BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10699

Length=660
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011100717.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6 ...    223   2e-63   Sesamum indicum [beniseed]
ref|XP_011100716.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6 ...    223   2e-63   Sesamum indicum [beniseed]
ref|XP_008223428.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6        221   1e-62   Prunus mume [ume]
ref|XP_007225398.1|  hypothetical protein PRUPE_ppa000674mg             221   1e-62   Prunus persica
ref|XP_003631936.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6        221   1e-62   Vitis vinifera
gb|EYU33078.1|  hypothetical protein MIMGU_mgv1a000776mg                218   8e-62   Erythranthe guttata [common monkey flower]
ref|XP_010319245.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6        218   9e-62   Solanum lycopersicum
ref|XP_008390409.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    215   9e-61   Malus domestica [apple tree]
ref|XP_006337992.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    215   1e-60   Solanum tuberosum [potatoes]
ref|XP_009372080.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6 ...    214   2e-60   Pyrus x bretschneideri [bai li]
ref|XP_009372078.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6 ...    214   2e-60   Pyrus x bretschneideri [bai li]
ref|XP_007035894.1|  Ubiquitin protein ligase 6 isoform 1               214   3e-60   
ref|XP_002519280.1|  ubiquitin-protein ligase, putative                 213   6e-60   
ref|XP_009769688.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    196   8e-60   Nicotiana sylvestris
ref|XP_004295041.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6        213   8e-60   Fragaria vesca subsp. vesca
ref|XP_012084139.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6        213   8e-60   Jatropha curcas
gb|KGN45601.1|  hypothetical protein Csa_6G000010                       196   1e-59   Cucumis sativus [cucumbers]
ref|XP_003529499.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    212   1e-59   Glycine max [soybeans]
gb|KHN28196.1|  E3 ubiquitin-protein ligase UPL6                        212   1e-59   Glycine soja [wild soybean]
ref|XP_008361924.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    212   2e-59   
ref|XP_002314972.1|  hypothetical protein POPTR_0010s15980g             212   2e-59   
ref|XP_008368327.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    212   2e-59   
ref|XP_007035898.1|  Ubiquitin protein ligase 6 isoform 5               209   5e-59   
ref|XP_007035896.1|  Ubiquitin protein ligase 6 isoform 3               210   6e-59   
ref|XP_011011005.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    209   6e-59   Populus euphratica
gb|KHG16787.1|  E3 ubiquitin-protein ligase UPL6 -like protein          210   7e-59   Gossypium arboreum [tree cotton]
ref|XP_007035895.1|  Ubiquitin protein ligase 6 isoform 2               209   1e-58   
ref|XP_011010988.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    209   2e-58   Populus euphratica
ref|XP_011010978.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    209   2e-58   Populus euphratica
gb|KJB38655.1|  hypothetical protein B456_006G265700                    207   5e-58   Gossypium raimondii
gb|KJB38656.1|  hypothetical protein B456_006G265700                    207   5e-58   Gossypium raimondii
gb|KJB38657.1|  hypothetical protein B456_006G265700                    207   6e-58   Gossypium raimondii
gb|KJB38654.1|  hypothetical protein B456_006G265700                    207   6e-58   Gossypium raimondii
ref|XP_007154424.1|  hypothetical protein PHAVU_003G118500g             207   1e-57   Phaseolus vulgaris [French bean]
gb|KJB72908.1|  hypothetical protein B456_011G204200                    205   1e-57   Gossypium raimondii
gb|KJB72909.1|  hypothetical protein B456_011G204200                    205   2e-57   Gossypium raimondii
gb|KJB72910.1|  hypothetical protein B456_011G204200                    205   3e-57   Gossypium raimondii
ref|XP_006600390.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    205   3e-57   Glycine max [soybeans]
ref|XP_003550723.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    205   3e-57   Glycine max [soybeans]
gb|KHN03256.1|  E3 ubiquitin-protein ligase UPL6                        205   3e-57   Glycine soja [wild soybean]
gb|KJB72911.1|  hypothetical protein B456_011G204200                    205   5e-57   Gossypium raimondii
gb|KJB72907.1|  hypothetical protein B456_011G204200                    205   5e-57   Gossypium raimondii
ref|XP_004486523.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    204   8e-57   Cicer arietinum [garbanzo]
ref|XP_011019320.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    203   8e-57   Populus euphratica
ref|XP_007147397.1|  hypothetical protein PHAVU_006G120900g             204   1e-56   Phaseolus vulgaris [French bean]
ref|XP_011019311.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    202   3e-56   Populus euphratica
ref|XP_008458320.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    202   4e-56   Cucumis melo [Oriental melon]
ref|XP_002312309.2|  hypothetical protein POPTR_0008s10070g             202   6e-56   Populus trichocarpa [western balsam poplar]
emb|CDO98729.1|  unnamed protein product                                200   2e-55   Coffea canephora [robusta coffee]
ref|XP_006597687.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    198   1e-54   Glycine max [soybeans]
ref|XP_003546300.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    198   1e-54   Glycine max [soybeans]
ref|XP_011656310.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    197   3e-54   Cucumis sativus [cucumbers]
ref|XP_006419303.1|  hypothetical protein CICLE_v10004231mg             194   7e-54   
gb|AES64909.2|  E3 ubiquitin-protein ligase UPL6                        196   9e-54   Medicago truncatula
gb|KHF99370.1|  E3 ubiquitin-protein ligase UPL6 -like protein          196   9e-54   Gossypium arboreum [tree cotton]
ref|XP_003594658.1|  E3 ubiquitin-protein ligase UPL6                   196   1e-53   
ref|XP_006419302.1|  hypothetical protein CICLE_v10004231mg             194   3e-53   Citrus clementina [clementine]
ref|XP_010102911.1|  E3 ubiquitin-protein ligase UPL6                   193   2e-52   
ref|XP_010941512.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6        192   3e-52   Elaeis guineensis
ref|XP_008801753.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6 ...    191   6e-52   Phoenix dactylifera
ref|XP_006296888.1|  hypothetical protein CARUB_v10012881mg             190   1e-51   Capsella rubella
ref|XP_010672598.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6        189   3e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010914658.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    187   1e-50   Elaeis guineensis
dbj|BAB02722.1|  unnamed protein product                                186   3e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406754.1|  hypothetical protein EUTSA_v10019984mg             186   3e-50   
ref|XP_008801752.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6 ...    186   4e-50   Phoenix dactylifera
ref|XP_008801754.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6 ...    186   4e-50   
ref|NP_001118648.1|  E3 ubiquitin-protein ligase UPL6                   186   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883053.1|  hypothetical protein ARALYDRAFT_479191             186   5e-50   
ref|NP_188346.2|  E3 ubiquitin-protein ligase UPL6                      186   5e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010045366.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6        185   6e-50   Eucalyptus grandis [rose gum]
ref|XP_010549016.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6        184   2e-49   Tarenaya hassleriana [spider flower]
ref|XP_009146032.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6 ...    184   2e-49   Brassica rapa
ref|XP_009146033.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6 ...    183   2e-49   Brassica rapa
gb|AES64913.2|  E3 ubiquitin-protein ligase UPL6-like protein           176   4e-49   Medicago truncatula
emb|CDX95876.1|  BnaC05g36270D                                          182   6e-49   
ref|XP_010489883.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    181   1e-48   
gb|KDO72050.1|  hypothetical protein CISIN_1g0016882mg                  166   3e-48   Citrus sinensis [apfelsine]
ref|XP_010270852.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6        180   4e-48   Nelumbo nucifera [Indian lotus]
ref|XP_010465746.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6 ...    179   9e-48   
ref|XP_010505122.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    179   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010465747.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6 ...    179   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_008779188.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    162   2e-46   
ref|XP_009402500.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    175   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT28040.1|  E3 ubiquitin-protein ligase UPL6                        174   6e-46   
ref|XP_003594662.1|  E3 ubiquitin-protein ligase UPL6                   163   1e-44   
ref|XP_009114441.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    170   1e-44   Brassica rapa
ref|XP_009114437.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    170   1e-44   Brassica rapa
ref|XP_008779187.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    157   2e-44   
ref|XP_011622287.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6 ...    168   7e-44   
gb|ERN03285.1|  hypothetical protein AMTR_s00003p00213880               168   8e-44   Amborella trichopoda
emb|CDY35005.1|  BnaA01g27290D                                          168   8e-44   Brassica napus [oilseed rape]
ref|XP_011622286.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6 ...    167   9e-44   Amborella trichopoda
emb|CDY65724.1|  BnaC01g43970D                                          167   1e-43   Brassica napus [oilseed rape]
ref|XP_009402499.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    152   9e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC78566.1|  hypothetical protein OsI_18547                          163   3e-42   Oryza sativa Indica Group [Indian rice]
gb|KFK39058.1|  hypothetical protein AALP_AA3G195500                    162   6e-42   Arabis alpina [alpine rockcress]
gb|EEE62409.1|  hypothetical protein OsJ_17200                          162   7e-42   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054713.1|  Os05g0159000                                       160   2e-41   
ref|XP_006654075.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    160   4e-41   Oryza brachyantha
ref|XP_008663934.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    149   7e-40   
ref|XP_006654076.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    154   5e-39   
ref|XP_002439333.1|  hypothetical protein SORBIDRAFT_09g004530          152   3e-38   Sorghum bicolor [broomcorn]
ref|XP_006597688.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    150   1e-37   
ref|XP_004977094.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6-...    147   2e-36   Setaria italica
gb|ABR16239.1|  unknown                                                 143   3e-35   Picea sitchensis
gb|EPS68435.1|  hypothetical protein M569_06334                         114   4e-25   Genlisea aurea
ref|XP_002978677.1|  hypothetical protein SELMODRAFT_443962             108   3e-23   Selaginella moellendorffii
ref|XP_002984608.1|  hypothetical protein SELMODRAFT_120783             108   5e-23   
ref|XP_010231678.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6        103   2e-21   
ref|XP_001774239.1|  predicted protein                                97.8    2e-19   
ref|XP_008801755.1|  PREDICTED: E3 ubiquitin-protein ligase UPL6 ...  97.1    3e-19   
ref|XP_002862195.1|  hypothetical protein ARALYDRAFT_359773           88.6    4e-18   
gb|KDO72054.1|  hypothetical protein CISIN_1g0016882mg                69.7    4e-12   Citrus sinensis [apfelsine]
gb|EMS23123.1|  ubiquitin-protein ligase E3 C                         57.0    4e-06   Rhodotorula toruloides NP11
ref|XP_007204674.1|  hypothetical protein PRUPE_ppa000451mg           56.2    6e-06   
ref|XP_007850795.1|  hypothetical protein Moror_802                   56.2    6e-06   
ref|XP_002284049.1|  PREDICTED: E3 ubiquitin-protein ligase UPL7 ...  56.2    7e-06   Vitis vinifera
emb|CEP08172.1|  hypothetical protein                                 55.8    9e-06   Parasitella parasitica
ref|XP_006430346.1|  hypothetical protein CICLE_v100109401mg          51.6    2e-05   
gb|EWC45778.1|  hypothetical protein DRE_05115                        54.3    3e-05   Drechslerella stenobrocha 248
ref|XP_010242961.1|  PREDICTED: E3 ubiquitin-protein ligase UPL7 ...  54.3    3e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010242967.1|  PREDICTED: E3 ubiquitin-protein ligase UPL7 ...  53.9    4e-05   Nelumbo nucifera [Indian lotus]
ref|XP_004208807.1|  PREDICTED: ubiquitin-protein ligase E3C-like     53.5    5e-05   
ref|XP_006820665.1|  PREDICTED: ubiquitin-protein ligase E3C-like     53.5    5e-05   Saccoglossus kowalevskii
ref|XP_006481929.1|  PREDICTED: E3 ubiquitin-protein ligase UPL7-...  53.1    6e-05   
gb|KDO60992.1|  hypothetical protein CISIN_1g045956mg                 53.1    7e-05   Citrus sinensis [apfelsine]
ref|XP_006481927.1|  PREDICTED: E3 ubiquitin-protein ligase UPL7-...  53.1    7e-05   Citrus sinensis [apfelsine]
ref|XP_011111592.1|  hypothetical protein H072_5778                   52.8    1e-04   
ref|XP_010933410.1|  PREDICTED: E3 ubiquitin-protein ligase UPL7      52.4    1e-04   Elaeis guineensis
gb|ELT92644.1|  hypothetical protein CAPTEDRAFT_228035                52.4    1e-04   Capitella teleta
dbj|GAN08541.1|  HECT-domain-containing protein                       52.0    2e-04   Mucor ambiguus
ref|XP_002876188.1|  ubiquitin-protein ligase 7                       51.6    2e-04   
ref|XP_008241337.1|  PREDICTED: E3 ubiquitin-protein ligase UPL7      51.2    3e-04   Prunus mume [ume]
ref|XP_008794046.1|  PREDICTED: E3 ubiquitin-protein ligase UPL7 ...  51.2    3e-04   
ref|XP_008794045.1|  PREDICTED: E3 ubiquitin-protein ligase UPL7 ...  51.2    3e-04   
ref|XP_008557305.1|  PREDICTED: ubiquitin-protein ligase E3C          50.8    4e-04   Microplitis demolitor
ref|XP_008794044.1|  PREDICTED: E3 ubiquitin-protein ligase UPL7 ...  50.8    4e-04   
ref|XP_008794042.1|  PREDICTED: E3 ubiquitin-protein ligase UPL7 ...  50.8    4e-04   Phoenix dactylifera
ref|XP_008794043.1|  PREDICTED: E3 ubiquitin-protein ligase UPL7 ...  50.8    4e-04   
gb|EYU38593.1|  hypothetical protein MIMGU_mgv1a000436mg              50.8    4e-04   Erythranthe guttata [common monkey flower]
ref|XP_011189070.1|  PREDICTED: ubiquitin-protein ligase E3C isof...  50.4    6e-04   
ref|XP_011189069.1|  PREDICTED: ubiquitin-protein ligase E3C isof...  50.4    7e-04   Zeugodacus cucurbitae [melon fruit fly]
gb|KFK34546.1|  hypothetical protein AALP_AA5G160300                  50.1    7e-04   Arabis alpina [alpine rockcress]
ref|XP_009404285.1|  PREDICTED: E3 ubiquitin-protein ligase UPL7      50.1    7e-04   Musa acuminata subsp. malaccensis [pisang utan]



>ref|XP_011100717.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 isoform X2 [Sesamum 
indicum]
Length=1029

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GDPS+RKRVDLGGRSSKERDRQKLLEQ R ERNRR +LRQQN+AA+KIQKCFRGR+
Sbjct  1    MFFTGDPSTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRQQNAAALKIQKCFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+AE+ ++RE FF TYG +CQ V RQ FGPDSDFL QLLFFFNP   +DFS +V+ C L
Sbjct  61   VVEAERGKIREKFFLTYGQYCQDVNRQCFGPDSDFLYQLLFFFNPRYVSDFSALVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L E V   GD+VS+FAGM+Y S R LV
Sbjct  121  LLEFVHDNGDVVSLFAGMDYSSKRGLV  147



>ref|XP_011100716.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 isoform X1 [Sesamum 
indicum]
Length=1031

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GDPS+RKRVDLGGRSSKERDRQKLLEQ R ERNRR +LRQQN+AA+KIQKCFRGR+
Sbjct  1    MFFTGDPSTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRQQNAAALKIQKCFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+AE+ ++RE FF TYG +CQ V RQ FGPDSDFL QLLFFFNP   +DFS +V+ C L
Sbjct  61   VVEAERGKIREKFFLTYGQYCQDVNRQCFGPDSDFLYQLLFFFNPRYVSDFSALVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L E V   GD+VS+FAGM+Y S R LV
Sbjct  121  LLEFVHDNGDVVSLFAGMDYSSKRGLV  147



>ref|XP_008223428.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 [Prunus mume]
Length=1035

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGD S+RKRVDLGGRS+KERDRQKLLEQ R ERNRR +LRQQNSAA+KIQKCFRGRK
Sbjct  1    MFFSGDSSTRKRVDLGGRSTKERDRQKLLEQTRLERNRRLWLRQQNSAALKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
               AE S+VRE F  TYG HCQ+V+R SFGPDS+FLRQLLFFF+     DFS++V+ C L
Sbjct  61   VAAAEHSKVREQFVGTYGKHCQNVDRFSFGPDSEFLRQLLFFFDARSVGDFSILVEMCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L++ V+ TGDIVS+FAGM+Y S  ALV
Sbjct  121  LQQFVRDTGDIVSLFAGMDYSSTHALV  147



>ref|XP_007225398.1| hypothetical protein PRUPE_ppa000674mg [Prunus persica]
 gb|EMJ26597.1| hypothetical protein PRUPE_ppa000674mg [Prunus persica]
Length=1039

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGD S+RKRVDLGGRS+KERDRQKLLEQ R ERNRR +LRQQNSAA+KIQKCFRGRK
Sbjct  1    MFFSGDSSTRKRVDLGGRSTKERDRQKLLEQTRLERNRRLWLRQQNSAALKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
               AE S+VRE F  TYG HCQ+V+R SFGPDS+FLRQLLFFF+     DFS++V+ C L
Sbjct  61   VAAAEHSKVREQFVGTYGKHCQNVDRFSFGPDSEFLRQLLFFFDARSVGDFSILVEMCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L++ V+ TGDIVS+FAGM+Y S  ALV
Sbjct  121  LQQFVRDTGDIVSLFAGMDYSSNHALV  147



>ref|XP_003631936.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 [Vitis vinifera]
 emb|CBI22841.3| unnamed protein product [Vitis vinifera]
Length=1034

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGD S+RKRVDLGGRSSKERDRQKLLEQ R ERNRR +LRQQNSAA++IQKCFRGRK
Sbjct  1    MFFSGDSSTRKRVDLGGRSSKERDRQKLLEQTRLERNRRWWLRQQNSAALRIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+AE ++VRE FF TYG HCQ+V+R SFGPDS+FLRQLLFFF+  +  DFS +V+ C L
Sbjct  61   AVEAEHAKVREQFFTTYGRHCQNVDRHSFGPDSEFLRQLLFFFDARNVGDFSALVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L+  V+ +GD V++FAGM+Y S  ALV
Sbjct  121  LQNFVRDSGDAVNLFAGMDYSSKNALV  147



>gb|EYU33078.1| hypothetical protein MIMGU_mgv1a000776mg [Erythranthe guttata]
Length=988

 Score =   218 bits (554),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GDPS+RKRVDLGGRSSKERDRQKLLEQ R ERNRR ++RQQNSAA+KIQKCFRGR+
Sbjct  1    MFFTGDPSTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWVRQQNSAALKIQKCFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             ++AE+ +VRE FF TYG +CQ V R+ FGPDSDFL QLLFFFNP   ADFS +V+ C L
Sbjct  61   VLEAERCKVREKFFLTYGQYCQDVNRECFGPDSDFLYQLLFFFNPRYVADFSALVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L E V  +GD++S+F GM Y S R LV
Sbjct  121  LLEFVHDSGDLISLFGGMGYSSKRGLV  147



>ref|XP_010319245.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 [Solanum lycopersicum]
Length=1030

 Score =   218 bits (555),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRSSKERDRQKLLEQ R ERNRR +LRQQNSAA+KIQKCFRGRK
Sbjct  1    MFFSGDPSTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRQQNSAALKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+ E+S+VRE+F  T+G+ C  V+RQ F PDSDFLR LLFFFNPT  AD SV+V+ C  
Sbjct  61   EVETERSKVRENFLRTHGERCHAVDRQCFSPDSDFLRHLLFFFNPTYTADVSVLVETCRS  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L E VQ  GD++S+FAG EY S  ALV
Sbjct  121  LLEFVQDNGDVISLFAGTEYASKAALV  147



>ref|XP_008390409.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like [Malus domestica]
Length=1034

 Score =   215 bits (548),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGD S+RKRVDLGGRS+KERDRQKLLEQ R ERNRR ++RQQNSAA+KIQKCFRGRK
Sbjct  1    MFFSGDSSTRKRVDLGGRSTKERDRQKLLEQTRLERNRRLWIRQQNSAALKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
               AE S+VRE F+  YG HCQ+V+R SFGPDS+FLRQLLFFF+     DFS++V+ C L
Sbjct  61   VAAAEHSKVREQFYGRYGGHCQNVDRFSFGPDSEFLRQLLFFFDARSVGDFSILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + V+ TGDIVS+ AGM+Y S  ALV
Sbjct  121  LHQFVRDTGDIVSLIAGMDYSSKHALV  147



>ref|XP_006337992.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like [Solanum tuberosum]
Length=1030

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRSSKERDRQKLLEQ R ERNRR +LRQQNSAA+KIQKCFRGRK
Sbjct  1    MFFSGDPSTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRQQNSAALKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+ E+S+VRE+F  T+G+ C  V+RQ F PDSDFLR LLFFFNPT   D SV+V+ C  
Sbjct  61   EVETERSKVRENFLKTHGERCHTVDRQCFSPDSDFLRHLLFFFNPTYTTDVSVLVETCRS  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L E V+  GD+VS+FAG EY S  ALV
Sbjct  121  LLEFVRDNGDVVSLFAGTEYASKAALV  147



>ref|XP_009372080.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 isoform X3 [Pyrus 
x bretschneideri]
Length=1019

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGD S+RKRVDLGGRS+KERDRQKLLEQ R ERNRR ++RQQNSAA+KIQKCFRGRK
Sbjct  1    MFFSGDSSTRKRVDLGGRSTKERDRQKLLEQTRLERNRRLWIRQQNSAALKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
               AE S+VRE F+  YG HCQ+V+R SFGPDS+FLRQLLFFF+     DFS++V+ C L
Sbjct  61   VAAAEHSKVREQFYGRYGRHCQNVDRFSFGPDSEFLRQLLFFFDARSVGDFSILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + V+ TGDIVS+ AGM+Y S  ALV
Sbjct  121  LHQFVRDTGDIVSLIAGMDYSSKHALV  147



>ref|XP_009372078.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009372079.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 isoform X2 [Pyrus 
x bretschneideri]
Length=1034

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGD S+RKRVDLGGRS+KERDRQKLLEQ R ERNRR ++RQQNSAA+KIQKCFRGRK
Sbjct  1    MFFSGDSSTRKRVDLGGRSTKERDRQKLLEQTRLERNRRLWIRQQNSAALKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
               AE S+VRE F+  YG HCQ+V+R SFGPDS+FLRQLLFFF+     DFS++V+ C L
Sbjct  61   VAAAEHSKVREQFYGRYGRHCQNVDRFSFGPDSEFLRQLLFFFDARSVGDFSILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + V+ TGDIVS+ AGM+Y S  ALV
Sbjct  121  LHQFVRDTGDIVSLIAGMDYSSKHALV  147



>ref|XP_007035894.1| Ubiquitin protein ligase 6 isoform 1 [Theobroma cacao]
 gb|EOY06820.1| Ubiquitin protein ligase 6 isoform 1 [Theobroma cacao]
Length=1035

 Score =   214 bits (545),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP++RKRVDLGGRSSKERDRQKLLEQ R ERNRR +LRQQNSAA+KIQK FRGRK
Sbjct  1    MFFSGDPTTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRQQNSAALKIQKYFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+AE ++VRE F+ TYG HCQ+V+R  FGPDS+FLRQL+FFFN  +  DF V+V+ C L
Sbjct  61   VVEAEHAKVREQFYQTYGKHCQNVDRHCFGPDSEFLRQLIFFFNAGNTDDFLVLVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRAL  656
            L+  V+ +GD+V +FAGM+Y S  +L
Sbjct  121  LQHFVRDSGDVVGLFAGMDYSSYHSL  146



>ref|XP_002519280.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF43144.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=1067

 Score =   213 bits (543),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP++RKRVDLGGRSSKERDRQKLLEQ R ERNRR +LRQQN++AIKIQKCFRGRK
Sbjct  1    MFFSGDPTTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRQQNASAIKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+ E+S+VR+ F+ TYG HCQ+V+   FGPDS+FLRQL FFFN  ++ DF+V+V+ C  
Sbjct  61   AVEIERSKVRDQFYQTYGKHCQNVDWHCFGPDSEFLRQLFFFFNAQNSGDFAVLVETCQR  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + V+  GDI+S+F G++Y + RALV
Sbjct  121  LLQFVRDGGDIISLFGGIDYSTNRALV  147



>ref|XP_009769688.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like [Nicotiana sylvestris]
Length=138

 Score =   196 bits (498),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRSSKERDRQKLLEQ R ERNRR +LRQQN AAIKIQKCFRGRK
Sbjct  1    MFFSGDPSTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRQQNCAAIKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+AE+S+VRE+F  TYGD C  V+RQ FGPDSDFL QLLFFFNPT   D S++V+ C  
Sbjct  61   EVEAERSKVRENFLKTYGDRCHRVDRQCFGPDSDFLCQLLFFFNPTYTNDVSILVETCRS  120

Query  579  LKELVQHTG  605
            L ELV+ +G
Sbjct  121  LLELVRDSG  129



>ref|XP_004295041.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 [Fragaria vesca subsp. 
vesca]
Length=1035

 Score =   213 bits (541),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGD S+RKRVDLGGRS+KERDRQKLLEQ R ERNRR +LRQQNSAA KIQKCFRGRK
Sbjct  1    MFFSGDSSNRKRVDLGGRSTKERDRQKLLEQTRLERNRRLWLRQQNSAATKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
              + E S+VRE F+ TYG+H Q+ ++  FGPDSDFLRQLLFFF+     DF+V+V+ C L
Sbjct  61   VARLEYSKVREQFYGTYGEHFQNADKSCFGPDSDFLRQLLFFFDARSVGDFTVLVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L++ V+ TGDIVS+FAGM+Y S +ALV
Sbjct  121  LQKFVRDTGDIVSLFAGMDYSSKQALV  147



>ref|XP_012084139.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 [Jatropha curcas]
 gb|KDP27971.1| hypothetical protein JCGZ_19051 [Jatropha curcas]
Length=1032

 Score =   213 bits (541),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GDP++RKRVDLGGRSSKERDRQKLLEQ R ERNRR +LRQQN+AAIKIQKCFRGRK
Sbjct  1    MFFTGDPTTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRQQNAAAIKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+AE+ +VR+ F+  YG HCQ+V+R SFGP SDFLRQL FFFN  +  DF+V+V+ C L
Sbjct  61   AVEAERHKVRDQFYRMYGKHCQNVDRHSFGPHSDFLRQLFFFFNAQNRVDFTVLVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + VQ  GDI S+F G++Y +  ALV
Sbjct  121  LLQFVQDCGDIFSLFGGVDYMANCALV  147



>gb|KGN45601.1| hypothetical protein Csa_6G000010 [Cucumis sativus]
Length=148

 Score =   196 bits (498),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GD S+RKRVDLGGRSSKERDRQKLLEQ R ERNRR  LRQQN AA+KIQKCFRGRK
Sbjct  1    MFFTGDSSTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLSLRQQNFAALKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            A +A +  VRE F +TYG HC+ V+R  FGPDS+F  QLLFF+N     DF V+V+AC L
Sbjct  61   ASEAARFSVREQFHDTYGKHCEKVDRHCFGPDSEFFHQLLFFYNAKHIDDFMVLVEACRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L++ VQ  GD++SIFAG +Y   +ALV
Sbjct  121  LRKFVQENGDMLSIFAGKDYLLNKALV  147



>ref|XP_003529499.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform 1 [Glycine 
max]
Length=1026

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRSSKERDR+ LLEQ R ERNRR +LRQQNSA +KIQKCFRGRK
Sbjct  1    MFFSGDPSTRKRVDLGGRSSKERDRKNLLEQTRVERNRRLWLRQQNSAVLKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+ EQS+VRE F+  YG HCQ+V+R SFGPDS+FL Q L+FF   +  DF V+V+ C L
Sbjct  61   AVRTEQSKVREQFYKIYGKHCQNVDRNSFGPDSNFLYQFLYFFKAENIDDFLVLVQICRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L   VQ  GD+V +FAG++Y S RALV
Sbjct  121  LWWSVQDNGDVVKLFAGVDYSSTRALV  147



>gb|KHN28196.1| E3 ubiquitin-protein ligase UPL6 [Glycine soja]
Length=1026

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRSSKERDR+ LLEQ R ERNRR +LRQQNSA +KIQKCFRGRK
Sbjct  1    MFFSGDPSTRKRVDLGGRSSKERDRKNLLEQTRVERNRRLWLRQQNSAVLKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+ EQS+VRE F+  YG HCQ+V+R SFGPDS+FL Q L+FF   +  DF V+V+ C L
Sbjct  61   AVRTEQSKVREQFYKIYGKHCQNVDRNSFGPDSNFLYQFLYFFKAENIDDFLVLVQICRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L   VQ  GD+V +FAG++Y S RALV
Sbjct  121  LWWSVQDNGDVVKLFAGVDYSSTRALV  147



>ref|XP_008361924.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like [Malus domestica]
Length=1033

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGD S+RKRVDLGGRS+KERDRQKLLEQ R ERNRR ++RQQN AA+KIQKCFRGRK
Sbjct  1    MFFSGDSSTRKRVDLGGRSTKERDRQKLLEQTRLERNRRLWIRQQNLAALKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
               AE S+VRE F+  YG HCQ+V+R SFGPDS+FLRQLLFFF+     DFS++V+ C L
Sbjct  61   VAAAEHSKVREQFYGRYGRHCQNVDRFSFGPDSEFLRQLLFFFDARSVGDFSILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + V+ TGDI+S+ AGM+Y S  ALV
Sbjct  121  LHQFVRETGDIISLVAGMDYSSKHALV  147



>ref|XP_002314972.1| hypothetical protein POPTR_0010s15980g [Populus trichocarpa]
 gb|EEF01143.1| hypothetical protein POPTR_0010s15980g [Populus trichocarpa]
Length=1027

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GDPS+RKRVDLGGRSSKERDRQKLLEQ R ERNRR +++QQN+AA+KIQK FRGRK
Sbjct  1    MFFNGDPSTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWVKQQNAAALKIQKWFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+AEQS VRE FF TYG +CQ+V+R  F PDS+FLRQLLFFFN  ++ DF+++V+ C L
Sbjct  61   AVEAEQSTVREQFFGTYGKYCQNVDRHCFSPDSEFLRQLLFFFNAQNSDDFTILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + V+ +GDIVS+FAG++Y +   LV
Sbjct  121  LLQNVRDSGDIVSLFAGVDYSTKHGLV  147



>ref|XP_008368327.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like [Malus domestica]
Length=1037

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGD S+RKRVDLGGRS+KERDRQKLLEQ R ERNRR ++RQQN AA+KIQKCFRGRK
Sbjct  1    MFFSGDSSTRKRVDLGGRSTKERDRQKLLEQTRLERNRRLWIRQQNLAALKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
               AE S+VRE F+  YG HCQ+V+R SFGPDS+FLRQLLFFF+     DFS++V+ C L
Sbjct  61   VAAAEHSKVREQFYGRYGRHCQNVDRFSFGPDSEFLRQLLFFFDARSVGDFSILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + V+ TGDI+S+ AGM+Y S  ALV
Sbjct  121  LHQFVRETGDIISLVAGMDYSSKHALV  147



>ref|XP_007035898.1| Ubiquitin protein ligase 6 isoform 5 [Theobroma cacao]
 gb|EOY06824.1| Ubiquitin protein ligase 6 isoform 5 [Theobroma cacao]
Length=920

 Score =   209 bits (533),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP++RKRVDLGGRSSKERDRQKLLEQ R ERNRR +LRQQNSAA+KIQK FRGRK
Sbjct  1    MFFSGDPTTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRQQNSAALKIQKYFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+AE ++VRE F+ TYG HCQ+V+R  FGPDS+FLRQL+FFFN  +  DF V+V+ C L
Sbjct  61   VVEAEHAKVREQFYQTYGKHCQNVDRHCFGPDSEFLRQLIFFFNAGNTDDFLVLVETCRL  120

Query  579  LKELVQHT-GDIVSIFAGMEYDSXRAL  656
            L+  V+ + GD+V +FAGM+Y S  +L
Sbjct  121  LQHFVRDSAGDVVGLFAGMDYSSYHSL  147



>ref|XP_007035896.1| Ubiquitin protein ligase 6 isoform 3 [Theobroma cacao]
 gb|EOY06822.1| Ubiquitin protein ligase 6 isoform 3 [Theobroma cacao]
Length=961

 Score =   210 bits (534),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP++RKRVDLGGRSSKERDRQKLLEQ R ERNRR +LRQQNSAA+KIQK FRGRK
Sbjct  1    MFFSGDPTTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRQQNSAALKIQKYFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+AE ++VRE F+ TYG HCQ+V+R  FGPDS+FLRQL+FFFN  +  DF V+V+ C L
Sbjct  61   VVEAEHAKVREQFYQTYGKHCQNVDRHCFGPDSEFLRQLIFFFNAGNTDDFLVLVETCRL  120

Query  579  LKELVQHT-GDIVSIFAGMEYDSXRAL  656
            L+  V+ + GD+V +FAGM+Y S  +L
Sbjct  121  LQHFVRDSAGDVVGLFAGMDYSSYHSL  147



>ref|XP_011011005.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform X4 [Populus 
euphratica]
Length=838

 Score =   209 bits (531),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRSSKERDRQKLLEQ R ERNRR +++QQN+AA+KIQK FRGRK
Sbjct  1    MFFSGDPSTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWVKQQNAAALKIQKWFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+AEQS VRE FF TYG +CQ+V+R  F PDS+FLRQLLFFFN  ++ DF+++V+ C L
Sbjct  61   AVEAEQSTVREQFFGTYGKYCQNVDRHCFSPDSEFLRQLLFFFNAQNSDDFTILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + V+  G IVS+FA ++Y +  ALV
Sbjct  121  LLQNVRDNGGIVSLFASVDYSTKHALV  147



>gb|KHG16787.1| E3 ubiquitin-protein ligase UPL6 -like protein [Gossypium arboreum]
Length=1008

 Score =   210 bits (534),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP++RKRVDLGGRSSKERDRQKLLEQ R ERNRR +LRQQNSAA+KIQK FRGRK
Sbjct  1    MFFSGDPTTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRQQNSAALKIQKYFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+ E+++V+E F+ TYG HC HV+R  FGPDS+FLRQL+FF N  +  DFSV+V+ C L
Sbjct  61   VVEVERAKVQEQFYKTYGKHCHHVDRHCFGPDSEFLRQLIFFVNAWNMNDFSVLVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            ++  V+ +GD+V +FAG +Y S  +LV
Sbjct  121  IQHFVRESGDVVELFAGTDYLSNHSLV  147



>ref|XP_007035895.1| Ubiquitin protein ligase 6 isoform 2 [Theobroma cacao]
 gb|EOY06821.1| Ubiquitin protein ligase 6 isoform 2 [Theobroma cacao]
Length=1036

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP++RKRVDLGGRSSKERDRQKLLEQ R ERNRR +LRQQNSAA+KIQK FRGRK
Sbjct  1    MFFSGDPTTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRQQNSAALKIQKYFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+AE ++VRE F+ TYG HCQ+V+R  FGPDS+FLRQL+FFFN  +  DF V+V+ C L
Sbjct  61   VVEAEHAKVREQFYQTYGKHCQNVDRHCFGPDSEFLRQLIFFFNAGNTDDFLVLVETCRL  120

Query  579  LKELVQHT-GDIVSIFAGMEYDSXRAL  656
            L+  V+ + GD+V +FAGM+Y S  +L
Sbjct  121  LQHFVRDSAGDVVGLFAGMDYSSYHSL  147



>ref|XP_011010988.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform X2 [Populus 
euphratica]
Length=1032

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRSSKERDRQKLLEQ R ERNRR +++QQN+AA+KIQK FRGRK
Sbjct  1    MFFSGDPSTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWVKQQNAAALKIQKWFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+AEQS VRE FF TYG +CQ+V+R  F PDS+FLRQLLFFFN  ++ DF+++V+ C L
Sbjct  61   AVEAEQSTVREQFFGTYGKYCQNVDRHCFSPDSEFLRQLLFFFNAQNSDDFTILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + V+  G IVS+FA ++Y +  ALV
Sbjct  121  LLQNVRDNGGIVSLFASVDYSTKHALV  147



>ref|XP_011010978.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform X1 [Populus 
euphratica]
Length=1037

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRSSKERDRQKLLEQ R ERNRR +++QQN+AA+KIQK FRGRK
Sbjct  1    MFFSGDPSTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWVKQQNAAALKIQKWFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+AEQS VRE FF TYG +CQ+V+R  F PDS+FLRQLLFFFN  ++ DF+++V+ C L
Sbjct  61   AVEAEQSTVREQFFGTYGKYCQNVDRHCFSPDSEFLRQLLFFFNAQNSDDFTILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + V+  G IVS+FA ++Y +  ALV
Sbjct  121  LLQNVRDNGGIVSLFASVDYSTKHALV  147



>gb|KJB38655.1| hypothetical protein B456_006G265700 [Gossypium raimondii]
Length=1029

 Score =   207 bits (528),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP++RKRVDLGGRSSKERDRQKLLEQ R ERNRR +LRQQNSAA+KIQK FRGRK
Sbjct  1    MFFSGDPTTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRQQNSAALKIQKYFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+ E+++VRE F+  YG HC HV+R  FGPDS+FLRQL+FF N  +  DFSV+V+ C  
Sbjct  61   VVEVERAKVREQFYKNYGQHCHHVDRHCFGPDSEFLRQLIFFVNAWNMNDFSVLVETCRF  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            ++  V+ +GD+V +FAG +Y S  +LV
Sbjct  121  IQHFVRESGDVVELFAGTDYLSNHSLV  147



>gb|KJB38656.1| hypothetical protein B456_006G265700 [Gossypium raimondii]
Length=1032

 Score =   207 bits (528),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP++RKRVDLGGRSSKERDRQKLLEQ R ERNRR +LRQQNSAA+KIQK FRGRK
Sbjct  1    MFFSGDPTTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRQQNSAALKIQKYFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+ E+++VRE F+  YG HC HV+R  FGPDS+FLRQL+FF N  +  DFSV+V+ C  
Sbjct  61   VVEVERAKVREQFYKNYGQHCHHVDRHCFGPDSEFLRQLIFFVNAWNMNDFSVLVETCRF  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            ++  V+ +GD+V +FAG +Y S  +LV
Sbjct  121  IQHFVRESGDVVELFAGTDYLSNHSLV  147



>gb|KJB38657.1| hypothetical protein B456_006G265700 [Gossypium raimondii]
Length=1020

 Score =   207 bits (527),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP++RKRVDLGGRSSKERDRQKLLEQ R ERNRR +LRQQNSAA+KIQK FRGRK
Sbjct  1    MFFSGDPTTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRQQNSAALKIQKYFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+ E+++VRE F+  YG HC HV+R  FGPDS+FLRQL+FF N  +  DFSV+V+ C  
Sbjct  61   VVEVERAKVREQFYKNYGQHCHHVDRHCFGPDSEFLRQLIFFVNAWNMNDFSVLVETCRF  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            ++  V+ +GD+V +FAG +Y S  +LV
Sbjct  121  IQHFVRESGDVVELFAGTDYLSNHSLV  147



>gb|KJB38654.1| hypothetical protein B456_006G265700 [Gossypium raimondii]
Length=1024

 Score =   207 bits (527),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP++RKRVDLGGRSSKERDRQKLLEQ R ERNRR +LRQQNSAA+KIQK FRGRK
Sbjct  1    MFFSGDPTTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRQQNSAALKIQKYFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+ E+++VRE F+  YG HC HV+R  FGPDS+FLRQL+FF N  +  DFSV+V+ C  
Sbjct  61   VVEVERAKVREQFYKNYGQHCHHVDRHCFGPDSEFLRQLIFFVNAWNMNDFSVLVETCRF  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            ++  V+ +GD+V +FAG +Y S  +LV
Sbjct  121  IQHFVRESGDVVELFAGTDYLSNHSLV  147



>ref|XP_007154424.1| hypothetical protein PHAVU_003G118500g [Phaseolus vulgaris]
 gb|ESW26418.1| hypothetical protein PHAVU_003G118500g [Phaseolus vulgaris]
Length=1006

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 116/147 (79%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRSSKERDR+ LLEQ R ERNRR +LRQQNSA ++IQKCFRGRK
Sbjct  1    MFFSGDPSTRKRVDLGGRSSKERDRKNLLEQTRVERNRRLWLRQQNSAVLRIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AVK EQ ++RE F+  YG +CQ+V+R SFGPDSDFL Q L+FF   +  DF V+V+ C L
Sbjct  61   AVKTEQYKLREQFYEAYGKYCQNVDRNSFGPDSDFLCQFLYFFKADNIDDFLVLVQICRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L   VQ  GD+V +FAG++Y S RA V
Sbjct  121  LWWFVQDNGDVVKLFAGVDYSSTRAFV  147



>gb|KJB72908.1| hypothetical protein B456_011G204200 [Gossypium raimondii]
Length=745

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GDPSSRKRVDLGGRSSKERDRQKLLEQ R ERNRR +LR+QNSAA+ IQK FRGRK
Sbjct  1    MFFTGDPSSRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRRQNSAALTIQKYFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+AE ++VRE F+ TY  HCQ+V+R  FGPDS+FLRQL+FFF+  +  DFSV+V+ C L
Sbjct  61   VVEAEHAKVREHFYQTYRKHCQNVDRHCFGPDSEFLRQLIFFFDAHNLNDFSVLVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            ++  V+ +GD V +FAGM+Y    +LV
Sbjct  121  IQNFVRDSGDTVGLFAGMDYSPNHSLV  147



>gb|KJB72909.1| hypothetical protein B456_011G204200 [Gossypium raimondii]
Length=925

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GDPSSRKRVDLGGRSSKERDRQKLLEQ R ERNRR +LR+QNSAA+ IQK FRGRK
Sbjct  1    MFFTGDPSSRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRRQNSAALTIQKYFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+AE ++VRE F+ TY  HCQ+V+R  FGPDS+FLRQL+FFF+  +  DFSV+V+ C L
Sbjct  61   VVEAEHAKVREHFYQTYRKHCQNVDRHCFGPDSEFLRQLIFFFDAHNLNDFSVLVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            ++  V+ +GD V +FAGM+Y    +LV
Sbjct  121  IQNFVRDSGDTVGLFAGMDYSPNHSLV  147



>gb|KJB72910.1| hypothetical protein B456_011G204200 [Gossypium raimondii]
Length=1004

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GDPSSRKRVDLGGRSSKERDRQKLLEQ R ERNRR +LR+QNSAA+ IQK FRGRK
Sbjct  1    MFFTGDPSSRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRRQNSAALTIQKYFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+AE ++VRE F+ TY  HCQ+V+R  FGPDS+FLRQL+FFF+  +  DFSV+V+ C L
Sbjct  61   VVEAEHAKVREHFYQTYRKHCQNVDRHCFGPDSEFLRQLIFFFDAHNLNDFSVLVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            ++  V+ +GD V +FAGM+Y    +LV
Sbjct  121  IQNFVRDSGDTVGLFAGMDYSPNHSLV  147



>ref|XP_006600390.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform X2 [Glycine 
max]
Length=1020

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP +RKRVDLGGRSSKERDR+ LLEQ R ERNRR +LRQQNSA +KIQKCFRGRK
Sbjct  1    MFFSGDPFTRKRVDLGGRSSKERDRKNLLEQTRVERNRRLWLRQQNSAVLKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+ EQS++RE F+  YG +CQ+V+R SFGPDS+FL Q L+FF   +  DF V+V+ C L
Sbjct  61   AVRTEQSKLREQFYKIYGKYCQNVDRNSFGPDSNFLCQFLYFFKAENIEDFLVLVQICRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L   VQ  GD+V +FAG++Y S RALV
Sbjct  121  LWWSVQDNGDVVKLFAGVDYSSTRALV  147



>ref|XP_003550723.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoformX1 [Glycine 
max]
Length=1026

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP +RKRVDLGGRSSKERDR+ LLEQ R ERNRR +LRQQNSA +KIQKCFRGRK
Sbjct  1    MFFSGDPFTRKRVDLGGRSSKERDRKNLLEQTRVERNRRLWLRQQNSAVLKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+ EQS++RE F+  YG +CQ+V+R SFGPDS+FL Q L+FF   +  DF V+V+ C L
Sbjct  61   AVRTEQSKLREQFYKIYGKYCQNVDRNSFGPDSNFLCQFLYFFKAENIEDFLVLVQICRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L   VQ  GD+V +FAG++Y S RALV
Sbjct  121  LWWSVQDNGDVVKLFAGVDYSSTRALV  147



>gb|KHN03256.1| E3 ubiquitin-protein ligase UPL6 [Glycine soja]
Length=1026

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP +RKRVDLGGRSSKERDR+ LLEQ R ERNRR +LRQQNSA +KIQKCFRGRK
Sbjct  1    MFFSGDPFTRKRVDLGGRSSKERDRKNLLEQTRVERNRRLWLRQQNSAVLKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+ EQS++RE F+  YG +CQ+V+R SFGPDS+FL Q L+FF   +  DF V+V+ C L
Sbjct  61   AVRTEQSKLREQFYKIYGKYCQNVDRNSFGPDSNFLCQFLYFFKAENIEDFLVLVQICRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L   VQ  GD+V +FAG++Y S RALV
Sbjct  121  LWWSVQDNGDVVKLFAGVDYSSTRALV  147



>gb|KJB72911.1| hypothetical protein B456_011G204200 [Gossypium raimondii]
Length=1030

 Score =   205 bits (521),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GDPSSRKRVDLGGRSSKERDRQKLLEQ R ERNRR +LR+QNSAA+ IQK FRGRK
Sbjct  1    MFFTGDPSSRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRRQNSAALTIQKYFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+AE ++VRE F+ TY  HCQ+V+R  FGPDS+FLRQL+FFF+  +  DFSV+V+ C L
Sbjct  61   VVEAEHAKVREHFYQTYRKHCQNVDRHCFGPDSEFLRQLIFFFDAHNLNDFSVLVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            ++  V+ +GD V +FAGM+Y    +LV
Sbjct  121  IQNFVRDSGDTVGLFAGMDYSPNHSLV  147



>gb|KJB72907.1| hypothetical protein B456_011G204200 [Gossypium raimondii]
Length=1032

 Score =   205 bits (521),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GDPSSRKRVDLGGRSSKERDRQKLLEQ R ERNRR +LR+QNSAA+ IQK FRGRK
Sbjct  1    MFFTGDPSSRKRVDLGGRSSKERDRQKLLEQTRLERNRRLWLRRQNSAALTIQKYFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+AE ++VRE F+ TY  HCQ+V+R  FGPDS+FLRQL+FFF+  +  DFSV+V+ C L
Sbjct  61   VVEAEHAKVREHFYQTYRKHCQNVDRHCFGPDSEFLRQLIFFFDAHNLNDFSVLVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            ++  V+ +GD V +FAGM+Y    +LV
Sbjct  121  IQNFVRDSGDTVGLFAGMDYSPNHSLV  147



>ref|XP_004486523.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like [Cicer arietinum]
Length=1024

 Score =   204 bits (520),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRS+KERDR+ LLEQ R ERNRR +LRQQNSAA++IQKCFR RK
Sbjct  1    MFFSGDPSNRKRVDLGGRSTKERDRKNLLEQTRLERNRRLWLRQQNSAALRIQKCFRARK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+ EQS++RE F   YG +C +V+R +FGPDSDFLRQ L+FFN  +  DF V+V+ C L
Sbjct  61   VVRIEQSKLREKFLRIYGKNCPNVDRNAFGPDSDFLRQFLYFFNAENIDDFLVLVQICRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + VQ  GD+VS+FAG++Y S  ALV
Sbjct  121  LLKCVQENGDVVSLFAGVDYSSICALV  147



>ref|XP_011019320.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform X2 [Populus 
euphratica]
Length=835

 Score =   203 bits (516),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GD S+RKRVDLGGRSSKERDR+KLLEQ R ERN R +++QQN+AA+KIQK FRG K
Sbjct  1    MFFNGDSSTRKRVDLGGRSSKERDRKKLLEQTRLERNSRLWVKQQNAAAVKIQKWFRGTK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+AE SRVRE F  TYG  CQ+V+R  FGPDS+F RQLLFFFN  D+ DF+++V+ C L
Sbjct  61   AVEAEHSRVREKFHGTYGKCCQNVDRHCFGPDSEFFRQLLFFFNAKDSDDFTILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + VQ +GDIVS+FAG +Y +  ALV
Sbjct  121  LLQNVQDSGDIVSLFAGGDYSTKHALV  147



>ref|XP_007147397.1| hypothetical protein PHAVU_006G120900g [Phaseolus vulgaris]
 gb|ESW19391.1| hypothetical protein PHAVU_006G120900g [Phaseolus vulgaris]
Length=1031

 Score =   204 bits (519),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGD S+RKRVDLGGRSSKERDR+ LLEQ R ERNRR +LRQQNS+A+KIQKCFRGRK
Sbjct  1    MFFSGDSSTRKRVDLGGRSSKERDRKNLLEQTRLERNRRLWLRQQNSSALKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+AEQS++RE F + YG +CQ+++R +FGPDSDFLRQ L+FFN  +  DF ++V+ C L
Sbjct  61   VVRAEQSKLREKFLSIYGKNCQNLDRNAFGPDSDFLRQFLYFFNAENIEDFLILVQICRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L++ V+ +GD+V +FA  EY S  ALV
Sbjct  121  LQQFVRESGDVVQLFAAEEYSSRCALV  147



>ref|XP_011019311.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform X1 [Populus 
euphratica]
Length=1033

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GD S+RKRVDLGGRSSKERDR+KLLEQ R ERN R +++QQN+AA+KIQK FRG K
Sbjct  1    MFFNGDSSTRKRVDLGGRSSKERDRKKLLEQTRLERNSRLWVKQQNAAAVKIQKWFRGTK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+AE SRVRE F  TYG  CQ+V+R  FGPDS+F RQLLFFFN  D+ DF+++V+ C L
Sbjct  61   AVEAEHSRVREKFHGTYGKCCQNVDRHCFGPDSEFFRQLLFFFNAKDSDDFTILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + VQ +GDIVS+FAG +Y +  ALV
Sbjct  121  LLQNVQDSGDIVSLFAGGDYSTKHALV  147



>ref|XP_008458320.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase UPL6 
[Cucumis melo]
Length=1033

 Score =   202 bits (515),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GD S+RKRVDLGGRSSKERDRQKLLEQ R ERNRR  LRQQN AA+KIQKCFRGRK
Sbjct  1    MFFTGDSSTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLSLRQQNFAALKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            A +A + RVRE F +TYG HC+ V+R  FGPDS+F  QLLFF+N     DFSV+V+AC L
Sbjct  61   ASEAARFRVREQFHDTYGKHCEKVDRHCFGPDSEFFHQLLFFYNAKHIDDFSVLVEACRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L++ VQ  GDI+SIFAG +Y   +ALV
Sbjct  121  LRKFVQENGDILSIFAGKDYLLNKALV  147



>ref|XP_002312309.2| hypothetical protein POPTR_0008s10070g [Populus trichocarpa]
 gb|EEE89676.2| hypothetical protein POPTR_0008s10070g [Populus trichocarpa]
Length=1033

 Score =   202 bits (514),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GD S+RKRVDLGGRSSKERDR+KLLEQ R ERN R +++QQN+AA+KIQK FRGRK
Sbjct  1    MFFNGDSSTRKRVDLGGRSSKERDRKKLLEQTRLERNSRLWVKQQNAAAVKIQKWFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+AE SRVR  F  TYG  CQ+V+R  FGPDS+F RQLLFFFN  D+ DF+++V+ C L
Sbjct  61   AVEAEHSRVRGKFHGTYGKCCQNVDRHCFGPDSEFFRQLLFFFNAKDSDDFTILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + VQ +GDIVS+FAG +Y +  ALV
Sbjct  121  LLQNVQDSGDIVSLFAGGDYSTKHALV  147



>emb|CDO98729.1| unnamed protein product [Coffea canephora]
Length=1033

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 120/148 (81%), Gaps = 1/148 (1%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGD S+RKRVDLGGRSSKERDR+KL+EQ R ERNRR  LRQ NSAA+KIQKCFRGRK
Sbjct  1    MFFSGDSSTRKRVDLGGRSSKERDRKKLVEQTRFERNRRLQLRQNNSAALKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+AE+S VRE FF  +G H Q V+RQ FGPDSDFLR LLFFFNP +AAD S +V+ C L
Sbjct  61   LVEAERSEVRERFFTRFGKHFQIVDRQCFGPDSDFLRWLLFFFNPKNAADCSALVEVCQL  120

Query  579  LKELVQ-HTGDIVSIFAGMEYDSXRALV  659
            L++L Q +  DI+S+FAG +Y S +ALV
Sbjct  121  LQKLDQDNVLDIISLFAGADYPSNKALV  148



>ref|XP_006597687.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform X2 [Glycine 
max]
Length=1028

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGD S+RKRVDLGGRSSKERDR  LLEQ R ERNRR +LRQQNSAA++IQKCFRGRK
Sbjct  1    MFFSGDSSTRKRVDLGGRSSKERDRNNLLEQTRLERNRRMWLRQQNSAALRIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+ EQS++RE F + YG +CQ+++R ++ P SDFLRQ L+FFN  +  DF ++V+ C +
Sbjct  61   VVRTEQSKLREKFLSIYGKNCQNLDRNAYAPGSDFLRQFLYFFNAENIDDFLILVQICRM  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L+  VQ +GD+V +FAG++Y S  ALV
Sbjct  121  LQRFVQDSGDVVRLFAGVDYSSTCALV  147



>ref|XP_003546300.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform X1 [Glycine 
max]
 gb|KHN14267.1| E3 ubiquitin-protein ligase UPL6 [Glycine soja]
Length=1031

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGD S+RKRVDLGGRSSKERDR  LLEQ R ERNRR +LRQQNSAA++IQKCFRGRK
Sbjct  1    MFFSGDSSTRKRVDLGGRSSKERDRNNLLEQTRLERNRRMWLRQQNSAALRIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+ EQS++RE F + YG +CQ+++R ++ P SDFLRQ L+FFN  +  DF ++V+ C +
Sbjct  61   VVRTEQSKLREKFLSIYGKNCQNLDRNAYAPGSDFLRQFLYFFNAENIDDFLILVQICRM  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L+  VQ +GD+V +FAG++Y S  ALV
Sbjct  121  LQRFVQDSGDVVRLFAGVDYSSTCALV  147



>ref|XP_011656310.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase UPL6 
[Cucumis sativus]
Length=1030

 Score =   197 bits (501),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GD S+RKRVDLGGRSSKERDRQKLLEQ R ERNRR  LRQQN AA+KIQKCFRGRK
Sbjct  1    MFFTGDSSTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLSLRQQNFAALKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            A +A +  VRE F +TYG HC+ V+R  FGPDS+F  QLLFF+N     DF V+V+AC L
Sbjct  61   ASEAARFSVREQFHDTYGKHCEKVDRHCFGPDSEFFHQLLFFYNAKHIDDFMVLVEACRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L++ VQ  GD++SIFAG +Y   +ALV
Sbjct  121  LRKFVQENGDMLSIFAGKDYLLNKALV  147



>ref|XP_006419303.1| hypothetical protein CICLE_v10004231mg [Citrus clementina]
 gb|ESR32543.1| hypothetical protein CICLE_v10004231mg [Citrus clementina]
Length=792

 Score =   194 bits (494),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP++RKRVDLGGRSSKERDRQKLLEQ R ERNRR YLR+QN AAIKIQKCFRG+K
Sbjct  1    MFFSGDPTTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLYLRKQNHAAIKIQKCFRGKK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            A++ E S+VRE FF TYG H Q+V RQ FGP S F RQL FFFN  + +D SV+V+ C L
Sbjct  61   AMEIEHSKVREQFFATYGRHIQNVNRQCFGPQSAFFRQLFFFFNARNVSDISVLVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            +K  VQ +GD+V +FAG++Y S RALV
Sbjct  121  MKHFVQESGDVVGLFAGIDYSSKRALV  147



>gb|AES64909.2| E3 ubiquitin-protein ligase UPL6 [Medicago truncatula]
Length=1024

 Score =   196 bits (498),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRSSKERDR+ LLEQ R ERNRR +LRQQNSAA++IQKCFR +K
Sbjct  1    MFFSGDPSNRKRVDLGGRSSKERDRKNLLEQTRLERNRRLWLRQQNSAALRIQKCFRAKK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+ EQS++R+ F + YG +C +V+R++FGPDSDFLRQ L+FFN  +  DF V+++ C L
Sbjct  61   VVRTEQSKLRQKFLHIYGKNCLNVDRKAFGPDSDFLRQFLYFFNAENHDDFLVLLQICRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + VQ +G+ V +FAG  Y S  ALV
Sbjct  121  LLKFVQESGNAVRLFAGENYSSVCALV  147



>gb|KHF99370.1| E3 ubiquitin-protein ligase UPL6 -like protein [Gossypium arboreum]
Length=1032

 Score =   196 bits (498),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GDP++RKRVDLG +SSKERDRQKLL+Q R ERNR  +L QQNSAA+KIQK FRGRK
Sbjct  1    MFFTGDPTTRKRVDLGSQSSKERDRQKLLKQTRLERNRCLWLCQQNSAALKIQKYFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+ E+++V+E F+ TYG HC HV+R  FGPDS+FLRQL+FF N  +  DFSV+V+ C L
Sbjct  61   VVEVERAKVQEQFYKTYGKHCHHVDRHCFGPDSEFLRQLIFFVNAWNMNDFSVLVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            ++  V+ +GD+V +FAG +Y S  +LV
Sbjct  121  IQHFVRESGDVVELFAGTDYLSNHSLV  147



>ref|XP_003594658.1| E3 ubiquitin-protein ligase UPL6 [Medicago truncatula]
Length=1103

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRSSKERDR+ LLEQ R ERNRR +LRQQNSAA++IQKCFR +K
Sbjct  1    MFFSGDPSNRKRVDLGGRSSKERDRKNLLEQTRLERNRRLWLRQQNSAALRIQKCFRAKK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+ EQS++R+ F + YG +C +V+R++FGPDSDFLRQ L+FFN  +  DF V+++ C L
Sbjct  61   VVRTEQSKLRQKFLHIYGKNCLNVDRKAFGPDSDFLRQFLYFFNAENHDDFLVLLQICRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + VQ +G+ V +FAG  Y S  ALV
Sbjct  121  LLKFVQESGNAVRLFAGENYSSVCALV  147



>ref|XP_006419302.1| hypothetical protein CICLE_v10004231mg [Citrus clementina]
 ref|XP_006488791.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like [Citrus sinensis]
 gb|ESR32542.1| hypothetical protein CICLE_v10004231mg [Citrus clementina]
Length=1028

 Score =   194 bits (494),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP++RKRVDLGGRSSKERDRQKLLEQ R ERNRR YLR+QN AAIKIQKCFRG+K
Sbjct  1    MFFSGDPTTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLYLRKQNHAAIKIQKCFRGKK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            A++ E S+VRE FF TYG H Q+V RQ FGP S F RQL FFFN  + +D SV+V+ C L
Sbjct  61   AMEIEHSKVREQFFATYGRHIQNVNRQCFGPQSAFFRQLFFFFNARNVSDISVLVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            +K  VQ +GD+V +FAG++Y S RALV
Sbjct  121  MKHFVQESGDVVGLFAGIDYSSKRALV  147



>ref|XP_010102911.1| E3 ubiquitin-protein ligase UPL6 [Morus notabilis]
 gb|EXB94379.1| E3 ubiquitin-protein ligase UPL6 [Morus notabilis]
Length=1413

 Score =   193 bits (491),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 116/149 (78%), Gaps = 2/149 (1%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQ--KCFRG  392
            MFFSGDPS+RKRVDLGGRS+KERDRQKLLEQ R ERNRR +LRQQN A IKIQ  KCFRG
Sbjct  1    MFFSGDPSNRKRVDLGGRSTKERDRQKLLEQTRLERNRRLWLRQQNLAGIKIQLQKCFRG  60

Query  393  RKAVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKAC  572
            RK V AE+SRVR+ F+  YG  CQ+V+R  FG  S+FLR+LL+FF+  +A D S +V+ C
Sbjct  61   RKVVAAERSRVRQEFYGKYGTLCQNVDRNCFGVRSEFLRELLYFFDARNAGDISTLVETC  120

Query  573  CLLKELVQHTGDIVSIFAGMEYDSXRALV  659
             LL++  Q +G+IV +FAGM+Y    ALV
Sbjct  121  RLLQQFAQDSGNIVGLFAGMDYLYNHALV  149



>ref|XP_010941512.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 [Elaeis guineensis]
Length=1032

 Score =   192 bits (487),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GD S+RKRVDLGGRSSKERDRQ LLEQ R ER RR  LRQQ +AAIKIQKCFRGRK
Sbjct  1    MFFTGDASTRKRVDLGGRSSKERDRQMLLEQTRLERKRRLGLRQQTNAAIKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+  +  VRE F  T+G+ CQ  + + FGPDS+FLRQLLFFF   +  D +++++AC L
Sbjct  61   AVEIARLEVREQFSFTFGNRCQKADWRCFGPDSEFLRQLLFFFTANNNGDVTILLEACHL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + VQH G+I+S+FAG+EY S R LV
Sbjct  121  LLQYVQHNGNILSLFAGLEYSSKRFLV  147



>ref|XP_008801753.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 isoform X2 [Phoenix 
dactylifera]
Length=1031

 Score =   191 bits (485),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGD S RKRVDLGGRSSKERDRQ LL+Q R ER RR  LRQQ++AA+KIQKCFRGRK
Sbjct  1    MFFSGDASIRKRVDLGGRSSKERDRQMLLDQTRLERKRRLGLRQQSNAAVKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+  +S+VRE F  T+GDHCQ  +   FGPDS+FLRQ+LFFF   +  D S++++AC +
Sbjct  61   AVEMARSKVREQFCFTFGDHCQKADWHCFGPDSEFLRQMLFFFTANNNGDVSILLEACQM  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + V++ G IVS+FAG++Y S  +LV
Sbjct  121  LLQYVRYNGSIVSLFAGLDYSSKHSLV  147



>ref|XP_006296888.1| hypothetical protein CARUB_v10012881mg [Capsella rubella]
 gb|EOA29786.1| hypothetical protein CARUB_v10012881mg [Capsella rubella]
Length=1029

 Score =   190 bits (482),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 88/147 (60%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRS+KERD +KLLEQ R ERNRR   +QQNSAA+KIQK FRGR+
Sbjct  1    MFFSGDPSTRKRVDLGGRSTKERDARKLLEQTRMERNRRLLQKQQNSAALKIQKFFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            ++  E+++VR  F  TYG HCQ+V+R  F P S FLRQLLFFF   ++ DF ++V+ C L
Sbjct  61   SMAIERAKVRHDFCETYGSHCQNVDRHCFEPGSSFLRQLLFFFKAQNSEDFVILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L  LV  +G IVS+F+G++Y +   LV
Sbjct  121  LHSLVSSSGGIVSLFSGLDYSTEHNLV  147



>ref|XP_010672598.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 [Beta vulgaris subsp. 
vulgaris]
Length=1031

 Score =   189 bits (480),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQ R ER RR + R+QNSAAIKIQKC+R  K
Sbjct  1    MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQTRLERKRRLFQREQNSAAIKIQKCYRAWK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+ E  ++RE FF  YG  CQ+V R  F PDS FL +LLFFFNP +  D   + + C L
Sbjct  61   AVEVEHQKMREQFFVKYGKRCQNVGRHCFDPDSRFLCELLFFFNPRNEEDLFALAETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L+   Q +GD++++F GM Y S R+LV
Sbjct  121  LQAFAQDSGDVITLFTGMAYSSNRSLV  147



>ref|XP_010914658.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform X1 [Elaeis 
guineensis]
Length=1031

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGD S+R+RVDLGGRSSKERDRQ LLEQ R ER RR  LRQQ++AAIKIQKCFRGRK
Sbjct  1    MFFSGDASTRRRVDLGGRSSKERDRQMLLEQTRLERKRRLGLRQQSNAAIKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+  + +VRE F +T+G HCQ  +   FGPDS+FLRQ+LFFF   +  D S++++AC  
Sbjct  61   AVEMARLKVREQFSSTFGGHCQKADWHCFGPDSEFLRQMLFFFTANNNGDVSILLEACQR  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + V H G IVS+FAG +Y S  +LV
Sbjct  121  LLQYVGHNGSIVSLFAGPDYSSKHSLV  147



>dbj|BAB02722.1| unnamed protein product [Arabidopsis thaliana]
Length=963

 Score =   186 bits (471),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRS+KERD +KLLEQ R ERNRR   +QQNSAA+KIQK FRGR+
Sbjct  1    MFFSGDPSTRKRVDLGGRSTKERDARKLLEQTRMERNRRLLQKQQNSAALKIQKFFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            ++  E+S+VR  F  TYG++CQ+V+R  F P S FLRQ LFFF   ++ DF ++V+ C L
Sbjct  61   SMAIERSKVRHDFCETYGNNCQNVDRHCFEPGSSFLRQFLFFFKAQNSGDFVILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L+  V  +GDIVS+F+G++Y S   LV
Sbjct  121  LQSFVDSSGDIVSLFSGLDYSSEHNLV  147



>ref|XP_006406754.1| hypothetical protein EUTSA_v10019984mg [Eutrema salsugineum]
 gb|ESQ48207.1| hypothetical protein EUTSA_v10019984mg [Eutrema salsugineum]
Length=1004

 Score =   186 bits (471),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRS+KERD +KLLEQ R ERNRR   +QQNSAA++IQK FRGR+
Sbjct  1    MFFSGDPSTRKRVDLGGRSTKERDARKLLEQTRMERNRRLLQKQQNSAAVRIQKFFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            ++  E+S+VR  F  TYG++CQ+V+R  F P S FLRQLLFFF   ++ DF ++V+ C L
Sbjct  61   SMAIERSKVRRDFCETYGNNCQNVDRHCFQPGSSFLRQLLFFFKAQNSGDFVILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L++    +GDIVS+F+G++Y S  +LV
Sbjct  121  LQKFAHSSGDIVSLFSGLDYSSEHSLV  147



>ref|XP_008801752.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 isoform X1 [Phoenix 
dactylifera]
Length=1033

 Score =   186 bits (472),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 115/149 (77%), Gaps = 2/149 (1%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQ--KCFRG  392
            MFFSGD S RKRVDLGGRSSKERDRQ LL+Q R ER RR  LRQQ++AA+KIQ  KCFRG
Sbjct  1    MFFSGDASIRKRVDLGGRSSKERDRQMLLDQTRLERKRRLGLRQQSNAAVKIQLQKCFRG  60

Query  393  RKAVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKAC  572
            RKAV+  +S+VRE F  T+GDHCQ  +   FGPDS+FLRQ+LFFF   +  D S++++AC
Sbjct  61   RKAVEMARSKVREQFCFTFGDHCQKADWHCFGPDSEFLRQMLFFFTANNNGDVSILLEAC  120

Query  573  CLLKELVQHTGDIVSIFAGMEYDSXRALV  659
             +L + V++ G IVS+FAG++Y S  +LV
Sbjct  121  QMLLQYVRYNGSIVSLFAGLDYSSKHSLV  149



>ref|XP_008801754.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 isoform X3 [Phoenix 
dactylifera]
Length=1022

 Score =   186 bits (471),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 115/149 (77%), Gaps = 2/149 (1%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQ--KCFRG  392
            MFFSGD S RKRVDLGGRSSKERDRQ LL+Q R ER RR  LRQQ++AA+KIQ  KCFRG
Sbjct  1    MFFSGDASIRKRVDLGGRSSKERDRQMLLDQTRLERKRRLGLRQQSNAAVKIQLQKCFRG  60

Query  393  RKAVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKAC  572
            RKAV+  +S+VRE F  T+GDHCQ  +   FGPDS+FLRQ+LFFF   +  D S++++AC
Sbjct  61   RKAVEMARSKVREQFCFTFGDHCQKADWHCFGPDSEFLRQMLFFFTANNNGDVSILLEAC  120

Query  573  CLLKELVQHTGDIVSIFAGMEYDSXRALV  659
             +L + V++ G IVS+FAG++Y S  +LV
Sbjct  121  QMLLQYVRYNGSIVSLFAGLDYSSKHSLV  149



>ref|NP_001118648.1| E3 ubiquitin-protein ligase UPL6 [Arabidopsis thaliana]
 gb|AEE75919.1| E3 ubiquitin-protein ligase UPL6 [Arabidopsis thaliana]
Length=1015

 Score =   186 bits (471),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRS+KERD +KLLEQ R ERNRR   +QQNSAA+KIQK FRGR+
Sbjct  1    MFFSGDPSTRKRVDLGGRSTKERDARKLLEQTRMERNRRLLQKQQNSAALKIQKFFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            ++  E+S+VR  F  TYG++CQ+V+R  F P S FLRQ LFFF   ++ DF ++V+ C L
Sbjct  61   SMAIERSKVRHDFCETYGNNCQNVDRHCFEPGSSFLRQFLFFFKAQNSGDFVILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L+  V  +GDIVS+F+G++Y S   LV
Sbjct  121  LQSFVDSSGDIVSLFSGLDYSSEHNLV  147



>ref|XP_002883053.1| hypothetical protein ARALYDRAFT_479191 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59312.1| hypothetical protein ARALYDRAFT_479191 [Arabidopsis lyrata subsp. 
lyrata]
Length=1029

 Score =   186 bits (471),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRS+KERD +KLLEQ R ERNRR   +QQNSAA+KIQK FRGR+
Sbjct  1    MFFSGDPSTRKRVDLGGRSTKERDARKLLEQTRMERNRRLLQKQQNSAALKIQKFFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            ++  E+S+VR  F  TYG++CQ+V+R  F P S FLRQ LFFF   ++ DF ++V+ C L
Sbjct  61   SMAIERSKVRHDFCETYGNNCQNVDRHCFEPGSSFLRQFLFFFKAQNSGDFVILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L+  V  +GDIVS+F+G++Y S   LV
Sbjct  121  LQSFVDSSGDIVSLFSGLDYSSKHNLV  147



>ref|NP_188346.2| E3 ubiquitin-protein ligase UPL6 [Arabidopsis thaliana]
 ref|NP_001189915.1| E3 ubiquitin-protein ligase UPL6 [Arabidopsis thaliana]
 sp|Q8RWB8.1|UPL6_ARATH RecName: Full=E3 ubiquitin-protein ligase UPL6; Short=Ubiquitin-protein 
ligase 6 [Arabidopsis thaliana]
 gb|AAM13201.1| unknown protein [Arabidopsis thaliana]
 gb|AAQ89615.1| At3g17205 [Arabidopsis thaliana]
 gb|AEE75918.1| E3 ubiquitin-protein ligase UPL6 [Arabidopsis thaliana]
 gb|AEE75920.1| E3 ubiquitin-protein ligase UPL6 [Arabidopsis thaliana]
Length=1029

 Score =   186 bits (471),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRS+KERD +KLLEQ R ERNRR   +QQNSAA+KIQK FRGR+
Sbjct  1    MFFSGDPSTRKRVDLGGRSTKERDARKLLEQTRMERNRRLLQKQQNSAALKIQKFFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            ++  E+S+VR  F  TYG++CQ+V+R  F P S FLRQ LFFF   ++ DF ++V+ C L
Sbjct  61   SMAIERSKVRHDFCETYGNNCQNVDRHCFEPGSSFLRQFLFFFKAQNSGDFVILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L+  V  +GDIVS+F+G++Y S   LV
Sbjct  121  LQSFVDSSGDIVSLFSGLDYSSEHNLV  147



>ref|XP_010045366.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 [Eucalyptus grandis]
 gb|KCW87540.1| hypothetical protein EUGRSUZ_B03986 [Eucalyptus grandis]
Length=1033

 Score =   185 bits (470),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPSSRKRV LGGRS+KERDRQKLLEQ R ER RR +LR+Q  AAIKIQK +RGRK
Sbjct  1    MFFSGDPSSRKRVALGGRSTKERDRQKLLEQTRLERERRSWLRKQTLAAIKIQKGYRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+A +S VR  F+ TYG  C++V R  FGPDS FLRQLLFFFN     D S++V+ C  
Sbjct  61   DVEAARSDVRMEFYCTYGKRCENVNRHCFGPDSVFLRQLLFFFNAHIDGDLSILVEVCLY  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            ++  V  +GD+VS+FAG +Y S +ALV
Sbjct  121  IRRYVHDSGDLVSLFAGEDYLSRQALV  147



>ref|XP_010549016.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 [Tarenaya hassleriana]
Length=1028

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GDP++RKRVDLGGRS+KERD QKLLEQ R+ERNRR   RQQNSAA+KIQK FRGRK
Sbjct  1    MFFTGDPTTRKRVDLGGRSTKERDAQKLLEQTRKERNRRLMQRQQNSAALKIQKFFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            ++  E+S+VR+ F  TYG+ CQ+V+R  F P S FL+QLLFFF   +  D  ++V+ C L
Sbjct  61   SMATERSKVRQDFCKTYGNKCQNVDRHCFEPGSGFLQQLLFFFKAQNMGDVMLLVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L+  V  +GDIVS+F+G  Y S  +LV
Sbjct  121  LQNFVHSSGDIVSLFSGTVYSSEHSLV  147



>ref|XP_009146032.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 isoform X1 [Brassica 
rapa]
 emb|CDX92117.1| BnaA05g22900D [Brassica napus]
Length=1033

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRS+KERD  KLLEQ R ERNRR   +QQN+AA+KIQK FRGR+
Sbjct  1    MFFSGDPSTRKRVDLGGRSTKERDAPKLLEQTRMERNRRLLQKQQNAAALKIQKFFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            +V  E+S+VR  F  TYG++CQ+V+R  F P S FLRQLLFFF   ++ DF ++V+ C L
Sbjct  61   SVAIERSKVRREFCETYGNNCQNVDRNCFEPGSSFLRQLLFFFKAQNSGDFVILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            LK      GDI+S+F+G++Y +   LV
Sbjct  121  LKIFTHSNGDILSLFSGLDYSAEHNLV  147



>ref|XP_009146033.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 isoform X2 [Brassica 
rapa]
Length=1032

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRS+KERD  KLLEQ R ERNRR   +QQN+AA+KIQK FRGR+
Sbjct  1    MFFSGDPSTRKRVDLGGRSTKERDAPKLLEQTRMERNRRLLQKQQNAAALKIQKFFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            +V  E+S+VR  F  TYG++CQ+V+R  F P S FLRQLLFFF   ++ DF ++V+ C L
Sbjct  61   SVAIERSKVRREFCETYGNNCQNVDRNCFEPGSSFLRQLLFFFKAQNSGDFVILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            LK      GDI+S+F+G++Y +   LV
Sbjct  121  LKIFTHSNGDILSLFSGLDYSAEHNLV  147



>gb|AES64913.2| E3 ubiquitin-protein ligase UPL6-like protein [Medicago truncatula]
Length=374

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF GD  + K VDLGG S KE DR+ LLEQ + ERN+R +LR+QNSAA++IQKCFR +K
Sbjct  41   MFFDGDHLNHKCVDLGGCSCKEIDRKNLLEQTQLERNKRLWLREQNSAALQIQKCFRAKK  100

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             VK EQS++R+ F N YG +C +V+R++FGPDSDFLRQ L+FFN  +  DF V+V+ C L
Sbjct  101  VVKTEQSKLRQKFLNIYGKNCLNVDRKAFGPDSDFLRQFLYFFNAENHDDFLVLVQICRL  160

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + VQ +GD V +FAG  Y S  A V
Sbjct  161  LLQFVQESGDAVKLFAGESYSSVCAFV  187



>emb|CDX95876.1| BnaC05g36270D [Brassica napus]
Length=1033

 Score =   182 bits (463),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRS+KERD +KLLEQ R ERNRR   +QQN+AA+KIQK FRGR+
Sbjct  1    MFFSGDPSTRKRVDLGGRSTKERDARKLLEQTRMERNRRLLQKQQNAAALKIQKFFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            +V  E+S+VR  F  TYGD+CQ+V+R  F P S FLRQ LFFF   ++ DF ++V+ C L
Sbjct  61   SVATERSKVRREFCETYGDNCQNVDRHCFEPGSSFLRQFLFFFKAKNSGDFLILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            LK      GDI+S+F+G +Y +   LV
Sbjct  121  LKMFAHSNGDILSLFSGSDYSAEHNLV  147



>ref|XP_010489883.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like [Camelina sativa]
Length=951

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF GDPS+RKRVDLGGRS+KERD +KLLEQ R ERNRR   +QQNSAA+KIQK FRGR+
Sbjct  1    MFFPGDPSTRKRVDLGGRSTKERDTRKLLEQTRMERNRRLLQKQQNSAALKIQKFFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            ++  E+++VR  F  TYG++CQ+V+R  F P S FLRQLLFF    ++ DF ++V+ C L
Sbjct  61   SMAIERAKVRHDFCETYGNNCQNVDRHCFEPSSSFLRQLLFFIKAQNSGDFVILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            +   V  TGDIV +F+G++Y +   LV
Sbjct  121  MNNFVHSTGDIVGLFSGLDYSAEHNLV  147



>gb|KDO72050.1| hypothetical protein CISIN_1g0016882mg, partial [Citrus sinensis]
 gb|KDO72051.1| hypothetical protein CISIN_1g0016882mg, partial [Citrus sinensis]
 gb|KDO72052.1| hypothetical protein CISIN_1g0016882mg, partial [Citrus sinensis]
 gb|KDO72053.1| hypothetical protein CISIN_1g0016882mg, partial [Citrus sinensis]
Length=128

 Score =   166 bits (420),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP++RKRVDLGGRSSKERDRQKLLEQ R ERNRR YLR+QN AAIKIQKCFRG+K
Sbjct  1    MFFSGDPTTRKRVDLGGRSSKERDRQKLLEQTRLERNRRLYLRRQNHAAIKIQKCFRGKK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            A++ E S+VRE FF TYG H Q+V RQ FGP S F RQL FFFN  + +D SV+V+ C L
Sbjct  61   AMEIEHSKVREQFFATYGRHIQNVNRQCFGPQSAFFRQLFFFFNARNVSDISVLVETCRL  120

Query  579  LKELVQHT  602
            +K  VQ +
Sbjct  121  MKHFVQES  128



>ref|XP_010270852.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 [Nelumbo nucifera]
Length=1035

 Score =   180 bits (456),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GD S+RKRVDLGGRSSKERDRQKLLEQ R ER RR  LRQQNSAAIKIQKCFRGR+
Sbjct  1    MFFTGDSSTRKRVDLGGRSSKERDRQKLLEQTRLERQRRLGLRQQNSAAIKIQKCFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            A +AE+ +VRE F   +GDHCQ V+R  F  DS FL QLLFFFN  ++ DF+++V  C L
Sbjct  61   AAEAERFKVREQFCMIFGDHCQKVDRGCFNHDSQFLCQLLFFFNAHNSGDFAILVGTCRL  120

Query  579  LKELVQHTGDIVSIFAGMEY  638
                V+ +GD + +FAG  Y
Sbjct  121  FHLFVRDSGDTLGLFAGANY  140



>ref|XP_010465746.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 isoform X1 [Camelina 
sativa]
Length=1043

 Score =   179 bits (454),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF GDPS+RKRVDLGGRS+KERD +KLLEQ R ERNRR   +QQNSAA+KIQK FRGR+
Sbjct  1    MFFPGDPSTRKRVDLGGRSTKERDTRKLLEQTRMERNRRLLQKQQNSAALKIQKFFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            ++  E+++VR  F  TYG+ CQ+V+R  F P S FLRQLLFF    ++ DF ++V+ C L
Sbjct  61   SMAIERAKVRHDFCETYGNKCQNVDRHCFEPSSSFLRQLLFFIKAQNSGDFVILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            +   V  +GDIV +F+G++Y +   LV
Sbjct  121  MNNFVHSSGDIVGLFSGLDYSAEHNLV  147



>ref|XP_010505122.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like [Camelina sativa]
Length=1029

 Score =   179 bits (454),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF GDPS+RKRVDLGGRS+KERD +KLLEQ R ERNRR   +QQNSAA+KIQK FRGR+
Sbjct  1    MFFPGDPSTRKRVDLGGRSTKERDTRKLLEQTRMERNRRLLQKQQNSAALKIQKFFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            ++  E+++VR  F  TYG+ CQ+V+R  F P S FLRQLLFF    ++ DF ++V+ C L
Sbjct  61   SMAIERAKVRHDFCETYGNKCQNVDRHCFEPSSSFLRQLLFFIKAQNSGDFVILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            +   V  +GDIV +F+G++Y +   LV
Sbjct  121  MNNFVHSSGDIVGLFSGLDYSAEHNLV  147



>ref|XP_010465747.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 isoform X2 [Camelina 
sativa]
Length=1029

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF GDPS+RKRVDLGGRS+KERD +KLLEQ R ERNRR   +QQNSAA+KIQK FRGR+
Sbjct  1    MFFPGDPSTRKRVDLGGRSTKERDTRKLLEQTRMERNRRLLQKQQNSAALKIQKFFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            ++  E+++VR  F  TYG+ CQ+V+R  F P S FLRQLLFF    ++ DF ++V+ C L
Sbjct  61   SMAIERAKVRHDFCETYGNKCQNVDRHCFEPSSSFLRQLLFFIKAQNSGDFVILVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            +   V  +GDIV +F+G++Y +   LV
Sbjct  121  MNNFVHSSGDIVGLFSGLDYSAEHNLV  147



>ref|XP_008779188.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform X2 [Phoenix 
dactylifera]
Length=151

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GD SSRKRVDLGGRSSKERDRQ LLEQ R ER RR  LRQQ +AAIKIQKCFRGRK
Sbjct  1    MFFTGDASSRKRVDLGGRSSKERDRQMLLEQTRLERKRRLGLRQQTNAAIKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+    +VRE F   +G+ CQ  + + FGPDS+FLRQLLFFF  ++  D +++++AC L
Sbjct  61   AVETACLKVREQFSFAFGNRCQKADWRCFGPDSEFLRQLLFFFTASNNGDVTILLEACQL  120

Query  579  LKELVQH  599
            L + V H
Sbjct  121  LLQYVHH  127



>ref|XP_009402500.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like [Musa acuminata 
subsp. malaccensis]
Length=1027

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF GD S+RKRVDLGGRSSKE DRQ LLEQAR +R RR   RQQ SAAIKIQKCFRG K
Sbjct  1    MFFMGDASTRKRVDLGGRSSKESDRQVLLEQARLDRKRRLVHRQQTSAAIKIQKCFRGMK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             VK  ++ VR+ F  TYGD  +  +   FGPDS+FLRQLLFFF   + +D +++V+AC L
Sbjct  61   DVKMARTEVRQQFHVTYGDRGEKADWHCFGPDSEFLRQLLFFFTANNISDVTLLVEACRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L +  Q +G+I+++FAG++Y   R+LV
Sbjct  121  LLQYRQQSGNIITLFAGLDYPLKRSLV  147



>gb|EMT28040.1| E3 ubiquitin-protein ligase UPL6 [Aegilops tauschii]
Length=952

 Score =   174 bits (440),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 92/150 (61%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  210  GETMFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFR  389
            G  MFFSGDP+SRKRVDLGGRS+KERDRQ LLEQ R+ER RR  LR QNS+A KIQKCFR
Sbjct  54   GAGMFFSGDPTSRKRVDLGGRSNKERDRQVLLEQTREERRRRLALRLQNSSATKIQKCFR  113

Query  390  GRKAVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKA  569
            GRKA +  +S VR++F +T+G+HCQ V+R  FG +SDFLRQLLFFFN +  +D +++ + 
Sbjct  114  GRKAFELARSEVRKNFCSTFGEHCQRVDRNCFGNNSDFLRQLLFFFNASKDSDIAILSQV  173

Query  570  CCLLKELVQHTGDIVSIFAGMEYDSXRALV  659
            C LL + V+H GD+VS+FAG++Y S   +V
Sbjct  174  CSLLLQYVKH-GDVVSLFAGVDYSSVEPVV  202



>ref|XP_003594662.1| E3 ubiquitin-protein ligase UPL6 [Medicago truncatula]
Length=350

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 108/167 (65%), Gaps = 20/167 (12%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF GD  + K VDLGG S KE DR+ LLEQ + ERN+R +LR+QNSAA++IQKCFR +K
Sbjct  5    MFFDGDHLNHKCVDLGGCSCKEIDRKNLLEQTQLERNKRLWLREQNSAALQIQKCFRAKK  64

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             VK EQS++R+ F N YG +C +V+R++FGPDSDFLRQ L+FFN  +  DF V+V+ C L
Sbjct  65   VVKTEQSKLRQKFLNIYGKNCLNVDRKAFGPDSDFLRQFLYFFNAENHDDFLVLVQICRL  124

Query  579  LKELVQHTG--------------------DIVSIFAGMEYDSXRALV  659
            L + VQ +G                    D V +FAG  Y S  A V
Sbjct  125  LLQFVQESGNCYPTFVIAFTVYFLLHFGWDAVKLFAGESYSSVCAFV  171



>ref|XP_009114441.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform X2 [Brassica 
rapa]
Length=1031

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 107/147 (73%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRS+KE D +KLLEQ + ERNRR   ++ NSAA+KIQK FRGR+
Sbjct  1    MFFSGDPSTRKRVDLGGRSTKEGDARKLLEQTKMERNRRLLQKKHNSAALKIQKVFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            +    +S+VR  F  TYGD+CQ+V+R  F P S FL Q LFFF    + DF ++V+ C L
Sbjct  61   STAIVRSKVRRDFCETYGDNCQNVDRHCFEPASSFLPQFLFFFKAQSSGDFVMLVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L++    +GDI+S+F+G++Y S   +V
Sbjct  121  LRKFAHSSGDILSLFSGLDYSSEHNMV  147



>ref|XP_009114437.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform X1 [Brassica 
rapa]
Length=1032

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 107/147 (73%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRS+KE D +KLLEQ + ERNRR   ++ NSAA+KIQK FRGR+
Sbjct  1    MFFSGDPSTRKRVDLGGRSTKEGDARKLLEQTKMERNRRLLQKKHNSAALKIQKVFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            +    +S+VR  F  TYGD+CQ+V+R  F P S FL Q LFFF    + DF ++V+ C L
Sbjct  61   STAIVRSKVRRDFCETYGDNCQNVDRHCFEPASSFLPQFLFFFKAQSSGDFVMLVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L++    +GDI+S+F+G++Y S   +V
Sbjct  121  LRKFAHSSGDILSLFSGLDYSSEHNMV  147



>ref|XP_008779187.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform X1 [Phoenix 
dactylifera]
Length=153

 Score =   157 bits (396),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 97/129 (75%), Gaps = 2/129 (2%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQ--KCFRG  392
            MFF+GD SSRKRVDLGGRSSKERDRQ LLEQ R ER RR  LRQQ +AAIKIQ  KCFRG
Sbjct  1    MFFTGDASSRKRVDLGGRSSKERDRQMLLEQTRLERKRRLGLRQQTNAAIKIQLQKCFRG  60

Query  393  RKAVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKAC  572
            RKAV+    +VRE F   +G+ CQ  + + FGPDS+FLRQLLFFF  ++  D +++++AC
Sbjct  61   RKAVETACLKVREQFSFAFGNRCQKADWRCFGPDSEFLRQLLFFFTASNNGDVTILLEAC  120

Query  573  CLLKELVQH  599
             LL + V H
Sbjct  121  QLLLQYVHH  129



>ref|XP_011622287.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 isoform X2 [Amborella 
trichopoda]
Length=1002

 Score =   168 bits (425),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GD ++RKRVDLGGRSSKERDRQKLLEQ R ER RR  L+Q+  AAIKIQKCFRGRK
Sbjct  1    MFFTGDSTNRKRVDLGGRSSKERDRQKLLEQTRLERKRRLGLKQETLAAIKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+AE+  VRE F   +G+ C+ V+R  FGP+S+FLRQLLFFF+  D  DF  + + C +
Sbjct  61   AVEAERLEVREQFCIKFGERCEKVDRHCFGPESEFLRQLLFFFSLHDRDDFIRLAETCRV  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + ++  G++  +FAG +  S +A+V
Sbjct  121  LHQFIKFDGNVKILFAGDDLPSNQAIV  147



>gb|ERN03285.1| hypothetical protein AMTR_s00003p00213880 [Amborella trichopoda]
Length=1021

 Score =   168 bits (425),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GD ++RKRVDLGGRSSKERDRQKLLEQ R ER RR  L+Q+  AAIKIQKCFRGRK
Sbjct  1    MFFTGDSTNRKRVDLGGRSSKERDRQKLLEQTRLERKRRLGLKQETLAAIKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+AE+  VRE F   +G+ C+ V+R  FGP+S+FLRQLLFFF+  D  DF  + + C +
Sbjct  61   AVEAERLEVREQFCIKFGERCEKVDRHCFGPESEFLRQLLFFFSLHDRDDFIRLAETCRV  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + ++  G++  +FAG +  S +A+V
Sbjct  121  LHQFIKFDGNVKILFAGDDLPSNQAIV  147



>emb|CDY35005.1| BnaA01g27290D [Brassica napus]
Length=1032

 Score =   168 bits (425),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 105/147 (71%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRS+KE D +KLLEQ R ERNRR   ++ NSAA+KIQK FRGR+
Sbjct  1    MFFSGDPSTRKRVDLGGRSTKEGDARKLLEQTRMERNRRLLQKKHNSAALKIQKFFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            +    +S+VR  F  TYGD+CQ+V+R  F P S FL Q LFFF    + DF ++V+ C L
Sbjct  61   STAIVRSKVRRDFCETYGDNCQNVDRHCFEPASSFLPQFLFFFKAQSSGDFVMLVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L+     +GDI+S+F+G++Y +    V
Sbjct  121  LRNFAHSSGDILSLFSGLDYSTEHNTV  147



>ref|XP_011622286.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 isoform X1 [Amborella 
trichopoda]
Length=1031

 Score =   167 bits (424),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GD ++RKRVDLGGRSSKERDRQKLLEQ R ER RR  L+Q+  AAIKIQKCFRGRK
Sbjct  1    MFFTGDSTNRKRVDLGGRSSKERDRQKLLEQTRLERKRRLGLKQETLAAIKIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV+AE+  VRE F   +G+ C+ V+R  FGP+S+FLRQLLFFF+  D  DF  + + C +
Sbjct  61   AVEAERLEVREQFCIKFGERCEKVDRHCFGPESEFLRQLLFFFSLHDRDDFIRLAETCRV  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + ++  G++  +FAG +  S +A+V
Sbjct  121  LHQFIKFDGNVKILFAGDDLPSNQAIV  147



>emb|CDY65724.1| BnaC01g43970D [Brassica napus]
Length=1032

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 105/147 (71%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRS+KE D ++LLEQ R ERNRR   +Q NSAA+KIQK FRGR+
Sbjct  1    MFFSGDPSTRKRVDLGGRSTKEGDARRLLEQTRMERNRRLLQKQHNSAALKIQKFFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            ++  E+ +VR  F  TYGD+CQ+V+R  F P S FL Q LFFF    + DF ++V+ C L
Sbjct  61   SMAIERFKVRRDFCETYGDNCQNVDRHCFEPASSFLPQFLFFFKAQSSGDFVMLVETCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L++     GDI+S F+G++Y +    V
Sbjct  121  LRQFAHSCGDILSFFSGLDYSTEHNTV  147



>ref|XP_009402499.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like, partial [Musa 
acuminata subsp. malaccensis]
Length=128

 Score =   152 bits (383),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFF+GD S+RKRVDLGGRSSKE DRQ LLEQAR +R RR   RQQ SAAIKIQKCFRG K
Sbjct  1    MFFTGDASTRKRVDLGGRSSKESDRQVLLEQARLDRKRRLVHRQQTSAAIKIQKCFRGMK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             VK  ++ VR+ F  TYGD  +  +   FGPDS+FLRQLLFFF   + +D +++V+AC L
Sbjct  61   DVKMARTEVRQQFHVTYGDRGEKADWHCFGPDSEFLRQLLFFFTANNISDVTLLVEACRL  120

Query  579  LKELVQHT  602
            L +  Q +
Sbjct  121  LLQYRQQS  128



>gb|EEC78566.1| hypothetical protein OsI_18547 [Oryza sativa Indica Group]
Length=1050

 Score =   163 bits (413),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 87/152 (57%), Positives = 114/152 (75%), Gaps = 1/152 (1%)
 Frame = +3

Query  207  RGET-MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKC  383
            +GE+ MFFSGDP++RKRVDLGGRSSKERDRQ LLEQ R+ER RR  LR QNS+A KIQKC
Sbjct  43   KGESGMFFSGDPTARKRVDLGGRSSKERDRQVLLEQTREERRRRLGLRLQNSSATKIQKC  102

Query  384  FRGRKAVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIV  563
            FRG++ ++  +S VR +F +T+G+HCQ V+  SFG +SDFLRQ LFFFN    +D +++ 
Sbjct  103  FRGKRDLELARSEVRGNFCSTFGEHCQRVDWSSFGANSDFLRQFLFFFNAKKDSDIAILC  162

Query  564  KACCLLKELVQHTGDIVSIFAGMEYDSXRALV  659
            + C LL + V+H GD++ +F G  Y S   LV
Sbjct  163  QVCNLLLDYVKHGGDVLRLFGGTNYSSLEPLV  194



>gb|KFK39058.1| hypothetical protein AALP_AA3G195500 [Arabis alpina]
Length=1030

 Score =   162 bits (411),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+RKRVDLGGRS+KERD +KLLEQ R ERNRR   +QQNSAA+KIQ+ FRGR+
Sbjct  1    MFFSGDPSTRKRVDLGGRSTKERDARKLLEQTRMERNRRLLQKQQNSAALKIQRFFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            A+  E+S+VR  F   YGD+CQ+V+R  F PDS FLRQ LFFF   ++ DF ++V+ C L
Sbjct  61   AMAIERSKVRHDFCEAYGDNCQNVDRHCFEPDSRFLRQFLFFFKAQNSGDFVILVEMCRL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L+     +GDIV +F+G++Y S   LV
Sbjct  121  LQNFTHSSGDIVGLFSGVDYSSEHNLV  147



>gb|EEE62409.1| hypothetical protein OsJ_17200 [Oryza sativa Japonica Group]
Length=1164

 Score =   162 bits (411),  Expect = 7e-42, Method: Composition-based stats.
 Identities = 87/152 (57%), Positives = 113/152 (74%), Gaps = 1/152 (1%)
 Frame = +3

Query  207  RGET-MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKC  383
            +GE+ MFFSGDP++RKRVDLGGRSSKERDRQ LLEQ R+ER RR  LR QNS+A KIQKC
Sbjct  130  KGESGMFFSGDPTARKRVDLGGRSSKERDRQVLLEQTREERRRRLGLRLQNSSATKIQKC  189

Query  384  FRGRKAVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIV  563
            FRG++ ++  +S VR +F +T+G+HCQ V+  SFG +SDFLRQ LFFFN    +D +++ 
Sbjct  190  FRGKRDLELARSEVRGNFCSTFGEHCQRVDWSSFGANSDFLRQFLFFFNAKKDSDIAILC  249

Query  564  KACCLLKELVQHTGDIVSIFAGMEYDSXRALV  659
            + C LL   V+H GD++ +F G  Y S   LV
Sbjct  250  QVCNLLLYYVKHGGDVLRLFGGTNYSSLEPLV  281



>ref|NP_001054713.1| Os05g0159000 [Oryza sativa Japonica Group]
 gb|AAV43916.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16627.1| Os05g0159000 [Oryza sativa Japonica Group]
Length=1030

 Score =   160 bits (406),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 85/147 (58%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP++RKRVDLGGRSSKERDRQ LLEQ R+ER RR  LR QNS+A KIQKCFRG++
Sbjct  1    MFFSGDPTARKRVDLGGRSSKERDRQVLLEQTREERRRRLGLRLQNSSATKIQKCFRGKR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             ++  +S VR +F +T+G+HCQ V+  SFG +SDFLRQ LFFFN    +D +++ + C L
Sbjct  61   DLELARSEVRGNFCSTFGEHCQRVDWSSFGANSDFLRQFLFFFNAKKDSDIAILCQVCNL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L   V+H GD++ +F G  Y S   LV
Sbjct  121  LLYYVKHGGDVLRLFGGTNYSSLEPLV  147



>ref|XP_006654075.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform X1 [Oryza 
brachyantha]
Length=1030

 Score =   160 bits (405),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 84/147 (57%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP++RKRVDLGGRS+KERDRQ LLEQ R+ER RR  LR QN++A KIQKCFRGR+
Sbjct  1    MFFSGDPTARKRVDLGGRSNKERDRQVLLEQTREERRRRLGLRLQNNSATKIQKCFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             ++  +S VR +F +T+G++CQ V+  SFG +SDFLRQ LFFFN    +D +++ + C L
Sbjct  61   DLELARSEVRGNFCSTFGENCQRVDWSSFGANSDFLRQFLFFFNAKKDSDIAMLYQVCNL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L E V+H GD++ +F G+ Y S   LV
Sbjct  121  LLEYVKHGGDVLKLFGGINYSSVEPLV  147



>ref|XP_008663934.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like [Zea mays]
Length=292

 Score =   149 bits (377),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+R+RVDLGGRSSKERDR+ LLEQ R+ER RRQ LR QN++A KIQK FRG+K
Sbjct  1    MFFSGDPSARRRVDLGGRSSKERDRKVLLEQTREERRRRQGLRLQNTSATKIQKFFRGKK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            A++  +S VR++F +T+G+HC+ +E  +FG +SDFLRQLLFFFN  +  D +++ + C L
Sbjct  61   ALELARSEVRKNFCSTFGEHCERIEWNNFGTNSDFLRQLLFFFNANEDNDIAILCQICNL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + V+  GD+V++F G+   S + LV
Sbjct  121  LLQYVKQGGDVVTLFTGVNGSSLQPLV  147



>ref|XP_006654076.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform X2 [Oryza 
brachyantha]
Length=1028

 Score =   154 bits (389),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 83/147 (56%), Positives = 110/147 (75%), Gaps = 2/147 (1%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP++RKRVDLGGRS+KERDRQ LLEQ R+ER RR  LR QN++A KIQKCFRGR+
Sbjct  1    MFFSGDPTARKRVDLGGRSNKERDRQVLLEQTREERRRRLGLRLQNNSATKIQKCFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             ++  +S VR +F +T+G++CQ V+   FG +SDFLRQ LFFFN    +D +++ + C L
Sbjct  61   DLELARSEVRGNFCSTFGENCQRVD--CFGANSDFLRQFLFFFNAKKDSDIAMLYQVCNL  118

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L E V+H GD++ +F G+ Y S   LV
Sbjct  119  LLEYVKHGGDVLKLFGGINYSSVEPLV  145



>ref|XP_002439333.1| hypothetical protein SORBIDRAFT_09g004530 [Sorghum bicolor]
 gb|EES17763.1| hypothetical protein SORBIDRAFT_09g004530 [Sorghum bicolor]
Length=1026

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 116/147 (79%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPSSR+RVDLGGRS+KERDR+ LLEQ R+ER RRQ LR QN++A KIQK FRG+K
Sbjct  1    MFFSGDPSSRRRVDLGGRSNKERDRKVLLEQTREERRRRQGLRLQNTSATKIQKFFRGKK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            A+++ +S VR++F +T+G+HC+ +E  +FG +SDFLRQLLFFFN  +  D +++ + C L
Sbjct  61   ALESARSEVRKNFCSTFGEHCERIEWNNFGTNSDFLRQLLFFFNANEDNDIAILCQVCNL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + V+  GD+V++F G++  S + LV
Sbjct  121  LLQYVKQGGDVVTLFTGVDGSSLQPLV  147



>ref|XP_006597688.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform X3 [Glycine 
max]
Length=993

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 94/147 (64%), Gaps = 35/147 (24%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGD S+RKRVDLGGRSSKERDR  LLEQ R ERNRR +LRQQNSAA++IQKCFRGRK
Sbjct  1    MFFSGDSSTRKRVDLGGRSSKERDRNNLLEQTRLERNRRMWLRQQNSAALRIQKCFRGRK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V+ EQS++RE F + YG +CQ+++R ++ PDS                           
Sbjct  61   VVRTEQSKLREKFLSIYGKNCQNLDRNAYAPDS---------------------------  93

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
                    GD+V +FAG++Y S  ALV
Sbjct  94   --------GDVVRLFAGVDYSSTCALV  112



>ref|XP_004977094.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform X1 [Setaria 
italica]
Length=1027

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPS+R+RVDLGGRSSKERDR+ LLEQ R+ER RRQ LR QNS+A KIQK FR +K
Sbjct  1    MFFSGDPSARRRVDLGGRSSKERDRKVLLEQTREERRRRQGLRLQNSSATKIQKFFRSKK  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            A++  +S +R++F +T+G+HC+ ++ ++FG +SDFLRQLLFFFN  +  D +++ + C L
Sbjct  61   ALELARSEIRKNFCSTFGEHCERIDWKNFGTNSDFLRQLLFFFNANEDNDIAILCQVCNL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + V+  GD V++FAG+   S + LV
Sbjct  121  LLQYVKRGGDTVTLFAGVNDSSLQPLV  147



>gb|ABR16239.1| unknown [Picea sitchensis]
Length=1032

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 105/147 (71%), Gaps = 0/147 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDPSSRK+VDLGGRSSKERDRQK LEQ +  R +RQ LRQQ  +A  IQKCFRGR+
Sbjct  1    MFFSGDPSSRKKVDLGGRSSKERDRQKYLEQTKLAREQRQRLRQQTLSAQVIQKCFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
            AV   +S +RE F  T+G++ +  +R +F P S++LRQLLFFF   +  D   +V+AC L
Sbjct  61   AVAMARSEIREEFCITFGEYGEQADRNAFNPSSEYLRQLLFFFRANNHGDILRLVEACKL  120

Query  579  LKELVQHTGDIVSIFAGMEYDSXRALV  659
            L + +Q +G+I+ IF   +  S +A++
Sbjct  121  LHQSIQVSGNILDIFTNGDISSDQAII  147



>gb|EPS68435.1| hypothetical protein M569_06334, partial [Genlisea aurea]
Length=867

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  378  KCFRGRKAVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSV  557
            K FRGR+ V++E+ +VR+ FF TYG  C+ V RQ FGP S+FL QL+FFFNP   ADFS 
Sbjct  1    KIFRGRRVVESERFKVRQRFFLTYGQRCEQVNRQCFGPKSNFLYQLVFFFNPRHVADFSA  60

Query  558  IVKACCLLKELVQHTGDIVSIFAGMEYDSXRALV  659
            +V+ C LL E  Q +GDIVSIFAG +Y S R LV
Sbjct  61   LVEICRLLCEFAQDSGDIVSIFAGSDYLSHRGLV  94



>ref|XP_002978677.1| hypothetical protein SELMODRAFT_443962 [Selaginella moellendorffii]
 gb|EFJ20124.1| hypothetical protein SELMODRAFT_443962 [Selaginella moellendorffii]
Length=1028

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 88/148 (59%), Gaps = 1/148 (1%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP  R++V+L GRSSKE DRQ  L + + ER +RQ  R +   A++IQKCFRGR+
Sbjct  1    MFFSGDPGLRRKVELRGRSSKESDRQGTLNRVKDEREQRQRARLRQQGALRIQKCFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKAC-C  575
             V   Q  +RE F   +G+     +R  F P+S +L Q+ F  +P ++ADF  +  AC  
Sbjct  61   DVAVNQVLIREKFVAAFGEFSDRADRNVFKPESLYLPQIFFMISPKNSADFYRLAGACRH  120

Query  576  LLKELVQHTGDIVSIFAGMEYDSXRALV  659
             L+ + +  G + S+F   +Y + R  +
Sbjct  121  FLRCMSETEGGVFSVFVSGDYTTQRGAI  148



>ref|XP_002984608.1| hypothetical protein SELMODRAFT_120783 [Selaginella moellendorffii]
 gb|EFJ14253.1| hypothetical protein SELMODRAFT_120783 [Selaginella moellendorffii]
Length=1026

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 88/148 (59%), Gaps = 1/148 (1%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGDP  R++V+L GRSSKE DRQ  L + + ER +RQ  R +   A++IQKCFRGR+
Sbjct  1    MFFSGDPGLRRKVELRGRSSKESDRQGTLNRVKDEREQRQRARLRQQGALRIQKCFRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKAC-C  575
             V   Q  +RE F   +G+     +R  F P+S +L Q+ F  +P ++ADF  +  AC  
Sbjct  61   DVAVNQVLIREKFVAAFGEFSDRADRNVFKPESLYLPQIFFMISPKNSADFYRLAGACRH  120

Query  576  LLKELVQHTGDIVSIFAGMEYDSXRALV  659
             L+ + +  G + S+F   +Y + R  +
Sbjct  121  FLRCMSETEGGVFSVFVSGDYTTQRCAI  148



>ref|XP_010231678.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 [Brachypodium distachyon]
Length=1041

 Score =   103 bits (257),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +3

Query  369  KIQKCFRGRKAVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAAD  548
            K+QKCFRG+KA    +S VR++F +T+G++CQ V+   F  +SDFLRQLLFFFN ++  D
Sbjct  63   KLQKCFRGKKAFDMARSEVRKTFCSTFGENCQRVDWNCFSTNSDFLRQLLFFFNASEDND  122

Query  549  FSVIVKACCLLKELVQHTGDIVSIFAGMEYDSXRALV  659
             +++ + C LL + V+H GD+V++FAG +Y +   LV
Sbjct  123  IAILSQVCNLLLQYVKH-GDVVNLFAGNDYSAVEPLV  158



>ref|XP_001774239.1| predicted protein [Physcomitrella patens]
 gb|EDQ61015.1| predicted protein [Physcomitrella patens]
Length=1036

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = +3

Query  219  MFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRK  398
            MFFSGD +S+K+VDLGGRS KERDRQKLL Q + ER +RQ LR Q  +A +IQK  RGR+
Sbjct  1    MFFSGDATSKKKVDLGGRSGKERDRQKLLLQTKLEREQRQRLRIQTQSAKQIQKFVRGRR  60

Query  399  AVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCL  578
             V A +  +R  F   YG+  +  +R +F P S FL  L FFF  ++  D   +V AC L
Sbjct  61   EVAAVRPIIRSEFCAIYGEFSERADRNAFLPSSKFLSLLFFFFQSSNDGDVQRLVGACRL  120

Query  579  LKE  587
            LK+
Sbjct  121  LKQ  123



>ref|XP_008801755.1| PREDICTED: E3 ubiquitin-protein ligase UPL6 isoform X4 [Phoenix 
dactylifera]
Length=968

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/82 (50%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +3

Query  414  QSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCLLKELV  593
            +S+VRE F  T+GDHCQ  +   FGPDS+FLRQ+LFFF   +  D S++++AC +L + V
Sbjct  3    RSKVREQFCFTFGDHCQKADWHCFGPDSEFLRQMLFFFTANNNGDVSILLEACQMLLQYV  62

Query  594  QHTGDIVSIFAGMEYDSXRALV  659
            ++ G IVS+FAG++Y S  +LV
Sbjct  63   RYNGSIVSLFAGLDYSSKHSLV  84



>ref|XP_002862195.1| hypothetical protein ARALYDRAFT_359773 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38453.1| hypothetical protein ARALYDRAFT_359773, partial [Arabidopsis 
lyrata subsp. lyrata]
Length=165

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  411  EQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACCLLKEL  590
            E+S+VR  F  TYG++CQ+V+R  F P S FLRQ LFFF   ++ DF ++V+ C LL+  
Sbjct  4    ERSKVRHDFCETYGNNCQNVDRHCFEPGSSFLRQFLFFFKAQNSGDFLILVETCRLLQSF  63

Query  591  VQHTGDIVSIFAGMEYDSXRALV  659
            V  +GDIVS+F+G++Y     LV
Sbjct  64   VDSSGDIVSLFSGLDYSFKHNLV  86



>gb|KDO72054.1| hypothetical protein CISIN_1g0016882mg, partial [Citrus sinensis]
Length=78

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +3

Query  384  FRGRKAVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIV  563
            +RG+KA++ E S+VRE FF TYG H Q+V RQ FGP S F RQL FFFN  + +D SV+V
Sbjct  6    YRGKKAMEIEHSKVREQFFATYGRHIQNVNRQCFGPQSAFFRQLFFFFNARNVSDISVLV  65

Query  564  KACCLLKELVQHT  602
            + C L+K  VQ +
Sbjct  66   ETCRLMKHFVQES  78



>gb|EMS23123.1| ubiquitin-protein ligase E3 C [Rhodosporidium toruloides NP11]
 emb|CDR46475.1| RHTO0S12e04918g1_1 [Rhodosporidium toruloides]
Length=1185

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 47/75 (63%), Gaps = 3/75 (4%)
 Frame = +3

Query  222  FFSGDPSSRKRVDLGGR---SSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRG  392
             F+G   +R +++LGGR   S++      L+++ARQER +R+  R++ +AA+ IQ  +RG
Sbjct  4    LFTGSARARPQINLGGRQGDSNQPASHLDLVQRARQEREQRERDRKKAAAALSIQAFYRG  63

Query  393  RKAVKAEQSRVRESF  437
            RKA +  +S  R  F
Sbjct  64   RKAARQARSGFRSQF  78



>ref|XP_007204674.1| hypothetical protein PRUPE_ppa000451mg [Prunus persica]
 gb|EMJ05873.1| hypothetical protein PRUPE_ppa000451mg [Prunus persica]
Length=1167

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 51/95 (54%), Gaps = 1/95 (1%)
 Frame = +3

Query  246  RKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAVKAEQSRV  425
            + +V L G S+KE  R  LLE+  QER  RQY R+ +SAA+ IQ+ +R  +  K   S +
Sbjct  6    KHQVSLRGASAKEITRDALLERVSQERELRQYARRASSAAVFIQRVWRRYRVTKMVASEL  65

Query  426  RESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFN  530
            RE + N    + +     ++   S+ +R  LFF  
Sbjct  66   REEWENVMNQYAELAITATWL-SSNIVRPFLFFIT  99



>ref|XP_007850795.1| hypothetical protein Moror_802 [Moniliophthora roreri MCA 2997]
 gb|ESK89887.1| hypothetical protein Moror_802 [Moniliophthora roreri MCA 2997]
Length=1009

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 44/69 (64%), Gaps = 5/69 (7%)
 Frame = +3

Query  225  FSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAV  404
            F  DPS+++ ++L G+S+     Q +LEQA+Q RN R   +++  AAI+IQ  +RGRK  
Sbjct  4    FLDDPSNKRTINLSGQSTST-SHQSILEQAKQRRNERIEHKRRTDAAIQIQGWYRGRK--  60

Query  405  KAEQSRVRE  431
              E  RVRE
Sbjct  61   --EARRVRE  67



>ref|XP_002284049.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 isoform X1 [Vitis 
vinifera]
 ref|XP_010654015.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 isoform X1 [Vitis 
vinifera]
 ref|XP_010654016.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 isoform X1 [Vitis 
vinifera]
 ref|XP_010654017.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 isoform X1 [Vitis 
vinifera]
 emb|CBI30209.3| unnamed protein product [Vitis vinifera]
Length=1161

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 49/97 (51%), Gaps = 2/97 (2%)
 Frame = +3

Query  234  DPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAVKAE  413
            D   + +V L G S+KE  R  LLE+  QER  R Y+R+  +AAI IQ+ +R    +K  
Sbjct  2    DDHRKHQVSLRGASAKEITRDALLEKVSQERELRNYVRRATAAAIFIQRVWRRYNVIKMV  61

Query  414  QSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFF  524
              +++E +      H   + R      S FLR  LFF
Sbjct  62   AVQLQEEWETLVNHHAVLMTRTWI--SSSFLRPFLFF  96



>emb|CEP08172.1| hypothetical protein [Parasitella parasitica]
Length=1036

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 40/135 (30%), Positives = 67/135 (50%), Gaps = 14/135 (10%)
 Frame = +3

Query  225  FSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAV  404
            F G+   R+ ++LGG   K  D++ LL +A+ ER  R+  R +  +A +IQ  FRGR+  
Sbjct  5    FEGNFKPRRNINLGG-VKKVDDKRFLLAKAQSERKAREQERLKLKSAQQIQSLFRGRREA  63

Query  405  KAEQSRVRESFFNTYGDHCQHVERQSFGPDS--DFLRQLLFFFNPTDAADFSVIVKACCL  578
             + + ++R+ F             QSF P +     RQL+FF+   +  D      A CL
Sbjct  64   SSTRQQLRQEFHQLLS-----ANTQSFDPKTLMALTRQLIFFYQTREEED------AQCL  112

Query  579  LKELVQHTGDIVSIF  623
             + + + T  + S+F
Sbjct  113  EQYVSKTTPLMRSMF  127



>ref|XP_006430346.1| hypothetical protein CICLE_v100109401mg, partial [Citrus clementina]
 gb|ESR43586.1| hypothetical protein CICLE_v100109401mg, partial [Citrus clementina]
Length=129

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 47/99 (47%), Gaps = 2/99 (2%)
 Frame = +3

Query  234  DPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAVKAE  413
            DP ++ +V L G S+KE  R+ LLE+  QER  R Y R+  ++AI IQ  +R     K  
Sbjct  2    DPYNKHQVSLRGASTKEISREALLEKVSQERELRNYARRATASAIFIQSVWRRYSVTKKV  61

Query  414  QSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFN  530
              +++E +      H   +        S  LR  LFF  
Sbjct  62   AVQLQEEWVALVNCHASLITGSWIS--SVVLRPFLFFVT  98



>gb|EWC45778.1| hypothetical protein DRE_05115 [Drechslerella stenobrocha 248]
Length=1171

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 58/110 (53%), Gaps = 4/110 (4%)
 Frame = +3

Query  225  FSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAV  404
            F+G+   +++V+L G+ +     Q ++  AR+ R +R+  RQ+N+AAI+IQ  FR  ++ 
Sbjct  4    FTGNTRRKRQVNLSGKPTSA-PSQSVIAAARESRAQRESERQKNAAAIRIQSAFRAYRSR  62

Query  405  KAEQSRVRESFFNTYG-DHCQHVERQSFGPDSDFLRQLLFFFNPTDAADF  551
            K   S  R ++  + G       E    G D+  L  LL F+ PTD  D 
Sbjct  63   KLCCSSWRVAWDKSVGFSPLSRGESSPLGADA--LAHLLLFYTPTDPTDL  110



>ref|XP_010242961.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 isoform X1 [Nelumbo 
nucifera]
Length=1171

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 50/97 (52%), Gaps = 2/97 (2%)
 Frame = +3

Query  234  DPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAVKAE  413
            D SS+++V L G S+KE  R  LLE+   ER  R Y R+  + AI IQK +R     K  
Sbjct  2    DESSKQQVSLRGASAKEITRNALLEKVSHERELRSYTRRAAAVAIFIQKVWRRYNVTKKV  61

Query  414  QSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFF  524
             ++++E  +    +H Q V   S    S  LR  LFF
Sbjct  62   AAKLQEE-WKALVNH-QDVLLSSRWVSSSLLRPFLFF  96



>ref|XP_010242967.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 isoform X2 [Nelumbo 
nucifera]
Length=1098

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 50/97 (52%), Gaps = 2/97 (2%)
 Frame = +3

Query  234  DPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAVKAE  413
            D SS+++V L G S+KE  R  LLE+   ER  R Y R+  + AI IQK +R     K  
Sbjct  2    DESSKQQVSLRGASAKEITRNALLEKVSHERELRSYTRRAAAVAIFIQKVWRRYNVTKKV  61

Query  414  QSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFF  524
             ++++E  +    +H Q V   S    S  LR  LFF
Sbjct  62   AAKLQEE-WKALVNH-QDVLLSSRWVSSSLLRPFLFF  96



>ref|XP_004208807.1| PREDICTED: ubiquitin-protein ligase E3C-like, partial [Hydra 
vulgaris]
Length=828

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 46/70 (66%), Gaps = 4/70 (6%)
 Frame = +3

Query  225  FSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRG---R  395
            F G   +  +V LGG +SK+ D++ LL+ A+ ER +R+ LR+QN +A+KIQ  +RG   R
Sbjct  4    FDGQHKTGLKVSLGG-ASKKIDKKSLLQSAKDERTKRELLRRQNISALKIQSWYRGITVR  62

Query  396  KAVKAEQSRV  425
            + + A++  V
Sbjct  63   RCISAKERDV  72



>ref|XP_006820665.1| PREDICTED: ubiquitin-protein ligase E3C-like [Saccoglossus kowalevskii]
Length=1060

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 66/125 (53%), Gaps = 10/125 (8%)
 Frame = +3

Query  219  MF-FSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGR  395
            MF F+GD  SR +V LGG S +E+  + LL Q + ER +R+  R++  +A ++Q  +RG 
Sbjct  1    MFGFNGDYRSRPKVSLGGASKQEKT-ESLLLQNKLERQKRENHRRRIVSATQLQSWWRGS  59

Query  396  KAVKAEQSRVRESF---FNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVK  566
            +  +  + + RE F      Y    +++ + +    S   RQ+L+F+   +  D   +V 
Sbjct  60   RVRQNRRHKEREDFDVELQHYHKSKRYITKNTL---STLYRQILYFYK--ERKDSDRLVS  114

Query  567  ACCLL  581
             C LL
Sbjct  115  LCQLL  119



>ref|XP_006481929.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-like isoform X3 [Citrus 
sinensis]
Length=927

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 47/97 (48%), Gaps = 2/97 (2%)
 Frame = +3

Query  234  DPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAVKAE  413
            DP ++ +V L G S+KE  R+ LLE+  QER  R Y R+  ++AI IQ  +R     K  
Sbjct  2    DPYNKHQVSLRGASTKEISREALLEKVSQERELRNYARRATASAIFIQSVWRCYSVTKKV  61

Query  414  QSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFF  524
              +++E +      H   +        S  LR  LFF
Sbjct  62   AVQLQEEWVALVNCHASLITGSWIS--SVVLRPFLFF  96



>gb|KDO60992.1| hypothetical protein CISIN_1g045956mg [Citrus sinensis]
Length=1150

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 47/97 (48%), Gaps = 2/97 (2%)
 Frame = +3

Query  234  DPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAVKAE  413
            DP ++ +V L G S+KE  R+ LLE+  QER  R Y R+  ++AI IQ  +R     K  
Sbjct  2    DPYNKHQVSLRGASTKEISREALLEKVSQERELRNYARRATASAIFIQSVWRCYSVTKKV  61

Query  414  QSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFF  524
              +++E +      H   +        S  LR  LFF
Sbjct  62   AVQLQEEWVALVNCHASLITGSWIS--SVVLRPFLFF  96



>ref|XP_006481927.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-like isoform X1 [Citrus 
sinensis]
Length=1150

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 47/97 (48%), Gaps = 2/97 (2%)
 Frame = +3

Query  234  DPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAVKAE  413
            DP ++ +V L G S+KE  R+ LLE+  QER  R Y R+  ++AI IQ  +R     K  
Sbjct  2    DPYNKHQVSLRGASTKEISREALLEKVSQERELRNYARRATASAIFIQSVWRCYSVTKKV  61

Query  414  QSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFF  524
              +++E +      H   +        S  LR  LFF
Sbjct  62   AVQLQEEWVALVNCHASLITGSWIS--SVVLRPFLFF  96



>ref|XP_011111592.1| hypothetical protein H072_5778 [Dactylellina haptotyla CBS 200.50]
 gb|EPS40412.1| hypothetical protein H072_5778 [Dactylellina haptotyla CBS 200.50]
Length=1308

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 61/123 (50%), Gaps = 8/123 (7%)
 Frame = +3

Query  198  SPRRGETMFFSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQ  377
            S RR   +  SG   SR    L G S+K  +    +  AR+ R RR+  RQ+N+AA+ IQ
Sbjct  137  STRRPRQVNLSG--KSRASPTLSGPSAKGVNTSTSVATARELRARRESERQRNAAAVTIQ  194

Query  378  KCFRGRKAVKAEQSRVRESFFNTYGDHCQHVERQSFGP-----DSDFLRQLLFFFNPTDA  542
              +RG  +  A ++  R+++  + G     V  QS GP     + D +  LL F  PT+ 
Sbjct  195  STYRGHASRIALRNNNRDAWDKSVGFKASSVTAQS-GPTVAASNIDAIALLLLFCEPTNP  253

Query  543  ADF  551
            AD 
Sbjct  254  ADL  256



>ref|XP_010933410.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 [Elaeis guineensis]
Length=1171

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 55/97 (57%), Gaps = 4/97 (4%)
 Frame = +3

Query  237  PSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAVKAEQ  416
            P  +++V L G S+KE  R  LLE+  QER  R Y R+ ++AA+ +Q+ +R   A+K   
Sbjct  4    PPKQRQVSLRGASAKEISRDALLEKVSQERELRIYNRRASAAALFVQRVWRRYNAMKKVS  63

Query  417  SRVRESFFNTYGDHCQHVERQSFGPDS-DFLRQLLFF  524
             ++++  + T  D  QH  + + G  S + LR  LFF
Sbjct  64   EQLQQE-WETLAD--QHNNQMTSGWISKNLLRPFLFF  97



>gb|ELT92644.1| hypothetical protein CAPTEDRAFT_228035 [Capitella teleta]
Length=1088

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 72/140 (51%), Gaps = 10/140 (7%)
 Frame = +3

Query  225  FSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAV  404
            F GD   +    LGG S KE +R  L+++ ++ER +R+ LR+Q  +A+ IQ  +RG +  
Sbjct  4    FEGDFRKKPTQSLGGASRKE-ERGSLIQRTQEERRKRELLRKQQLSALIIQSFYRGYRNR  62

Query  405  KAEQSRVRESFFNTYGDH---CQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVKACC  575
             + Q+  R+ F  T+  H    Q  E  + G  S  +R+++FF+   D  D   ++  C 
Sbjct  63   VSAQNAERDGFDITWSQHRKQRQATEIDAVGIAS-LIRKIVFFYK--DGQDDDRLLWLCQ  119

Query  576  LLKELVQHTGDIVSIFAGME  635
            L   L++   +I+    G E
Sbjct  120  L---LIRQQKNIIEWMTGTE  136



>dbj|GAN08541.1| HECT-domain-containing protein [Mucor ambiguus]
Length=1040

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/108 (28%), Positives = 56/108 (52%), Gaps = 4/108 (4%)
 Frame = +3

Query  225  FSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAV  404
            F G+   ++ ++LGG   K  D++ LL +A+ ER  R+  R +  +A +IQ  FRGR+  
Sbjct  5    FEGNFRPKRNINLGG-VKKVDDKRSLLAKAQSERKAREQERLRLKSAQQIQSFFRGRQQA  63

Query  405  KAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAAD  548
               +  +R  F         + ++ ++       RQL++F++P + AD
Sbjct  64   TLTKQALRHDFHQLLSSTDSNTDKLTW---MTLARQLIWFYHPNNEAD  108



>ref|XP_002876188.1| ubiquitin-protein ligase 7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52447.1| ubiquitin-protein ligase 7 [Arabidopsis lyrata subsp. lyrata]
Length=1130

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 46/97 (47%), Gaps = 2/97 (2%)
 Frame = +3

Query  234  DPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAVKAE  413
            D + + +V L G SS E  R  LL +  QER  R Y R+ N+AA+ IQ+ +R     K  
Sbjct  2    DLNRKHKVSLRGASSGEISRDALLAKVSQERELRSYARRANAAALFIQRVWRSYIVRKKA  61

Query  414  QSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFF  524
               +RE + N    H   + +      S  LR  LFF
Sbjct  62   AIEIREQWENLLSCHSDSLTKSWV--SSRVLRPFLFF  96



>ref|XP_008241337.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 [Prunus mume]
Length=1167

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 48/93 (52%), Gaps = 1/93 (1%)
 Frame = +3

Query  246  RKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAVKAEQSRV  425
            + +V L G S KE  R  LLE+  QER  RQY R+ +SAA+ IQ+ +R  +  K   S +
Sbjct  6    KHQVSLRGASVKEITRDALLEKVSQERELRQYARRASSAAVFIQRVWRRYRVTKMVASEL  65

Query  426  RESFFNTYGDHCQHVERQSFGPDSDFLRQLLFF  524
            RE +      + +     ++    + +R  LFF
Sbjct  66   REEWEKVMNQYAELAITATWL-SGNIVRPFLFF  97



>ref|XP_008794046.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 isoform X5 [Phoenix 
dactylifera]
Length=1055

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 53/97 (55%), Gaps = 4/97 (4%)
 Frame = +3

Query  237  PSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAVKAEQ  416
            P  +++V L G S+KE  R  LLE+  QER  R Y R+ ++AA+ +Q+ +R   A+K   
Sbjct  4    PPKQRQVSLRGASAKEITRDALLEKVSQERELRIYNRRASAAALFVQRVWRRYNAIKKVS  63

Query  417  SRVRESFFNTYGDHCQHVERQSFGPDS-DFLRQLLFF  524
             +++   + T  D  QH    + G  S + LR  LFF
Sbjct  64   EQLQRE-WETLTD--QHNNEMTSGWISKNLLRPFLFF  97



>ref|XP_008794045.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 isoform X4 [Phoenix 
dactylifera]
Length=1076

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 53/97 (55%), Gaps = 4/97 (4%)
 Frame = +3

Query  237  PSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAVKAEQ  416
            P  +++V L G S+KE  R  LLE+  QER  R Y R+ ++AA+ +Q+ +R   A+K   
Sbjct  4    PPKQRQVSLRGASAKEITRDALLEKVSQERELRIYNRRASAAALFVQRVWRRYNAIKKVS  63

Query  417  SRVRESFFNTYGDHCQHVERQSFGPDS-DFLRQLLFF  524
             +++   + T  D  QH    + G  S + LR  LFF
Sbjct  64   EQLQRE-WETLTD--QHNNEMTSGWISKNLLRPFLFF  97



>ref|XP_008557305.1| PREDICTED: ubiquitin-protein ligase E3C [Microplitis demolitor]
Length=1033

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 32/104 (31%), Positives = 55/104 (53%), Gaps = 3/104 (3%)
 Frame = +3

Query  225  FSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAV  404
            F GD   + + +L G +SK  ++  LL+ A  ER +R+ +RQ+N+A +KIQ   R     
Sbjct  4    FEGDYRRKPQQNLAG-ASKRNEKSVLLQHAHLERMKREDIRQRNNATLKIQAYTRSYLIR  62

Query  405  KAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPT  536
            ++ + R R+ F N        V+  S      ++R +LFF+ P+
Sbjct  63   QSIKRRSRQEFDNARSQLT--VKFLSLDILEPYVRSVLFFYQPS  104



>ref|XP_008794044.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 isoform X3 [Phoenix 
dactylifera]
Length=1148

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 53/97 (55%), Gaps = 4/97 (4%)
 Frame = +3

Query  237  PSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAVKAEQ  416
            P  +++V L G S+KE  R  LLE+  QER  R Y R+ ++AA+ +Q+ +R   A+K   
Sbjct  4    PPKQRQVSLRGASAKEITRDALLEKVSQERELRIYNRRASAAALFVQRVWRRYNAIKKVS  63

Query  417  SRVRESFFNTYGDHCQHVERQSFGPDS-DFLRQLLFF  524
             +++   + T  D  QH    + G  S + LR  LFF
Sbjct  64   EQLQRE-WETLTD--QHNNEMTSGWISKNLLRPFLFF  97



>ref|XP_008794042.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 isoform X1 [Phoenix 
dactylifera]
Length=1169

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 53/97 (55%), Gaps = 4/97 (4%)
 Frame = +3

Query  237  PSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAVKAEQ  416
            P  +++V L G S+KE  R  LLE+  QER  R Y R+ ++AA+ +Q+ +R   A+K   
Sbjct  4    PPKQRQVSLRGASAKEITRDALLEKVSQERELRIYNRRASAAALFVQRVWRRYNAIKKVS  63

Query  417  SRVRESFFNTYGDHCQHVERQSFGPDS-DFLRQLLFF  524
             +++   + T  D  QH    + G  S + LR  LFF
Sbjct  64   EQLQRE-WETLTD--QHNNEMTSGWISKNLLRPFLFF  97



>ref|XP_008794043.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 isoform X2 [Phoenix 
dactylifera]
Length=1163

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 53/97 (55%), Gaps = 4/97 (4%)
 Frame = +3

Query  237  PSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAVKAEQ  416
            P  +++V L G S+KE  R  LLE+  QER  R Y R+ ++AA+ +Q+ +R   A+K   
Sbjct  4    PPKQRQVSLRGASAKEITRDALLEKVSQERELRIYNRRASAAALFVQRVWRRYNAIKKVS  63

Query  417  SRVRESFFNTYGDHCQHVERQSFGPDS-DFLRQLLFF  524
             +++   + T  D  QH    + G  S + LR  LFF
Sbjct  64   EQLQRE-WETLTD--QHNNEMTSGWISKNLLRPFLFF  97



>gb|EYU38593.1| hypothetical protein MIMGU_mgv1a000436mg [Erythranthe guttata]
Length=1156

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 52/105 (50%), Gaps = 15/105 (14%)
 Frame = +3

Query  234  DPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAVKAE  413
            DP  + +V L G+S+KE  R  LLE+  QER  R Y R+ N+A + IQ+ +R    +K  
Sbjct  3    DPR-KHQVSLRGKSAKEITRDALLERVNQERELRNYTRRANAAVVLIQRVWRRHHEMKLV  61

Query  414  QSRVRESFFNTYGDHCQHVERQSFGPDS------DFLRQLLFFFN  530
              R+RE +        + +     GP +      + LR  LFF N
Sbjct  62   ALRLREEW--------EIMMNSRAGPLTGKQIAREILRPFLFFIN  98



>ref|XP_011189070.1| PREDICTED: ubiquitin-protein ligase E3C isoform X2 [Bactrocera 
cucurbitae]
Length=1118

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 65/122 (53%), Gaps = 10/122 (8%)
 Frame = +3

Query  219  MF-FSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQ---KCF  386
            MF F GD   R    LGG +S+  DR+ ++ +A+QER +R  LR+QN+ AI +Q   + F
Sbjct  1    MFGFDGDYRRRPVQSLGG-ASQSCDRETIIRKAQQERQKRNELRRQNNGAIVLQSYTRSF  59

Query  387  RGRKAVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVK  566
              R+  K  +    + F  T+ D    +E +  G     LR+LLFF+   ++ D   +++
Sbjct  60   IHRQRRKRLEREAFDEFLRTHRDRV--IEDECLG---YLLRRLLFFYTSRESKDGERLIE  114

Query  567  AC  572
             C
Sbjct  115  VC  116



>ref|XP_011189069.1| PREDICTED: ubiquitin-protein ligase E3C isoform X1 [Bactrocera 
cucurbitae]
Length=1121

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 65/122 (53%), Gaps = 10/122 (8%)
 Frame = +3

Query  219  MF-FSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQ---KCF  386
            MF F GD   R    LGG +S+  DR+ ++ +A+QER +R  LR+QN+ AI +Q   + F
Sbjct  1    MFGFDGDYRRRPVQSLGG-ASQSCDRETIIRKAQQERQKRNELRRQNNGAIVLQSYTRSF  59

Query  387  RGRKAVKAEQSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFFFNPTDAADFSVIVK  566
              R+  K  +    + F  T+ D    +E +  G     LR+LLFF+   ++ D   +++
Sbjct  60   IHRQRRKRLEREAFDEFLRTHRDRV--IEDECLG---YLLRRLLFFYTSRESKDGERLIE  114

Query  567  AC  572
             C
Sbjct  115  VC  116



>gb|KFK34546.1| hypothetical protein AALP_AA5G160300 [Arabis alpina]
Length=1143

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 45/97 (46%), Gaps = 2/97 (2%)
 Frame = +3

Query  234  DPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAVKAE  413
            D + + +V L G SS E  R  LL +  QER  R Y R+ N+AA+ IQ+ +R     K  
Sbjct  2    DLNRKHKVSLRGASSGEISRDALLAKVSQERELRSYARRANAAALYIQRVWRSYIVRKKA  61

Query  414  QSRVRESFFNTYGDHCQHVERQSFGPDSDFLRQLLFF  524
               +RE + N     C+          S  LR  LFF
Sbjct  62   AIEIREDWENLLS--CRSDTLTKSWVSSSVLRPFLFF  96



>ref|XP_009404285.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 [Musa acuminata subsp. 
malaccensis]
Length=1162

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 53/103 (51%), Gaps = 9/103 (9%)
 Frame = +3

Query  225  FSGDPSSRKRVDLGGRSSKERDRQKLLEQARQERNRRQYLRQQNSAAIKIQKCFRGRKAV  404
             SG P  R+ V L G S+KE  R  LLE+   ER  R Y R+ ++AA+ IQ+ +R    +
Sbjct  1    MSGPPQQRQ-VSLRGASAKEITRDALLEKLAHERELRSYQRRASAAALFIQRVWRRYIVI  59

Query  405  KAEQSRVRESF---FNTYGDHCQHVERQSFGPDSDFLRQLLFF  524
            K    +++E +    + Y DH       S    ++FLR  LFF
Sbjct  60   KKVSEQLQEEWEALADHYDDH-----MTSGWISNNFLRPFLFF  97



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1063448340092