BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10687

Length=658
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592140.1|  PREDICTED: yrdC domain-containing protein, m...    132   1e-33   Nicotiana tomentosiformis
ref|XP_010651157.1|  PREDICTED: yrdC domain-containing protein, m...    132   2e-33   
ref|XP_002285123.1|  PREDICTED: yrdC domain-containing protein, m...    132   2e-33   Vitis vinifera
ref|XP_004251129.1|  PREDICTED: yrdC domain-containing protein, m...    131   4e-33   Solanum lycopersicum
ref|XP_009798165.1|  PREDICTED: yrdC domain-containing protein, m...    130   9e-33   Nicotiana sylvestris
ref|XP_009798166.1|  PREDICTED: yrdC domain-containing protein, m...    130   1e-32   Nicotiana sylvestris
ref|XP_006340159.1|  PREDICTED: yrdC domain-containing protein, m...    129   2e-32   Solanum tuberosum [potatoes]
emb|CAN77236.1|  hypothetical protein VITISV_024209                     133   5e-32   Vitis vinifera
gb|EYU18837.1|  hypothetical protein MIMGU_mgv1a011291mg                128   6e-32   Erythranthe guttata [common monkey flower]
emb|CDP07118.1|  unnamed protein product                                125   2e-31   Coffea canephora [robusta coffee]
ref|XP_002313460.2|  hypothetical protein POPTR_0009s03050g             125   5e-31   
ref|XP_010483709.1|  PREDICTED: yrdC domain-containing protein, m...    122   6e-31   Camelina sativa [gold-of-pleasure]
ref|XP_007016722.1|  DHBP synthase RibB-like alpha/beta domain is...    124   2e-30   
gb|KDO73244.1|  hypothetical protein CISIN_1g024072mg                   124   2e-30   Citrus sinensis [apfelsine]
ref|XP_007016721.1|  DHBP synthase RibB-like alpha/beta domain is...    124   4e-30   
ref|XP_010443861.1|  PREDICTED: yrdC domain-containing protein, m...    120   4e-30   Camelina sativa [gold-of-pleasure]
gb|KDO73245.1|  hypothetical protein CISIN_1g024072mg                   122   5e-30   Citrus sinensis [apfelsine]
ref|XP_010456585.1|  PREDICTED: yrdC domain-containing protein, m...    120   6e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006488109.1|  PREDICTED: yrdC domain-containing protein, m...    121   7e-30   Citrus sinensis [apfelsine]
gb|KDP44061.1|  hypothetical protein JCGZ_05528                         122   8e-30   Jatropha curcas
ref|XP_012064831.1|  PREDICTED: LOW QUALITY PROTEIN: yrdC domain-...    122   1e-29   
ref|XP_006488108.1|  PREDICTED: yrdC domain-containing protein, m...    122   1e-29   Citrus sinensis [apfelsine]
ref|XP_006424587.1|  hypothetical protein CICLE_v10029204mg             120   1e-29   Citrus clementina [clementine]
ref|XP_011089896.1|  PREDICTED: yrdC domain-containing protein, m...    120   2e-29   Sesamum indicum [beniseed]
ref|XP_010483708.1|  PREDICTED: yrdC domain-containing protein, m...    121   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_009798167.1|  PREDICTED: yrdC domain-containing protein, m...    120   2e-29   Nicotiana sylvestris
ref|XP_002879291.1|  hypothetical protein ARALYDRAFT_482017             120   3e-29   
ref|XP_009120593.1|  PREDICTED: yrdC domain-containing protein, m...    118   3e-29   Brassica rapa
ref|XP_011089895.1|  PREDICTED: yrdC domain-containing protein, m...    121   3e-29   Sesamum indicum [beniseed]
ref|XP_002530287.1|  Protein SUA5, putative                             120   3e-29   Ricinus communis
ref|XP_010043742.1|  PREDICTED: yrdC domain-containing protein, m...    119   9e-29   Eucalyptus grandis [rose gum]
ref|XP_010443860.1|  PREDICTED: yrdC domain-containing protein, m...    119   1e-28   Camelina sativa [gold-of-pleasure]
ref|NP_568924.1|  DHBP synthase RibB-like alpha/beta domain-conta...    116   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010456581.1|  PREDICTED: yrdC domain-containing protein, m...    119   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_011015423.1|  PREDICTED: yrdC domain-containing protein, m...    119   2e-28   Populus euphratica
ref|XP_011041969.1|  PREDICTED: yrdC domain-containing protein, m...    119   2e-28   Populus euphratica
gb|KJB83809.1|  hypothetical protein B456_013G266600                    117   2e-28   Gossypium raimondii
emb|CDY53638.1|  BnaC09g54010D                                          118   3e-28   Brassica napus [oilseed rape]
ref|XP_008349745.1|  PREDICTED: yrdC domain-containing protein, m...    117   3e-28   
gb|KJB83810.1|  hypothetical protein B456_013G266600                    117   3e-28   Gossypium raimondii
ref|XP_004251130.1|  PREDICTED: yrdC domain-containing protein, m...    117   3e-28   Solanum lycopersicum
ref|XP_006340160.1|  PREDICTED: yrdC domain-containing protein, m...    117   3e-28   Solanum tuberosum [potatoes]
ref|XP_008359161.1|  PREDICTED: yrdC domain-containing protein, m...    117   4e-28   
ref|XP_006281699.1|  hypothetical protein CARUB_v10027848mg             118   4e-28   Capsella rubella
ref|XP_008349744.1|  PREDICTED: yrdC domain-containing protein, m...    118   5e-28   
ref|XP_008359146.1|  PREDICTED: yrdC domain-containing protein, m...    117   7e-28   
ref|XP_010520366.1|  PREDICTED: yrdC domain-containing protein, m...    117   7e-28   Tarenaya hassleriana [spider flower]
ref|XP_008359154.1|  PREDICTED: yrdC domain-containing protein, m...    117   8e-28   
ref|XP_008359129.1|  PREDICTED: yrdC domain-containing protein, m...    117   8e-28   
ref|XP_004505988.1|  PREDICTED: yrdC domain-containing protein, m...    117   9e-28   Cicer arietinum [garbanzo]
ref|XP_008359137.1|  PREDICTED: yrdC domain-containing protein, m...    117   9e-28   
gb|KFK27587.1|  hypothetical protein AALP_AA8G403100                    116   1e-27   Arabis alpina [alpine rockcress]
ref|XP_004295027.2|  PREDICTED: yrdC domain-containing protein, m...    117   1e-27   Fragaria vesca subsp. vesca
ref|XP_009120592.1|  PREDICTED: yrdC domain-containing protein, m...    116   1e-27   Brassica rapa
ref|XP_011041970.1|  PREDICTED: yrdC domain-containing protein, m...    115   2e-27   Populus euphratica
ref|XP_009771987.1|  PREDICTED: yrdC domain-containing protein, m...    115   2e-27   Nicotiana sylvestris
ref|XP_011461709.1|  PREDICTED: yrdC domain-containing protein, m...    115   2e-27   Fragaria vesca subsp. vesca
ref|XP_002864693.1|  hypothetical protein ARALYDRAFT_358267             116   2e-27   Arabidopsis lyrata subsp. lyrata
emb|CDY31532.1|  BnaA10g13390D                                          115   3e-27   Brassica napus [oilseed rape]
ref|NP_974970.1|  DHBP synthase RibB-like alpha/beta domain-conta...    115   4e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010264693.1|  PREDICTED: yrdC domain-containing protein, m...    114   5e-27   Nelumbo nucifera [Indian lotus]
ref|XP_007205665.1|  hypothetical protein PRUPE_ppa009466mg             115   5e-27   Prunus persica
ref|XP_008225594.1|  PREDICTED: yrdC domain-containing protein, m...    115   6e-27   Prunus mume [ume]
ref|XP_010264692.1|  PREDICTED: yrdC domain-containing protein, m...    114   7e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010685191.1|  PREDICTED: yrdC domain-containing protein, m...    114   8e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010264691.1|  PREDICTED: yrdC domain-containing protein, m...    114   9e-27   Nelumbo nucifera [Indian lotus]
ref|XP_007132251.1|  hypothetical protein PHAVU_011G078800g             113   1e-26   Phaseolus vulgaris [French bean]
dbj|BAB09832.1|  unnamed protein product                                113   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004148791.1|  PREDICTED: yrdC domain-containing protein, m...    114   1e-26   Cucumis sativus [cucumbers]
ref|XP_007132250.1|  hypothetical protein PHAVU_011G078800g             113   2e-26   Phaseolus vulgaris [French bean]
ref|XP_009335081.1|  PREDICTED: yrdC domain-containing protein, m...    113   2e-26   Pyrus x bretschneideri [bai li]
ref|XP_009335080.1|  PREDICTED: yrdC domain-containing protein, m...    113   3e-26   Pyrus x bretschneideri [bai li]
gb|KEH30047.1|  telomere recombination domain protein                   113   4e-26   Medicago truncatula
ref|XP_009367084.1|  PREDICTED: yrdC domain-containing protein, m...    112   7e-26   Pyrus x bretschneideri [bai li]
ref|XP_009367085.1|  PREDICTED: yrdC domain-containing protein, m...    112   7e-26   Pyrus x bretschneideri [bai li]
ref|XP_006400832.1|  hypothetical protein EUTSA_v10014329mg             112   7e-26   Eutrema salsugineum [saltwater cress]
ref|XP_003606393.1|  YrdC domain-containing protein                     113   7e-26   
emb|CDY69844.1|  BnaCnng65630D                                          108   9e-26   Brassica napus [oilseed rape]
ref|XP_010520367.1|  PREDICTED: yrdC domain-containing protein, m...    110   1e-25   Tarenaya hassleriana [spider flower]
gb|ERN15970.1|  hypothetical protein AMTR_s00175p00054310               109   3e-25   Amborella trichopoda
ref|XP_008788051.1|  PREDICTED: yrdC domain-containing protein, m...    110   3e-25   Phoenix dactylifera
ref|XP_003538209.1|  PREDICTED: yrdC domain-containing protein, m...    110   3e-25   Glycine max [soybeans]
gb|KHN38769.1|  YrdC domain-containing protein, mitochondrial           110   3e-25   Glycine soja [wild soybean]
ref|XP_006854503.2|  PREDICTED: yrdC domain-containing protein, m...    109   5e-25   Amborella trichopoda
ref|XP_008465284.1|  PREDICTED: yrdC domain-containing protein, m...    108   1e-24   Cucumis melo [Oriental melon]
ref|XP_010098198.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    111   3e-24   
gb|EPS58703.1|  hypothetical protein M569_16110                         105   3e-24   Genlisea aurea
ref|XP_009416119.1|  PREDICTED: yrdC domain-containing protein, m...    106   7e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416120.1|  PREDICTED: yrdC domain-containing protein, m...    103   3e-23   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ89704.1|  predicted protein                                      103   5e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK00353.1|  predicted protein                                      102   5e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010910769.1|  PREDICTED: yrdC domain-containing protein, m...    103   7e-23   Elaeis guineensis
ref|XP_003561935.1|  PREDICTED: LOW QUALITY PROTEIN: yrdC domain-...    103   7e-23   
gb|EMT33550.1|  hypothetical protein F775_08277                         102   3e-22   
ref|XP_006649582.1|  PREDICTED: yrdC domain-containing protein, m...    100   9e-22   Oryza brachyantha
ref|XP_004985302.1|  PREDICTED: yrdC domain-containing protein, m...  99.8    2e-21   Setaria italica
gb|ABF94505.1|  yrdC protein, putative, expressed                     99.4    2e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EAY88934.1|  hypothetical protein OsI_10418                        99.4    2e-21   Oryza sativa Indica Group [Indian rice]
ref|NP_001148954.1|  ischemia/reperfusion inducible protein           95.9    4e-20   Zea mays [maize]
gb|ACN27269.1|  unknown                                               95.9    5e-20   Zea mays [maize]
ref|XP_008676520.1|  PREDICTED: ischemia/reperfusion inducible pr...  95.9    6e-20   Zea mays [maize]
ref|XP_002465687.1|  hypothetical protein SORBIDRAFT_01g043750        92.8    5e-19   Sorghum bicolor [broomcorn]
ref|XP_009798170.1|  PREDICTED: yrdC domain-containing protein, m...  90.9    9e-19   Nicotiana sylvestris
ref|XP_006645318.1|  PREDICTED: yrdC domain-containing protein, m...  90.1    2e-18   
ref|XP_001757618.1|  predicted protein                                80.5    2e-15   
ref|XP_002991001.1|  hypothetical protein SELMODRAFT_132635           80.5    5e-15   
ref|XP_002982893.1|  hypothetical protein SELMODRAFT_234090           78.2    3e-14   
ref|XP_001811736.2|  PREDICTED: yrdC domain-containing protein, m...  78.6    3e-14   Tribolium castaneum [rust-red flour beetle]
ref|NP_001077336.1|  yrdC domain-containing protein, mitochondrial    78.6    3e-14   Danio rerio [leopard danio]
ref|XP_009796628.1|  PREDICTED: uncharacterized protein LOC104243172  74.7    2e-13   Nicotiana sylvestris
ref|XP_007515601.1|  predicted protein                                76.3    3e-13   Bathycoccus prasinos
ref|XP_007492881.1|  PREDICTED: yrdC domain-containing protein, m...  75.5    6e-13   Monodelphis domestica
emb|CDQ81567.1|  unnamed protein product                              73.9    1e-12   Oncorhynchus mykiss
ref|XP_010897415.1|  PREDICTED: yrdC domain-containing protein, m...  74.3    2e-12   Esox lucius
gb|EFA11620.1|  hypothetical protein TcasGA2_TC030645                 73.2    2e-12   
ref|XP_008320921.1|  PREDICTED: yrdC domain-containing protein, m...  73.6    2e-12   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008275607.1|  PREDICTED: yrdC domain-containing protein, m...  72.4    5e-12   Stegastes partitus
ref|XP_008429347.1|  PREDICTED: yrdC domain-containing protein, m...  72.4    5e-12   Poecilia reticulata
ref|XP_010793211.1|  PREDICTED: yrdC domain-containing protein, m...  72.0    7e-12   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_006007187.1|  PREDICTED: yrdC domain-containing protein, m...  71.6    7e-12   Latimeria chalumnae
ref|XP_007249671.1|  PREDICTED: yrdC domain-containing protein, m...  72.0    8e-12   
ref|XP_006007186.1|  PREDICTED: yrdC domain-containing protein, m...  72.0    9e-12   Latimeria chalumnae
gb|ACO09892.1|  Hypothetical protein ywlC                             71.6    9e-12   Osmerus mordax
ref|XP_005649715.1|  hypothetical protein COCSUDRAFT_65132            73.9    1e-11   Coccomyxa subellipsoidea C-169
ref|XP_007893149.1|  PREDICTED: yrdC domain-containing protein, m...  71.2    1e-11   Callorhinchus milii [Australian ghost shark]
gb|ENN81859.1|  hypothetical protein YQE_01752                        70.5    2e-11   Dendroctonus ponderosae
ref|XP_011196736.1|  PREDICTED: yrdC domain-containing protein, m...  70.5    2e-11   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_010729920.1|  PREDICTED: yrdC domain-containing protein, m...  70.1    3e-11   
ref|XP_004947809.1|  PREDICTED: yrdC domain-containing protein, m...  68.9    4e-11   
ref|XP_006631445.1|  PREDICTED: yrdC domain-containing protein, m...  69.7    4e-11   
ref|XP_011616497.1|  PREDICTED: yrdC domain-containing protein, m...  70.1    4e-11   Takifugu rubripes [tiger puffer]
ref|XP_004991111.1|  yrdC domain-containing protein                   70.5    7e-11   Salpingoeca rosetta
gb|ERL85623.1|  hypothetical protein D910_03042                       69.7    8e-11   Dendroctonus ponderosae
ref|XP_007557311.1|  PREDICTED: yrdC domain-containing protein, m...  68.9    1e-10   Poecilia formosa
ref|XP_005176493.2|  PREDICTED: yrdC domain-containing protein, m...  68.2    1e-10   
ref|XP_002131919.2|  PREDICTED: yrdC domain-containing protein, m...  69.7    1e-10   Ciona intestinalis [sea vase]
ref|WP_021055359.1|  sua5/YciO/YrdC/YwlC family protein               68.2    1e-10   
ref|XP_011971870.1|  PREDICTED: yrdC domain-containing protein, m...  68.6    1e-10   Ovis aries musimon
ref|XP_005317896.1|  PREDICTED: yrdC domain-containing protein, m...  68.6    1e-10   Ictidomys tridecemlineatus
gb|KHN32083.1|  Hypothetical protein glysoja_028878                   67.4    1e-10   Glycine soja [wild soybean]
ref|XP_004535797.1|  PREDICTED: yrdC domain-containing protein, m...  68.2    1e-10   
ref|XP_004003536.2|  PREDICTED: yrdC domain-containing protein, m...  68.6    1e-10   
ref|XP_004641157.1|  PREDICTED: yrdC domain-containing protein, m...  68.9    2e-10   
ref|XP_005796105.1|  PREDICTED: yrdC domain-containing protein, m...  67.8    2e-10   
ref|XP_001415562.1|  predicted protein                                67.4    2e-10   Ostreococcus lucimarinus CCE9901
ref|XP_005736173.1|  PREDICTED: yrdC domain-containing protein, m...  68.2    2e-10   Pundamilia nyererei
ref|XP_003450557.1|  PREDICTED: yrdC domain-containing protein, m...  68.2    2e-10   Oreochromis niloticus
ref|XP_004551029.1|  PREDICTED: yrdC domain-containing protein, m...  68.2    2e-10   Maylandia zebra
ref|XP_417757.1|  PREDICTED: yrdC domain-containing protein, mito...  67.8    2e-10   Gallus gallus [bantam]
ref|NP_001069018.1|  yrdC domain-containing protein, mitochondria...  68.2    2e-10   Bos taurus [bovine]
ref|XP_006791738.1|  PREDICTED: yrdC domain-containing protein, m...  67.8    2e-10   Neolamprologus brichardi [lyretail cichlid]
ref|XP_002720685.1|  PREDICTED: yrdC domain-containing protein, m...  67.8    2e-10   Oryctolagus cuniculus [domestic rabbit]
ref|XP_011582578.1|  PREDICTED: yrdC domain-containing protein, m...  67.8    2e-10   Aquila chrysaetos canadensis
ref|WP_045170633.1|  hypothetical protein                             66.6    2e-10   Ehrlichia minasensis
gb|EFX74263.1|  hypothetical protein DAPPUDRAFT_215182                67.0    3e-10   Daphnia pulex
ref|XP_005925643.1|  PREDICTED: yrdC domain-containing protein, m...  67.4    3e-10   Haplochromis burtoni
ref|XP_002112428.1|  hypothetical protein TRIADDRAFT_25776            66.6    3e-10   Trichoplax adhaerens
ref|XP_002059453.1|  GJ18829                                          67.4    3e-10   Drosophila virilis
ref|XP_005298513.1|  PREDICTED: yrdC domain-containing protein, m...  67.8    3e-10   Chrysemys picta bellii
ref|XP_008473202.1|  PREDICTED: yrdC domain-containing protein, m...  67.0    3e-10   Diaphorina citri
ref|XP_006077666.1|  PREDICTED: yrdC domain-containing protein, m...  68.2    4e-10   
ref|XP_002589778.1|  hypothetical protein BRAFLDRAFT_90451            65.9    4e-10   Branchiostoma floridae
ref|XP_004324709.1|  PREDICTED: yrdC domain-containing protein, m...  67.4    4e-10   
ref|XP_006134308.1|  PREDICTED: yrdC domain-containing protein, m...  66.2    5e-10   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_001974938.1|  GG20842                                          66.6    5e-10   Drosophila erecta
ref|XP_308435.3|  AGAP007397-PA                                       66.6    6e-10   Anopheles gambiae str. PEST
ref|XP_002091655.1|  GE13782                                          66.2    6e-10   Drosophila yakuba
ref|XP_010958164.1|  PREDICTED: yrdC domain-containing protein, m...  66.6    7e-10   Camelus bactrianus [camel]
ref|XP_005234937.1|  PREDICTED: yrdC domain-containing protein, m...  65.9    7e-10   Falco peregrinus [peregrine]
ref|XP_001987565.1|  GH19895                                          66.2    7e-10   Drosophila grimshawi
ref|XP_003462302.1|  PREDICTED: yrdC domain-containing protein, m...  66.2    8e-10   Cavia porcellus [guinea pig]
ref|XP_002004296.1|  GI19851                                          65.5    9e-10   Drosophila mojavensis
ref|XP_004266484.1|  PREDICTED: yrdC domain-containing protein, m...  65.9    1e-09   Orcinus orca [Orca]
ref|NP_001015837.1|  yrdC N(6)-threonylcarbamoyltransferase domai...  65.1    1e-09   Xenopus tropicalis [western clawed frog]
gb|EGI58189.1|  YrdC domain-containing protein, mitochondrial         65.5    1e-09   Acromyrmex echinatior
ref|XP_011066129.1|  PREDICTED: yrdC domain-containing protein, m...  65.5    1e-09   Acromyrmex echinatior
ref|XP_004851055.1|  PREDICTED: yrdC domain-containing protein, m...  65.1    1e-09   Heterocephalus glaber [naked mole rat]
ref|WP_013933582.1|  translation factor Sua5                          66.2    1e-09   
ref|XP_008149538.1|  PREDICTED: yrdC domain-containing protein, m...  65.9    2e-09   Eptesicus fuscus
ref|XP_004078322.1|  PREDICTED: yrdC domain-containing protein, m...  65.1    2e-09   Oryzias latipes [Japanese rice fish]
ref|WP_014557116.1|  tRNA threonylcarbamoyladenosine biosynthesis...  64.7    2e-09   Haloquadratum walsbyi
ref|XP_011483925.1|  PREDICTED: yrdC domain-containing protein, m...  65.1    2e-09   Oryzias latipes [Japanese rice fish]
ref|XP_004851054.1|  PREDICTED: yrdC domain-containing protein, m...  65.5    2e-09   Heterocephalus glaber [naked mole rat]
ref|XP_006867616.1|  PREDICTED: yrdC domain-containing protein, m...  65.5    2e-09   Chrysochloris asiatica
ref|XP_002063044.1|  GK21591                                          64.3    2e-09   
ref|XP_003074421.1|  yrdC protein-related (ISS)                       64.7    2e-09   
ref|WP_045648539.1|  translation factor Sua5                          65.9    2e-09   
ref|XP_010574599.1|  PREDICTED: yrdC domain-containing protein, m...  65.5    2e-09   Haliaeetus leucocephalus
ref|WP_011572876.1|  DNA binding protein; translation factor          64.7    2e-09   Haloquadratum walsbyi
ref|XP_006099198.1|  PREDICTED: yrdC domain-containing protein, m...  65.1    2e-09   Myotis lucifugus
ref|XP_004907262.1|  PREDICTED: yrdC domain-containing protein, m...  64.7    2e-09   
ref|XP_001959177.1|  GF12752                                          65.9    3e-09   
ref|XP_001659198.1|  AAEL001412-PA                                    64.3    3e-09   
emb|CEF96720.1|  DHBP synthase RibB-like alpha/beta domain            64.7    3e-09   Ostreococcus tauri
ref|XP_005058531.1|  PREDICTED: yrdC domain-containing protein, m...  64.7    3e-09   
ref|XP_004591753.1|  PREDICTED: yrdC domain-containing protein, m...  63.9    3e-09   
ref|WP_011304401.1|  hypothetical protein                             63.5    3e-09   Ehrlichia canis
gb|AAH88928.1|  LOC496333 protein                                     63.5    3e-09   Xenopus laevis [clawed frog]
ref|XP_002082361.1|  GD25261                                          64.3    4e-09   Drosophila simulans
ref|XP_005372448.1|  PREDICTED: yrdC domain-containing protein, m...  63.5    4e-09   
ref|XP_011866838.1|  PREDICTED: yrdC domain-containing protein, m...  64.3    4e-09   Vollenhovia emeryi
ref|XP_007538151.1|  PREDICTED: yrdC domain-containing protein, m...  64.3    4e-09   Erinaceus europaeus [common hedgehog]
gb|AAH73618.1|  LOC398509 protein                                     63.9    4e-09   Xenopus laevis [clawed frog]
ref|NP_001082498.2|  yrdC domain containing                           64.3    4e-09   Xenopus laevis [clawed frog]
ref|XP_011866837.1|  PREDICTED: yrdC domain-containing protein, m...  64.3    4e-09   Vollenhovia emeryi
ref|XP_011422154.1|  PREDICTED: yrdC domain-containing protein, m...  63.5    5e-09   Crassostrea gigas
ref|XP_011561358.1|  PREDICTED: yrdC domain-containing protein, m...  63.5    5e-09   Plutella xylostella [cabbage moth]
ref|XP_011695376.1|  PREDICTED: yrdC domain-containing protein, m...  63.9    5e-09   Wasmannia auropunctata
ref|WP_041302033.1|  translation factor Sua5                          64.3    6e-09   
ref|XP_004402694.1|  PREDICTED: yrdC domain-containing protein, m...  63.9    6e-09   Odobenus rosmarus divergens
ref|XP_793502.2|  PREDICTED: yrdC domain-containing protein, mito...  63.5    6e-09   Strongylocentrotus purpuratus [purple urchin]
ref|XP_012058761.1|  PREDICTED: yrdC domain-containing protein, m...  63.9    6e-09   Atta cephalotes
ref|XP_010975801.1|  PREDICTED: yrdC domain-containing protein, m...  62.8    6e-09   Camelus dromedarius [camel]
ref|XP_004741611.1|  PREDICTED: yrdC domain-containing protein, m...  62.8    7e-09   Mustela putorius furo [black ferret]
gb|EHB17138.1|  YrdC domain-containing protein, mitochondrial         63.9    7e-09   Heterocephalus glaber [naked mole rat]
ref|XP_006739873.1|  PREDICTED: yrdC domain-containing protein, m...  62.8    7e-09   Leptonychotes weddellii
ref|XP_001638711.1|  predicted protein                                62.8    7e-09   Nematostella vectensis
ref|XP_008848473.1|  PREDICTED: yrdC domain-containing protein, m...  63.5    8e-09   
ref|XP_008516124.1|  PREDICTED: yrdC domain-containing protein, m...  63.2    8e-09   Equus przewalskii [Przewalski horse]
ref|XP_010721742.1|  PREDICTED: yrdC domain-containing protein, m...  63.5    8e-09   Meleagris gallopavo [common turkey]
ref|XP_003788199.1|  PREDICTED: yrdC domain-containing protein, m...  63.5    8e-09   Otolemur garnettii
ref|XP_005084417.1|  PREDICTED: yrdC domain-containing protein, m...  63.5    8e-09   Mesocricetus auratus [Syrian golden hamster]
ref|XP_006212778.1|  PREDICTED: yrdC domain-containing protein, m...  62.8    8e-09   Vicugna pacos
ref|XP_001866124.1|  ischemia/reperfusion inducible protein           63.2    8e-09   Culex quinquefasciatus
gb|EZA54788.1|  YrdC domain-containing protein, mitochondrial         63.2    9e-09   Ooceraea biroi
ref|XP_011209920.1|  PREDICTED: yrdC domain-containing protein, m...  62.8    9e-09   
ref|XP_011338216.1|  PREDICTED: yrdC domain-containing protein, m...  63.2    1e-08   
ref|XP_004679498.1|  PREDICTED: yrdC domain-containing protein, m...  63.5    1e-08   Condylura cristata
ref|XP_007945808.1|  PREDICTED: yrdC domain-containing protein, m...  63.2    1e-08   Orycteropus afer afer
ref|XP_001360991.2|  GA17233                                          63.9    1e-08   
gb|AAH88428.1|  Yrdc protein                                          63.2    1e-08   Rattus norvegicus [brown rat]
ref|XP_011379662.1|  PREDICTED: yrdC domain-containing protein, m...  63.2    1e-08   Pteropus vampyrus
ref|XP_002017926.1|  GL17434                                          63.9    1e-08   
ref|XP_006924284.1|  PREDICTED: yrdC domain-containing protein, m...  63.2    1e-08   
ref|XP_004372146.1|  PREDICTED: yrdC domain-containing protein, m...  63.2    1e-08   
gb|EDL80408.1|  ischemia/reperfusion inducible protein                63.2    1e-08   Rattus norvegicus [brown rat]
ref|NP_783194.2|  yrdC domain-containing protein, mitochondrial p...  63.2    1e-08   Rattus norvegicus [brown rat]
gb|EHJ79214.1|  ischemia/reperfusion inducible protein                63.2    1e-08   
ref|NP_001027444.1|  CG33786                                          62.8    1e-08   Drosophila melanogaster
ref|XP_003415357.1|  PREDICTED: yrdC domain-containing protein, m...  63.2    1e-08   Loxodonta africana [African bush elephant]
ref|XP_011642124.1|  PREDICTED: yrdC domain-containing protein, m...  62.4    1e-08   Pogonomyrmex barbatus
ref|XP_004467160.1|  PREDICTED: yrdC domain-containing protein, m...  63.2    1e-08   Dasypus novemcinctus
ref|XP_011642123.1|  PREDICTED: yrdC domain-containing protein, m...  62.4    1e-08   
ref|XP_006886653.1|  PREDICTED: yrdC domain-containing protein, m...  62.8    2e-08   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_011642122.1|  PREDICTED: yrdC domain-containing protein, m...  62.8    2e-08   Pogonomyrmex barbatus
ref|XP_006924283.1|  PREDICTED: yrdC domain-containing protein, m...  62.8    2e-08   Pteropus alecto
gb|KII65378.1|  YrdC domain-containing protein, mitochondrial         60.8    2e-08   Thelohanellus kitauei
emb|CDS23363.1|  yrdC domain containing protein                       60.5    2e-08   Echinococcus granulosus
ref|XP_002034718.1|  GM19771                                          62.8    2e-08   Drosophila sechellia
ref|XP_004665262.1|  PREDICTED: yrdC domain-containing protein, m...  62.4    3e-08   Jaculus jaculus
gb|ACT58856.1|  Sua5/YciO/YrdC/YwlC family protein                    62.4    3e-08   Hirschia baltica ATCC 49814
ref|XP_004426032.1|  PREDICTED: yrdC domain-containing protein, m...  62.0    3e-08   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|WP_026386550.1|  hypothetical protein                             61.2    3e-08   Acidobacteria bacterium KBS 146
ref|WP_024848184.1|  translation factor Sua5                          62.4    3e-08   Aminobacter sp. J41
ref|XP_005439718.1|  PREDICTED: yrdC domain-containing protein, m...  60.8    4e-08   Falco cherrug
ref|WP_037463998.1|  hypothetical protein                             60.8    4e-08   
ref|XP_002507629.1|  predicted protein                                62.0    4e-08   Micromonas commoda
gb|ETN61266.1|  ischemia/reperfusion inducible protein                61.6    4e-08   Anopheles darlingi [American malaria mosquito]
emb|CDS25503.1|  yrdc domain containing protein mitochondrial         61.6    4e-08   Hymenolepis microstoma
gb|ERJ72817.1|  Sua5/YciO/YrdC/YwlC family protein                    60.5    4e-08   Porphyromonas sp. oral taxon 278 str. W7784
gb|ELK49037.1|  tRNA threonylcarbamoyladenosine biosynthesis protein  62.0    5e-08   Halobacillus sp. BAB-2008
ref|WP_039870322.1|  tRNA threonylcarbamoyladenosine biosynthesis...  62.0    5e-08   
ref|WP_031552137.1|  translation factor Sua5                          61.6    5e-08   Parvularcula oceani
ref|WP_035388209.1|  tRNA threonylcarbamoyladenosine biosynthesis...  62.0    5e-08   
ref|WP_044125206.1|  translation factor Sua5                          60.1    5e-08   Porphyromonas sp. oral taxon 278
ref|WP_013404972.1|  translation factor Sua5                          62.0    6e-08   Halanaerobium hydrogeniformans
ref|WP_017823899.1|  hypothetical protein                             61.6    6e-08   Brachybacterium muris
ref|NP_001040163.1|  ischemia/reperfusion inducible protein           61.2    6e-08   Bombyx mori [silk moth]
ref|WP_045031621.1|  translation factor Sua5                          59.7    6e-08   Draconibacterium sediminis
ref|WP_044195142.1|  hypothetical protein                             59.7    7e-08   Ehrlichia sp. HF
ref|XP_005090627.1|  PREDICTED: yrdC domain-containing protein, m...  61.2    7e-08   Aplysia californica
ref|WP_043881525.1|  translation factor Sua5                          59.3    7e-08   Vibrio cholerae
ref|WP_025029474.1|  translation factor Sua5                          61.2    7e-08   Nitratireductor aquibiodomus
ref|WP_007006845.1|  translation factor Sua5                          61.2    8e-08   Nitratireductor
ref|WP_033933414.1|  translation factor Sua5                          59.3    8e-08   Vibrio cholerae
ref|WP_038558139.1|  translation factor Sua5                          59.7    8e-08   Draconibacterium orientale
ref|WP_013300764.1|  translation factor Sua5                          61.2    8e-08   Parvularcula bermudensis
ref|XP_009066724.1|  hypothetical protein LOTGIDRAFT_134383           59.3    8e-08   Lottia gigantea
ref|WP_042702101.1|  translation factor Sua5                          59.7    9e-08   Methanobrevibacter arboriphilus
ref|WP_035350237.1|  hypothetical protein                             59.7    1e-07   
ref|WP_014215147.1|  translation factor Sua5                          61.2    1e-07   
ref|WP_025977180.1|  translation factor Sua5                          60.8    1e-07   
ref|WP_024071911.1|  hypothetical protein                             59.3    1e-07   
ref|WP_003166989.1|  Sua5/YciO/YrdC/YwlC family protein               60.8    1e-07   
ref|WP_042669009.1|  tRNA threonylcarbamoyladenosine biosynthesis...  60.8    1e-07   
ref|WP_012241967.1|  translation factor Sua5                          59.3    1e-07   
ref|WP_020265741.1|  MULTISPECIES: hypothetical protein               60.8    1e-07   
ref|WP_024352684.1|  translation factor Sua5                          60.8    1e-07   
ref|WP_003164804.1|  translation factor Sua5                          60.8    1e-07   
gb|EUB58881.1|  YrdC domain-containing protein                        60.1    1e-07   
ref|WP_014265902.1|  hypothetical protein                             59.7    1e-07   
emb|CDI97112.1|  yrdc domain containing protein mitochondrial         60.5    1e-07   
ref|WP_021042071.1|  translation factor SUA5                          59.3    1e-07   
ref|WP_033515949.1|  translation factor Sua5                          59.7    1e-07   
ref|WP_034710130.1|  translation factor Sua5                          58.9    1e-07   
ref|WP_032483056.1|  translation factor Sua5                          58.9    1e-07   
ref|WP_007544391.1|  DNA binding protein, translation factor          59.3    1e-07   
ref|WP_020714884.1|  hypothetical protein                             59.3    1e-07   
ref|WP_045835566.1|  translation factor Sua5                          60.5    1e-07   
ref|WP_008366022.1|  Sua5/YciO/YrdC/YwlC family protein               59.3    1e-07   
gb|EKG52685.1|  SUA5 domain protein                                   59.3    2e-07   
gb|EFN88220.1|  YrdC domain-containing protein, mitochondrial         59.7    2e-07   
ref|WP_040113984.1|  translation factor Sua5                          60.5    2e-07   
ref|WP_018996487.1|  translation factor Sua5                          60.1    2e-07   
ref|WP_029522432.1|  translation factor Sua5                          58.9    2e-07   
ref|XP_011501887.1|  PREDICTED: yrdC domain-containing protein, m...  59.3    2e-07   
ref|XP_008588657.1|  PREDICTED: yrdC domain-containing protein, m...  58.5    2e-07   
ref|WP_024276194.1|  translation factor Sua5                          60.1    2e-07   
ref|WP_015915112.1|  translation factor Sua5                          60.1    2e-07   
ref|WP_045499971.1|  translation factor Sua5                          58.2    2e-07   
ref|XP_011154178.1|  PREDICTED: yrdC domain-containing protein, m...  59.7    2e-07   
ref|WP_013948576.1|  translation factor Sua5                          60.1    2e-07   
ref|XP_011176212.1|  PREDICTED: yrdC domain-containing protein, m...  59.7    2e-07   
gb|EFZ21035.1|  hypothetical protein SINV_05462                       59.3    2e-07   
ref|WP_032477891.1|  translation factor Sua5                          60.1    2e-07   
ref|WP_004129766.1|  Sua5/YciO/YrdC family protein                    60.1    2e-07   
ref|XP_009031727.1|  hypothetical protein HELRODRAFT_182753           58.5    2e-07   
ref|WP_032468052.1|  translation factor Sua5                          60.1    2e-07   
gb|ELU02517.1|  hypothetical protein CAPTEDRAFT_171446                59.3    2e-07   
ref|WP_040140020.1|  translation factor Sua5                          60.1    2e-07   
ref|WP_039191532.1|  tRNA threonylcarbamoyladenosine biosynthesis...  60.1    2e-07   
ref|WP_028056973.1|  translation factor Sua5                          59.7    2e-07   
ref|WP_018192869.1|  MULTISPECIES: hypothetical protein               60.1    2e-07   
ref|WP_029942099.1|  translation factor Sua5                          59.7    2e-07   
ref|WP_033340176.1|  translation factor SUA5                          58.5    2e-07   
ref|WP_013064426.1|  translation factor Sua5                          58.2    2e-07   
ref|WP_013984677.1|  MULTISPECIES: Sua5/YciO/YrdC/YwlC family pro...  59.7    2e-07   
ref|WP_042667202.1|  tRNA threonylcarbamoyladenosine biosynthesis...  59.7    2e-07   
ref|WP_042668985.1|  MULTISPECIES: tRNA threonylcarbamoyladenosin...  59.7    3e-07   
ref|WP_035429884.1|  translation factor Sua5                          59.7    3e-07   
ref|WP_012707064.1|  translation factor Sua5                          59.7    3e-07   
ref|WP_013482938.1|  translation factor                               58.2    3e-07   
ref|WP_013679497.1|  translation factor Sua5                          59.7    3e-07   
ref|WP_036482035.1|  translation factor Sua5                          59.7    3e-07   
ref|WP_034695051.1|  translation factor Sua5                          57.8    3e-07   
gb|ESQ83703.1|  translation factor Sua5                               59.7    3e-07   
ref|WP_034704371.1|  translation factor Sua5                          57.8    3e-07   
ref|WP_019829829.1|  translation factor Sua5                          59.7    3e-07   
ref|WP_033149405.1|  translation factor Sua5                          58.2    3e-07   
ref|WP_014934425.1|  YrdC domain-containing protein                   58.5    3e-07   
ref|WP_001132582.1|  translation factor Sua5                          59.7    3e-07   
ref|WP_032474596.1|  translation factor Sua5                          59.3    3e-07   
ref|WP_019896603.1|  translation factor Sua5                          59.3    3e-07   
ref|WP_033932415.1|  translation factor Sua5                          59.3    3e-07   
ref|WP_033929553.1|  translation factor Sua5                          59.3    3e-07   
ref|WP_039144355.1|  translation factor Sua5                          59.3    3e-07   
ref|WP_001132581.1|  Sua5 YciO YrdC YwlC family protein               59.3    3e-07   
gb|KFR03588.1|  hypothetical protein Y956_15046                       58.2    3e-07   
ref|WP_042990052.1|  translation factor Sua5                          59.3    3e-07   
gb|AKB04297.1|  tRNA threonylcarbamoyl adenosine modification pro...  59.3    3e-07   
ref|WP_028979375.1|  translation factor Sua5                          57.8    3e-07   
ref|WP_001897767.1|  translation factor Sua5                          59.3    4e-07   
ref|WP_032482669.1|  translation factor Sua5                          59.3    4e-07   
ref|WP_001132584.1|  translation factor Sua5                          59.3    4e-07   
ref|WP_001887368.1|  translation factor Sua5                          59.3    4e-07   
ref|WP_001132592.1|  translation factor Sua5                          59.3    4e-07   
ref|WP_032473843.1|  translation factor Sua5                          59.3    4e-07   
ref|WP_001132586.1|  MULTISPECIES: translation factor Sua5            59.3    4e-07   
ref|WP_001132587.1|  translation factor Sua5                          59.3    4e-07   
ref|WP_001132589.1|  translation factor Sua5                          59.3    4e-07   
ref|WP_001132585.1|  translation factor Sua5                          59.3    4e-07   
ref|WP_001132583.1|  translation factor Sua5                          59.3    4e-07   
ref|WP_034745605.1|  translation factor Sua5                          57.8    4e-07   
ref|WP_036301553.1|  translation factor Sua5                          59.3    4e-07   
ref|XP_009165184.1|  hypothetical protein T265_02622                  59.3    4e-07   
ref|WP_001132590.1|  Sua5 YciO YrdC YwlC family protein               59.3    4e-07   
ref|WP_001132579.1|  Sua5 YciO YrdC YwlC family protein               59.3    4e-07   
ref|WP_001132575.1|  translation factor Sua5                          59.3    4e-07   
ref|XP_009469267.1|  PREDICTED: yrdC domain-containing protein, m...  57.8    4e-07   
ref|WP_036073202.1|  tRNA threonylcarbamoyladenosine biosynthesis...  59.3    4e-07   
ref|WP_001132578.1|  MULTISPECIES: translation factor Sua5            59.3    4e-07   
ref|WP_005527840.1|  hypothetical protein                             59.3    4e-07   
ref|WP_044190428.1|  translation factor Sua5                          57.8    4e-07   
ref|WP_001132576.1|  Sua5 YciO YrdC YwlC family protein               59.3    4e-07   
ref|WP_022577802.1|  translation factor Sua5                          59.3    4e-07   
ref|WP_035547691.1|  tRNA threonylcarbamoyladenosine biosynthesis...  58.5    4e-07   
ref|WP_044232179.1|  translation factor Sua5                          57.8    4e-07   
ref|WP_001132577.1|  Sua5 YciO YrdC YwlC family protein               59.3    4e-07   
gb|ETX01467.1|  hypothetical protein ETSY1_07235                      58.2    4e-07   
ref|WP_010021941.1|  translation factor Sua5                          59.3    4e-07   
gb|EGU20292.1|  hypothetical protein SX4_1891                         58.5    4e-07   
ref|WP_007261839.1|  translation factor Sua5                          59.3    4e-07   
ref|WP_040998545.1|  translation factor Sua5                          57.4    4e-07   
ref|WP_034852185.1|  translation factor Sua5                          59.3    4e-07   
gb|KDO12952.1|  translation factor Sua5                               59.3    4e-07   
ref|WP_034445682.1|  hypothetical protein                             58.9    4e-07   
ref|WP_022144839.1|  hypothetical protein                             56.6    4e-07   
ref|WP_001132580.1|  Sua5 YciO YrdC YwlC family protein               58.9    4e-07   
gb|ELR58170.1|  YrdC domain-containing protein, mitochondrial         57.4    5e-07   
ref|WP_033507740.1|  translation factor Sua5                          58.2    5e-07   
ref|XP_008180220.1|  PREDICTED: yrdC domain-containing protein, m...  58.5    5e-07   
ref|WP_042491959.1|  translation factor Sua5                          58.9    5e-07   
ref|WP_016197082.1|  TsaC protein                                     57.4    5e-07   
ref|WP_018238990.1|  translation factor Sua5                          58.9    5e-07   
ref|WP_042490448.1|  translation factor Sua5                          58.9    5e-07   
gb|KDR14324.1|  YrdC domain-containing protein, mitochondrial         58.2    5e-07   
ref|WP_005045418.1|  Sua5/YciO/YrdC/YwlC family protein               57.4    5e-07   
ref|XP_003388048.1|  PREDICTED: yrdC domain-containing protein, m...  58.2    5e-07   
ref|WP_006009804.1|  hypothetical protein                             57.4    5e-07   
ref|WP_026168261.1|  translation factor Sua5                          58.9    5e-07   
ref|WP_034799145.1|  translation factor Sua5                          58.9    5e-07   
ref|WP_035062362.1|  hypothetical protein                             57.4    5e-07   
emb|CDI04960.1|  conserved hypothetical protein                       58.9    5e-07   
gb|KCZ51356.1|  hypothetical protein HY29_05685                       58.9    5e-07   
ref|WP_015597437.1|  translation factor Sua5                          58.9    6e-07   
ref|WP_028904145.1|  MULTISPECIES: translation factor Sua5            57.4    6e-07   
ref|WP_035023345.1|  MULTISPECIES: translation factor Sua5            58.9    6e-07   
ref|WP_034825664.1|  translation factor Sua5                          58.5    6e-07   
ref|WP_045463137.1|  translation factor Sua5                          57.0    6e-07   
ref|WP_028907423.1|  translation factor Sua5                          57.4    6e-07   
ref|WP_008322724.1|  DNA binding protein, translation factor          57.4    6e-07   
ref|WP_026159525.1|  hypothetical protein                             58.5    6e-07   
ref|WP_008595414.1|  translation factor Sua5                          58.5    6e-07   
dbj|GAO39031.1|  hypothetical protein SCH01S_25_00110                 58.5    6e-07   
ref|WP_029258084.1|  translation factor Sua5                          58.9    6e-07   
ref|WP_025403059.1|  hypothetical protein                             57.8    6e-07   
ref|WP_029521376.1|  translation factor Sua5                          57.4    6e-07   
ref|WP_002833676.1|  translation factor Sua5                          58.5    6e-07   
ref|WP_021857232.1|  dephospho-CoA kinase                             58.9    6e-07   
ref|WP_037413337.1|  translation factor Sua5                          58.5    6e-07   
ref|WP_008579724.1|  Sua5/YciO/YrdC/YwlC family protein               57.4    6e-07   
ref|WP_024926659.1|  MULTISPECIES: translation factor Sua5            58.5    6e-07   
ref|WP_034448680.1|  hypothetical protein                             58.9    7e-07   
ref|WP_022692857.1|  translation factor Sua5                          57.0    7e-07   
ref|WP_023394200.1|  Sua5/YciO/YrdC/YwlC family protein               57.4    7e-07   
ref|WP_011450878.1|  hypothetical protein                             57.4    7e-07   
ref|WP_013269974.1|  translation factor Sua5                          58.5    7e-07   
ref|WP_036913252.1|  translation factor Sua5                          57.0    7e-07   
ref|WP_010620640.1|  translation factor Sua5                          58.5    7e-07   
ref|WP_008576894.1|  MULTISPECIES: Sua5/YciO/YrdC/YwlC family pro...  57.4    7e-07   
ref|WP_037279267.1|  hypothetical protein                             58.5    7e-07   
ref|WP_007344931.1|  Sua5/YciO/YrdC/YwlC family protein               57.4    7e-07   
ref|WP_028910710.1|  translation factor Sua5                          57.0    7e-07   
ref|WP_034730528.1|  translation factor Sua5                          56.6    7e-07   
gb|AEJ00763.1|  Sua5/YciO/YrdC/YwlC family protein                    58.5    7e-07   
gb|EKG92473.1|  SUA5 domain protein                                   57.0    7e-07   
ref|WP_007994741.1|  Sua5/YciO/YrdC/YwlC family protein               57.4    7e-07   
ref|WP_011416634.1|  sua5/yciO/yrdC/ywlC family protein               57.4    8e-07   
ref|WP_018182605.1|  hypothetical protein                             58.5    8e-07   
ref|WP_011114272.1|  hypothetical protein                             57.0    8e-07   
ref|WP_028912670.1|  translation factor Sua5                          57.0    8e-07   
ref|XP_001605728.2|  PREDICTED: yrdC domain-containing protein, m...  58.2    8e-07   
dbj|GAA56369.1|  YrdC domain-containing protein mitochondrial         58.5    8e-07   
ref|WP_004065452.1|  Sua5/YciO/YrdC/YwlC family protein               57.0    8e-07   
ref|WP_004973721.1|  Sua5/YciO/YrdC/YwlC family protein               57.0    8e-07   
ref|WP_006829245.1|  tRNA threonylcarbamoyladenosine biosynthesis...  58.5    8e-07   
ref|WP_013035374.1|  Sua5/YciO/YrdC/YwlC family protein               57.0    8e-07   
ref|WP_010267410.1|  MULTISPECIES: hypothetical protein               57.0    8e-07   
ref|WP_022454331.1|  translation factor sua5                          57.0    8e-07   
ref|WP_010263995.1|  hypothetical protein                             57.0    8e-07   
gb|EKY31937.1|  Sua5 YciO YrdC YwlC family protein                    58.2    8e-07   
ref|WP_027374514.1|  MULTISPECIES: translation factor Sua5            56.6    8e-07   
ref|WP_006330392.1|  hypothetical protein                             58.2    8e-07   
ref|WP_008005141.1|  Sua5/YciO/YrdC/YwlC family protein               57.0    8e-07   
ref|WP_006600763.1|  Sua5/YciO/YrdC/YwlC family protein               57.0    9e-07   
ref|WP_018328848.1|  translation factor Sua5                          58.2    9e-07   
ref|WP_004045369.1|  Sua5/YciO/YrdC/YwlC family protein               57.0    9e-07   
ref|WP_045889711.1|  hypothetical protein                             57.0    9e-07   
ref|XP_005395277.1|  PREDICTED: yrdC domain-containing protein, m...  57.8    9e-07   
ref|WP_026612950.1|  translation factor Sua5                          58.2    9e-07   
ref|WP_042664033.1|  DNA-binding protein                              57.0    9e-07   
ref|WP_046118460.1|  translation factor Sua5                          58.2    9e-07   
ref|WP_012965368.1|  tRNA threonylcarbamoyladenosine biosynthesis...  58.2    9e-07   
ref|WP_040591973.1|  translation factor Sua5                          58.2    9e-07   
ref|WP_008606068.1|  Sua5/YciO/YrdC/YwlC family protein               57.0    9e-07   
ref|WP_045089003.1|  translation factor Sua5                          56.6    1e-06   
ref|WP_008432986.1|  tRNA threonylcarbamoyladenosine biosynthesis...  58.2    1e-06   
ref|WP_028754342.1|  translation factor Sua5                          58.2    1e-06   
ref|WP_026618491.1|  translation factor Sua5                          58.2    1e-06   
ref|WP_042665155.1|  tRNA threonylcarbamoyladenosine biosynthesis...  58.2    1e-06   
ref|WP_023440601.1|  translation factor Sua5                          58.2    1e-06   
ref|WP_007196460.1|  translation factor Sua5                          58.2    1e-06   
ref|WP_031573315.1|  tRNA threonylcarbamoyladenosine biosynthesis...  58.2    1e-06   
ref|WP_034576262.1|  hypothetical protein                             57.4    1e-06   
ref|WP_043940629.1|  translation factor Sua5                          58.2    1e-06   
ref|WP_018674467.1|  hypothetical protein                             56.2    1e-06   
ref|WP_013174057.1|  tRNA threonylcarbamoyladenosine biosynthesis...  58.2    1e-06   
ref|WP_044388024.1|  translation factor Sua5                          58.2    1e-06   
ref|WP_018426776.1|  translation factor Sua5                          57.8    1e-06   
ref|WP_035535972.1|  translation factor Sua5                          57.8    1e-06   
ref|WP_027698178.1|  translation factor Sua5                          57.8    1e-06   
ref|WP_008419077.1|  Sua5/YciO/YrdC/YwlC family protein               56.2    1e-06   
gb|KDA03944.1|  Sua5/YciO/YrdC/YwlC family protein                    57.8    1e-06   
ref|WP_036734648.1|  translation factor                               55.1    1e-06   
ref|WP_002977438.1|  translation factor Sua5                          56.2    1e-06   
ref|WP_007550288.1|  tRNA threonylcarbamoyladenosine biosynthesis...  57.8    1e-06   
ref|WP_039367113.1|  translation factor Sua5                          56.2    1e-06   
ref|WP_043706999.1|  translation factor Sua5                          56.2    1e-06   
ref|WP_043708021.1|  translation factor Sua5                          57.8    1e-06   
ref|WP_026392840.1|  hypothetical protein                             56.6    1e-06   
ref|WP_041360545.1|  translation factor Sua5                          57.8    1e-06   
gb|ADU42869.1|  Sua5/YciO/YrdC/YwlC family protein                    57.8    1e-06   
ref|WP_017261027.1|  hypothetical protein                             57.8    1e-06   
gb|AEA78195.1|  Sua5 YciO YrdC YwlC family protein                    57.8    1e-06   
gb|EET91967.1|  YrdC family protein                                   57.8    1e-06   
emb|CCV03596.1|  conserved hypothetical protein                       57.8    1e-06   
ref|WP_021799665.1|  Sua5/YciO/YrdC/YwlC family protein               56.6    1e-06   
ref|WP_013635583.1|  translation factor Sua5                          57.8    1e-06   
ref|WP_044184569.1|  translation factor Sua5                          56.6    1e-06   
ref|WP_027433541.1|  MULTISPECIES: tRNA threonylcarbamoyladenosin...  57.8    1e-06   



>ref|XP_009592140.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Nicotiana 
tomentosiformis]
Length=281

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 80/107 (75%), Gaps = 7/107 (7%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDLRVE------TNRMGMVQPATEDYAEAAIEAIK  515
            +   GF+ L  R+RR    VSVK KM   +E        ++  V PATEDYAE AIE+IK
Sbjct  26   VENIGFLNLWARRRRGFSAVSVK-KMAWSLEKGEGNVETKVVSVSPATEDYAEEAIESIK  84

Query  516  SGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            +G VIAVPTDTLYGFAC+ACSAEAVNRIY+IKGRK+T+PLAICVGDV
Sbjct  85   AGKVIAVPTDTLYGFACNACSAEAVNRIYEIKGRKHTSPLAICVGDV  131



>ref|XP_010651157.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Vitis vinifera]
Length=270

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 83/101 (82%), Gaps = 3/101 (3%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIA  533
            + KFGFV++ ++ RR    VS   KM+  V  + +G+V+PAT+ +AE AIEAIK+G VIA
Sbjct  23   VAKFGFVQILKQNRR--FRVSFPKKME-AVMGSELGVVRPATDAHAEEAIEAIKAGKVIA  79

Query  534  VPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            VPTDTLYGFACDACS+EAVNRIY+IKGRK+T+PLAICVGDV
Sbjct  80   VPTDTLYGFACDACSSEAVNRIYEIKGRKHTSPLAICVGDV  120



>ref|XP_002285123.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X1 [Vitis vinifera]
 emb|CBI16307.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 83/101 (82%), Gaps = 3/101 (3%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIA  533
            + KFGFV++ ++ RR    VS   KM+  V  + +G+V+PAT+ +AE AIEAIK+G VIA
Sbjct  25   VAKFGFVQILKQNRR--FRVSFPKKME-AVMGSELGVVRPATDAHAEEAIEAIKAGKVIA  81

Query  534  VPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            VPTDTLYGFACDACS+EAVNRIY+IKGRK+T+PLAICVGDV
Sbjct  82   VPTDTLYGFACDACSSEAVNRIYEIKGRKHTSPLAICVGDV  122



>ref|XP_004251129.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X1 [Solanum lycopersicum]
Length=281

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 78/107 (73%), Gaps = 7/107 (7%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDLRVET------NRMGMVQPATEDYAEAAIEAIK  515
            + K GF+ L  R R+ L  VSVK KM   +E        +   V PA EDY + AIEAI+
Sbjct  26   VEKIGFLNLWARSRKGLSAVSVK-KMGWSLENPDGDVETKKATVSPAAEDYGQEAIEAIR  84

Query  516  SGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            +G VIAVPTDTLYGFACDACSAEAVNRIY+IKGRK+T+PLAICVGDV
Sbjct  85   AGKVIAVPTDTLYGFACDACSAEAVNRIYEIKGRKHTSPLAICVGDV  131



>ref|XP_009798165.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X1 [Nicotiana sylvestris]
Length=280

 Score =   130 bits (327),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 81/107 (76%), Gaps = 10/107 (9%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDLRVETN------RMGMVQPATEDYAEAAIEAIK  515
            + K GF+ L  R RR   G SVK KM   +E +      ++  V PATEDYA+ AIEAIK
Sbjct  28   VEKIGFLNLWTRSRR---GFSVK-KMAWSLEKSDGNVDTKVVSVSPATEDYAKEAIEAIK  83

Query  516  SGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            +G VIAVPTDTLYGFACDACSAEAVNRIY+IKGRK+T+PLAICVGD+
Sbjct  84   AGKVIAVPTDTLYGFACDACSAEAVNRIYEIKGRKHTSPLAICVGDI  130



>ref|XP_009798166.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Nicotiana sylvestris]
Length=278

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 81/107 (76%), Gaps = 10/107 (9%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDLRVETN------RMGMVQPATEDYAEAAIEAIK  515
            + K GF+ L  R RR   G SVK KM   +E +      ++  V PATEDYA+ AIEAIK
Sbjct  26   VEKIGFLNLWTRSRR---GFSVK-KMAWSLEKSDGNVDTKVVSVSPATEDYAKEAIEAIK  81

Query  516  SGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            +G VIAVPTDTLYGFACDACSAEAVNRIY+IKGRK+T+PLAICVGD+
Sbjct  82   AGKVIAVPTDTLYGFACDACSAEAVNRIYEIKGRKHTSPLAICVGDI  128



>ref|XP_006340159.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X1 [Solanum tuberosum]
Length=280

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 77/107 (72%), Gaps = 7/107 (7%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDLRVET------NRMGMVQPATEDYAEAAIEAIK  515
            + K GF+ L  R R+    VSVK KM   +E        +   V PA EDY + AIEAI+
Sbjct  25   VEKIGFLNLWARSRKGFSAVSVK-KMGWSLENPDGDVETKKATVSPAAEDYGQEAIEAIR  83

Query  516  SGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            +G VIAVPTDTLYGFACDACSAEAVNRIY+IKGRK+T+PLAICVGDV
Sbjct  84   AGKVIAVPTDTLYGFACDACSAEAVNRIYEIKGRKHTSPLAICVGDV  130



>emb|CAN77236.1| hypothetical protein VITISV_024209 [Vitis vinifera]
Length=750

 Score =   133 bits (335),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 66/101 (65%), Positives = 83/101 (82%), Gaps = 3/101 (3%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIA  533
            + KFGFV++ ++ RR    VS   KM+  V  + +G+V+PAT+ +AE AIEAIK+G VIA
Sbjct  578  VAKFGFVQILKQNRR--FRVSFPKKME-AVMGSELGVVRPATDAHAEEAIEAIKAGKVIA  634

Query  534  VPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            VPTDTLYGFACDACS+EAVNRIY+IKGRK+T+PLAICVGDV
Sbjct  635  VPTDTLYGFACDACSSEAVNRIYEIKGRKHTSPLAICVGDV  675



>gb|EYU18837.1| hypothetical protein MIMGU_mgv1a011291mg [Erythranthe guttata]
Length=286

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 80/108 (74%), Gaps = 8/108 (7%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVK------TKMD-LRVETNRMGMVQPATEDYAEAAIEAI  512
            + K  FVK+ Q  RR + G S K       K D   VE+  MG V PATEDYA+ AI+A+
Sbjct  30   VQKLQFVKILQ-SRREIGGTSAKRMAWSLEKCDGQSVESATMGAVHPATEDYADEAIKAL  88

Query  513  KSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            ++G VIAVPTDTLYGFACDACS EAV+RIY+IKGRKYT+PLAICVGDV
Sbjct  89   RAGQVIAVPTDTLYGFACDACSMEAVHRIYEIKGRKYTSPLAICVGDV  136



>emb|CDP07118.1| unnamed protein product [Coffea canephora]
Length=232

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 70/77 (91%), Gaps = 1/77 (1%)
 Frame = +3

Query  426  KMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYD  605
            K D  VE+ +MG+V+PATEDYA+ A+EAIK+G VIAVPTDTLYGFACDACS EAVNRIY+
Sbjct  7    KCDGNVES-KMGLVRPATEDYAQEAVEAIKAGKVIAVPTDTLYGFACDACSVEAVNRIYE  65

Query  606  IKGRKYTNPLAICVGDV  656
            IKGRKYT+PLAICVG+V
Sbjct  66   IKGRKYTSPLAICVGNV  82



>ref|XP_002313460.2| hypothetical protein POPTR_0009s03050g [Populus trichocarpa]
 gb|EEE87415.2| hypothetical protein POPTR_0009s03050g [Populus trichocarpa]
Length=284

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 78/107 (73%), Gaps = 8/107 (7%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDLRVET------NRMGMVQPATEDYAEAAIEAIK  515
            + K GFV     KR   +G+    KM   +E       N++ +V+PATE YA+ AIEA+K
Sbjct  30   VPKLGFVPFLTHKRH--LGLGFSKKMSSSMENCHVDVQNKLEVVRPATEVYAQEAIEALK  87

Query  516  SGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            +G VIAVPTDTLYGFACDACS EAVNRIY++KGRK+T+PLAICVGDV
Sbjct  88   AGKVIAVPTDTLYGFACDACSLEAVNRIYEMKGRKHTSPLAICVGDV  134



>ref|XP_010483709.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X2 [Camelina sativa]
Length=176

 Score =   122 bits (307),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 72/105 (69%), Gaps = 4/105 (4%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDL-RVET---NRMGMVQPATEDYAEAAIEAIKSG  521
            + +  F  +    RR   G+  K    L R ET   N   +V PATE YA+ AIEAIKS 
Sbjct  27   VSELRFFSIANHSRRLRWGLQKKMVWSLERAETCVVNNSCLVHPATEAYAQKAIEAIKSE  86

Query  522  NVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             VIAVPTDTLYGFACDACS EAVNRIY+IKGRK T+PLAICVGDV
Sbjct  87   KVIAVPTDTLYGFACDACSLEAVNRIYEIKGRKLTSPLAICVGDV  131



>ref|XP_007016722.1| DHBP synthase RibB-like alpha/beta domain isoform 2, partial 
[Theobroma cacao]
 gb|EOY34341.1| DHBP synthase RibB-like alpha/beta domain isoform 2, partial 
[Theobroma cacao]
Length=277

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 81/105 (77%), Gaps = 4/105 (4%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDL-RVET---NRMGMVQPATEDYAEAAIEAIKSG  521
            + K GFV   Q+KRR   G S K   ++ R E    +++G+V PAT+ YA+ A+ A+K+G
Sbjct  23   VPKLGFVPFLQQKRRFRGGFSKKMGSNVERCEVGVESKLGLVHPATKFYADEAVIALKAG  82

Query  522  NVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             VIAVPTDTLYGFACDACS+EAVN+IY+IKGRK+T+PLAICVGDV
Sbjct  83   KVIAVPTDTLYGFACDACSSEAVNKIYEIKGRKHTSPLAICVGDV  127



>gb|KDO73244.1| hypothetical protein CISIN_1g024072mg [Citrus sinensis]
Length=273

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 75/107 (70%), Gaps = 12/107 (11%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDLRVET------NRMGMVQPATEDYAEAAIEAIK  515
            + K  FV      RR         KM   +E       N+ G+V+PATE +AE AI+A+K
Sbjct  23   VPKLWFVSFLHLNRR------FPKKMAFSLENGQVSVENKAGLVRPATEAHAEEAIQALK  76

Query  516  SGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            +G VIAVPTDTLYGFACDACS+EAVNRIY+IKGRK+T+PLAICVGDV
Sbjct  77   TGKVIAVPTDTLYGFACDACSSEAVNRIYEIKGRKHTSPLAICVGDV  123



>ref|XP_007016721.1| DHBP synthase RibB-like alpha/beta domain isoform 1 [Theobroma 
cacao]
 gb|EOY34340.1| DHBP synthase RibB-like alpha/beta domain isoform 1 [Theobroma 
cacao]
Length=327

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 80/107 (75%), Gaps = 8/107 (7%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDLRVE------TNRMGMVQPATEDYAEAAIEAIK  515
            + K GFV   Q+KRR   G S   KM   VE       +++G+V PAT+ YA+ A+ A+K
Sbjct  73   VPKLGFVPFLQQKRRFRGGFS--KKMGSNVERCEVGVESKLGLVHPATKFYADEAVIALK  130

Query  516  SGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            +G VIAVPTDTLYGFACDACS+EAVN+IY+IKGRK+T+PLAICVGDV
Sbjct  131  AGKVIAVPTDTLYGFACDACSSEAVNKIYEIKGRKHTSPLAICVGDV  177



>ref|XP_010443861.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X2 [Camelina sativa]
Length=176

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 72/105 (69%), Gaps = 4/105 (4%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDL-RVET---NRMGMVQPATEDYAEAAIEAIKSG  521
            + +  F  +    RR   G+  K    L R ET   +   +V PATE YA+ AIEAIKS 
Sbjct  27   VSELRFFSIANHSRRLRWGLQKKMVWSLERAETCVVSNSCLVHPATEAYAQEAIEAIKSE  86

Query  522  NVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             VIAVPTDTLYGFACDACS EAVNRIY+IKGRK T+PLAICVGDV
Sbjct  87   KVIAVPTDTLYGFACDACSLEAVNRIYEIKGRKLTSPLAICVGDV  131



>gb|KDO73245.1| hypothetical protein CISIN_1g024072mg [Citrus sinensis]
Length=232

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +3

Query  450  NRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTN  629
            N+ G+V+PATE +AE AI+A+K+G VIAVPTDTLYGFACDACS+EAVNRIY+IKGRK+T+
Sbjct  14   NKAGLVRPATEAHAEEAIQALKTGKVIAVPTDTLYGFACDACSSEAVNRIYEIKGRKHTS  73

Query  630  PLAICVGDV  656
            PLAICVGDV
Sbjct  74   PLAICVGDV  82



>ref|XP_010456585.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Camelina sativa]
Length=165

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 72/105 (69%), Gaps = 4/105 (4%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDL-RVET---NRMGMVQPATEDYAEAAIEAIKSG  521
            + +  F  +    RR   G+  K    L R ET   N   +V PATE YA+ AIEAIKS 
Sbjct  27   VSELRFFSIANHSRRLGWGLQKKMVWSLDRAETCVVNNSCLVHPATEAYAQEAIEAIKSE  86

Query  522  NVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             VIAVPTDTLYGFACDACS +AVNRIY+IKGRK T+PLAICVGDV
Sbjct  87   KVIAVPTDTLYGFACDACSLDAVNRIYEIKGRKLTSPLAICVGDV  131



>ref|XP_006488109.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X2 [Citrus sinensis]
 ref|XP_006488110.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X3 [Citrus sinensis]
Length=232

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +3

Query  450  NRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTN  629
            N+ G+V+PATE +AE AI+A+K+G VIAVPTDTLYGFACDACS+EAVNRIY+IKGRK+T+
Sbjct  14   NKAGLVRPATEAHAEEAIQALKTGKVIAVPTDTLYGFACDACSSEAVNRIYEIKGRKHTS  73

Query  630  PLAICVGDV  656
            PLAICVGDV
Sbjct  74   PLAICVGDV  82



>gb|KDP44061.1| hypothetical protein JCGZ_05528 [Jatropha curcas]
Length=277

 Score =   122 bits (306),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 72/95 (76%), Gaps = 6/95 (6%)
 Frame = +3

Query  390  KRRSLVGVSVKTKMDLRVET------NRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTL  551
            KR+  +G     KM   +E       N++G V+PAT+ YAE A+EA+K+GNVIAVPTDTL
Sbjct  33   KRKKKLGFGFPRKMAWSLEKCDMDVKNKLGAVRPATKLYAEEAVEALKAGNVIAVPTDTL  92

Query  552  YGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            YGFACDACS  AVNRIY IKGRK+T+PLAICVGDV
Sbjct  93   YGFACDACSLHAVNRIYKIKGRKHTSPLAICVGDV  127



>ref|XP_012064831.1| PREDICTED: LOW QUALITY PROTEIN: yrdC domain-containing protein, 
mitochondrial [Jatropha curcas]
Length=284

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 72/95 (76%), Gaps = 6/95 (6%)
 Frame = +3

Query  390  KRRSLVGVSVKTKMDLRVET------NRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTL  551
            KR+  +G     KM   +E       N++G V+PAT+ YAE A+EA+K+GNVIAVPTDTL
Sbjct  40   KRKKKLGFGFPRKMAWSLEKCDMDVKNKLGAVRPATKLYAEEAVEALKAGNVIAVPTDTL  99

Query  552  YGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            YGFACDACS  AVNRIY IKGRK+T+PLAICVGDV
Sbjct  100  YGFACDACSLHAVNRIYKIKGRKHTSPLAICVGDV  134



>ref|XP_006488108.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X1 [Citrus sinensis]
Length=273

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +3

Query  450  NRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTN  629
            N+ G+V+PATE +AE AI+A+K+G VIAVPTDTLYGFACDACS+EAVNRIY+IKGRK+T+
Sbjct  55   NKAGLVRPATEAHAEEAIQALKTGKVIAVPTDTLYGFACDACSSEAVNRIYEIKGRKHTS  114

Query  630  PLAICVGDV  656
            PLAICVGDV
Sbjct  115  PLAICVGDV  123



>ref|XP_006424587.1| hypothetical protein CICLE_v10029204mg [Citrus clementina]
 gb|ESR37827.1| hypothetical protein CICLE_v10029204mg [Citrus clementina]
Length=232

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +3

Query  450  NRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTN  629
            N+ G+V+PATE +AE AI+A+K+G VIAVPTDTLYGFACDACS EAVNRIY+IKGRK+T+
Sbjct  14   NKAGLVRPATEAHAEEAIQALKTGKVIAVPTDTLYGFACDACSLEAVNRIYEIKGRKHTS  73

Query  630  PLAICVGDV  656
            PLAICVGDV
Sbjct  74   PLAICVGDV  82



>ref|XP_011089896.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Sesamum indicum]
Length=234

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  441  VETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRK  620
            VE  ++G+V+PAT +YAE AIEA+++G VIAVPTDTLYGFACDACS EAV+RIY+IKGRK
Sbjct  13   VENPKLGLVRPATNEYAEEAIEAVRAGQVIAVPTDTLYGFACDACSIEAVHRIYEIKGRK  72

Query  621  YTNPLAICVGDV  656
            YT+PLAICV DV
Sbjct  73   YTSPLAICVADV  84



>ref|XP_010483708.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X1 [Camelina sativa]
Length=282

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 72/105 (69%), Gaps = 4/105 (4%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDL-RVET---NRMGMVQPATEDYAEAAIEAIKSG  521
            + +  F  +    RR   G+  K    L R ET   N   +V PATE YA+ AIEAIKS 
Sbjct  27   VSELRFFSIANHSRRLRWGLQKKMVWSLERAETCVVNNSCLVHPATEAYAQKAIEAIKSE  86

Query  522  NVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             VIAVPTDTLYGFACDACS EAVNRIY+IKGRK T+PLAICVGDV
Sbjct  87   KVIAVPTDTLYGFACDACSLEAVNRIYEIKGRKLTSPLAICVGDV  131



>ref|XP_009798167.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X3 [Nicotiana sylvestris]
 ref|XP_009798168.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X3 [Nicotiana sylvestris]
 ref|XP_009798169.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X3 [Nicotiana sylvestris]
Length=232

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = +3

Query  426  KMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYD  605
            K D  V+T ++  V PATEDYA+ AIEAIK+G VIAVPTDTLYGFACDACSAEAVNRIY+
Sbjct  7    KSDGNVDT-KVVSVSPATEDYAKEAIEAIKAGKVIAVPTDTLYGFACDACSAEAVNRIYE  65

Query  606  IKGRKYTNPLAICVGDV  656
            IKGRK+T+PLAICVGD+
Sbjct  66   IKGRKHTSPLAICVGDI  82



>ref|XP_002879291.1| hypothetical protein ARALYDRAFT_482017 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55550.1| hypothetical protein ARALYDRAFT_482017 [Arabidopsis lyrata subsp. 
lyrata]
Length=263

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 72/105 (69%), Gaps = 4/105 (4%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDL-RVET---NRMGMVQPATEDYAEAAIEAIKSG  521
            + +  F  +    RR   G+  K    L R ET   +   +V PATE YA+ AIEAIKS 
Sbjct  27   VSELRFFSIANHSRRLRWGLQKKMVWSLERAETCVVSNSCLVHPATEAYAQEAIEAIKSD  86

Query  522  NVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             VIAVPTDTLYGFACDACS EAVNRIY+IKGRK T+PLAICVGDV
Sbjct  87   KVIAVPTDTLYGFACDACSLEAVNRIYEIKGRKLTSPLAICVGDV  131



>ref|XP_009120593.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Brassica rapa]
Length=178

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 71/107 (66%), Gaps = 4/107 (4%)
 Frame = +3

Query  348  GVIGKFGFVKLGQRKRRSLVGVSVKTKMDL-RVE---TNRMGMVQPATEDYAEAAIEAIK  515
             +I +  F       RR  +G+       L R E      + +V PATE YA+ AIEAIK
Sbjct  27   AIIPELRFFATASHSRRLRLGLQKNKVWSLQRAELCVVTSLCIVHPATEAYAQEAIEAIK  86

Query  516  SGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            S  VIAVPTDTLYGFACDACS EAVNRIY+IKGRK T+PLAICVGDV
Sbjct  87   SEKVIAVPTDTLYGFACDACSLEAVNRIYEIKGRKLTSPLAICVGDV  133



>ref|XP_011089895.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X1 [Sesamum indicum]
Length=285

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  441  VETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRK  620
            VE  ++G+V+PAT +YAE AIEA+++G VIAVPTDTLYGFACDACS EAV+RIY+IKGRK
Sbjct  64   VENPKLGLVRPATNEYAEEAIEAVRAGQVIAVPTDTLYGFACDACSIEAVHRIYEIKGRK  123

Query  621  YTNPLAICVGDV  656
            YT+PLAICV DV
Sbjct  124  YTSPLAICVADV  135



>ref|XP_002530287.1| Protein SUA5, putative [Ricinus communis]
 gb|EEF32094.1| Protein SUA5, putative [Ricinus communis]
Length=233

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +3

Query  450  NRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTN  629
            +++G+V+PATE YAE A+EA+K+G VIAVPTDTLYGFACDACS EAVNRIY+IKGRK+T+
Sbjct  15   DKLGVVRPATELYAEEAVEALKAGKVIAVPTDTLYGFACDACSLEAVNRIYEIKGRKHTS  74

Query  630  PLAICVGDV  656
            PLAIC+GDV
Sbjct  75   PLAICIGDV  83



>ref|XP_010043742.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Eucalyptus 
grandis]
 gb|KCW85732.1| hypothetical protein EUGRSUZ_B02494 [Eucalyptus grandis]
Length=271

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 80/103 (78%), Gaps = 8/103 (8%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDLRVE--TNRMGMVQPATEDYAEAAIEAIKSGNV  527
            + + GFV++ ++ RR      +++KM   ++    ++ +V+ ATE +A  A+EA+KSG V
Sbjct  25   VPRNGFVRIPEQSRR------LESKMARSLDKCEGKLDVVREATEPHAPEAVEALKSGKV  78

Query  528  IAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            IAVPTDTLYGFACDACSAEAVNRIY+IKGRK+T+PLAICVGDV
Sbjct  79   IAVPTDTLYGFACDACSAEAVNRIYEIKGRKHTSPLAICVGDV  121



>ref|XP_010443860.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X1 [Camelina sativa]
Length=283

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 72/105 (69%), Gaps = 4/105 (4%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDL-RVET---NRMGMVQPATEDYAEAAIEAIKSG  521
            + +  F  +    RR   G+  K    L R ET   +   +V PATE YA+ AIEAIKS 
Sbjct  27   VSELRFFSIANHSRRLRWGLQKKMVWSLERAETCVVSNSCLVHPATEAYAQEAIEAIKSE  86

Query  522  NVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             VIAVPTDTLYGFACDACS EAVNRIY+IKGRK T+PLAICVGDV
Sbjct  87   KVIAVPTDTLYGFACDACSLEAVNRIYEIKGRKLTSPLAICVGDV  131



>ref|NP_568924.1| DHBP synthase RibB-like alpha/beta domain-containing protein 
[Arabidopsis thaliana]
 gb|AAK55670.1|AF378867_1 AT5g60590/muf9_240 [Arabidopsis thaliana]
 gb|AAK91479.1| AT5g60590/muf9_240 [Arabidopsis thaliana]
 gb|AED97351.1| DHBP synthase RibB-like alpha/beta domain-containing protein 
[Arabidopsis thaliana]
Length=164

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 73/105 (70%), Gaps = 4/105 (4%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDL-RVET---NRMGMVQPATEDYAEAAIEAIKSG  521
            + +     +  + RR   G+  K    L R ET   ++  +V PATE YA+ AIEAIKS 
Sbjct  27   VSELRCFSIANQSRRLRWGLQKKMVWSLERAETCVVSKSCLVHPATEAYAQEAIEAIKSE  86

Query  522  NVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             VIAVPTDTLYGFACDACS EAV+RIY+IKGRK T+PLAICVGDV
Sbjct  87   KVIAVPTDTLYGFACDACSLEAVSRIYEIKGRKLTSPLAICVGDV  131



>ref|XP_010456581.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X1 [Camelina sativa]
Length=283

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 72/105 (69%), Gaps = 4/105 (4%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDL-RVET---NRMGMVQPATEDYAEAAIEAIKSG  521
            + +  F  +    RR   G+  K    L R ET   N   +V PATE YA+ AIEAIKS 
Sbjct  27   VSELRFFSIANHSRRLGWGLQKKMVWSLDRAETCVVNNSCLVHPATEAYAQEAIEAIKSE  86

Query  522  NVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             VIAVPTDTLYGFACDACS +AVNRIY+IKGRK T+PLAICVGDV
Sbjct  87   KVIAVPTDTLYGFACDACSLDAVNRIYEIKGRKLTSPLAICVGDV  131



>ref|XP_011015423.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X1 [Populus euphratica]
Length=286

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 77/109 (71%), Gaps = 8/109 (7%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVS--VKTKMDLRVET------NRMGMVQPATEDYAEAAIEA  509
            + K GFV     KR   +G+      KM   +E       N++ +V+PATE YA+ AIEA
Sbjct  28   VPKLGFVPFLTHKRHLGLGLGLGFSKKMSSSMENCHVDVQNKLEVVRPATEVYAQEAIEA  87

Query  510  IKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            +K+G VIAVPTDTLYGFACDACS EAVNRIY++KGR +T+PLAICVGDV
Sbjct  88   LKAGKVIAVPTDTLYGFACDACSLEAVNRIYEMKGRNHTSPLAICVGDV  136



>ref|XP_011041969.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X1 [Populus euphratica]
Length=286

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 78/109 (72%), Gaps = 8/109 (7%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSV--KTKMDLRVET------NRMGMVQPATEDYAEAAIEA  509
            + K GFV     KR   +G+ +    KM   +E       N++ +V+PATE YA+ AIEA
Sbjct  28   VPKLGFVPFLTHKRHLGLGLGLGLSKKMSSSMENCHVDVQNKLEVVRPATEVYAQEAIEA  87

Query  510  IKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            +K+G VIAVPTDTLYGFACDACS EAVNRIY++KGR +T+PLAICVGDV
Sbjct  88   LKAGKVIAVPTDTLYGFACDACSLEAVNRIYEMKGRNHTSPLAICVGDV  136



>gb|KJB83809.1| hypothetical protein B456_013G266600 [Gossypium raimondii]
Length=232

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = +3

Query  426  KMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYD  605
            K D+ VE N++ +++ ATE  A+ AIEA+K+G VIAVPTDTLYGFACDACS+EAVNRIYD
Sbjct  7    KYDVGVE-NKLELIRSATESNADEAIEALKAGKVIAVPTDTLYGFACDACSSEAVNRIYD  65

Query  606  IKGRKYTNPLAICVGDV  656
            IKGRK+T+PLAICVGDV
Sbjct  66   IKGRKHTSPLAICVGDV  82



>emb|CDY53638.1| BnaC09g54010D [Brassica napus]
Length=281

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 73/107 (68%), Gaps = 6/107 (6%)
 Frame = +3

Query  351  VIGKFGFVKLGQRKRRSLVG-----VSVKTKMDLRVETNRMGMVQPATEDYAEAAIEAIK  515
            +I +  F       RR  +G     V    + +L V TN   +V PATE YA+ AIEAIK
Sbjct  28   IISELRFFATANHSRRLRLGLQKNKVWSLQRAELSVVTNSC-IVHPATEAYAQEAIEAIK  86

Query  516  SGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            S  VIAVPTDTLYGFACDACS EAVNRIY+IKGRK T+PLAICVGDV
Sbjct  87   SEKVIAVPTDTLYGFACDACSLEAVNRIYEIKGRKLTSPLAICVGDV  133



>ref|XP_008349745.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X2 [Malus domestica]
Length=232

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = +3

Query  426  KMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYD  605
            K D  VET+ +G+V+PATE +AE A+ A+++G VIAVPTDTLYGFACDACS EAVNRIY+
Sbjct  7    KSDAGVETH-LGVVRPATEAHAEEAVGALRAGKVIAVPTDTLYGFACDACSLEAVNRIYE  65

Query  606  IKGRKYTNPLAICVGDV  656
            IKGRK+T+PLAICVGDV
Sbjct  66   IKGRKHTSPLAICVGDV  82



>gb|KJB83810.1| hypothetical protein B456_013G266600 [Gossypium raimondii]
Length=215

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = +3

Query  426  KMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYD  605
            K D+ VE N++ +++ ATE  A+ AIEA+K+G VIAVPTDTLYGFACDACS+EAVNRIYD
Sbjct  7    KYDVGVE-NKLELIRSATESNADEAIEALKAGKVIAVPTDTLYGFACDACSSEAVNRIYD  65

Query  606  IKGRKYTNPLAICVGDV  656
            IKGRK+T+PLAICVGDV
Sbjct  66   IKGRKHTSPLAICVGDV  82



>ref|XP_004251130.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Solanum lycopersicum]
Length=232

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +3

Query  432  DLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIK  611
            D  VET +   V PA EDY + AIEAI++G VIAVPTDTLYGFACDACSAEAVNRIY+IK
Sbjct  9    DGDVETKK-ATVSPAAEDYGQEAIEAIRAGKVIAVPTDTLYGFACDACSAEAVNRIYEIK  67

Query  612  GRKYTNPLAICVGDV  656
            GRK+T+PLAICVGDV
Sbjct  68   GRKHTSPLAICVGDV  82



>ref|XP_006340160.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X2 [Solanum tuberosum]
Length=232

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +3

Query  432  DLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIK  611
            D  VET +   V PA EDY + AIEAI++G VIAVPTDTLYGFACDACSAEAVNRIY+IK
Sbjct  9    DGDVETKK-ATVSPAAEDYGQEAIEAIRAGKVIAVPTDTLYGFACDACSAEAVNRIYEIK  67

Query  612  GRKYTNPLAICVGDV  656
            GRK+T+PLAICVGDV
Sbjct  68   GRKHTSPLAICVGDV  82



>ref|XP_008359161.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X5 [Malus domestica]
 ref|XP_008359167.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X5 [Malus domestica]
 ref|XP_008359172.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X5 [Malus domestica]
Length=245

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = +3

Query  426  KMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYD  605
            K D  VET+ +G+V+PATE +AE A+ A+++G VIAVPTDTLYGFACDACS EAVNRIY+
Sbjct  7    KSDAGVETH-LGVVRPATEAHAEEAVGALRAGEVIAVPTDTLYGFACDACSLEAVNRIYE  65

Query  606  IKGRKYTNPLAICVGDV  656
            IKGRK+T+PLAICVGDV
Sbjct  66   IKGRKHTSPLAICVGDV  82



>ref|XP_006281699.1| hypothetical protein CARUB_v10027848mg [Capsella rubella]
 gb|EOA14597.1| hypothetical protein CARUB_v10027848mg [Capsella rubella]
Length=283

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 71/105 (68%), Gaps = 4/105 (4%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDL-RVET---NRMGMVQPATEDYAEAAIEAIKSG  521
            + +  F  +    RR   G+  K    L R ET   +    V PATE YA+ AIEAIKS 
Sbjct  27   VSELRFFSIANHSRRLRWGLQKKMVWSLERAETCVVSNSCFVHPATEAYAKEAIEAIKSE  86

Query  522  NVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             VIAVPTDTLYGFACDACS EAVNRIY+IKGRK T+PLAICVGDV
Sbjct  87   KVIAVPTDTLYGFACDACSLEAVNRIYEIKGRKLTSPLAICVGDV  131



>ref|XP_008349744.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X1 [Malus domestica]
Length=295

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = +3

Query  426  KMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYD  605
            K D  VET+ +G+V+PATE +AE A+ A+++G VIAVPTDTLYGFACDACS EAVNRIY+
Sbjct  70   KSDAGVETH-LGVVRPATEAHAEEAVGALRAGKVIAVPTDTLYGFACDACSLEAVNRIYE  128

Query  606  IKGRKYTNPLAICVGDV  656
            IKGRK+T+PLAICVGDV
Sbjct  129  IKGRKHTSPLAICVGDV  145



>ref|XP_008359146.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X3 [Malus domestica]
Length=300

 Score =   117 bits (294),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = +3

Query  426  KMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYD  605
            K D  VET+ +G+V+PATE +AE A+ A+++G VIAVPTDTLYGFACDACS EAVNRIY+
Sbjct  62   KSDAGVETH-LGVVRPATEAHAEEAVGALRAGEVIAVPTDTLYGFACDACSLEAVNRIYE  120

Query  606  IKGRKYTNPLAICVGDV  656
            IKGRK+T+PLAICVGDV
Sbjct  121  IKGRKHTSPLAICVGDV  137



>ref|XP_010520366.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X1 [Tarenaya hassleriana]
Length=281

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 74/107 (69%), Gaps = 8/107 (7%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDLRVE------TNRMGMVQPATEDYAEAAIEAIK  515
            + + GF+    +KRR   G  ++ KM    E       ++ G+V PAT  YA+ AIEAIK
Sbjct  27   LPELGFISFVNQKRR--FGWGLQRKMVWNSERADMCVASKTGIVHPATGTYAQEAIEAIK  84

Query  516  SGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            S  V+AVPTDTLYGFACDACS EAVNRIY IKGR+ T+PLAICVGDV
Sbjct  85   SDKVVAVPTDTLYGFACDACSLEAVNRIYAIKGRRLTSPLAICVGDV  131



>ref|XP_008359154.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X4 [Malus domestica]
Length=296

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = +3

Query  426  KMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYD  605
            K D  VET+ +G+V+PATE +AE A+ A+++G VIAVPTDTLYGFACDACS EAVNRIY+
Sbjct  58   KSDAGVETH-LGVVRPATEAHAEEAVGALRAGEVIAVPTDTLYGFACDACSLEAVNRIYE  116

Query  606  IKGRKYTNPLAICVGDV  656
            IKGRK+T+PLAICVGDV
Sbjct  117  IKGRKHTSPLAICVGDV  133



>ref|XP_008359129.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X1 [Malus domestica]
Length=310

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = +3

Query  426  KMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYD  605
            K D  VET+ +G+V+PATE +AE A+ A+++G VIAVPTDTLYGFACDACS EAVNRIY+
Sbjct  72   KSDAGVETH-LGVVRPATEAHAEEAVGALRAGEVIAVPTDTLYGFACDACSLEAVNRIYE  130

Query  606  IKGRKYTNPLAICVGDV  656
            IKGRK+T+PLAICVGDV
Sbjct  131  IKGRKHTSPLAICVGDV  147



>ref|XP_004505988.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
[Cicer arietinum]
Length=293

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  453  RMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNP  632
            ++G+V PAT+ YA  A+EA+K+G VIAVPTDTLYGFACDACS EAVNRIYDIKGRK+T+P
Sbjct  79   KIGVVHPATDAYAAEAVEALKAGKVIAVPTDTLYGFACDACSLEAVNRIYDIKGRKHTSP  138

Query  633  LAICVGDV  656
            LAICVGDV
Sbjct  139  LAICVGDV  146



>ref|XP_008359137.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Malus domestica]
Length=306

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = +3

Query  426  KMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYD  605
            K D  VET+ +G+V+PATE +AE A+ A+++G VIAVPTDTLYGFACDACS EAVNRIY+
Sbjct  68   KSDAGVETH-LGVVRPATEAHAEEAVGALRAGEVIAVPTDTLYGFACDACSLEAVNRIYE  126

Query  606  IKGRKYTNPLAICVGDV  656
            IKGRK+T+PLAICVGDV
Sbjct  127  IKGRKHTSPLAICVGDV  143



>gb|KFK27587.1| hypothetical protein AALP_AA8G403100 [Arabis alpina]
Length=279

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 72/105 (69%), Gaps = 4/105 (4%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDL-RVET---NRMGMVQPATEDYAEAAIEAIKSG  521
            + +  F  +    +R   G+  K    L R ET   +   +V PATE YA+ AIEAIKS 
Sbjct  27   VTELRFYSITNNSKRLRWGLQKKMIWSLQRAETCVVSNSSIVHPATEAYAQEAIEAIKSE  86

Query  522  NVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             VIAVPTDTLYGFACDACS EAVNRIY+IKGRK T+PLAICVGDV
Sbjct  87   KVIAVPTDTLYGFACDACSLEAVNRIYEIKGRKLTSPLAICVGDV  131



>ref|XP_004295027.2| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X1 [Fragaria vesca subsp. vesca]
Length=286

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +3

Query  378  LGQRKRRSLVGVSVKTKMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYG  557
            L  R+ R  +  S++       E  ++G+V+PATE + + A+EA+++G VIAVPTDTLYG
Sbjct  44   LHSRRLRPKMAWSLEKLDAAAFEVTQLGVVRPATEAHVDEAVEALRAGKVIAVPTDTLYG  103

Query  558  FACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            FACDACS EAV+RIY+IKGRK+T+PLAICVGDV
Sbjct  104  FACDACSLEAVHRIYEIKGRKHTSPLAICVGDV  136



>ref|XP_009120592.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X1 [Brassica rapa]
Length=282

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 71/107 (66%), Gaps = 4/107 (4%)
 Frame = +3

Query  348  GVIGKFGFVKLGQRKRRSLVGVSVKTKMDL-RVE---TNRMGMVQPATEDYAEAAIEAIK  515
             +I +  F       RR  +G+       L R E      + +V PATE YA+ AIEAIK
Sbjct  27   AIIPELRFFATASHSRRLRLGLQKNKVWSLQRAELCVVTSLCIVHPATEAYAQEAIEAIK  86

Query  516  SGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            S  VIAVPTDTLYGFACDACS EAVNRIY+IKGRK T+PLAICVGDV
Sbjct  87   SEKVIAVPTDTLYGFACDACSLEAVNRIYEIKGRKLTSPLAICVGDV  133



>ref|XP_011041970.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X2 [Populus euphratica]
 ref|XP_011041971.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X2 [Populus euphratica]
 ref|XP_011041972.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X2 [Populus euphratica]
 ref|XP_011015424.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X2 [Populus euphratica]
 ref|XP_011015425.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X2 [Populus euphratica]
Length=232

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +3

Query  450  NRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTN  629
            N++ +V+PATE YA+ AIEA+K+G VIAVPTDTLYGFACDACS EAVNRIY++KGR +T+
Sbjct  14   NKLEVVRPATEVYAQEAIEALKAGKVIAVPTDTLYGFACDACSLEAVNRIYEMKGRNHTS  73

Query  630  PLAICVGDV  656
            PLAICVGDV
Sbjct  74   PLAICVGDV  82



>ref|XP_009771987.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like, 
partial [Nicotiana sylvestris]
Length=228

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = +3

Query  426  KMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYD  605
            K D  VET ++  V PATED AE AI+AIK+G VI VPTDTLYGFACDACSAEA+NRIY+
Sbjct  3    KSDGNVET-KVVSVSPATEDCAEEAIKAIKAGKVITVPTDTLYGFACDACSAEAMNRIYE  61

Query  606  IKGRKYTNPLAICVGDV  656
            IKGRK+T+PLAICVGDV
Sbjct  62   IKGRKHTSPLAICVGDV  78



>ref|XP_011461709.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Fragaria vesca subsp. vesca]
Length=234

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +3

Query  444  ETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKY  623
            E  ++G+V+PATE + + A+EA+++G VIAVPTDTLYGFACDACS EAV+RIY+IKGRK+
Sbjct  14   EVTQLGVVRPATEAHVDEAVEALRAGKVIAVPTDTLYGFACDACSLEAVHRIYEIKGRKH  73

Query  624  TNPLAICVGDV  656
            T+PLAICVGDV
Sbjct  74   TSPLAICVGDV  84



>ref|XP_002864693.1| hypothetical protein ARALYDRAFT_358267 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40952.1| hypothetical protein ARALYDRAFT_358267 [Arabidopsis lyrata subsp. 
lyrata]
Length=284

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 71/105 (68%), Gaps = 4/105 (4%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMDL-RVET---NRMGMVQPATEDYAEAAIEAIKSG  521
            I +     +    RR   G+  K    L R ET   +   +V PATE YA+ AIEAIKS 
Sbjct  27   ISELRCFSIANHSRRLRWGLQKKMVWSLERAETCVVSNSCLVHPATEAYAQEAIEAIKSE  86

Query  522  NVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             VIAVPTDTLYGFACDACS EAVNRIY+IKGRK T+PLAICVGDV
Sbjct  87   KVIAVPTDTLYGFACDACSLEAVNRIYEIKGRKLTSPLAICVGDV  131



>emb|CDY31532.1| BnaA10g13390D [Brassica napus]
Length=281

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 70/107 (65%), Gaps = 4/107 (4%)
 Frame = +3

Query  348  GVIGKFGFVKLGQRKRRSLVGVSVKTKMDL-RVE---TNRMGMVQPATEDYAEAAIEAIK  515
             +I +  F       RR  +G+       L R E        +V PATE YA+ AIEAIK
Sbjct  27   AIISELRFFATASHSRRLRLGLQKNKVWSLQRAELCVVTSSCIVHPATEAYAQEAIEAIK  86

Query  516  SGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            S  VIAVPTDTLYGFACDACS EAVNRIY+IKGRK T+PLAICVGDV
Sbjct  87   SEKVIAVPTDTLYGFACDACSLEAVNRIYEIKGRKLTSPLAICVGDV  133



>ref|NP_974970.1| DHBP synthase RibB-like alpha/beta domain-containing protein 
[Arabidopsis thaliana]
 gb|AED97352.1| DHBP synthase RibB-like alpha/beta domain-containing protein 
[Arabidopsis thaliana]
Length=288

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 71/97 (73%), Gaps = 4/97 (4%)
 Frame = +3

Query  378  LGQRKRRSLVGVSVKTKMDL-RVET---NRMGMVQPATEDYAEAAIEAIKSGNVIAVPTD  545
            +  + RR   G+  K    L R ET   ++  +V PATE YA+ AIEAIKS  VIAVPTD
Sbjct  35   IANQSRRLRWGLQKKMVWSLERAETCVVSKSCLVHPATEAYAQEAIEAIKSEKVIAVPTD  94

Query  546  TLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            TLYGFACDACS EAV+RIY+IKGRK T+PLAICVGDV
Sbjct  95   TLYGFACDACSLEAVSRIYEIKGRKLTSPLAICVGDV  131



>ref|XP_010264693.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X3 [Nelumbo nucifera]
 ref|XP_010264694.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X3 [Nelumbo nucifera]
Length=254

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 74/105 (70%), Gaps = 8/105 (8%)
 Frame = +3

Query  360  KFGFVKLGQRKRRSLVGVSVKT------KMDLRVETNRMGMVQPATEDYAEAAIEAIKSG  521
            K GF     + R+ L G  VK       + D+ +E  + G+V  A E + E AIEAI+SG
Sbjct  3    KLGFFSFFHQNRK-LGGAFVKKMACEGKRNDVALEV-KTGVVLTAEEVHTEDAIEAIRSG  60

Query  522  NVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             VIAVPTDTLYGFACDACS EAVNRIY+IKGRKYT+PLAICVGDV
Sbjct  61   KVIAVPTDTLYGFACDACSTEAVNRIYEIKGRKYTSPLAICVGDV  105



>ref|XP_007205665.1| hypothetical protein PRUPE_ppa009466mg [Prunus persica]
 gb|EMJ06864.1| hypothetical protein PRUPE_ppa009466mg [Prunus persica]
Length=291

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = +3

Query  426  KMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYD  605
            K D  VET  +G+V+PAT  + E A+EA+++G VIAVPTDTLYGFACDACS EAVNRIY+
Sbjct  66   KCDAGVETE-LGVVRPATGAHTEEAVEALRAGKVIAVPTDTLYGFACDACSLEAVNRIYE  124

Query  606  IKGRKYTNPLAICVGDV  656
            IKGRK+T+PLAICVGDV
Sbjct  125  IKGRKHTSPLAICVGDV  141



>ref|XP_008225594.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Prunus 
mume]
Length=291

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 75/103 (73%), Gaps = 5/103 (5%)
 Frame = +3

Query  360  KFGFVKLGQRKR-RSLVG---VSVKTKMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNV  527
            K G V   Q +R R  V     S   K D  VET  +G+V+PAT  + E A+EA+++G V
Sbjct  40   KLGLVPTVQSRRLRRCVEEKMASSLEKCDAGVETE-VGVVRPATGAHTEEAVEALRAGKV  98

Query  528  IAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            IAVPTDTLYGFACDACS EAVNRIY+IKGRK+T+PLAICVGDV
Sbjct  99   IAVPTDTLYGFACDACSLEAVNRIYEIKGRKHTSPLAICVGDV  141



>ref|XP_010264692.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Nelumbo nucifera]
Length=268

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 74/105 (70%), Gaps = 8/105 (8%)
 Frame = +3

Query  360  KFGFVKLGQRKRRSLVGVSVKT------KMDLRVETNRMGMVQPATEDYAEAAIEAIKSG  521
            K GF     + R+ L G  VK       + D+ +E  + G+V  A E + E AIEAI+SG
Sbjct  17   KLGFFSFFHQNRK-LGGAFVKKMACEGKRNDVALEV-KTGVVLTAEEVHTEDAIEAIRSG  74

Query  522  NVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             VIAVPTDTLYGFACDACS EAVNRIY+IKGRKYT+PLAICVGDV
Sbjct  75   KVIAVPTDTLYGFACDACSTEAVNRIYEIKGRKYTSPLAICVGDV  119



>ref|XP_010685191.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Beta 
vulgaris subsp. vulgaris]
Length=282

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 76/108 (70%), Gaps = 11/108 (10%)
 Frame = +3

Query  354  IGKFGFVKLGQRKRRSLVGVSVKTKMD-------LRVETNRMGMVQPATEDYAEAAIEAI  512
            + + G++ L QR R S  GV  K           LR   N  G+V PAT+++AE AI+++
Sbjct  28   VSRVGYIHLKQRYR-SFAGVCAKVAPSSNGCDGSLR---NGAGVVLPATKEFAEEAIQSL  83

Query  513  KSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            K G VIAVPTDTLYGFACDACS EAV+RIY+IKGRK T+PLAICVGDV
Sbjct  84   KLGKVIAVPTDTLYGFACDACSREAVHRIYEIKGRKLTSPLAICVGDV  131



>ref|XP_010264691.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X1 [Nelumbo nucifera]
Length=278

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 74/105 (70%), Gaps = 8/105 (8%)
 Frame = +3

Query  360  KFGFVKLGQRKRRSLVGVSVKT------KMDLRVETNRMGMVQPATEDYAEAAIEAIKSG  521
            K GF     + R+ L G  VK       + D+ +E  + G+V  A E + E AIEAI+SG
Sbjct  27   KLGFFSFFHQNRK-LGGAFVKKMACEGKRNDVALEV-KTGVVLTAEEVHTEDAIEAIRSG  84

Query  522  NVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             VIAVPTDTLYGFACDACS EAVNRIY+IKGRKYT+PLAICVGDV
Sbjct  85   KVIAVPTDTLYGFACDACSTEAVNRIYEIKGRKYTSPLAICVGDV  129



>ref|XP_007132251.1| hypothetical protein PHAVU_011G078800g [Phaseolus vulgaris]
 ref|XP_007132252.1| hypothetical protein PHAVU_011G078800g [Phaseolus vulgaris]
 gb|ESW04245.1| hypothetical protein PHAVU_011G078800g [Phaseolus vulgaris]
 gb|ESW04246.1| hypothetical protein PHAVU_011G078800g [Phaseolus vulgaris]
Length=227

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  459  GMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLA  638
            G+V PAT+ YA  A+EA+K+G VIAVPTDTLYGFACDACS EAVNRIY+IKGR++T+PLA
Sbjct  13   GVVHPATDAYAGEAVEALKAGKVIAVPTDTLYGFACDACSLEAVNRIYEIKGRRHTSPLA  72

Query  639  ICVGDV  656
            ICVGDV
Sbjct  73   ICVGDV  78



>dbj|BAB09832.1| unnamed protein product [Arabidopsis thaliana]
Length=239

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 3/76 (4%)
 Frame = +3

Query  438  RVET---NRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDI  608
            R ET   ++  +V PATE YA+ AIEAIKS  VIAVPTDTLYGFACDACS EAV+RIY+I
Sbjct  7    RAETCVVSKSCLVHPATEAYAQEAIEAIKSEKVIAVPTDTLYGFACDACSLEAVSRIYEI  66

Query  609  KGRKYTNPLAICVGDV  656
            KGRK T+PLAICVGDV
Sbjct  67   KGRKLTSPLAICVGDV  82



>ref|XP_004148791.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Cucumis 
sativus]
 gb|KGN64719.1| hypothetical protein Csa_1G077210 [Cucumis sativus]
Length=281

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 75/105 (71%), Gaps = 7/105 (7%)
 Frame = +3

Query  357  GKFGFVKLGQRKRRSLVGVSVKTKMDL-----RVETNRMGMVQPATEDYAEAAIEAIKSG  521
              +G V   QR R S V   +KT   L     RVE N +  ++PA+E +A+ A +A+K+G
Sbjct  29   SNYGIVSFLQRNRGSRVSF-LKTNWSLEKCCMRVE-NCLQALRPASEAFAQEATDALKAG  86

Query  522  NVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             VIAVPTDTLYG ACDACSAEAV+RIY+IKGRK T+PLAICVGDV
Sbjct  87   KVIAVPTDTLYGLACDACSAEAVHRIYEIKGRKLTSPLAICVGDV  131



>ref|XP_007132250.1| hypothetical protein PHAVU_011G078800g [Phaseolus vulgaris]
 gb|ESW04244.1| hypothetical protein PHAVU_011G078800g [Phaseolus vulgaris]
Length=273

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  459  GMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLA  638
            G+V PAT+ YA  A+EA+K+G VIAVPTDTLYGFACDACS EAVNRIY+IKGR++T+PLA
Sbjct  59   GVVHPATDAYAGEAVEALKAGKVIAVPTDTLYGFACDACSLEAVNRIYEIKGRRHTSPLA  118

Query  639  ICVGDV  656
            ICVGDV
Sbjct  119  ICVGDV  124



>ref|XP_009335081.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
Length=283

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = +3

Query  426  KMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYD  605
            K D  VET+ +G+V+PATE  AE A+ A+++G VIAVPTDTLYGFACDACS EAVNRIY+
Sbjct  58   KSDAGVETH-LGVVRPATEAQAEEAVGALRAGKVIAVPTDTLYGFACDACSLEAVNRIYE  116

Query  606  IKGRKYTNPLAICVGDV  656
            IKGRK+T+PLAICV DV
Sbjct  117  IKGRKHTSPLAICVEDV  133



>ref|XP_009335080.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X1 [Pyrus x bretschneideri]
Length=295

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = +3

Query  426  KMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYD  605
            K D  VET+ +G+V+PATE  AE A+ A+++G VIAVPTDTLYGFACDACS EAVNRIY+
Sbjct  70   KSDAGVETH-LGVVRPATEAQAEEAVGALRAGKVIAVPTDTLYGFACDACSLEAVNRIYE  128

Query  606  IKGRKYTNPLAICVGDV  656
            IKGRK+T+PLAICV DV
Sbjct  129  IKGRKHTSPLAICVEDV  145



>gb|KEH30047.1| telomere recombination domain protein [Medicago truncatula]
 gb|AES88590.2| telomere recombination domain protein [Medicago truncatula]
Length=349

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +3

Query  453  RMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNP  632
            + G+V PAT+ YA  A+E +K+G VIAVPTDTLYGFACDACS EAVNRIY+IKGRK+T+P
Sbjct  15   KTGVVHPATDAYAAEAVETLKAGKVIAVPTDTLYGFACDACSLEAVNRIYEIKGRKHTSP  74

Query  633  LAICVGDV  656
            LAICVGDV
Sbjct  75   LAICVGDV  82



>ref|XP_009367084.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X1 [Pyrus x bretschneideri]
Length=295

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = +3

Query  426  KMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYD  605
            K D  VET+ +G+V+ ATE +AE A+ A+++G VIAVPTDTLYGFACDACS EAVNRIY+
Sbjct  70   KSDAGVETH-LGVVRQATEAHAEEAVGALRAGKVIAVPTDTLYGFACDACSLEAVNRIYE  128

Query  606  IKGRKYTNPLAICVGDV  656
            IKGR++T+PLA+CVGDV
Sbjct  129  IKGRRHTSPLAVCVGDV  145



>ref|XP_009367085.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X2 [Pyrus x bretschneideri]
Length=291

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = +3

Query  426  KMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYD  605
            K D  VET+ +G+V+ ATE +AE A+ A+++G VIAVPTDTLYGFACDACS EAVNRIY+
Sbjct  66   KSDAGVETH-LGVVRQATEAHAEEAVGALRAGKVIAVPTDTLYGFACDACSLEAVNRIYE  124

Query  606  IKGRKYTNPLAICVGDV  656
            IKGR++T+PLA+CVGDV
Sbjct  125  IKGRRHTSPLAVCVGDV  141



>ref|XP_006400832.1| hypothetical protein EUTSA_v10014329mg [Eutrema salsugineum]
 gb|ESQ42285.1| hypothetical protein EUTSA_v10014329mg [Eutrema salsugineum]
Length=281

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +3

Query  462  MVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAI  641
            +V PA E YA+ AIEAIKS  VIAVPTDTLYGFACDACS EAVNRIY+IKGRK T+PLAI
Sbjct  67   IVHPANEAYAQEAIEAIKSEKVIAVPTDTLYGFACDACSLEAVNRIYEIKGRKLTSPLAI  126

Query  642  CVGDV  656
            CVGDV
Sbjct  127  CVGDV  131



>ref|XP_003606393.1| YrdC domain-containing protein [Medicago truncatula]
Length=462

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +3

Query  453  RMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNP  632
            + G+V PAT+ YA  A+E +K+G VIAVPTDTLYGFACDACS EAVNRIY+IKGRK+T+P
Sbjct  15   KTGVVHPATDAYAAEAVETLKAGKVIAVPTDTLYGFACDACSLEAVNRIYEIKGRKHTSP  74

Query  633  LAICVGDV  656
            LAICVGDV
Sbjct  75   LAICVGDV  82



>emb|CDY69844.1| BnaCnng65630D [Brassica napus]
Length=163

 Score =   108 bits (271),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +3

Query  462  MVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAI  641
            +V PATE YA+ AI AI+S  VI+VPTDTLYGFACDACS EAVNRIY+IKGRK T+PLAI
Sbjct  40   VVHPATEAYAQEAIIAIRSEKVISVPTDTLYGFACDACSLEAVNRIYEIKGRKLTSPLAI  99

Query  642  CVGDV  656
            CVGDV
Sbjct  100  CVGDV  104



>ref|XP_010520367.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Tarenaya hassleriana]
Length=232

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +3

Query  450  NRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTN  629
            ++ G+V PAT  YA+ AIEAIKS  V+AVPTDTLYGFACDACS EAVNRIY IKGR+ T+
Sbjct  14   SKTGIVHPATGTYAQEAIEAIKSDKVVAVPTDTLYGFACDACSLEAVNRIYAIKGRRLTS  73

Query  630  PLAICVGDV  656
            PLAICVGDV
Sbjct  74   PLAICVGDV  82



>gb|ERN15970.1| hypothetical protein AMTR_s00175p00054310 [Amborella trichopoda]
Length=228

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  453  RMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNP  632
            +MGMV PA E + E A+EA+KSG +IAVPTDTLYGFACDACS  AV+RIY+IKGRK+T+P
Sbjct  14   KMGMVLPAQETHVEKAVEAMKSGQLIAVPTDTLYGFACDACSTAAVHRIYEIKGRKHTSP  73

Query  633  LAICVGDV  656
            LA+CV +V
Sbjct  74   LAVCVANV  81



>ref|XP_008788051.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
[Phoenix dactylifera]
Length=269

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  390  KRRSLVGVSVKTKMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACD  569
            ++R  VG +++ ++D+  +  + G++ PAT D+ + AI AI +G VIAVPTDT+YGFACD
Sbjct  36   QKRKFVG-ALRKRLDMGFQA-KAGVILPATGDHVKEAIHAITAGQVIAVPTDTIYGFACD  93

Query  570  ACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            ACSA+AVNRIY+IKGRK T+PLAICV DV
Sbjct  94   ACSAQAVNRIYEIKGRKQTSPLAICVADV  122



>ref|XP_003538209.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
[Glycine max]
Length=290

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +3

Query  426  KMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYD  605
             M   V  +    V PAT+ YA  A+EA+K+G VIAVPTDTLYGFACDACS EAVNRIY+
Sbjct  65   NMACSVSVDNCDTVHPATDAYAGEAVEALKAGKVIAVPTDTLYGFACDACSMEAVNRIYE  124

Query  606  IKGRKYTNPLAICVGDV  656
            IKGR++T+P+AICVGDV
Sbjct  125  IKGRRHTSPVAICVGDV  141



>gb|KHN38769.1| YrdC domain-containing protein, mitochondrial [Glycine soja]
Length=290

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +3

Query  426  KMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYD  605
             M   V  +    V PAT+ YA  A+EA+K+G VIAVPTDTLYGFACDACS EAVNRIY+
Sbjct  65   NMACSVSVDNCDTVHPATDAYAGEAVEALKAGKVIAVPTDTLYGFACDACSMEAVNRIYE  124

Query  606  IKGRKYTNPLAICVGDV  656
            IKGR++T+P+AICVGDV
Sbjct  125  IKGRRHTSPVAICVGDV  141



>ref|XP_006854503.2| PREDICTED: yrdC domain-containing protein, mitochondrial [Amborella 
trichopoda]
Length=270

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  453  RMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNP  632
            +MGMV PA E + E A+EA+KSG +IAVPTDTLYGFACDACS  AV+RIY+IKGRK+T+P
Sbjct  56   KMGMVLPAQETHVEKAVEAMKSGQLIAVPTDTLYGFACDACSTAAVHRIYEIKGRKHTSP  115

Query  633  LAICVGDV  656
            LA+CV +V
Sbjct  116  LAVCVANV  123



>ref|XP_008465284.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Cucumis 
melo]
Length=281

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 73/104 (70%), Gaps = 7/104 (7%)
 Frame = +3

Query  360  KFGFVKLGQRKRRSLVGVSVKTKMDLR-----VETNRMGMVQPATEDYAEAAIEAIKSGN  524
             +G V   QR R S V   +KT   L      VE N +  ++PA+E +A+ A +A+K+G 
Sbjct  30   NYGIVSFLQRNRGSRVSF-LKTDWSLEKCCMPVE-NCLQALRPASEAFAQEATDALKAGK  87

Query  525  VIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            VIAVPTDTLYG ACDACSAEAV+RIY+IKGRK T+PLAICVG V
Sbjct  88   VIAVPTDTLYGLACDACSAEAVHRIYEIKGRKLTSPLAICVGGV  131



>ref|XP_010098198.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Morus notabilis]
 gb|EXB74654.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Morus notabilis]
Length=978

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +3

Query  450  NRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTN  629
            N  G+V PA+E +AE A EA+++G VIAVPTDTLYGFACDACS EAVNRIY IKGRK+T+
Sbjct  14   NICGVVLPASETHAEEACEALRAGKVIAVPTDTLYGFACDACSLEAVNRIYKIKGRKHTS  73

Query  630  PLAICVGDV  656
            PLAICVGDV
Sbjct  74   PLAICVGDV  82



>gb|EPS58703.1| hypothetical protein M569_16110, partial [Genlisea aurea]
Length=211

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  465  VQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAIC  644
            V+PA+ D+A  A+EA+KSG VIAVPTDT+YGFACDACS  AVNRIY+IKGRK+T PLAIC
Sbjct  3    VRPASLDHAAEAVEAVKSGKVIAVPTDTIYGFACDACSVHAVNRIYEIKGRKHTAPLAIC  62

Query  645  VGDV  656
            V DV
Sbjct  63   VADV  66



>ref|XP_009416119.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=277

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 72/102 (71%), Gaps = 9/102 (9%)
 Frame = +3

Query  369  FVKLGQRKRRSLVGVSVKTKMDLRVETN------RMGMVQPATEDYAEAAIEAIKSGNVI  530
            F  L Q++R S    ++++ M   V+ +      R G++ PAT+D  E AIEAIK+  VI
Sbjct  32   FPLLSQKRRSS---GAIRSYMSQSVDNSEIGSKVRAGVILPATDDRIEEAIEAIKTEQVI  88

Query  531  AVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AVPTDTLYGFACDACSAEAVN+IY+IKGRK T+PLAI V  V
Sbjct  89   AVPTDTLYGFACDACSAEAVNKIYEIKGRKQTSPLAISVAGV  130



>ref|XP_009416120.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=229

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +3

Query  453  RMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNP  632
            R G++ PAT+D  E AIEAIK+  VIAVPTDTLYGFACDACSAEAVN+IY+IKGRK T+P
Sbjct  15   RAGVILPATDDRIEEAIEAIKTEQVIAVPTDTLYGFACDACSAEAVNKIYEIKGRKQTSP  74

Query  633  LAICVGDV  656
            LAI V  V
Sbjct  75   LAISVAGV  82



>dbj|BAJ89704.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=274

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  417  VKTKMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNR  596
            V   +  ++E + M  + PA++D+   AI+AI  G VIAVPTDT+YGFACDACSAEAVNR
Sbjct  49   VSENISHKIEAS-MDHILPASQDHVVKAIDAINGGQVIAVPTDTIYGFACDACSAEAVNR  107

Query  597  IYDIKGRKYTNPLAICVGDV  656
            IY+IKGR +T PLAICV DV
Sbjct  108  IYEIKGRIHTRPLAICVADV  127



>dbj|BAK00353.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=214

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  456  MGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPL  635
            M  + PA++D+   AI+AI  G VIAVPTDT+YGFACDACSAEAVNRIY+IKGR +T PL
Sbjct  1    MDHILPASQDHVVKAIDAINGGQVIAVPTDTIYGFACDACSAEAVNRIYEIKGRIHTRPL  60

Query  636  AICVGDV  656
            AICV DV
Sbjct  61   AICVADV  67



>ref|XP_010910769.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Elaeis 
guineensis]
Length=276

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  459  GMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLA  638
            G+V PAT D+ E AI AI +  VIAVPTDTLYGFACDACSA+AVNRIY+IKGRK  +PLA
Sbjct  64   GVVLPATGDHVEEAINAITAEQVIAVPTDTLYGFACDACSAQAVNRIYEIKGRKQMSPLA  123

Query  639  ICVGDV  656
            ICV DV
Sbjct  124  ICVADV  129



>ref|XP_003561935.1| PREDICTED: LOW QUALITY PROTEIN: yrdC domain-containing protein, 
mitochondrial [Brachypodium distachyon]
Length=273

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 70/106 (66%), Gaps = 15/106 (14%)
 Frame = +3

Query  369  FVKLG----QRKRRSLVGVSV------KTKMDLRVETNRMGMVQPATEDYAEAAIEAIKS  518
            FVK+G    Q + + +V  S+        +++LR E      + PATED+   AI+AI  
Sbjct  27   FVKVGTLASQHETKCVVSCSIGVSENRAHRIELRAE-----HILPATEDHVVKAIDAINR  81

Query  519  GNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            G VIAVPTDT+YGFACDACSAEAVNRIY+IKGR    PLAICV DV
Sbjct  82   GQVIAVPTDTIYGFACDACSAEAVNRIYEIKGRIXARPLAICVSDV  127



>gb|EMT33550.1| hypothetical protein F775_08277 [Aegilops tauschii]
Length=274

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  465  VQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAIC  644
            + PA++D+   AI+AI  G VIAVPTDT+YGFACDACSAEAVNRIY+IKGR +T PLAIC
Sbjct  64   ILPASQDHVVKAIDAINGGQVIAVPTDTIYGFACDACSAEAVNRIYEIKGRIHTRPLAIC  123

Query  645  VGDV  656
            V DV
Sbjct  124  VADV  127



>ref|XP_006649582.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
[Oryza brachyantha]
Length=274

 Score =   100 bits (249),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 69/102 (68%), Gaps = 7/102 (7%)
 Frame = +3

Query  369  FVKLG----QRKRRSLVGVSVKTKMDL--RVETNRMGMVQPATEDYAEAAIEAIKSGNVI  530
            FVK+     Q + +S+V  SV+   ++  R+E    G + PAT D    AI++I  G VI
Sbjct  27   FVKVSRLSSQHETKSVVSCSVRLSDNVTHRIEAT-AGHILPATTDNVMKAIDSINRGQVI  85

Query  531  AVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AVPTDT+YGFACDACSAEAVN IY+IKGR  T PLAICV DV
Sbjct  86   AVPTDTIYGFACDACSAEAVNCIYEIKGRIQTRPLAICVADV  127



>ref|XP_004985302.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
[Setaria italica]
Length=274

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 67/102 (66%), Gaps = 7/102 (7%)
 Frame = +3

Query  369  FVKLG----QRKRRSLVGVSVKTKMDL--RVETNRMGMVQPATEDYAEAAIEAIKSGNVI  530
            FVK+     Q + RS V  S++   +   R E     +  PAT+D+   AI+AI  G VI
Sbjct  27   FVKVSRLPSQHETRSQVSCSIRVSENAADRFEATAENIF-PATKDHVMKAIDAINRGQVI  85

Query  531  AVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AVPTDT+YGFACDACSA AVNRIY+IKGR  T PLAICV DV
Sbjct  86   AVPTDTIYGFACDACSAGAVNRIYEIKGRVQTRPLAICVADV  127



>gb|ABF94505.1| yrdC protein, putative, expressed [Oryza sativa Japonica Group]
 gb|EAZ25957.1| hypothetical protein OsJ_09812 [Oryza sativa Japonica Group]
 dbj|BAG90626.1| unnamed protein product [Oryza sativa Japonica Group]
Length=274

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  465  VQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAIC  644
            + PAT D+   AI++I  G VIAVPTDT+YGFACDACSAEAVNRIY+IKGR  T PLAIC
Sbjct  64   ILPATNDHVMKAIDSINRGQVIAVPTDTIYGFACDACSAEAVNRIYEIKGRVQTRPLAIC  123

Query  645  VGDV  656
            V DV
Sbjct  124  VADV  127



>gb|EAY88934.1| hypothetical protein OsI_10418 [Oryza sativa Indica Group]
Length=274

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  465  VQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAIC  644
            + PAT D+   AI++I  G VIAVPTDT+YGFACDACSAEAVNRIY+IKGR  T PLAIC
Sbjct  64   ILPATNDHVMKAIDSINRGQVIAVPTDTIYGFACDACSAEAVNRIYEIKGRVQTRPLAIC  123

Query  645  VGDV  656
            V DV
Sbjct  124  VADV  127



>ref|NP_001148954.1| ischemia/reperfusion inducible protein [Zea mays]
 gb|ACG33633.1| ischemia/reperfusion inducible protein [Zea mays]
Length=275

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 67/102 (66%), Gaps = 7/102 (7%)
 Frame = +3

Query  369  FVKL----GQRKRRSLVGVSVKTKMDL--RVETNRMGMVQPATEDYAEAAIEAIKSGNVI  530
            FVK+     Q + +S V  SV+   +   R++     +  PA +D+   A +AI  G VI
Sbjct  28   FVKVRRLPSQHETKSQVSCSVRVSENTAHRIDATAENIF-PAMKDHVLKATDAINRGEVI  86

Query  531  AVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AVPTDT+YGFACDACSA AVNRIY+IKGR  T PLAICVGDV
Sbjct  87   AVPTDTIYGFACDACSAGAVNRIYEIKGRIQTRPLAICVGDV  128



>gb|ACN27269.1| unknown [Zea mays]
 tpg|DAA43930.1| TPA: ischemia/reperfusion inducible protein [Zea mays]
Length=275

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 63/93 (68%), Gaps = 3/93 (3%)
 Frame = +3

Query  384  QRKRRSLVGVSVKTKMDL--RVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYG  557
            Q + +S V  SV+   +   R++     +  PA +D+   A +AI  G VIAVPTDT+YG
Sbjct  37   QHETKSQVSCSVRVSENTAHRIDATAENIF-PAVKDHVLKATDAINRGEVIAVPTDTIYG  95

Query  558  FACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            FACDACSA AVNRIY+IKGR  T PLAICVGDV
Sbjct  96   FACDACSAGAVNRIYEIKGRIQTRPLAICVGDV  128



>ref|XP_008676520.1| PREDICTED: ischemia/reperfusion inducible protein isoform X1 
[Zea mays]
Length=299

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 63/93 (68%), Gaps = 3/93 (3%)
 Frame = +3

Query  384  QRKRRSLVGVSVKTKMDL--RVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYG  557
            Q + +S V  SV+   +   R++     +  PA +D+   A +AI  G VIAVPTDT+YG
Sbjct  61   QHETKSQVSCSVRVSENTAHRIDATAENIF-PAVKDHVLKATDAINRGEVIAVPTDTIYG  119

Query  558  FACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            FACDACSA AVNRIY+IKGR  T PLAICVGDV
Sbjct  120  FACDACSAGAVNRIYEIKGRIQTRPLAICVGDV  152



>ref|XP_002465687.1| hypothetical protein SORBIDRAFT_01g043750 [Sorghum bicolor]
 gb|EER92685.1| hypothetical protein SORBIDRAFT_01g043750 [Sorghum bicolor]
Length=275

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  471  PATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVG  650
            PA +D+   A +AI  G VIAVPTDT+YGFACDACSA AVNRIY+IKGR  T PLAICV 
Sbjct  67   PAMKDHVLKATDAINRGEVIAVPTDTIYGFACDACSAGAVNRIYEIKGRIQTRPLAICVA  126

Query  651  DV  656
            DV
Sbjct  127  DV  128



>ref|XP_009798170.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
[Nicotiana sylvestris]
Length=187

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  426  KMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYD  605
            K +  VET ++  V PATEDYAE  IE IK+  VI VPTDTLYGFACDACSAEAVNRIY+
Sbjct  7    KSNGNVET-KVVSVSPATEDYAEETIEVIKAEKVITVPTDTLYGFACDACSAEAVNRIYE  65

Query  606  IKGR  617
            IKGR
Sbjct  66   IKGR  69



>ref|XP_006645318.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
[Oryza brachyantha]
Length=202

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AI++I  G VIAVPTDT+YGFACDACSAEAVNRIY+IKGR  T PLAICV DV
Sbjct  3    AIDSINRGQVIAVPTDTIYGFACDACSAEAVNRIYEIKGRVQTRPLAICVADV  55



>ref|XP_001757618.1| predicted protein [Physcomitrella patens]
 gb|EDQ77675.1| predicted protein, partial [Physcomitrella patens]
Length=154

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  474  ATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGD  653
            A E++ + A+ A+ +  VIAVPTDTLYG ACDA SAEA+ R+Y+IK RK ++PLA+CV D
Sbjct  2    AREEHYKEAVRALGNEQVIAVPTDTLYGLACDASSAEAIRRVYEIKERKLSSPLAVCVSD  61

Query  654  V  656
            V
Sbjct  62   V  62



>ref|XP_002991001.1| hypothetical protein SELMODRAFT_132635 [Selaginella moellendorffii]
 gb|EFJ08045.1| hypothetical protein SELMODRAFT_132635 [Selaginella moellendorffii]
Length=201

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +3

Query  465  VQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAIC  644
            V  AT++    AI A++ G+VI+VPTDTLYG A DACS  AV RIYDIKGR   +PLA+C
Sbjct  9    VLAATQENVRHAIAALRRGDVISVPTDTLYGLAADACSRVAVERIYDIKGRNAGSPLAVC  68

Query  645  VGDV  656
            V DV
Sbjct  69   VADV  72



>ref|XP_002982893.1| hypothetical protein SELMODRAFT_234090 [Selaginella moellendorffii]
 gb|EFJ16138.1| hypothetical protein SELMODRAFT_234090 [Selaginella moellendorffii]
Length=201

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +3

Query  465  VQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAIC  644
            +  AT++    AI A++ G+VI+VPTDTLYG A DACS  A+ RIY+IKGR   +PLA+C
Sbjct  9    IWAATQENVRHAIAALRHGDVISVPTDTLYGLAADACSRVALERIYEIKGRNAGSPLAVC  68

Query  645  VGDV  656
            V DV
Sbjct  69   VADV  72



>ref|XP_001811736.2| PREDICTED: yrdC domain-containing protein, mitochondrial [Tribolium 
castaneum]
Length=216

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +3

Query  456  MGMVQPATEDYAEA-AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNP  632
            M +  P  + +AEA A++ +KSG VIA+PTDT+YG ACDA +  ++N++Y IKGR    P
Sbjct  1    MALHVPIRDPHAEALAVDLLKSGRVIALPTDTVYGLACDATNITSINKLYSIKGRNEAKP  60

Query  633  LAICVGDV  656
            +AIC+GDV
Sbjct  61   VAICLGDV  68



>ref|NP_001077336.1| yrdC domain-containing protein, mitochondrial [Danio rerio]
 gb|AAI34956.1| Zgc:162301 protein [Danio rerio]
Length=235

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 57/83 (69%), Gaps = 4/83 (5%)
 Frame = +3

Query  417  VKTKMDLRVETN---RMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEA  587
            +KT++ LR+ +N    + + QP   +     + A+K+G V+AVPTDT+YG AC A ++EA
Sbjct  5    LKTRV-LRISSNFSDDLTLHQPEWTEILSCTVNALKAGQVVAVPTDTIYGLACVAQNSEA  63

Query  588  VNRIYDIKGRKYTNPLAICVGDV  656
            + R+YDIKGR    PLAICVG++
Sbjct  64   IRRVYDIKGRNGDKPLAICVGEI  86



>ref|XP_009796628.1| PREDICTED: uncharacterized protein LOC104243172 [Nicotiana sylvestris]
Length=133

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 55/87 (63%), Gaps = 12/87 (14%)
 Frame = +3

Query  366  GFVKLGQRKRRSLVGVSVK------TKMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNV  527
            GF+ L  R RR   G S+K       K D  VET ++  V PATEDYAE AIEAIK+G +
Sbjct  53   GFLNLWTRSRR---GFSMKKIAWSLEKSDGNVET-KVVFVSPATEDYAEEAIEAIKAGKI  108

Query  528  IAVPTDTLYGFACDACSAEAVNRIYDI  608
            + VPT+TLYGFACDA    A N I+ +
Sbjct  109  LDVPTNTLYGFACDAWY--AFNLIFPL  133



>ref|XP_007515601.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14480.1| predicted protein [Bathycoccus prasinos]
Length=293

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  492  EAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICV  647
            E A++A+K G+VIAVPTDTLYGFACDA +AEA+  +Y +KGR+ T P+A+CV
Sbjct  80   EFAVQALKRGSVIAVPTDTLYGFACDASNAEAIENLYAVKGREKTKPVAVCV  131



>ref|XP_007492881.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Monodelphis 
domestica]
Length=294

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 59/98 (60%), Gaps = 2/98 (2%)
 Frame = +3

Query  369  FVKLGQRKRRSLVGVSVKTKMDLRVETNRMG--MVQPATEDYAEAAIEAIKSGNVIAVPT  542
            F++L +    S  G +  +K DL  E +  G   V  +  +   AA+ A+++G ++AVPT
Sbjct  43   FLQLPRGVVDSRAGQAAASKRDLEGERSEKGGGAVSWSWSEALTAAVTALRAGGLVAVPT  102

Query  543  DTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            DTLYG AC AC + A+  +Y +KGR  T PLA+C+G V
Sbjct  103  DTLYGVACSACCSAALGAVYSLKGRSQTKPLAVCLGGV  140



>emb|CDQ81567.1| unnamed protein product [Oncorhynchus mykiss]
Length=258

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 3/62 (5%)
 Frame = +3

Query  480  EDYAE---AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVG  650
            +D AE   + +EA+K G V+AVPTDT+YG AC A ++ A+ ++YDIKGRK   PLAICVG
Sbjct  48   QDGAEILNSTVEALKDGQVVAVPTDTIYGLACLAQNSNAIKKVYDIKGRKGQKPLAICVG  107

Query  651  DV  656
            ++
Sbjct  108  EI  109



>ref|XP_010897415.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Esox 
lucius]
Length=303

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  483  DYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            D+  + + A+K G V+AVPTDT+YG AC A +++A+ R+YDIKGR    PLAICVG++
Sbjct  97   DFLNSTVAALKRGEVVAVPTDTVYGLACLAQNSDAIKRVYDIKGRNGQKPLAICVGEI  154



>gb|EFA11620.1| hypothetical protein TcasGA2_TC030645, partial [Tribolium castaneum]
Length=203

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A++ +KSG VIA+PTDT+YG ACDA +  ++N++Y IKGR    P+AIC+GDV
Sbjct  3    AVDLLKSGRVIALPTDTVYGLACDATNITSINKLYSIKGRNEAKPVAICLGDV  55



>ref|XP_008320921.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Cynoglossus 
semilaevis]
Length=272

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  501  IEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            ++A+K G V+AVPTDT+YG AC A ++EAV +IYDIKGR    PLAICVG++
Sbjct  73   VKALKQGQVVAVPTDTIYGLACLAQNSEAVKKIYDIKGRNGQKPLAICVGEI  124



>ref|XP_008275607.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Stegastes 
partitus]
Length=265

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  504  EAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            +A+K G+V+ VPTDT+YG AC A ++EAV RIYDIKGR    PLAICVG++
Sbjct  66   KALKEGHVVGVPTDTIYGLACLAQNSEAVRRIYDIKGRNGQKPLAICVGEI  116



>ref|XP_008429347.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Poecilia 
reticulata]
Length=267

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 63/115 (55%), Gaps = 17/115 (15%)
 Frame = +3

Query  363  FGFVKLGQRKRR----SLVGVSVKTKMDLRVETNRMGMVQPAT-------------EDYA  491
            FGFV  G  K R    S V V + T+M    +T  + +  P +              +  
Sbjct  4    FGFVAAGLIKYRGSHCSAVAVRLGTEMCKEPKTKLLRLYPPTSNGPTVHQETQTDDSEVL  63

Query  492  EAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
               ++A+K G+++AVPTDT+YG AC A ++EAV +IY++K R    PLAICVG++
Sbjct  64   SCTVKALKDGHIVAVPTDTIYGLACLAQNSEAVKKIYEVKERNGQKPLAICVGEI  118



>ref|XP_010793211.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Notothenia 
coriiceps]
Length=270

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  501  IEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            ++A+K G+V+AVPTDT+YG AC   ++EAV +IYDIKGR    PLAICVG++
Sbjct  67   VKALKEGHVVAVPTDTIYGLACLTQNSEAVKKIYDIKGRNGNKPLAICVGEI  118



>ref|XP_006007187.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Latimeria chalumnae]
Length=237

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A++A++ G+VI VPTDT+YG AC A ++EA+ RIY+IKGR    PLAICVG+V
Sbjct  75   AVDALQQGSVIGVPTDTIYGIACLAQNSEAIRRIYEIKGRNGNKPLAICVGNV  127



>ref|XP_007249671.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Astyanax 
mexicanus]
Length=274

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            + ++A+K G V+AVPTDT+YG AC A ++EA+ R+Y+IKGR    PLAICVG++
Sbjct  73   STVKALKDGQVVAVPTDTIYGLACLAQNSEAIKRVYNIKGRNGNKPLAICVGEI  126



>ref|XP_006007186.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X1 [Latimeria chalumnae]
Length=277

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A++A++ G+VI VPTDT+YG AC A ++EA+ RIY+IKGR    PLAICVG+V
Sbjct  75   AVDALQQGSVIGVPTDTIYGIACLAQNSEAIRRIYEIKGRNGNKPLAICVGNV  127



>gb|ACO09892.1| Hypothetical protein ywlC [Osmerus mordax]
Length=268

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +3

Query  468  QPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICV  647
             P   +  +A ++++K G V+A+PTDT+YG AC A +++A+ R+Y+IKGR    PLAICV
Sbjct  57   HPDGAEILDATVQSLKEGQVVALPTDTIYGLACLAQNSDAIKRVYEIKGRNGQKPLAICV  116

Query  648  GDV  656
            G++
Sbjct  117  GEI  119



>ref|XP_005649715.1| hypothetical protein COCSUDRAFT_65132 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25171.1| hypothetical protein COCSUDRAFT_65132 [Coccomyxa subellipsoidea 
C-169]
Length=963

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +3

Query  459  GMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLA  638
            G V PA E  A  A EA++ G+V+AVPTDTLYG A  A S + V R+Y IK R+   PLA
Sbjct  751  GCVMPADESGAAVAAEALRRGDVVAVPTDTLYGLAACANSEQGVGRLYAIKHRQAHVPLA  810

Query  639  ICVGDV  656
            ICV DV
Sbjct  811  ICVADV  816



>ref|XP_007893149.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Callorhinchus 
milii]
Length=268

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = +3

Query  477  TEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            TE   E A E ++SG V+ VPTDT+YG AC A +++AV RIY IKGRK   PLAICVG V
Sbjct  60   TEALKETA-EVLRSGQVVGVPTDTIYGIACLAQNSDAVRRIYGIKGRKENRPLAICVGSV  118



>gb|ENN81859.1| hypothetical protein YQE_01752, partial [Dendroctonus ponderosae]
Length=232

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  492  EAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            ++ I+ +++GNV+AVPTDTLYG ACDA + EA++++Y IK R  + P+AIC G +
Sbjct  33   QSGIDLLQTGNVVAVPTDTLYGLACDATNMEAIHKMYSIKCRNESKPVAICFGQI  87



>ref|XP_011196736.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Bactrocera 
cucurbitae]
Length=226

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A+E I  G++IA+PTDT+YG AC+A + EA+ R+YDIKGR +  P+AICV ++
Sbjct  21   AVEYILDGDIIALPTDTVYGLACNANNEEAIKRLYDIKGRNFYKPVAICVKNL  73



>ref|XP_010729920.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Larimichthys 
crocea]
Length=267

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 3/66 (5%)
 Frame = +3

Query  468  QPATEDYAE---AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLA  638
            Q +  D AE     ++A+K G V+AVPTDT+YG AC A ++EA+ + YDIKGR    PLA
Sbjct  53   QESHTDGAEILSCTVKALKEGAVVAVPTDTIYGLACLAQNSEAIKKTYDIKGRNGQKPLA  112

Query  639  ICVGDV  656
            ICVG++
Sbjct  113  ICVGEI  118



>ref|XP_004947809.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X3 [Gallus gallus]
Length=196

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = +3

Query  420  KTKMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRI  599
             T++ LR+ T     V     +   AA+ A++ G ++AVPTDT+YG AC A  + AV  I
Sbjct  31   PTRVRLRLRTEPA--VSAGWREAVAAAVGALQEGGLVAVPTDTVYGVACLAQDSRAVQSI  88

Query  600  YDIKGRKYTNPLAICVGDV  656
            Y +KGR  T PLAIC+GDV
Sbjct  89   YSLKGRNGTKPLAICLGDV  107



>ref|XP_006631445.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
[Lepisosteus oculatus]
Length=243

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  492  EAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            +  +  +++G V+AVPTDT+YG AC A +++A+ R+YDIKGR    PLAICVG++
Sbjct  36   DTTVHVLQAGQVVAVPTDTIYGLACLAQNSDAIKRVYDIKGRNGEKPLAICVGEI  90



>ref|XP_011616497.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Takifugu 
rubripes]
Length=270

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  504  EAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            + +K G+V+A+PTDT+YG AC A ++EA+ +IYDIKGR    PLAICVG +
Sbjct  72   KCLKEGHVVALPTDTIYGLACLAQNSEAIRKIYDIKGRNQQKPLAICVGQI  122



>ref|XP_004991111.1| yrdC domain-containing protein [Salpingoeca rosetta]
 gb|EGD76739.1| yrdC domain-containing protein [Salpingoeca rosetta]
Length=388

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +3

Query  480  EDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            +D    A+E +++G VI VPTDT+YG AC A S + V RIY IKGR    P+AICV DV
Sbjct  98   DDVVADAVETLRAGGVIGVPTDTIYGLACLAQSTQGVRRIYSIKGRSELKPIAICVHDV  156



>gb|ERL85623.1| hypothetical protein D910_03042 [Dendroctonus ponderosae]
Length=330

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  492  EAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            ++ I+ +++GNV+AVPTDTLYG ACDA + EA++++Y IK R  + P+AIC G +
Sbjct  131  QSGIDLLQTGNVVAVPTDTLYGLACDATNMEAIHKMYSIKCRNESKPVAICFGQI  185



>ref|XP_007557311.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Poecilia 
formosa]
Length=267

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 61/115 (53%), Gaps = 17/115 (15%)
 Frame = +3

Query  363  FGFVKLGQRKRR----SLVGVSVKTKMDLRVETNRMGMVQPAT-------------EDYA  491
            FGFV  G  K R    S V   + T M    +T  + +  P +              +  
Sbjct  4    FGFVAAGLIKYRGSHCSAVAGRLGTDMCKEPKTKLLRLYPPTSNGPTVHQETQTDDSEVL  63

Query  492  EAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
               ++A+K G+++AVPTDT+YG AC A ++EAV +IY++K R    PLAICVG++
Sbjct  64   SCTVKALKDGHIVAVPTDTIYGLACLAQNSEAVKKIYEVKERNGQKPLAICVGEI  118



>ref|XP_005176493.2| PREDICTED: yrdC domain-containing protein, mitochondrial [Musca 
domestica]
Length=226

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +3

Query  489  AEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            ++ A   IKSG+VIA+PTDT+YG ACDA +  A+ ++Y IKGR +  P+AICV D+
Sbjct  18   SDIAAHYIKSGHVIALPTDTVYGLACDANNEIAIKKLYTIKGRDFHKPVAICVRDL  73



>ref|XP_002131919.2| PREDICTED: yrdC domain-containing protein, mitochondrial [Ciona 
intestinalis]
Length=342

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 58/103 (56%), Gaps = 11/103 (11%)
 Frame = +3

Query  348  GVIGKFGFVKLGQRKRRSLVGVSVKTKMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNV  527
            G+IG +   K+      +++  ++KTK      TN         ED  E+ +  +  G +
Sbjct  70   GIIGGYEPAKISS----NILPSAMKTKFFKLSHTN-------DNEDVIESCVRILHRGGI  118

Query  528  IAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            +A+PTDTLYG AC A S EAV ++Y+IK R    P+AICVGD+
Sbjct  119  VALPTDTLYGVACLAQSTEAVEKLYEIKARNPLKPVAICVGDL  161



>ref|WP_021055359.1| sua5/YciO/YrdC/YwlC family protein [Haloquadratum walsbyi]
 gb|ERG95887.1| sua5/YciO/YrdC/YwlC family protein [Haloquadratum walsbyi J07HQW2]
Length=245

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 49/88 (56%), Gaps = 6/88 (7%)
 Frame = +3

Query  393  RRSLVGVSVKTKMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDA  572
            +RS  G    T  DL      +G            A++AIKSG  +  PTDT+YG   DA
Sbjct  19   KRSQSGTDSNTGTDL------VGQTMENNSTALSTAVKAIKSGEPVVYPTDTVYGLGVDA  72

Query  573  CSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             +++A+ R++DIKGR Y NPL++ V ++
Sbjct  73   SNSDAIERVFDIKGRNYDNPLSLAVQNI  100



>ref|XP_011971870.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Ovis aries musimon]
Length=276

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  +EA+  +Y IKGR  T PLA+C+G V
Sbjct  70   AAVAELRAGAVVAVPTDTLYGLACSASCSEALGAVYRIKGRSETKPLAVCLGRV  123



>ref|XP_005317896.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Ictidomys 
tridecemlineatus]
Length=280

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 59/106 (56%), Gaps = 8/106 (8%)
 Frame = +3

Query  357  GKFGFVKLGQRKRRSLVGVSVKTKMDLRVETNRMGMVQPATEDYA------EAAIEAIKS  518
            G  G  + G+  R     ++      LR+  N  G VQ ++ + A       AA+  +++
Sbjct  23   GPTGSARSGRLLRPPSPALAAPGARLLRLPGN--GAVQASSPERAGWTETLRAAVAELRA  80

Query  519  GNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            G V+AVPTDTLYG AC A  + A++ +Y +KGR  T PLA+C+G V
Sbjct  81   GAVVAVPTDTLYGLACSASCSTALDAVYRLKGRSETKPLAVCLGRV  126



>gb|KHN32083.1| Hypothetical protein glysoja_028878 [Glycine soja]
Length=190

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 45/76 (59%), Gaps = 18/76 (24%)
 Frame = +3

Query  429  MDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDI  608
            M   V  +   MV PAT+ YA  A+EA+K+G                  S EAVNRIY+I
Sbjct  53   MSCSVSVDNSDMVHPATDAYAGEAVEALKAG------------------SLEAVNRIYEI  94

Query  609  KGRKYTNPLAICVGDV  656
            KGR++T+PLAICVGDV
Sbjct  95   KGRRHTSPLAICVGDV  110



>ref|XP_004535797.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
[Ceratitis capitata]
Length=252

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 55/79 (70%), Gaps = 5/79 (6%)
 Frame = +3

Query  423  TKMDLRVETNRM-GMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRI  599
            +KM LRV   ++  +++P   D A    +++  G VIA+PTDT+YGFACDA + +A+ ++
Sbjct  25   SKM-LRVSQEKIYKVLEPKAIDIAR---QSLLDGEVIALPTDTVYGFACDANNEDAIKKL  80

Query  600  YDIKGRKYTNPLAICVGDV  656
            YDIKGR+   P+AICV ++
Sbjct  81   YDIKGRESYKPVAICVKNL  99



>ref|XP_004003536.2| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X1 [Ovis aries]
Length=273

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  +EA+  +Y IKGR  T PLA+C+G V
Sbjct  67   AAVAELRAGAVVAVPTDTLYGLACSASCSEALGAVYRIKGRSETKPLAVCLGRV  120



>ref|XP_004641157.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Octodon 
degus]
Length=300

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  +EA+  +Y +KGR  T PLA+C+G V
Sbjct  56   AAVAELRAGAVVAVPTDTLYGLACSASCSEALGAVYRLKGRSETKPLAVCLGRV  109



>ref|XP_005796105.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
[Xiphophorus maculatus]
Length=238

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             ++A+K G+++AVPTDT+YG AC A ++EAV +IY++K R    PLAICVG++
Sbjct  37   TVKALKDGHIVAVPTDTIYGLACLAQNSEAVKKIYEVKERNGQKPLAICVGEI  89



>ref|XP_001415562.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO93854.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=195

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A  A++ G VIAVPTDT+YGFA  A + +AV R+Y+IKGR+   PLAI VGDV
Sbjct  1    AAAALRRGGVIAVPTDTIYGFAASAANGDAVRRLYEIKGRRAGVPLAIAVGDV  53



>ref|XP_005736173.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
[Pundamilia nyererei]
Length=267

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  501  IEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            ++A+K G+++AVPTDT+YG AC A +++AV + YD KGR    PLAICVG++
Sbjct  67   VKALKEGHIVAVPTDTIYGLACLAQNSDAVRKTYDTKGRNGQKPLAICVGEI  118



>ref|XP_003450557.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
[Oreochromis niloticus]
Length=267

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 58/94 (62%), Gaps = 4/94 (4%)
 Frame = +3

Query  387  RKRRSLVGVSVKTK-MDLRVETNRMGMVQPATEDYAEA---AIEAIKSGNVIAVPTDTLY  554
            R+ R+ +   +KTK + L   T+    V     D AE     ++A+K G+++AVPTDT+Y
Sbjct  25   RRIRAEMCKELKTKVLRLLPPTSNGPTVHRDETDGAEILSYTVKALKEGHIVAVPTDTIY  84

Query  555  GFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            G AC A +++AV + YD KGR    PLAICVG++
Sbjct  85   GLACLAQNSDAVRKTYDTKGRNGQKPLAICVGEI  118



>ref|XP_004551029.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
[Maylandia zebra]
Length=267

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  501  IEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            ++A+K G+++AVPTDT+YG AC A +++AV + YD KGR    PLAICVG++
Sbjct  67   VKALKEGHIVAVPTDTIYGLACLAQNSDAVRKTYDTKGRNGQKPLAICVGEI  118



>ref|XP_417757.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Gallus gallus]
Length=255

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+ A++ G ++AVPTDT+YG AC A  + AV  IY +KGR  T PLAIC+GDV
Sbjct  51   AAVGALQEGGLVAVPTDTVYGVACLAQDSRAVQSIYSLKGRNGTKPLAICLGDV  104



>ref|NP_001069018.1| yrdC domain-containing protein, mitochondrial precursor [Bos 
taurus]
 sp|Q0VC80.1|YRDC_BOVIN RecName: Full=YrdC domain-containing protein, mitochondrial; 
Flags: Precursor [Bos taurus]
 gb|AAI20308.1| YrdC domain containing (E. coli) [Bos taurus]
 tpg|DAA30990.1| TPA: yrdC domain-containing protein, mitochondrial precursor 
[Bos taurus]
Length=276

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  +EA+  +Y +KGR  T PLA+C+G V
Sbjct  70   AAVAELRAGAVVAVPTDTLYGLACSASCSEALGAVYRVKGRSETKPLAVCLGRV  123



>ref|XP_006791738.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
[Neolamprologus brichardi]
Length=265

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  501  IEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            ++A+K G+++AVPTDT+YG AC A +++AV + YD KGR    PLAICVG++
Sbjct  67   VKALKEGHIVAVPTDTIYGLACLAQNSDAVRKTYDTKGRNGQKPLAICVGEI  118



>ref|XP_002720685.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Oryctolagus 
cuniculus]
Length=280

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 6/72 (8%)
 Frame = +3

Query  459  GMVQPATEDYA------EAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRK  620
            G VQ A+ + A       AA+  +++G V+AVPTDTLYG AC A  +EA+  +Y +KGR 
Sbjct  55   GAVQAASPERAGWTEALRAAVAELRAGAVVAVPTDTLYGLACSASCSEALGAVYRLKGRS  114

Query  621  YTNPLAICVGDV  656
               PLA+C+G V
Sbjct  115  EAKPLAVCLGRV  126



>ref|XP_011582578.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Aquila 
chrysaetos canadensis]
Length=269

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (67%), Gaps = 3/69 (4%)
 Frame = +3

Query  459  GMVQPATEDYAEA---AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTN  629
            G  QP  + + EA   A+ A+++G ++AVPTDT+YG AC A  + AV  IY +KGR    
Sbjct  50   GAAQPDPQGWREAVAAAVGALQAGGLVAVPTDTVYGVACLAQDSGAVRSIYSLKGRNGRK  109

Query  630  PLAICVGDV  656
            PLAIC+GDV
Sbjct  110  PLAICLGDV  118



>ref|WP_045170633.1| hypothetical protein [Ehrlichia mineirensis]
 emb|CEI84677.1| Translation factor SUA5 [Ehrlichia mineirensis]
Length=196

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AI+A+K+ ++IA PT+T+Y  A DA S EAV +IY IKGR Y  PL++ VG++
Sbjct  5    AIQALKNEHLIAFPTETVYALAADAYSIEAVQKIYQIKGRSYNKPLSLLVGNI  57



>gb|EFX74263.1| hypothetical protein DAPPUDRAFT_215182 [Daphnia pulex]
Length=226

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A+E +KSG+VIA+PTDTLYG AC + S EA+ ++Y IK R    P+AICV  V
Sbjct  20   AVELLKSGSVIALPTDTLYGIACLSQSPEALKKLYQIKSRDKNKPVAICVSQV  72



>ref|XP_005925643.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
[Haplochromis burtoni]
Length=267

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  501  IEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            ++A+K G+++AVPTDT+YG AC A +++A+ + YD KGR    PLAICVG++
Sbjct  67   VKALKEGHIVAVPTDTIYGLACLAQNSDAIRKTYDTKGRNGQKPLAICVGEI  118



>ref|XP_002112428.1| hypothetical protein TRIADDRAFT_25776 [Trichoplax adhaerens]
 gb|EDV24538.1| hypothetical protein TRIADDRAFT_25776, partial [Trichoplax adhaerens]
Length=219

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  492  EAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             AA E++++GN+IA+PTDT+YG A  A    AV+++Y+ KGR+  NP++ICVGDV
Sbjct  3    SAAKESLQAGNIIALPTDTIYGIAALAQLPNAVDKLYNTKGRRRDNPISICVGDV  57



>ref|XP_002059453.1| GJ18829 [Drosophila virilis]
 gb|EDW58865.1| GJ18829 [Drosophila virilis]
Length=259

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = +3

Query  429  MDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDI  608
            M  + +T    +   A+ D  + A + +  G VI +PTDT+YG ACDA + EA+ R+Y+I
Sbjct  30   MQTKQQTQPTPVCAVASLDALKLAEQCLHLGQVIGLPTDTVYGLACDANNEEAIQRLYEI  89

Query  609  KGRKYTNPLAICVGDV  656
            KGR    P+AICV ++
Sbjct  90   KGRDEHKPVAICVNNI  105



>ref|XP_005298513.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Chrysemys 
picta bellii]
Length=295

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+ A++ G ++AVPTDT+YG A  A S++A+ +IY++KGR    PLAIC+GDV
Sbjct  89   AAVSALREGGLVAVPTDTIYGIAALAQSSQAIKKIYNLKGRNGGKPLAICLGDV  142



>ref|XP_008473202.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Diaphorina 
citri]
Length=245

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  489  AEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A  A + +K G V+A+PTDTLYG ACDA +++A+N +Y+IK R    PLAICV ++
Sbjct  37   ALLAAQCLKKGCVVALPTDTLYGLACDATNSKAINILYEIKKRDVNKPLAICVSEI  92



>ref|XP_006077666.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Bubalus 
bubalis]
Length=326

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  +EA+  +Y +KGR  T PLA+C+G V
Sbjct  120  AAVAELRAGAVVAVPTDTLYGLACSASCSEALGAVYRVKGRSETKPLAVCLGRV  173



>ref|XP_002589778.1| hypothetical protein BRAFLDRAFT_90451 [Branchiostoma floridae]
 gb|EEN45789.1| hypothetical protein BRAFLDRAFT_90451 [Branchiostoma floridae]
Length=160

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 61/101 (60%), Gaps = 9/101 (9%)
 Frame = +3

Query  375  KLGQRKRRSLVGVSVKTKMDLRVET---NRMGMVQPATEDYAE----AAIEAIKSGNVIA  533
            KL Q+KR S   V + T++ LR  T    +M  +    +D  E     A +++++GN+IA
Sbjct  57   KLDQQKRMS--TVFLPTRILLRSCTGISRKMAKIIKLDDDMLEKQLSMAAKSLQAGNIIA  114

Query  534  VPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            VPTDT+YG A  A S EAV +IY IKGR  + P+AI V +V
Sbjct  115  VPTDTIYGLAGLAQSTEAVEQIYAIKGRNSSKPVAISVAEV  155



>ref|XP_004324709.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Tursiops 
truncatus]
Length=279

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  +EA+  +Y +KGR  T PLA+C+G V
Sbjct  73   AAVAELRAGAVVAVPTDTLYGLACSASCSEALGVVYRVKGRSETKPLAVCLGRV  126



>ref|XP_006134308.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Pelodiscus 
sinensis]
Length=216

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +3

Query  480  EDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            ++   A +  ++ G ++AVPTDT+YG AC A S++A+  IY++KGR    PLAIC+GDV
Sbjct  5    QEILNATVTVLQEGGLVAVPTDTVYGIACLAQSSQAIKNIYNLKGRNGGKPLAICLGDV  63



>ref|XP_001974938.1| GG20842 [Drosophila erecta]
 gb|EDV55338.1| GG20842 [Drosophila erecta]
Length=251

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 52/95 (55%), Gaps = 4/95 (4%)
 Frame = +3

Query  384  QRKRRSLVGVSVKTKMDLRVETNRMGMVQPATEDYAEAAI----EAIKSGNVIAVPTDTL  551
            Q+    LV  S       R++     +  P      EAA+    + + SG VIA+PTDT+
Sbjct  5    QKHLLRLVHASRHHHTSSRMQHQASELRTPVCPVGDEAALRLARQCLLSGQVIALPTDTV  64

Query  552  YGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            YG ACDA +  A+ R+Y+IKGR    P+AICV ++
Sbjct  65   YGLACDANNETAIQRLYEIKGRDEHKPVAICVHNI  99



>ref|XP_308435.3| AGAP007397-PA [Anopheles gambiae str. PEST]
 gb|EAA04653.3| AGAP007397-PA [Anopheles gambiae str. PEST]
Length=272

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 8/80 (10%)
 Frame = +3

Query  417  VKTKMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNR  596
            VK +    + TNR        +D    A+  +++G VIA+PTDT+YG  C A + EA++R
Sbjct  52   VKEQESKVISTNR--------KDAKAIAVAKLQAGEVIAIPTDTVYGLTCSANNPEAIHR  103

Query  597  IYDIKGRKYTNPLAICVGDV  656
            +Y+IKGR    P+AICV  +
Sbjct  104  LYNIKGRHELKPVAICVASI  123



>ref|XP_002091655.1| GE13782 [Drosophila yakuba]
 gb|EDW91367.1| GE13782 [Drosophila yakuba]
Length=251

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +3

Query  480  EDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            E   + A + + SG VIA+PTDT+YG ACDA +  A+ R+Y+IKGR    P+AICV ++
Sbjct  41   EAALQLARQCLLSGQVIALPTDTVYGLACDANNETAIQRLYEIKGRDEHKPVAICVHNI  99



>ref|XP_010958164.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Camelus 
bactrianus]
Length=277

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  +EA++ +Y IKGR    PLA+C+G V
Sbjct  73   AAVAEMRAGAVVAVPTDTLYGLACSASCSEALSAVYRIKGRNEIKPLAVCLGRV  126



>ref|XP_005234937.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Falco 
peregrinus]
Length=228

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  483  DYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            ++  AA+ A+++G ++AVPTDT+YG AC A  + AV  IY +KGR    PLAIC+GDV
Sbjct  20   EWGAAAVGALQAGGLVAVPTDTVYGVACLAQDSGAVRSIYSLKGRNGRKPLAICLGDV  77



>ref|XP_001987565.1| GH19895 [Drosophila grimshawi]
 gb|EDW02432.1| GH19895 [Drosophila grimshawi]
Length=250

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 7/68 (10%)
 Frame = +3

Query  474  ATEDYAEAAIEAIKS-------GNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNP  632
            +T  YA  A+ A+K        G VIA+PTDT+YG ACDA + EA+ R+Y+IKGR    P
Sbjct  28   STPVYAVDALNALKLAEQCLQLGKVIALPTDTVYGLACDANNEEAIQRLYEIKGRDAHKP  87

Query  633  LAICVGDV  656
            +AICV  +
Sbjct  88   VAICVNTI  95



>ref|XP_003462302.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Cavia 
porcellus]
Length=279

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 6/72 (8%)
 Frame = +3

Query  459  GMVQPATEDYA------EAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRK  620
            G VQ A+ + A       AA+  +++G V+AVPTDTLYG AC A  + A+  +Y +KGR 
Sbjct  55   GAVQAASPERAGWTEALRAAVAELRAGAVVAVPTDTLYGLACSASCSAALGAVYRLKGRS  114

Query  621  YTNPLAICVGDV  656
             T PLA+C+G V
Sbjct  115  GTKPLAVCLGRV  126



>ref|XP_002004296.1| GI19851 [Drosophila mojavensis]
 gb|EDW08231.1| GI19851 [Drosophila mojavensis]
Length=228

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A + ++ G VIA+PTDT+YG ACDA + +A+ R+Y+IKGR    P+AICV ++
Sbjct  23   AEQCLQLGKVIALPTDTVYGLACDANNEQAIQRLYEIKGRDEHKPVAICVNNI  75



>ref|XP_004266484.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Orcinus 
orca]
Length=279

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  +EA+  +Y +KGR  + PLA+C+G V
Sbjct  73   AAVAELRAGAVVAVPTDTLYGLACSASCSEALGVVYRVKGRSESKPLAVCLGRV  126



>ref|NP_001015837.1| yrdC N(6)-threonylcarbamoyltransferase domain containing [Xenopus 
(Silurana) tropicalis]
 gb|AAH90125.1| yrdC domain containing [Xenopus (Silurana) tropicalis]
Length=238

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +3

Query  480  EDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            ++    ++  ++ G VIAVPTDT+YG AC A ++++++ IY++KGR  T PLAICVG+V
Sbjct  30   KEILNTSLGILQQGGVIAVPTDTIYGIACLAQNSQSISNIYNVKGRNGTKPLAICVGNV  88



>gb|EGI58189.1| YrdC domain-containing protein, mitochondrial [Acromyrmex echinatior]
Length=263

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A+E ++ G VIAVPTDT+YG AC A  + A+ R+Y+IK R    PLAIC+ +V
Sbjct  60   AVELLQQGKVIAVPTDTVYGLACLAADSHAIQRLYEIKQRDERKPLAICLSNV  112



>ref|XP_011066129.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Acromyrmex 
echinatior]
Length=271

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A+E ++ G VIAVPTDT+YG AC A  + A+ R+Y+IK R    PLAIC+ +V
Sbjct  68   AVELLQQGKVIAVPTDTVYGLACLAADSHAIQRLYEIKQRDERKPLAICLSNV  120



>ref|XP_004851055.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Heterocephalus glaber]
Length=239

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 6/72 (8%)
 Frame = +3

Query  459  GMVQPATEDYA------EAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRK  620
            G VQ A+ + A       AA+  +++G V+AVPTDTLYG AC A  + A++ +Y +KGR 
Sbjct  55   GAVQAASPERAGWTEALRAAVAELRAGAVVAVPTDTLYGLACSASCSAALDAVYRLKGRS  114

Query  621  YTNPLAICVGDV  656
               PLA+C+G V
Sbjct  115  EAKPLAVCLGRV  126



>ref|WP_013933582.1| translation factor Sua5 [Zymomonas mobilis]
 gb|AEI37183.1| Sua5/YciO/YrdC/YwlC family protein [Zymomonas mobilis subsp. 
pomaceae ATCC 29192]
Length=324

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +3

Query  447  TNRMG-MVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKY  623
            ++R+G +V+P  E   + A+  I+SG  +AVPT+T+YG A DA S EAV RIY  KGR  
Sbjct  5    SSRLGTVVRPCDEAGIKEAVSLIRSGLPVAVPTETVYGLAADAASNEAVARIYQAKGRPS  64

Query  624  TNPLAICVGDV  656
             NPL + V D+
Sbjct  65   FNPLIVHVADI  75



>ref|XP_008149538.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Eptesicus 
fuscus]
Length=289

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 8/80 (10%)
 Frame = +3

Query  435  LRVETNRMGMVQPATEDYA------EAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNR  596
            LR+  N  G V+ A+ + A       AA+  ++SG V+AVPTDTLYG AC A  + A++ 
Sbjct  49   LRLPGN--GAVRAASPERAGWTEALRAAVAELRSGAVVAVPTDTLYGLACSASCSAALDA  106

Query  597  IYDIKGRKYTNPLAICVGDV  656
            +Y +KGR    PLA+C+G V
Sbjct  107  VYRLKGRSEAKPLAVCLGRV  126



>ref|XP_004078322.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Oryzias latipes]
Length=265

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +3

Query  477  TEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            +++  +  ++A++ G+++AVPTDT+YG AC A ++EAV +IY +KGR    PLAICV ++
Sbjct  57   SDEVLKCTVKALQDGHIVAVPTDTIYGLACLAQNSEAVRKIYAVKGRNGQKPLAICVREI  116



>ref|WP_014557116.1| tRNA threonylcarbamoyladenosine biosynthesis protein [Haloquadratum 
walsbyi]
 ref|YP_005841413.1| threonylcarbamoyl-AMP synthase YrdC [Haloquadratum walsbyi C23]
 emb|CCC41846.1| threonylcarbamoyl-AMP synthase YrdC [Haloquadratum walsbyi C23]
Length=235

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  483  DYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            D   AA+ AIKSG ++  PT+T+YG   DA + +A+ R++D KGR Y NPL++ V  V
Sbjct  33   DMLSAAVRAIKSGELVVYPTETVYGLGVDALNPDAIKRVFDTKGRTYDNPLSLAVESV  90



>ref|XP_011483925.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X1 [Oryzias latipes]
Length=266

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +3

Query  477  TEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            +++  +  ++A++ G+++AVPTDT+YG AC A ++EAV +IY +KGR    PLAICV ++
Sbjct  58   SDEVLKCTVKALQDGHIVAVPTDTIYGLACLAQNSEAVRKIYAVKGRNGQKPLAICVREI  117



>ref|XP_004851054.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X1 [Heterocephalus glaber]
Length=279

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 6/72 (8%)
 Frame = +3

Query  459  GMVQPATEDYA------EAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRK  620
            G VQ A+ + A       AA+  +++G V+AVPTDTLYG AC A  + A++ +Y +KGR 
Sbjct  55   GAVQAASPERAGWTEALRAAVAELRAGAVVAVPTDTLYGLACSASCSAALDAVYRLKGRS  114

Query  621  YTNPLAICVGDV  656
               PLA+C+G V
Sbjct  115  EAKPLAVCLGRV  126



>ref|XP_006867616.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Chrysochloris 
asiatica]
Length=280

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  + A+  +Y +KGR  T PLA+C+G V
Sbjct  73   AAVAELRAGAVVAVPTDTLYGLACSASCSAALEDVYRLKGRSETKPLAVCLGRV  126



>ref|XP_002063044.1| GK21591 [Drosophila willistoni]
 gb|EDW74030.1| GK21591 [Drosophila willistoni]
Length=222

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A + + +G +IA+PTDT+YG ACDA + +A+ R+Y+IKGR    P+AICV ++
Sbjct  18   ARQCLLAGQIIALPTDTVYGLACDANNEQAIQRLYEIKGRDEHKPVAICVHNI  70



>ref|XP_003074421.1| yrdC protein-related (ISS), partial [Ostreococcus tauri]
Length=239

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  483  DYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            D    A+ A++ G VIAVPTDT+YGFA  A    AV R+Y+IKGRK T  +AI VGDV
Sbjct  31   DAVALAVGALRRGGVIAVPTDTIYGFAARAEDGAAVRRLYEIKGRKATVAVAIAVGDV  88



>ref|WP_045648539.1| translation factor Sua5 [Hoeflea sp. BRH_c9]
 gb|KJS15965.1| translation factor Sua5 [Hoeflea sp. BRH_c9]
Length=323

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  456  MGMVQPATE-DYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNP  632
            M    P T+ D  E AIEA++ G+ +AVPT+T+YG A DA +AEA+  IY+ KGR   NP
Sbjct  1    MARTLPITDPDALELAIEALRRGDPVAVPTETVYGLAADATNAEAITAIYEAKGRPRFNP  60

Query  633  LAICVGDV  656
            L   V D+
Sbjct  61   LIAHVADI  68



>ref|XP_010574599.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Haliaeetus 
leucocephalus]
Length=288

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +3

Query  471  PATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVG  650
            P   +   AA+ A+++G ++AVPTDT+YG AC A  + AV  IY +KGR    PLAIC+G
Sbjct  76   PGWREAVAAAVGALQAGGLVAVPTDTVYGVACLAQDSGAVRSIYSLKGRNGRKPLAICLG  135

Query  651  DV  656
            DV
Sbjct  136  DV  137



>ref|WP_011572876.1| DNA binding protein; translation factor [Haloquadratum walsbyi]
 ref|YP_659368.1| DNA binding protein; translation factor [Haloquadratum walsbyi 
DSM 16790]
 emb|CAJ53794.1| threonylcarbamoyl-AMP synthase YrdC [Haloquadratum walsbyi DSM 
16790]
Length=235

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  483  DYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            D   AA+ AIKSG ++  PT+T+YG   DA + +A+ R++D KGR Y NPL++ V  V
Sbjct  33   DVLSAAVRAIKSGELVVYPTETVYGLGVDALNPDAIKRVFDTKGRTYDNPLSLAVESV  90



>ref|XP_006099198.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Myotis 
lucifugus]
Length=281

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 8/80 (10%)
 Frame = +3

Query  435  LRVETNRMGMVQPATEDYA------EAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNR  596
            LR+  N  G V+ A+ + A       AA+  ++SG V+AVPTDTLYG AC A  + A++ 
Sbjct  49   LRLPGN--GAVRAASPERAGWTEALRAAVGELRSGAVVAVPTDTLYGLACSASCSAALDA  106

Query  597  IYDIKGRKYTNPLAICVGDV  656
            +Y +KGR    PLA+C+G V
Sbjct  107  VYRLKGRSEAKPLAVCLGRV  126



>ref|XP_004907262.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Heterocephalus 
glaber]
Length=243

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +3

Query  486  YAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            +  AA+  +++G V+AVPTDTLYG AC A  + A++ +Y +KGR    PLA+C+G V
Sbjct  34   FLRAAVAELRAGAVVAVPTDTLYGLACSASCSAALDAVYRLKGRSEAKPLAVCLGRV  90



>ref|XP_001959177.1| GF12752 [Drosophila ananassae]
 gb|EDV35999.1| GF12752 [Drosophila ananassae]
Length=342

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  423  TKMDLRVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIY  602
            T M  ++E  +  +     E     A + + +G VIA+PTDT+YG ACDA + +A+ R+Y
Sbjct  113  TAMQSQMEEKKTTVCPVGDETAIPLARQCLLNGEVIALPTDTVYGLACDANNEQAIQRLY  172

Query  603  DIKGRKYTNPLAICVGDV  656
            +IKGR    P+AICV ++
Sbjct  173  EIKGRDEHKPVAICVHNI  190



>ref|XP_001659198.1| AAEL001412-PA [Aedes aegypti]
 gb|EAT47485.1| AAEL001412-PA [Aedes aegypti]
Length=251

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGD  653
            A   ++SG VIA+PTDT+YG AC A   +A+ R+Y IKGR+   P+AICV D
Sbjct  50   AANLLESGKVIALPTDTVYGLACSANDPKAIQRLYAIKGREEKKPVAICVAD  101



>emb|CEF96720.1| DHBP synthase RibB-like alpha/beta domain [Ostreococcus tauri]
Length=275

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  483  DYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            D    A+ A++ G VIAVPTDT+YGFA  A    AV R+Y+IKGRK T  +AI VGDV
Sbjct  68   DAVALAVGALRRGGVIAVPTDTIYGFAARAEDGAAVRRLYEIKGRKATVAVAIAVGDV  125



>ref|XP_005058531.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Ficedula 
albicollis]
Length=277

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 14/73 (19%)
 Frame = +3

Query  438  RVETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGR  617
            R E +R+GM               +K+G ++AVPTDT+YG AC A  + AV  IY +KGR
Sbjct  68   RTEASRLGM--------------QLKAGEIVAVPTDTVYGVACLAQDSAAVRSIYSLKGR  113

Query  618  KYTNPLAICVGDV  656
                PLAIC+GDV
Sbjct  114  NGAKPLAICLGDV  126



>ref|XP_004591753.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Ochotona 
princeps]
Length=229

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  489  AEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            ++ A  ++++G V+AVPTDTLYG AC A  + A++ +Y +KGR  T PLA+C+G V
Sbjct  21   SDGAAGSLRAGAVVAVPTDTLYGLACSASCSAALDAVYRLKGRSETKPLAVCLGRV  76



>ref|WP_011304401.1| hypothetical protein [Ehrlichia canis]
 gb|AAZ68323.1| translation factor SUA5 [Ehrlichia canis str. Jake]
Length=198

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AI+A+ + ++IA PT+T+Y  A DA S EA+ +IY IKGR Y  PL++ VG++
Sbjct  5    AIQALNNKHLIAFPTETVYALAGDAYSIEAIQKIYQIKGRSYNKPLSLLVGNI  57



>gb|AAH88928.1| LOC496333 protein, partial [Xenopus laevis]
Length=204

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  507  AIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             ++ G VI VPTDT+YG AC A ++++++ IY++KGR  T PLAICVG+V
Sbjct  5    GLQQGGVIGVPTDTIYGIACLAQNSQSISNIYNVKGRNGTKPLAICVGNV  54



>ref|XP_002082361.1| GD25261 [Drosophila simulans]
 gb|EDX07946.1| GD25261 [Drosophila simulans]
Length=248

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 4/59 (7%)
 Frame = +3

Query  492  EAAIEAIKS----GNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            EAA++  +     G VIA+PTDT+YG ACDA +  A+ R+Y+IKGR    P+AICV ++
Sbjct  38   EAALQLARQCLLGGQVIALPTDTVYGLACDANNETAIQRLYEIKGRDEHKPVAICVHNI  96



>ref|XP_005372448.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like, 
partial [Microtus ochrogaster]
Length=209

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 45/72 (63%), Gaps = 6/72 (8%)
 Frame = +3

Query  459  GMVQPATEDYA------EAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRK  620
            G VQ A+ + +       AA+  +++G V+AVPTDTLYG AC A  + A+  +Y +KGR 
Sbjct  55   GAVQAASPERSGWTEALRAAVAELRAGAVVAVPTDTLYGLACSASCSAALGCVYRLKGRS  114

Query  621  YTNPLAICVGDV  656
               PLA+C+G V
Sbjct  115  EAKPLAVCLGRV  126



>ref|XP_011866838.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Vollenhovia emeryi]
Length=256

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A E ++ G VIA+PTDT+YG AC A +++AV R+Y IK R    PLAIC+ +V
Sbjct  53   AAEMLRQGKVIAIPTDTVYGLACLATNSQAVQRLYKIKRRSEQKPLAICLSNV  105



>ref|XP_007538151.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Erinaceus 
europaeus]
Length=255

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 3/65 (5%)
 Frame = +3

Query  471  PATEDYAEA---AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAI  641
            P+   + EA   A+  +++G V+AVPTDTLYG AC A  + A+  +Y +KGR    PLA+
Sbjct  37   PSRSGWTEALRAAVAELRAGAVVAVPTDTLYGLACSASCSAALGAVYRLKGRSQAKPLAV  96

Query  642  CVGDV  656
            C+G V
Sbjct  97   CLGRV  101



>gb|AAH73618.1| LOC398509 protein [Xenopus laevis]
Length=236

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +3

Query  480  EDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            ++    ++  ++ G VI VPTDT+YG AC A ++++++ IY++KGR  T PLAICVG+V
Sbjct  28   KEILNTSLGILQQGGVIGVPTDTIYGIACLAQNSQSISNIYNVKGRNGTKPLAICVGNV  86



>ref|NP_001082498.2| yrdC domain containing [Xenopus laevis]
Length=259

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +3

Query  480  EDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            ++    ++  ++ G VI VPTDT+YG AC A ++++++ IY++KGR  T PLAICVG+V
Sbjct  51   KEILNTSLGILQQGGVIGVPTDTIYGIACLAQNSQSISNIYNVKGRNGTKPLAICVGNV  109



>ref|XP_011866837.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X1 [Vollenhovia emeryi]
Length=275

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A E ++ G VIA+PTDT+YG AC A +++AV R+Y IK R    PLAIC+ +V
Sbjct  72   AAEMLRQGKVIAIPTDTVYGLACLATNSQAVQRLYKIKRRSEQKPLAICLSNV  124



>ref|XP_011422154.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
[Crassostrea gigas]
Length=236

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A E++ SG VIAVPTDT+YG      ++EAV+R+Y+IK R Y+ PLAI V ++
Sbjct  35   ATESLLSGKVIAVPTDTIYGITALVQNSEAVDRMYNIKNRDYSKPLAISVAEI  87



>ref|XP_011561358.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X1 [Plutella xylostella]
 ref|XP_011561359.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like 
isoform X1 [Plutella xylostella]
Length=247

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  438  RVETNRMGMVQPATEDYAEA-AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKG  614
            +++ ++M  +    ++ A   A E + SG VIAVPTDT+YG AC A    A+ R+Y IKG
Sbjct  23   KMKVDKMAPIIQCYDELAHVKAAEYLGSGRVIAVPTDTIYGLACSANCPTAIQRLYSIKG  82

Query  615  RKYTNPLAICVGDV  656
            R    P+AICV  V
Sbjct  83   RDSAKPVAICVTSV  96



>ref|XP_011695376.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Wasmannia 
auropunctata]
Length=274

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A E ++ G VIAVPTDT+YG AC A ++ AV R+Y+IK R    PLAIC+G+V
Sbjct  69   AAEMLRQGKVIAVPTDTVYGLACLADNSRAVQRLYEIKRRDGGKPLAICLGNV  121



>ref|WP_041302033.1| translation factor Sua5 [Hirschia baltica]
Length=306

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +3

Query  462  MVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAI  641
            M+Q  + D  E A + I+ G ++A+PT+T+YG A DA + EAV RIY  KGR   NPL  
Sbjct  1    MIQSPSHDTMEQAAQIIRDGGIVAIPTETVYGLAADATNGEAVARIYAAKGRPSFNPLIS  60

Query  642  CVGDV  656
             V D+
Sbjct  61   HVNDM  65



>ref|XP_004402694.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Odobenus 
rosmarus divergens]
Length=276

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  + A+  +Y +KGR    PLA+C+G V
Sbjct  73   AAVAELRAGAVVAVPTDTLYGLACSASCSAALGAVYRLKGRSQAKPLAVCLGRV  126



>ref|XP_793502.2| PREDICTED: yrdC domain-containing protein, mitochondrial [Strongylocentrotus 
purpuratus]
Length=246

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICV  647
            A  ++ SGNVI+VPTDT+YG A  A SAEAV ++Y++KGR    P+AIC+
Sbjct  45   AANSLMSGNVISVPTDTIYGLAALAQSAEAVEKLYEVKGRNGNKPIAICI  94



>ref|XP_012058761.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Atta 
cephalotes]
Length=271

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A E ++ G VIAVPTDT+YG AC A ++ AV R+Y+IK R    PLA+C+ +V
Sbjct  68   AAELLRQGKVIAVPTDTVYGLACLAANSHAVQRLYEIKQRDERKPLAVCLSNV  120



>ref|XP_010975801.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Camelus 
dromedarius]
Length=200

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +3

Query  510  IKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            +++G V+AVPTDTLYG AC A  +EA++ +Y IKGR    PLA+C+G V
Sbjct  1    MRAGAVVAVPTDTLYGLACSASCSEALSAVYRIKGRNEIKPLAVCLGRV  49



>ref|XP_004741611.1| PREDICTED: yrdC domain-containing protein, mitochondrial, partial 
[Mustela putorius furo]
Length=207

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  + A+  +Y +KGR    PLA+C+G V
Sbjct  4    AAVAELRAGAVVAVPTDTLYGLACSASCSAALGAVYRLKGRSEAKPLAVCLGRV  57



>gb|EHB17138.1| YrdC domain-containing protein, mitochondrial [Heterocephalus 
glaber]
Length=276

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  + A++ +Y +KGR    PLA+C+G V
Sbjct  70   AAVAELRAGAVVAVPTDTLYGLACSASCSAALDAVYRLKGRSEAKPLAVCLGRV  123



>ref|XP_006739873.1| PREDICTED: yrdC domain-containing protein, mitochondrial, partial 
[Leptonychotes weddellii]
Length=210

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  + A+  +Y +KGR    PLA+C+G V
Sbjct  7    AAVAELRAGAVVAVPTDTLYGLACSASCSAALGAVYRLKGRSEAKPLAVCLGRV  60



>ref|XP_001638711.1| predicted protein [Nematostella vectensis]
 gb|EDO46648.1| predicted protein [Nematostella vectensis]
Length=224

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +3

Query  480  EDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            E+   AA+ ++K G+VIA+PTDT+YG A    S  AV ++Y+IKGR    P+AI VG++
Sbjct  17   EELIHAAVASLKLGHVIALPTDTIYGIAALTQSCNAVQKLYEIKGRHQEKPVAIAVGNI  75



>ref|XP_008848473.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Nannospalax 
galili]
Length=259

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 6/74 (8%)
 Frame = +3

Query  453  RMGMVQPATEDYA------EAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKG  614
            R+  VQ A+ + A       AA+  +++G V+AVPTDTLYG AC A  + A+  +Y +KG
Sbjct  32   RLLPVQTASPEPAGWSEALRAAVAELRAGAVVAVPTDTLYGLACSASCSAALGAVYRLKG  91

Query  615  RKYTNPLAICVGDV  656
            R    PLA+C+G V
Sbjct  92   RSEAKPLAVCLGRV  105



>ref|XP_008516124.1| PREDICTED: yrdC domain-containing protein, mitochondrial, partial 
[Equus przewalskii]
Length=227

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  + A+  +Y +KGR    PLA+C+G V
Sbjct  20   AAVAELRAGAVVAVPTDTLYGLACSASCSAALGAVYRLKGRSEAKPLAVCLGRV  73



>ref|XP_010721742.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Meleagris 
gallopavo]
Length=270

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  507  AIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A++ G ++AVPTDT+YG AC A  + AV  IY +KGR  T PLAIC+GDV
Sbjct  70   ALQQGGLVAVPTDTVYGVACLAQDSRAVRSIYSLKGRNGTKPLAICLGDV  119



>ref|XP_003788199.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Otolemur 
garnettii]
Length=275

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  + A+  +Y +KGR    PLA+C+G V
Sbjct  72   AAVAELRAGAVLAVPTDTLYGLACSASCSAALRDVYRLKGRSEAKPLAVCLGRV  125



>ref|XP_005084417.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Mesocricetus 
auratus]
Length=280

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (64%), Gaps = 6/72 (8%)
 Frame = +3

Query  459  GMVQPATEDYA------EAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRK  620
            G VQ A+ + +       AA+  +++G V+AVPTDTLYG AC A  + A++ +Y +KGR 
Sbjct  55   GAVQAASPERSGWTEALRAAVAELRAGAVVAVPTDTLYGLACSASCSAALDCVYRLKGRS  114

Query  621  YTNPLAICVGDV  656
               PLA+C+G V
Sbjct  115  EAKPLAVCLGRV  126



>ref|XP_006212778.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Vicugna 
pacos]
Length=222

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +3

Query  510  IKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            +++G V+AVPTDTLYG AC A  +EA++ +Y IKGR    PLA+C+G V
Sbjct  19   LRAGAVVAVPTDTLYGLACSASCSEALSAVYRIKGRNEIKPLAVCLGRV  67



>ref|XP_001866124.1| ischemia/reperfusion inducible protein [Culex quinquefasciatus]
 gb|EDS42908.1| ischemia/reperfusion inducible protein [Culex quinquefasciatus]
Length=242

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A   ++SG VI +PTDT+YG AC A    A+ ++YDIKGR  T P+AICV +V
Sbjct  38   AANLLESGKVIGLPTDTVYGLACSANDPAAIKKLYDIKGRICTKPIAICVPEV  90



>gb|EZA54788.1| YrdC domain-containing protein, mitochondrial, partial [Cerapachys 
biroi]
Length=253

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A E ++ G VIA+PTDT+YG AC A +  A+ R+Y+IK R    PLAIC+ +V
Sbjct  50   AAELLQQGKVIAIPTDTVYGLACSASNYRAIQRMYEIKRRDENKPLAICLSNV  102



>ref|XP_011209920.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Bactrocera 
dorsalis]
Length=223

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
             A+E I  G VI +PTDT+YG AC+A + +A+ ++YDIKGR    P+AICV ++
Sbjct  20   TAVECILDGEVIGLPTDTVYGLACNANNEKAIQKLYDIKGRDCYKPVAICVKNL  73



>ref|XP_011338216.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Cerapachys 
biroi]
Length=272

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A E ++ G VIA+PTDT+YG AC A +  A+ R+Y+IK R    PLAIC+ +V
Sbjct  69   AAELLQQGKVIAIPTDTVYGLACSASNYRAIQRMYEIKRRDENKPLAICLSNV  121



>ref|XP_004679498.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Condylura 
cristata]
Length=280

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  + A+  +Y +KGR    PLA+C+G V
Sbjct  73   AAVAELRAGAVVAVPTDTLYGLACSASCSAALGAVYRLKGRSEAKPLAVCLGRV  126



>ref|XP_007945808.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Orycteropus 
afer afer]
Length=280

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 3/66 (5%)
 Frame = +3

Query  468  QPATEDYAEA---AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLA  638
             P    +AEA   A+  +++G V+AVPTDTLYG AC A  + A+  +Y +KGR    PLA
Sbjct  61   SPEHAGWAEALRAAVAELRAGAVVAVPTDTLYGLACSANCSAALEDVYRLKGRSEAKPLA  120

Query  639  ICVGDV  656
            +C+G V
Sbjct  121  VCLGRV  126



>ref|XP_001360991.2| GA17233 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL25567.2| GA17233 [Drosophila pseudoobscura pseudoobscura]
Length=335

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +3

Query  441  VETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRK  620
            VE  +  + Q       + A + +  G VIA+PTDT+YG ACDA +  A+ R+Y+IKGR 
Sbjct  108  VEKTKTPVCQVEDRAALKVARQCLLGGQVIALPTDTVYGLACDANNEHAIQRMYEIKGRD  167

Query  621  YTNPLAICVGDV  656
               P+AICV ++
Sbjct  168  EHKPVAICVNNI  179



>gb|AAH88428.1| Yrdc protein [Rattus norvegicus]
Length=272

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = +3

Query  444  ETNRMGMVQPATEDYAEA---AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKG  614
            E+  +    P    + EA   A+  +++G V+AVPTDTLYG AC A  + A++ +Y +KG
Sbjct  45   ESEAVEAASPERSGWTEALRAAVAELRAGAVVAVPTDTLYGLACSASCSAALSCVYRLKG  104

Query  615  RKYTNPLAICVGDV  656
            R    PLA+C+G V
Sbjct  105  RSEAKPLAVCLGRV  118



>ref|XP_011379662.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Pteropus vampyrus]
Length=269

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  + A+  +Y +KGR    PLA+C+G V
Sbjct  73   AAVAELRAGAVVAVPTDTLYGLACSANCSAALGAVYRLKGRSEAKPLAVCLGRV  126



>ref|XP_002017926.1| GL17434 [Drosophila persimilis]
 gb|EDW35765.1| GL17434 [Drosophila persimilis]
Length=335

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +3

Query  441  VETNRMGMVQPATEDYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRK  620
            VE  +  + Q       + A + +  G VIA+PTDT+YG ACDA +  A+ R+Y+IKGR 
Sbjct  108  VEKTKTPVCQVEDRAALKVARQCLLGGQVIALPTDTVYGLACDANNEHAIQRMYEIKGRD  167

Query  621  YTNPLAICVGDV  656
               P+AICV ++
Sbjct  168  EHKPVAICVNNI  179



>ref|XP_006924284.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Pteropus alecto]
Length=269

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  + A+  +Y +KGR    PLA+C+G V
Sbjct  73   AAVAELRAGAVVAVPTDTLYGLACSANCSAALGAVYRLKGRSEAKPLAVCLGRV  126



>ref|XP_004372146.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Trichechus 
manatus latirostris]
Length=277

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  + A+  +Y +KGR    PLA+C+G V
Sbjct  70   AAVAELRAGAVVAVPTDTLYGLACSASCSAALGDVYRLKGRSEAKPLAVCLGRV  123



>gb|EDL80408.1| ischemia/reperfusion inducible protein [Rattus norvegicus]
Length=263

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = +3

Query  444  ETNRMGMVQPATEDYAEA---AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKG  614
            E+  +    P    + EA   A+  +++G V+AVPTDTLYG AC A  + A++ +Y +KG
Sbjct  36   ESEAVEAASPERSGWTEALRAAVAELRAGAVVAVPTDTLYGLACSASCSAALSCVYRLKG  95

Query  615  RKYTNPLAICVGDV  656
            R    PLA+C+G V
Sbjct  96   RSEAKPLAVCLGRV  109



>ref|NP_783194.2| yrdC domain-containing protein, mitochondrial precursor [Rattus 
norvegicus]
 sp|Q499R4.1|YRDC_RAT RecName: Full=YrdC domain-containing protein, mitochondrial; 
AltName: Full=Ischemia/reperfusion-inducible protein homolog; 
Flags: Precursor [Rattus norvegicus]
 gb|AAH99797.1| YrdC domain containing (E.coli) [Rattus norvegicus]
Length=280

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = +3

Query  444  ETNRMGMVQPATEDYAEA---AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKG  614
            E+  +    P    + EA   A+  +++G V+AVPTDTLYG AC A  + A++ +Y +KG
Sbjct  53   ESEAVEAASPERSGWTEALRAAVAELRAGAVVAVPTDTLYGLACSASCSAALSCVYRLKG  112

Query  615  RKYTNPLAICVGDV  656
            R    PLA+C+G V
Sbjct  113  RSEAKPLAVCLGRV  126



>gb|EHJ79214.1| ischemia/reperfusion inducible protein [Danaus plexippus]
Length=296

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 3/74 (4%)
 Frame = +3

Query  441  VETNRMGMVQPATE--DYAEAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKG  614
            ++ ++M  + P  +   Y +AA E ++ G VIAVPTDT+YG AC A   EA+ ++Y IKG
Sbjct  73   MKIDKMASIFPCDDVSSYVKAA-EYLEKGEVIAVPTDTIYGLACSAKCPEAIKKLYTIKG  131

Query  615  RKYTNPLAICVGDV  656
            R    P+AICV  +
Sbjct  132  RDSIKPVAICVNSI  145



>ref|NP_001027444.1| CG33786 [Drosophila melanogaster]
 gb|AAL49123.1| RE55868p [Drosophila melanogaster]
 gb|AAF57437.2| CG33786 [Drosophila melanogaster]
 gb|ACL87010.1| CG33786-PA, partial [synthetic construct]
 gb|ACL91417.1| CG33786-PA [synthetic construct]
Length=248

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 4/59 (7%)
 Frame = +3

Query  492  EAAIEAIKS----GNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            EAA++  +     G VIA+PTDT+YG ACDA +  A+ ++Y+IKGR    P+AICV ++
Sbjct  38   EAALQLARQCLLGGQVIALPTDTVYGLACDANNETAIQQLYEIKGRDEHKPVAICVHNI  96



>ref|XP_003415357.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Loxodonta 
africana]
Length=280

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  + A+  +Y +KGR    PLA+C+G V
Sbjct  73   AAVAELRAGAVVAVPTDTLYGLACSASCSAALGDVYRLKGRSEAKPLAVCLGRV  126



>ref|XP_011642124.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X3 [Pogonomyrmex barbatus]
 ref|XP_011642125.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X3 [Pogonomyrmex barbatus]
Length=241

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A E +  G VIAVPTDT+YG AC A +++A+ R+Y+IK R+   PLAIC+  V
Sbjct  41   AAELLGQGKVIAVPTDTVYGLACLASNSDAIQRLYEIKQREERKPLAICLSSV  93



>ref|XP_004467160.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Dasypus 
novemcinctus]
Length=280

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  + A+  +Y +KGR    PLA+C+G V
Sbjct  73   AAVAELRAGAVVAVPTDTLYGLACSASCSAALGAVYRLKGRCKAKPLAVCLGSV  126



>ref|XP_011642123.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X2 [Pogonomyrmex barbatus]
Length=252

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A E +  G VIAVPTDT+YG AC A +++A+ R+Y+IK R+   PLAIC+  V
Sbjct  52   AAELLGQGKVIAVPTDTVYGLACLASNSDAIQRLYEIKQREERKPLAICLSSV  104



>ref|XP_006886653.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Elephantulus 
edwardii]
Length=280

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  + A+  +Y +KGR  T PLA+C+  V
Sbjct  73   AAVAELRAGAVVAVPTDTLYGLACSASCSAALGDVYRLKGRSETKPLAVCLSRV  126



>ref|XP_011642122.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X1 [Pogonomyrmex barbatus]
Length=268

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  498  AIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            A E +  G VIAVPTDT+YG AC A +++A+ R+Y+IK R+   PLAIC+  V
Sbjct  68   AAELLGQGKVIAVPTDTVYGLACLASNSDAIQRLYEIKQREERKPLAICLSSV  120



>ref|XP_006924283.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X1 [Pteropus alecto]
 ref|XP_011379661.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform 
X1 [Pteropus vampyrus]
 gb|ELK01947.1| YrdC domain-containing protein, mitochondrial [Pteropus alecto]
Length=280

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  + A+  +Y +KGR    PLA+C+G V
Sbjct  73   AAVAELRAGAVVAVPTDTLYGLACSANCSAALGAVYRLKGRSEAKPLAVCLGRV  126



>gb|KII65378.1| YrdC domain-containing protein, mitochondrial [Thelohanellus 
kitauei]
Length=157

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  492  EAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGD  653
            E A+  +  G VIA PTDTLYG  C    +E+++RIY IK R ++ PLAIC+ D
Sbjct  16   EKAVGVLTCGGVIAAPTDTLYGIGCLLSFSESIDRIYAIKKRDFSKPLAICISD  69



>emb|CDS23363.1| yrdC domain containing protein [Echinococcus granulosus]
Length=153

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  516  SGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICV  647
            SG VIAVPTDT+YG AC + S   ++RIY IKGR    P+AIC+
Sbjct  29   SGGVIAVPTDTIYGLACCSLSTRGIDRIYQIKGRDAAKPMAICL  72



>ref|XP_002034718.1| GM19771 [Drosophila sechellia]
 gb|EDW48731.1| GM19771 [Drosophila sechellia]
Length=325

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +3

Query  492  EAAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            + A + +  G VIA+PTDT+YG ACDA +  A+ R+Y+IKGR    P+AICV ++
Sbjct  119  QLARQCLLGGQVIALPTDTVYGLACDANNETAIQRLYEIKGRDEHKPVAICVHNI  173



>ref|XP_004665262.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Jaculus 
jaculus]
Length=273

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  AAIEAIKSGNVIAVPTDTLYGFACDACSAEAVNRIYDIKGRKYTNPLAICVGDV  656
            AA+  +++G V+AVPTDTLYG AC A  + A++ +Y  KGR    PLA+C+G V
Sbjct  66   AAVAELRAGAVVAVPTDTLYGLACSASCSAALDAVYRAKGRSEAKPLAVCLGRV  119



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1049455598775