRPTCGVKCLL  236



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   406 bits (1043),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS  N+ F TTN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG +FPD++HAFKPNPK+++QENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DDVGIP +YRHMEGFGV+T+T+IN+DGK + VKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMEGFGVNTYTLINRDGKPHLVKFHWKPTCGVKCLL  236



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   406 bits (1043),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 188/235 (80%), Positives = 211/235 (90%), Gaps = 0/235 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCL  846
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+I K GKV +VKFHWKPTCG+K L
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLIAKSGKVLFVKFHWKPTCGIKNL  235



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score =   406 bits (1043),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 187/235 (80%), Positives = 212/235 (90%), Gaps = 0/235 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCL  846
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+++K GKV +VKFHWKPTCG+K L
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVSKSGKVLFVKFHWKPTCGIKNL  235



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   405 bits (1042),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 186/236 (79%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS  N+ F TTN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG +FPD++HAFKPNPK+++QENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DDVGIP +YRHMEGFGV+T+T+IN+DGK + VKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMEGFGVNTYTLINRDGKPHLVKFHWKPTCGVKCLL  236



>gb|AIU99480.1| catalase [Saccharum spontaneum]
Length=492

 Score =   405 bits (1042),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 186/236 (79%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS  N+ F TTN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG +FPD++HAFKPNPK+++QENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGLKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F + +DDVGIP +YRHMEGFGV+T+T+IN+DGK + VKFHWKPTCGVKCLL
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMEGFGVNTYTLINRDGKPHLVKFHWKPTCGVKCLL  236



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   405 bits (1042),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS  N+ F TTN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG +FPD++HAFKP+PK+++QENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVGIP +YRHMEGFGV+T+T+INKDGK + VKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDVGIPLNYRHMEGFGVNTYTLINKDGKPHLVKFHWKPTCGVKCLL  236



>ref|XP_003563243.1| PREDICTED: catalase isozyme 1 [Brachypodium distachyon]
Length=492

 Score =   405 bits (1042),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 214/236 (91%), Gaps = 0/236 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP K+RPSS  N  F +TN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSGANAGFWSTNSGAPVWNNNNALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG +FPD++HAFKP+PK+++QENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSHHP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCLL  849
            ESL+ F++ +DDVGIP +YRHMEGFGV+T+T+INKDGKV+ VKFHWKPTCGVKCLL
Sbjct  181  ESLHMFSFLFDDVGIPLNYRHMEGFGVNTYTLINKDGKVHLVKFHWKPTCGVKCLL  236



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score =   405 bits (1042),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 187/235 (80%), Positives = 212/235 (90%), Gaps = 0/235 (0%)
 Frame = +1

Query  142  MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  321
            MDP KYRPSS++N+PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNSPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  322  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  501
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPE+IRD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPESIRDIR  120

Query  502  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  681
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  682  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFHWKPTCGVKCL  846
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T++ K GKV +VKFHWKPTCG+K L
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVAKSGKVLFVKFHWKPTCGIKNL  235



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1853757769455