BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10542

Length=724
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006361548.1|  PREDICTED: cullin-4-like                           288   2e-87   Solanum tuberosum [potatoes]
ref|XP_011096567.1|  PREDICTED: cullin-4-like                           286   1e-86   Sesamum indicum [beniseed]
ref|NP_001234356.1|  cullin 4                                           278   3e-84   
ref|XP_011085242.1|  PREDICTED: cullin-4                                276   7e-83   
gb|KJB66936.1|  hypothetical protein B456_010G166800                    273   3e-82   Gossypium raimondii
ref|XP_007025065.1|  Cullin-4B isoform 2                                270   3e-82   
gb|KJB66935.1|  hypothetical protein B456_010G166800                    273   5e-82   Gossypium raimondii
ref|XP_007025064.1|  Cullin-4B isoform 1                                271   3e-81   
ref|XP_009759464.1|  PREDICTED: cullin-4                                269   1e-80   Nicotiana sylvestris
ref|XP_009599227.1|  PREDICTED: cullin-4                                268   3e-80   Nicotiana tomentosiformis
gb|EYU43260.1|  hypothetical protein MIMGU_mgv1a001310mg                263   2e-78   Erythranthe guttata [common monkey flower]
gb|KJB69828.1|  hypothetical protein B456_011G044900                    262   4e-78   Gossypium raimondii
ref|XP_009360892.1|  PREDICTED: cullin-4                                263   4e-78   Pyrus x bretschneideri [bai li]
gb|KJB69827.1|  hypothetical protein B456_011G044900                    262   6e-78   Gossypium raimondii
gb|KHG10035.1|  Cullin-4 -like protein                                  261   2e-77   Gossypium arboreum [tree cotton]
ref|XP_008225565.1|  PREDICTED: cullin-4                                259   1e-76   Prunus mume [ume]
gb|KGN65538.1|  hypothetical protein Csa_1G435830                       245   1e-76   Cucumis sativus [cucumbers]
ref|XP_007214632.1|  hypothetical protein PRUPE_ppa001433mg             259   1e-76   Prunus persica
ref|XP_008349190.1|  PREDICTED: cullin-4-like                           253   1e-76   
gb|KHG21020.1|  Cullin-4 -like protein                                  256   7e-76   Gossypium arboreum [tree cotton]
gb|KJB68315.1|  hypothetical protein B456_010G238300                    252   4e-75   Gossypium raimondii
gb|KJB68319.1|  hypothetical protein B456_010G238300                    252   1e-74   Gossypium raimondii
ref|XP_006449702.1|  hypothetical protein CICLE_v10014310mg             253   1e-74   Citrus clementina [clementine]
gb|KDO78192.1|  hypothetical protein CISIN_1g003648mg                   252   1e-74   Citrus sinensis [apfelsine]
gb|KJB68318.1|  hypothetical protein B456_010G238300                    253   1e-74   Gossypium raimondii
ref|XP_006467459.1|  PREDICTED: cullin-4-like isoform X1                253   1e-74   Citrus sinensis [apfelsine]
ref|XP_006467460.1|  PREDICTED: cullin-4-like isoform X2                252   1e-74   
gb|KDO78190.1|  hypothetical protein CISIN_1g003648mg                   253   1e-74   Citrus sinensis [apfelsine]
ref|XP_006449703.1|  hypothetical protein CICLE_v10014310mg             253   2e-74   
gb|KDO78191.1|  hypothetical protein CISIN_1g003648mg                   253   2e-74   Citrus sinensis [apfelsine]
ref|XP_012072113.1|  PREDICTED: cullin-4                                249   3e-73   Jatropha curcas
ref|XP_006352972.1|  PREDICTED: cullin-4-like                           247   1e-72   Solanum tuberosum [potatoes]
ref|XP_008371761.1|  PREDICTED: cullin-4                                248   2e-72   
gb|AAL27655.2|  putative cullin protein                                 247   3e-72   Olea europaea
ref|XP_011013417.1|  PREDICTED: cullin-4-like                           246   3e-72   Populus euphratica
gb|EPS64061.1|  cullin 4                                                245   4e-72   Genlisea aurea
ref|XP_004149667.1|  PREDICTED: cullin-4                                246   5e-72   Cucumis sativus [cucumbers]
ref|XP_002270764.2|  PREDICTED: cullin-4                                246   6e-72   Vitis vinifera
ref|XP_011011309.1|  PREDICTED: cullin-4-like isoform X2                241   4e-71   Populus euphratica
ref|XP_006377605.1|  hypothetical protein POPTR_0011s08280g             242   6e-71   
ref|XP_008444359.1|  PREDICTED: cullin-4                                243   7e-71   Cucumis melo [Oriental melon]
ref|XP_006377604.1|  hypothetical protein POPTR_0011s08280g             242   1e-70   Populus trichocarpa [western balsam poplar]
ref|XP_011011308.1|  PREDICTED: cullin-4-like isoform X1                242   1e-70   Populus euphratica
ref|XP_002305340.2|  hypothetical protein POPTR_0004s14020g             242   2e-70   Populus trichocarpa [western balsam poplar]
ref|XP_002519675.1|  cullin, putative                                   241   2e-70   
ref|XP_010247871.1|  PREDICTED: cullin-4-like isoform X2                239   4e-70   Nelumbo nucifera [Indian lotus]
gb|KCW73811.1|  hypothetical protein EUGRSUZ_E02414                     240   6e-70   Eucalyptus grandis [rose gum]
gb|KCW73810.1|  hypothetical protein EUGRSUZ_E02414                     240   7e-70   Eucalyptus grandis [rose gum]
ref|XP_010056896.1|  PREDICTED: cullin-4                                240   1e-69   Eucalyptus grandis [rose gum]
ref|XP_010247870.1|  PREDICTED: cullin-4-like isoform X1                239   1e-69   Nelumbo nucifera [Indian lotus]
emb|CBI30911.3|  unnamed protein product                                239   1e-69   Vitis vinifera
ref|XP_010274939.1|  PREDICTED: cullin-4-like                           239   2e-69   Nelumbo nucifera [Indian lotus]
emb|CAN75926.1|  hypothetical protein VITISV_010491                     239   2e-69   Vitis vinifera
ref|XP_010110959.1|  hypothetical protein L484_021653                   237   1e-68   
ref|XP_008787804.1|  PREDICTED: cullin-4-like isoform X2                237   1e-68   Phoenix dactylifera
ref|XP_008787803.1|  PREDICTED: cullin-4-like isoform X1                237   2e-68   Phoenix dactylifera
gb|KHN06973.1|  Cullin-4                                                236   2e-68   Glycine soja [wild soybean]
ref|XP_009408525.1|  PREDICTED: cullin-4-like                           234   9e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398338.1|  PREDICTED: cullin-4-like                           233   5e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010941311.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4-like      232   7e-67   Elaeis guineensis
ref|XP_010923713.1|  PREDICTED: cullin-4-like isoform X2                231   1e-66   Elaeis guineensis
ref|XP_010923712.1|  PREDICTED: cullin-4-like isoform X1                231   2e-66   Elaeis guineensis
ref|XP_004233125.1|  PREDICTED: cullin-4                                230   2e-66   Solanum lycopersicum
ref|XP_010666663.1|  PREDICTED: cullin-4                                230   3e-66   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN47328.1|  Cullin-4                                                228   1e-65   Glycine soja [wild soybean]
ref|XP_003546083.1|  PREDICTED: cullin-4-like                           224   4e-64   Glycine max [soybeans]
ref|XP_007147910.1|  hypothetical protein PHAVU_006G165300g             220   1e-62   Phaseolus vulgaris [French bean]
ref|XP_008809585.1|  PREDICTED: cullin-4-like                           220   1e-62   
ref|XP_003593913.1|  Cullin                                             218   5e-62   
ref|XP_003593912.1|  Cullin                                             218   7e-62   Medicago truncatula
ref|XP_003593911.1|  Cullin                                             218   7e-62   
ref|XP_003524860.1|  PREDICTED: cullin-4-like                           216   3e-61   Glycine max [soybeans]
ref|XP_008383554.1|  PREDICTED: cullin-4-like                           210   3e-61   
ref|XP_006585082.1|  PREDICTED: cullin-4-like isoform X2                211   9e-60   Glycine max [soybeans]
ref|XP_003532695.2|  PREDICTED: cullin-4-like isoform X1                212   9e-60   Glycine max [soybeans]
ref|XP_004486019.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4-like      210   5e-59   Cicer arietinum [garbanzo]
gb|KHN12460.1|  Cullin-4                                                209   8e-59   Glycine soja [wild soybean]
ref|XP_009101534.1|  PREDICTED: cullin-4-like                           208   2e-58   Brassica rapa
ref|XP_006836434.1|  PREDICTED: cullin-4                                207   4e-58   Amborella trichopoda
ref|XP_006398310.1|  hypothetical protein EUTSA_v10000782mg             204   5e-58   
ref|XP_006398309.1|  hypothetical protein EUTSA_v10000782mg             203   1e-57   
gb|KHN46079.1|  Cullin-4                                                205   2e-57   Glycine soja [wild soybean]
gb|KHN29857.1|  Cullin-4                                                195   2e-57   Glycine soja [wild soybean]
ref|XP_006398308.1|  hypothetical protein EUTSA_v10000782mg             204   7e-57   Eutrema salsugineum [saltwater cress]
emb|CDX77644.1|  BnaC07g18980D                                          202   3e-56   
ref|XP_006414121.1|  hypothetical protein EUTSA_v10024458mg             201   6e-56   Eutrema salsugineum [saltwater cress]
emb|CDY35152.1|  BnaA09g17890D                                          201   7e-56   Brassica napus [oilseed rape]
emb|CDY43957.1|  BnaA02g24350D                                          201   7e-56   Brassica napus [oilseed rape]
ref|XP_002863417.1|  hypothetical protein ARALYDRAFT_916814             200   1e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_004981509.1|  PREDICTED: cullin-4-like isoform X1                200   1e-55   
ref|XP_004981510.1|  PREDICTED: cullin-4-like isoform X2                200   1e-55   Setaria italica
emb|CDY33461.1|  BnaA06g36120D                                          199   2e-55   Brassica napus [oilseed rape]
ref|NP_568658.1|  cullin4                                               199   4e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010495750.1|  PREDICTED: cullin-4-like                           198   7e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009114369.1|  PREDICTED: cullin-4-like                           198   9e-55   Brassica rapa
ref|XP_010484784.1|  PREDICTED: cullin-4-like                           197   1e-54   Camelina sativa [gold-of-pleasure]
gb|AAM14063.1|  putative cullin                                         197   1e-54   Arabidopsis thaliana [mouse-ear cress]
emb|CDX87735.1|  BnaC02g32140D                                          197   2e-54   
gb|KFK31486.1|  cullin                                                  197   2e-54   Arabis alpina [alpine rockcress]
emb|CDY03235.1|  BnaC09g19210D                                          196   3e-54   
ref|XP_010441611.1|  PREDICTED: cullin-4                                196   4e-54   Camelina sativa [gold-of-pleasure]
ref|XP_006281916.1|  hypothetical protein CARUB_v10028121mg             195   1e-53   Capsella rubella
ref|XP_010529158.1|  PREDICTED: cullin-4                                194   1e-53   Tarenaya hassleriana [spider flower]
ref|XP_009128848.1|  PREDICTED: cullin-4                                192   1e-52   Brassica rapa
ref|XP_011460204.1|  PREDICTED: cullin-4                                191   2e-52   Fragaria vesca subsp. vesca
emb|CAC85265.1|  cullin 4                                               191   3e-52   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28509.1|  cullin 4                                                190   4e-52   Arabis alpina [alpine rockcress]
ref|XP_006650698.1|  PREDICTED: cullin-4-like                           190   7e-52   Oryza brachyantha
gb|EMT18857.1|  Cullin-4B                                               187   3e-51   
dbj|BAK02870.1|  predicted protein                                      187   4e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003558082.1|  PREDICTED: cullin-4                                187   7e-51   Brachypodium distachyon [annual false brome]
tpg|DAA51790.1|  TPA: hypothetical protein ZEAMMB73_453479              185   1e-50   
ref|XP_002466340.1|  hypothetical protein SORBIDRAFT_01g005920          186   1e-50   Sorghum bicolor [broomcorn]
gb|ACA52121.1|  cullin 4                                                173   2e-50   Vitis vinifera
gb|EEE60060.1|  hypothetical protein OsJ_12866                          184   1e-49   Oryza sativa Japonica Group [Japonica rice]
gb|AAT75245.1|  putative cullin protein                                 184   1e-49   Oryza sativa Japonica Group [Japonica rice]
gb|ABF99238.1|  Cullin-4B, putative, expressed                          184   1e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008644442.1|  PREDICTED: cullin-4                                181   1e-48   Zea mays [maize]
ref|XP_002984123.1|  ubiquitin-protein ligase, cullin 4                 177   2e-47   
ref|XP_002972211.1|  ubiquitin-protein ligase, Cullin 4                 177   2e-47   
ref|XP_001764780.1|  predicted protein                                  176   5e-47   
ref|XP_010518764.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4-like      172   8e-46   Tarenaya hassleriana [spider flower]
tpg|DAA51791.1|  TPA: hypothetical protein ZEAMMB73_453479              167   2e-44   
ref|XP_001776334.1|  predicted protein                                  168   3e-44   
gb|KHG11994.1|  Cullin-4 -like protein                                  133   2e-32   Gossypium arboreum [tree cotton]
ref|XP_005825979.1|  hypothetical protein GUITHDRAFT_160035             129   4e-30   Guillardia theta CCMP2712
gb|KJB66937.1|  hypothetical protein B456_010G166800                    121   1e-27   Gossypium raimondii
gb|KDO78193.1|  hypothetical protein CISIN_1g003648mg                   120   2e-27   Citrus sinensis [apfelsine]
ref|XP_006449701.1|  hypothetical protein CICLE_v10014310mg             120   2e-27   
gb|KIZ03018.1|  cullin 4                                                118   3e-27   Monoraphidium neglectum
ref|XP_006598170.1|  PREDICTED: cullin-4-like                           112   4e-27   
emb|CBJ49182.1|  conserved unknown protein                              120   5e-27   Ectocarpus siliculosus
ref|XP_005644988.1|  Cullin-domain-containing protein                   117   5e-26   Coccomyxa subellipsoidea C-169
gb|KJE89856.1|  Cullin 4                                                112   3e-24   Capsaspora owczarzaki ATCC 30864
ref|XP_004349795.2|  Cullin 4                                           112   3e-24   Capsaspora owczarzaki ATCC 30864
ref|XP_002947918.1|  hypothetical protein VOLCADRAFT_57881              111   3e-24   Volvox carteri f. nagariensis
ref|XP_002504743.1|  predicted protein                                  109   3e-23   Micromonas commoda
ref|XP_001703219.1|  cullin                                             108   5e-23   Chlamydomonas reinhardtii
ref|XP_011674419.1|  PREDICTED: cullin-4A                               107   5e-23   Strongylocentrotus purpuratus [purple urchin]
ref|XP_006823839.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B-like     108   5e-23   Saccoglossus kowalevskii
ref|XP_008171287.1|  PREDICTED: cullin-4B isoform X2                    108   6e-23   Chrysemys picta bellii
ref|XP_010139394.1|  PREDICTED: cullin-4B                               107   9e-23   Buceros rhinoceros silvestris
ref|XP_009899852.1|  PREDICTED: cullin-4B                               107   9e-23   Picoides pubescens
dbj|BAB64445.1|  hypothetical protein                                   104   1e-22   Macaca fascicularis [crab eating macaque]
ref|XP_005022179.1|  PREDICTED: cullin-4B                               107   1e-22   
ref|XP_010287736.1|  PREDICTED: cullin-4B                               107   1e-22   Phaethon lepturus
ref|XP_009968477.1|  PREDICTED: cullin-4B                               107   1e-22   Tyto alba [Schleiereule]
ref|XP_010020149.1|  PREDICTED: cullin-4B                               107   1e-22   Nestor notabilis
ref|XP_009915406.1|  PREDICTED: cullin-4B isoform X1                    107   1e-22   Haliaeetus albicilla
ref|XP_009871272.1|  PREDICTED: cullin-4B                               107   1e-22   Apaloderma vittatum
ref|XP_009578947.1|  PREDICTED: cullin-4B                               107   1e-22   Fulmarus glacialis
ref|XP_009487693.1|  PREDICTED: cullin-4B                               107   1e-22   Pelecanus crispus
ref|XP_009273579.1|  PREDICTED: cullin-4B                               107   1e-22   Aptenodytes forsteri
ref|XP_009073198.1|  PREDICTED: cullin-4B                               107   1e-22   Acanthisitta chloris
ref|XP_005432498.1|  PREDICTED: cullin-4B                               107   1e-22   Falco cherrug
ref|XP_005045907.1|  PREDICTED: cullin-4B                               107   1e-22   Ficedula albicollis
ref|XP_003208504.1|  PREDICTED: cullin-4B                               107   1e-22   Meleagris gallopavo [common turkey]
ref|XP_010162624.1|  PREDICTED: cullin-4B                               107   1e-22   Antrostomus carolinensis
ref|XP_005504485.1|  PREDICTED: cullin-4B                               107   1e-22   Columba livia [carrier pigeon]
ref|XP_005484500.1|  PREDICTED: cullin-4B                               107   1e-22   Zonotrichia albicollis
ref|XP_005148357.1|  PREDICTED: cullin-4B                               107   1e-22   
ref|XP_009943501.1|  PREDICTED: cullin-4B                               107   1e-22   Opisthocomus hoazin [hoatzin]
ref|XP_002196531.1|  PREDICTED: cullin-4B                               107   1e-22   Taeniopygia guttata
ref|XP_007060188.1|  PREDICTED: cullin-4B                               107   1e-22   Chelonia mydas [green seaturtle]
ref|XP_010150094.1|  PREDICTED: cullin-4B                               107   1e-22   Eurypyga helias
ref|XP_009564621.1|  PREDICTED: cullin-4B                               107   1e-22   Cuculus canorus
ref|XP_009088610.1|  PREDICTED: cullin-4B                               107   1e-22   Serinus canaria [canary]
ref|XP_009981623.1|  PREDICTED: cullin-4B                               107   1e-22   Tauraco erythrolophus
ref|XP_005241130.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B          107   1e-22   Falco peregrinus [peregrine]
ref|XP_008638702.1|  PREDICTED: cullin-4B                               107   1e-22   Corvus brachyrhynchos
ref|XP_009670270.1|  PREDICTED: cullin-4B                               107   1e-22   Struthio camelus australis
ref|XP_007436244.1|  PREDICTED: cullin-4B                               107   1e-22   Python bivittatus
ref|XP_005767862.1|  hypothetical protein EMIHUDRAFT_427672             106   2e-22   Emiliania huxleyi CCMP1516
ref|XP_005782887.1|  hypothetical protein EMIHUDRAFT_468368             106   2e-22   Emiliania huxleyi CCMP1516
ref|XP_006803308.1|  PREDICTED: cullin-4B-like                          106   2e-22   Neolamprologus brichardi [lyretail cichlid]
gb|EEC76292.1|  hypothetical protein OsI_13805                          105   3e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_011478226.1|  PREDICTED: cullin-4B                               106   3e-22   Oryzias latipes [Japanese rice fish]
ref|XP_003445252.1|  PREDICTED: cullin-4B                               105   4e-22   Oreochromis niloticus
ref|XP_004545810.1|  PREDICTED: cullin-4B-like                          105   4e-22   
ref|XP_005913219.1|  PREDICTED: cullin-4B-like                          105   4e-22   Haplochromis burtoni
ref|XP_008935860.1|  PREDICTED: cullin-4B                               105   6e-22   Merops nubicus
gb|ESA04652.1|  hypothetical protein GLOINDRAFT_85233                   105   6e-22   
ref|XP_005790994.1|  hypothetical protein EMIHUDRAFT_224320             102   6e-22   Emiliania huxleyi CCMP1516
ref|XP_006115461.1|  PREDICTED: cullin-4B                               105   9e-22   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_005307468.2|  PREDICTED: cullin-4B isoform X1                    105   9e-22   Chrysemys picta bellii
ref|XP_003229259.1|  PREDICTED: cullin-4B                               105   9e-22   
ref|XP_010210224.1|  PREDICTED: cullin-4B                               104   1e-21   Tinamus guttatus
ref|XP_006260081.1|  PREDICTED: cullin-4B                               104   1e-21   
ref|XP_006028559.1|  PREDICTED: cullin-4B                               104   1e-21   Alligator sinensis
ref|XP_420335.2|  PREDICTED: cullin-4B                                  104   1e-21   Gallus gallus [bantam]
dbj|BAC41443.3|  mKIAA0695 protein                                      104   1e-21   Mus musculus [mouse]
ref|XP_010206238.1|  PREDICTED: cullin-4B                               104   1e-21   Colius striatus
ref|XP_008324704.1|  PREDICTED: cullin-4B                               104   1e-21   
ref|XP_008491853.1|  PREDICTED: cullin-4B                               104   1e-21   Calypte anna
ref|XP_009887578.1|  PREDICTED: cullin-4B                               104   1e-21   Charadrius vociferus
ref|XP_001656862.1|  AAEL003466-PB                                      104   1e-21   Aedes aegypti
ref|XP_010073509.1|  PREDICTED: cullin-4B                               104   1e-21   Pterocles gutturalis
ref|XP_010764721.1|  PREDICTED: cullin-4B                               104   1e-21   Notothenia coriiceps [yellowbelly rockcod]
dbj|BAC27992.1|  unnamed protein product                                104   1e-21   Mus musculus [mouse]
ref|NP_001103612.1|  cullin-4B                                          104   1e-21   Mus musculus [mouse]
ref|XP_007569758.1|  PREDICTED: cullin-4B                               104   2e-21   Poecilia formosa
ref|XP_008418856.1|  PREDICTED: cullin-4B                               104   2e-21   Poecilia reticulata
ref|XP_005799582.1|  PREDICTED: cullin-4B-like                          104   2e-21   Xiphophorus maculatus
ref|XP_008274104.1|  PREDICTED: cullin-4B                               104   2e-21   Stegastes partitus
ref|XP_003970600.1|  PREDICTED: cullin-4B                               103   2e-21   Takifugu rubripes [tiger puffer]
ref|XP_009556241.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A          103   2e-21   Cuculus canorus
dbj|BAE36141.1|  unnamed protein product                                103   2e-21   Mus musculus [mouse]
gb|EWM25493.1|  ubiquitin-protein cullin 4                              103   2e-21   Nannochloropsis gaditana
dbj|BAB28222.2|  unnamed protein product                                103   2e-21   Mus musculus [mouse]
ref|XP_010730305.1|  PREDICTED: cullin-4B                               103   2e-21   
ref|XP_006632966.1|  PREDICTED: cullin-4B-like                          103   2e-21   
ref|XP_005083198.1|  PREDICTED: cullin-4B                               103   3e-21   
ref|XP_009506519.1|  PREDICTED: cullin-4B                               103   3e-21   Phalacrocorax carbo [common cormorant]
ref|XP_006003900.1|  PREDICTED: cullin-4B                               103   3e-21   Latimeria chalumnae
ref|XP_009534475.1|  hypothetical protein PHYSODRAFT_361833             103   3e-21   Phytophthora sojae
ref|XP_006076682.1|  PREDICTED: cullin-4A                               103   3e-21   
ref|XP_001510185.3|  PREDICTED: cullin-4B                               103   3e-21   
ref|XP_011974798.1|  PREDICTED: cullin-4A isoform X2                    103   3e-21   Ovis aries musimon
ref|XP_005998125.1|  PREDICTED: cullin-4A                               103   3e-21   
ref|XP_001638137.1|  predicted protein                                99.4    3e-21   Nematostella vectensis
pdb|4A0L|E  Chain E, Structure Of Ddb1-Ddb2-Cul4b-Rbx1 Bound To A...    102   3e-21   Homo sapiens [man]
ref|XP_007254497.1|  PREDICTED: cullin-4B-like                          103   3e-21   
pdb|4A0C|C  Chain C, Structure Of The Cand1-Cul4b-Rbx1 Complex          102   3e-21   Mus musculus [mouse]
ref|XP_007891612.1|  PREDICTED: cullin-4B                               103   4e-21   Callorhinchus milii [Australian ghost shark]
ref|NP_001120891.1|  cullin 4B                                          102   4e-21   Xenopus tropicalis [western clawed frog]
pdb|4A64|A  Chain A, Crystal Structure Of The N-Terminal Domain O...  99.8    5e-21   Homo sapiens [man]
ref|NP_001116316.1|  cullin-4B                                          102   5e-21   Danio rerio [leopard danio]
ref|XP_006877534.1|  PREDICTED: cullin-4B isoform X1                    102   5e-21   Chrysochloris asiatica
ref|XP_008988097.1|  PREDICTED: cullin-4B isoform X5                    102   5e-21   Callithrix jacchus [common marmoset]
ref|XP_864628.3|  PREDICTED: cullin-4B isoform 3                        102   5e-21   
ref|XP_008154341.1|  PREDICTED: cullin-4B isoform X1                    102   5e-21   
ref|XP_004713105.1|  PREDICTED: cullin-4B isoform X2                    102   5e-21   Echinops telfairi [lesser hedgehog tenrec]
gb|EGW01006.1|  Cullin-4B                                               102   5e-21   Cricetulus griseus [Chinese hamsters]
ref|XP_004713104.1|  PREDICTED: cullin-4B isoform X1                    102   5e-21   
gb|KFW86599.1|  Cullin-4B                                               102   5e-21   Manacus vitellinus
ref|XP_004478393.1|  PREDICTED: cullin-4B                               102   5e-21   
ref|XP_010592963.1|  PREDICTED: cullin-4B isoform X3                    102   6e-21   Loxodonta africana [African bush elephant]
ref|XP_010829841.1|  PREDICTED: cullin-4A                               102   6e-21   Bison bison bison
ref|XP_006981625.1|  PREDICTED: cullin-4B isoform X1                    102   6e-21   
ref|XP_006981626.1|  PREDICTED: cullin-4B isoform X2                    102   6e-21   
ref|XP_008832150.1|  PREDICTED: cullin-4B                               102   6e-21   
ref|XP_005673908.1|  PREDICTED: cullin-4B-like                          102   6e-21   
ref|XP_004379637.1|  PREDICTED: cullin-4B isoform 1                     102   6e-21   
ref|XP_003800032.1|  PREDICTED: cullin-4A                               102   6e-21   Otolemur garnettii
ref|XP_007951543.1|  PREDICTED: cullin-4B                               102   6e-21   Orycteropus afer afer
tpg|DAA23688.1|  TPA: cullin 4A                                         102   6e-21   Bos taurus [bovine]
ref|XP_003774810.1|  PREDICTED: cullin-4B                               102   7e-21   Sarcophilus harrisii
ref|XP_010894682.1|  PREDICTED: cullin-4B isoform X3                    102   7e-21   
ref|XP_006191373.1|  PREDICTED: cullin-4B-like isoform X2               102   8e-21   Camelus ferus
dbj|BAA31670.2|  KIAA0695 protein                                       102   8e-21   Homo sapiens [man]
ref|XP_010592962.1|  PREDICTED: cullin-4B isoform X1                    102   8e-21   Loxodonta africana [African bush elephant]
ref|XP_001870810.1|  cullin                                             102   8e-21   Culex quinquefasciatus
ref|NP_001041617.1|  cullin-4B                                          102   8e-21   Felis catus [cat]
ref|XP_011376545.1|  PREDICTED: cullin-4B isoform X2                    102   8e-21   
ref|XP_006191372.1|  PREDICTED: cullin-4B-like isoform X1               102   8e-21   Camelus ferus
ref|XP_010819678.1|  PREDICTED: cullin-4B isoform X5                    102   8e-21   
gb|EGI59840.1|  Cullin-4B                                               102   8e-21   Acromyrmex echinatior
ref|XP_008271384.1|  PREDICTED: cullin-4B isoform X5                    102   8e-21   Oryctolagus cuniculus [domestic rabbit]
ref|XP_006883869.1|  PREDICTED: cullin-4A                               102   8e-21   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_003707650.1|  PREDICTED: cullin-4A isoform X1                    102   8e-21   Megachile rotundata
ref|XP_012150671.1|  PREDICTED: cullin-4B isoform X2                    101   8e-21   Megachile rotundata
ref|XP_003690323.1|  PREDICTED: cullin-4B-like                          102   8e-21   Apis florea [dwarf honeybee]
ref|XP_003397436.1|  PREDICTED: cullin-4B-like                          102   8e-21   Bombus terrestris [large earth bumblebee]
ref|XP_392800.3|  PREDICTED: cullin-4B-like                             102   8e-21   Apis mellifera [bee]
ref|XP_003414815.1|  PREDICTED: cullin-4B isoform X2                    102   8e-21   
gb|KFQ02433.1|  Cullin-4B                                               102   8e-21   Haliaeetus albicilla
ref|XP_006885130.1|  PREDICTED: cullin-4B-like isoform X1               102   8e-21   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|KFV93759.1|  Cullin-4B                                               102   9e-21   Fulmarus glacialis
gb|KFP90614.1|  Cullin-4B                                               102   9e-21   Apaloderma vittatum
gb|KFP57528.1|  Cullin-4B                                               102   9e-21   Cathartes aura
gb|KFM04851.1|  Cullin-4B                                               102   9e-21   Aptenodytes forsteri
gb|KFR04226.1|  Cullin-4B                                               102   9e-21   Opisthocomus hoazin [hoatzin]
ref|XP_007647173.1|  PREDICTED: cullin-4B isoform X1                    102   9e-21   Cricetulus griseus [Chinese hamsters]
gb|KFZ62825.1|  Cullin-4B                                               102   9e-21   Podiceps cristatus
gb|KFV04835.1|  Cullin-4B                                               102   9e-21   Tauraco erythrolophus
gb|KFO92809.1|  Cullin-4B                                               102   9e-21   Buceros rhinoceros silvestris
ref|XP_005358493.1|  PREDICTED: cullin-4B                               102   9e-21   
ref|XP_005413716.1|  PREDICTED: cullin-4B isoform X4                    102   9e-21   Chinchilla lanigera
ref|XP_007610124.1|  PREDICTED: cullin-4B isoform X2                    102   9e-21   
gb|KFZ46418.1|  Cullin-4B                                               102   9e-21   
ref|XP_008538115.1|  PREDICTED: cullin-4B isoform X1                    102   9e-21   
gb|KFQ89647.1|  Cullin-4B                                               102   9e-21   
gb|KFQ77299.1|  Cullin-4B                                               102   9e-21   
gb|KFQ56289.1|  Cullin-4B                                               102   9e-21   
gb|KFP38487.1|  Cullin-4B                                               102   9e-21   
gb|KFO06527.1|  Cullin-4B                                               102   9e-21   
ref|XP_011063503.1|  PREDICTED: cullin-4A                               102   9e-21   
ref|XP_004762116.1|  PREDICTED: cullin-4B isoform X3                    102   1e-20   
ref|XP_005413713.1|  PREDICTED: cullin-4B isoform X1                    102   1e-20   
ref|XP_004704475.1|  PREDICTED: cullin-4A                               101   1e-20   
ref|XP_004653844.1|  PREDICTED: cullin-4B                               101   1e-20   
ref|XP_005413714.1|  PREDICTED: cullin-4B isoform X2                    102   1e-20   
ref|XP_004762115.1|  PREDICTED: cullin-4B isoform X2                    102   1e-20   
gb|KFO64284.1|  Cullin-4B                                               102   1e-20   
ref|XP_004762114.1|  PREDICTED: cullin-4B isoform X1                    102   1e-20   
ref|XP_005413715.1|  PREDICTED: cullin-4B isoform X3                    102   1e-20   
ref|XP_006082210.1|  PREDICTED: cullin-4B isoform X1                    102   1e-20   
ref|XP_008707988.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B          101   1e-20   
ref|XP_007530424.1|  PREDICTED: cullin-4B isoform X1                    102   1e-20   
gb|KFQ64788.1|  Cullin-4B                                               102   1e-20   
gb|KFP00724.1|  Cullin-4B                                               101   1e-20   
ref|XP_008974985.1|  PREDICTED: cullin-4B isoform X1                    102   1e-20   
ref|XP_006082211.1|  PREDICTED: cullin-4B isoform X2                    102   1e-20   
ref|XP_006877535.1|  PREDICTED: cullin-4B isoform X2                    101   1e-20   
ref|XP_006746270.1|  PREDICTED: cullin-4B                               102   1e-20   
ref|XP_008538116.1|  PREDICTED: cullin-4B isoform X2                    101   1e-20   
ref|XP_004713106.1|  PREDICTED: cullin-4B isoform X3                    101   1e-20   
ref|XP_003365917.2|  PREDICTED: cullin-4B                               102   1e-20   
ref|XP_008585584.1|  PREDICTED: cullin-4B isoform X2                    101   1e-20   
ref|NP_001100421.1|  cullin-4B                                          102   1e-20   
ref|XP_004437389.1|  PREDICTED: cullin-4B                               101   1e-20   
ref|XP_008585583.1|  PREDICTED: cullin-4B isoform X1                    101   1e-20   
ref|XP_006082212.1|  PREDICTED: cullin-4B isoform X3                    101   1e-20   
ref|XP_007940575.1|  PREDICTED: cullin-4A                               101   1e-20   
ref|NP_003579.3|  cullin-4B isoform 1                                   101   1e-20   
ref|XP_011227402.1|  PREDICTED: cullin-4B isoform X2                    101   1e-20   
ref|XP_006082213.1|  PREDICTED: cullin-4B isoform X4                    101   1e-20   
ref|XP_005319406.1|  PREDICTED: cullin-4B isoform X1                    101   1e-20   
ref|XP_011227401.1|  PREDICTED: cullin-4B isoform X1                    101   1e-20   
gb|AAH36216.1|  Cullin 4B                                               101   1e-20   
ref|XP_004762117.1|  PREDICTED: cullin-4B isoform X4                    101   1e-20   
ref|XP_008154342.1|  PREDICTED: cullin-4B isoform X2                    101   1e-20   
ref|XP_008271380.1|  PREDICTED: cullin-4B isoform X1                    101   1e-20   
ref|XP_007076302.1|  PREDICTED: cullin-4B isoform X2                    101   1e-20   
ref|XP_005262538.1|  PREDICTED: cullin-4B isoform X1                    101   1e-20   
ref|XP_011277734.1|  PREDICTED: cullin-4B isoform X2                    101   1e-20   
ref|XP_004647716.1|  PREDICTED: cullin-4B                               101   1e-20   
ref|XP_008271383.1|  PREDICTED: cullin-4B isoform X4                    101   1e-20   
ref|XP_004685823.1|  PREDICTED: cullin-4B isoform X1                    101   1e-20   
ref|XP_007076303.1|  PREDICTED: cullin-4B isoform X3                    101   1e-20   
ref|XP_011277733.1|  PREDICTED: cullin-4B isoform X1                    101   1e-20   
ref|XP_007076301.1|  PREDICTED: cullin-4B isoform X1                    101   1e-20   
ref|XP_006767871.1|  PREDICTED: cullin-4B                               101   1e-20   
ref|XP_004379638.1|  PREDICTED: cullin-4B isoform 2                     101   1e-20   
ref|XP_008070821.1|  PREDICTED: cullin-4B                               101   1e-20   
ref|XP_002720454.2|  PREDICTED: cullin-4B isoform X2                    101   1e-20   
ref|XP_008017651.1|  PREDICTED: cullin-4B isoform X4                    101   1e-20   
ref|XP_008017652.1|  PREDICTED: cullin-4B isoform X5                    101   1e-20   
ref|XP_008271382.1|  PREDICTED: cullin-4B isoform X3                    101   1e-20   
ref|XP_006981365.1|  PREDICTED: cullin-4A                               101   1e-20   
ref|XP_004406978.1|  PREDICTED: cullin-4B                               101   1e-20   
ref|XP_006917880.1|  PREDICTED: cullin-4B                               101   1e-20   
ref|XP_005884739.1|  PREDICTED: cullin-4B                               101   1e-20   
gb|EFB16493.1|  hypothetical protein PANDA_011593                       101   1e-20   
ref|NP_001073341.1|  cullin-4B isoform 2                                101   1e-20   
ref|XP_006144939.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B          101   1e-20   
ref|XP_004587715.1|  PREDICTED: cullin-4B                               101   1e-20   
ref|XP_008988095.1|  PREDICTED: cullin-4B isoform X3                    101   1e-20   
ref|XP_001086195.1|  PREDICTED: cullin-4B isoform 1                     101   1e-20   
ref|XP_011376546.1|  PREDICTED: cullin-4B isoform X3                    101   1e-20   
ref|XP_009196468.1|  PREDICTED: cullin-4B isoform X1                    101   1e-20   
gb|KFV68186.1|  Cullin-4B                                               101   1e-20   
ref|XP_007122105.1|  PREDICTED: cullin-4B-like isoform X1               101   1e-20   
ref|XP_012005530.1|  PREDICTED: cullin-4B isoform X6                    101   1e-20   
ref|XP_001603521.1|  PREDICTED: cullin-4A                               101   1e-20   
ref|XP_008683174.1|  PREDICTED: cullin-4A                               101   1e-20   
ref|XP_010989951.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B          101   1e-20   
ref|XP_006257551.1|  PREDICTED: cullin-4B isoform X1                    101   1e-20   
ref|XP_008988094.1|  PREDICTED: cullin-4B isoform X2                    101   1e-20   
ref|XP_006724847.1|  PREDICTED: cullin-4B isoform X2                    101   1e-20   
emb|CAD97843.1|  hypothetical protein                                   101   1e-20   
ref|XP_006724848.1|  PREDICTED: cullin-4B isoform X6                    101   1e-20   
ref|XP_006048864.1|  PREDICTED: cullin-4B isoform X1                    101   1e-20   
ref|XP_004285634.1|  PREDICTED: cullin-4B isoform 1                     101   1e-20   
ref|XP_007122106.1|  PREDICTED: cullin-4B-like isoform X2               101   1e-20   
ref|XP_849542.3|  PREDICTED: cullin-4A                                  101   1e-20   
ref|XP_006215961.1|  PREDICTED: cullin-4B isoform X1                    101   1e-20   
ref|XP_004874659.1|  PREDICTED: cullin-4B isoform X1                    101   1e-20   
ref|XP_005227530.1|  PREDICTED: cullin-4B isoform X2                    101   1e-20   
ref|XP_011962742.1|  PREDICTED: cullin-4B isoform X3                    101   1e-20   
ref|XP_008988096.1|  PREDICTED: cullin-4B isoform X4                    101   1e-20   
ref|XP_006048866.1|  PREDICTED: cullin-4B isoform X3                    101   1e-20   
ref|XP_006048867.1|  PREDICTED: cullin-4B isoform X4                    101   1e-20   
ref|XP_010627873.1|  PREDICTED: cullin-4B isoform X2                    101   1e-20   
ref|XP_002699556.2|  PREDICTED: cullin-4B isoform X4                    101   1e-20   
ref|XP_008988093.1|  PREDICTED: cullin-4B isoform X1                    101   1e-20   
gb|ELK27187.1|  Cullin-4B                                               101   1e-20   
ref|XP_010819677.1|  PREDICTED: cullin-4B isoform X3                    101   1e-20   
ref|XP_011376543.1|  PREDICTED: cullin-4B isoform X1                    101   1e-20   
ref|XP_009995422.1|  PREDICTED: cullin-4B                               101   1e-20   
gb|AAR13073.1|  cullin 4B                                               101   1e-20   
ref|XP_009196470.1|  PREDICTED: cullin-4B isoform X3                    101   1e-20   
ref|XP_010798617.1|  PREDICTED: cullin-4B isoform X1                    101   1e-20   
ref|XP_005700401.1|  PREDICTED: cullin-4B isoform X2                    101   1e-20   
ref|XP_001364868.1|  PREDICTED: cullin-4A                               101   1e-20   
ref|XP_004899937.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B          101   1e-20   
ref|XP_011942922.1|  PREDICTED: cullin-4B isoform X1                    101   1e-20   
ref|XP_006102095.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A          101   1e-20   
ref|XP_010627872.1|  PREDICTED: cullin-4B isoform X1                    101   1e-20   
ref|XP_003465638.1|  PREDICTED: cullin-4B                               101   2e-20   
gb|KFP13940.1|  Cullin-4B                                               101   2e-20   
ref|XP_010962238.1|  PREDICTED: cullin-4B                               101   2e-20   
ref|XP_002723510.1|  PREDICTED: cullin-4A                               101   2e-20   
ref|XP_006215962.1|  PREDICTED: cullin-4B isoform X2                    101   2e-20   
ref|XP_004874660.1|  PREDICTED: cullin-4B isoform X2                    101   2e-20   
ref|XP_005700400.1|  PREDICTED: cullin-4B isoform X1                    101   2e-20   
ref|XP_004423239.1|  PREDICTED: cullin-4A                               100   2e-20   
ref|XP_007064015.1|  PREDICTED: cullin-4A                               100   2e-20   
ref|XP_007178671.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B          101   2e-20   
ref|XP_011962741.1|  PREDICTED: cullin-4B isoform X1                    101   2e-20   
ref|XP_005884540.1|  PREDICTED: cullin-4A                               100   2e-20   
ref|XP_009968332.1|  PREDICTED: cullin-4A                               100   2e-20   
gb|EPQ19199.1|  Cullin-4B                                               101   2e-20   
ref|XP_006909411.1|  PREDICTED: cullin-4A                               100   2e-20   
ref|XP_008142137.1|  PREDICTED: cullin-4A                               100   2e-20   
ref|XP_006885131.1|  PREDICTED: cullin-4B-like isoform X2               100   2e-20   
gb|EMC88699.1|  Cullin-4B                                               101   2e-20   
ref|XP_004022402.2|  PREDICTED: cullin-4B isoform X2                    101   2e-20   
gb|AAK16812.1|AF212995_1  cullin CUL4B                                  100   2e-20   
ref|XP_010292721.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A          100   2e-20   
ref|XP_006218259.1|  PREDICTED: cullin-4A                               100   2e-20   
ref|XP_005420081.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A          100   2e-20   
ref|NP_001090088.1|  cullin 4B                                          100   2e-20   
ref|XP_007530425.1|  PREDICTED: cullin-4B isoform X2                    100   2e-20   
ref|XP_007507207.1|  PREDICTED: cullin-4B isoform X4                    100   2e-20   
ref|XP_005374279.1|  PREDICTED: cullin-4A                               100   2e-20   
gb|EFB23437.1|  hypothetical protein PANDA_021021                       100   2e-20   
ref|XP_004631217.1|  PREDICTED: cullin-4A                               100   2e-20   
ref|XP_011279428.1|  PREDICTED: cullin-4A                               100   2e-20   
ref|XP_011504999.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A-like     100   2e-20   
ref|XP_005307673.1|  PREDICTED: cullin-4A isoform X1                    100   2e-20   
ref|XP_009484087.1|  PREDICTED: cullin-4A                               100   2e-20   
ref|XP_005366325.1|  PREDICTED: cullin-4A                               100   2e-20   
ref|XP_010950632.1|  PREDICTED: cullin-4A                               100   2e-20   
ref|XP_010117727.1|  PREDICTED: cullin-4A                               100   2e-20   
ref|XP_007507204.1|  PREDICTED: cullin-4B isoform X1                    100   2e-20   
gb|ETK80929.1|  hypothetical protein L915_13497                         100   2e-20   
dbj|BAE38662.1|  unnamed protein product                              97.1    2e-20   
ref|XP_008944998.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A          100   2e-20   
ref|XP_007507205.1|  PREDICTED: cullin-4B isoform X2                    100   2e-20   
ref|XP_007507206.1|  PREDICTED: cullin-4B isoform X3                    100   2e-20   
ref|XP_006769372.1|  PREDICTED: cullin-4A                               100   2e-20   
ref|XP_008846647.1|  PREDICTED: cullin-4A                               100   2e-20   
ref|XP_005319407.1|  PREDICTED: cullin-4B isoform X2                    100   2e-20   
ref|XP_006851582.1|  PREDICTED: cullin-4A                               100   2e-20   
ref|XP_009644037.1|  PREDICTED: cullin-4A                               100   3e-20   
ref|XP_009578999.1|  PREDICTED: cullin-4A                               100   3e-20   
ref|XP_009324584.1|  PREDICTED: cullin-4A                               100   3e-20   
ref|XP_010981119.1|  PREDICTED: cullin-4A                               100   3e-20   
ref|XP_010160186.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A          100   3e-20   
ref|XP_009083710.1|  PREDICTED: cullin-4A                               100   3e-20   
ref|XP_004685824.1|  PREDICTED: cullin-4B isoform X2                    100   3e-20   
ref|XP_011529702.1|  PREDICTED: cullin-4B isoform X4                    100   3e-20   
ref|XP_009957785.1|  PREDICTED: cullin-4A                               100   3e-20   
ref|XP_011559799.1|  PREDICTED: cullin-4A                               100   3e-20   
ref|XP_004022403.1|  PREDICTED: cullin-4B isoform X4                    100   3e-20   
ref|XP_004285635.1|  PREDICTED: cullin-4B isoform 2                     100   3e-20   
ref|XP_009196472.1|  PREDICTED: cullin-4B isoform X5                    100   3e-20   
ref|XP_011529701.1|  PREDICTED: cullin-4B isoform X3                    100   3e-20   
ref|XP_009996265.1|  PREDICTED: cullin-4A                               100   3e-20   
ref|XP_011351411.1|  PREDICTED: cullin-4A                               100   3e-20   
ref|XP_004938591.1|  PREDICTED: cullin-4A isoform X2                    100   3e-20   
ref|XP_003640577.1|  PREDICTED: cullin-4A isoform X1                    100   3e-20   
ref|XP_005228767.1|  PREDICTED: cullin-4A                               100   3e-20   
ref|XP_005902314.1|  PREDICTED: cullin-4A                               100   3e-20   
ref|XP_009707260.1|  PREDICTED: cullin-4A                               100   3e-20   
ref|XP_004412313.1|  PREDICTED: cullin-4A                               100   3e-20   
ref|XP_007902269.1|  PREDICTED: cullin-4A isoform X2                    100   3e-20   
ref|XP_004325971.1|  PREDICTED: cullin-4A-like                        99.8    3e-20   
ref|XP_005516645.1|  PREDICTED: cullin-4A                               100   3e-20   
ref|XP_011566246.1|  PREDICTED: cullin-4B-like                          100   3e-20   
ref|XP_007902268.1|  PREDICTED: cullin-4A isoform X1                    100   3e-20   
gb|ELT94808.1|  hypothetical protein CAPTEDRAFT_227595                  100   3e-20   
ref|XP_005145983.1|  PREDICTED: cullin-4A                               100   3e-20   
ref|XP_005969110.1|  PREDICTED: cullin-4A                               100   3e-20   
ref|XP_004537530.1|  PREDICTED: cullin-4B-like                          100   3e-20   
ref|XP_009890453.1|  PREDICTED: cullin-4A                               100   3e-20   
ref|XP_011311356.1|  PREDICTED: cullin-4A                               100   3e-20   
ref|XP_008494595.1|  PREDICTED: cullin-4A                               100   3e-20   
ref|XP_003131149.1|  PREDICTED: cullin-4A                               100   3e-20   
gb|EHJ64739.1|  putative cullin 4B                                      100   3e-20   
ref|XP_010208799.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A-like   99.4    3e-20   
ref|XP_005037540.1|  PREDICTED: cullin-4A isoform X1                    100   4e-20   
ref|XP_005687851.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A        99.8    4e-20   
gb|ETN61630.1|  cullin                                                  100   4e-20   
ref|XP_003477616.1|  PREDICTED: cullin-4A isoform X1                  99.8    4e-20   
pdb|4A0K|A  Chain A, Structure Of Ddb1-Ddb2-Cul4a-Rbx1 Bound To A...  99.8    4e-20   
ref|XP_005438905.1|  PREDICTED: cullin-4A                               100   4e-20   
ref|XP_009820586.1|  PREDICTED: cullin-4A                             99.8    4e-20   
ref|XP_011745963.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A        99.8    4e-20   
ref|XP_004383008.1|  PREDICTED: cullin-4A                             99.8    4e-20   
dbj|BAE29401.1|  unnamed protein product                              97.8    4e-20   
gb|EFN66773.1|  Cullin-4B                                             99.8    4e-20   
ref|XP_010171675.1|  PREDICTED: cullin-4A                             99.8    5e-20   
ref|XP_003914139.1|  PREDICTED: cullin-4A isoform X2                  99.8    5e-20   
ref|XP_005022013.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A        99.4    5e-20   
ref|XP_009897043.1|  PREDICTED: cullin-4A                             99.8    5e-20   
ref|XP_007959168.1|  PREDICTED: cullin-4A isoform X1                  99.4    5e-20   
ref|XP_009470947.1|  PREDICTED: cullin-4A                             99.4    5e-20   
ref|XP_009274422.1|  PREDICTED: cullin-4A                             99.8    5e-20   
ref|XP_005586358.1|  PREDICTED: cullin-4A isoform X1                  99.4    5e-20   
dbj|BAD93235.1|  cullin-4A                                            99.4    5e-20   
ref|XP_011875561.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A        99.8    5e-20   
ref|XP_011168244.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A        99.8    5e-20   
ref|XP_001360920.1|  GA21273                                          99.8    6e-20   
ref|XP_011258663.1|  PREDICTED: cullin-4A                             99.4    6e-20   
ref|NP_001008895.1|  cullin-4A isoform 1                              99.4    6e-20   
ref|XP_003279808.1|  PREDICTED: cullin-4A isoform 1                   99.4    6e-20   
ref|XP_002824497.1|  PREDICTED: cullin-4A                             99.4    6e-20   
ref|XP_008555895.1|  PREDICTED: cullin-4A                             99.8    6e-20   



>ref|XP_006361548.1| PREDICTED: cullin-4-like [Solanum tuberosum]
Length=824

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 170/229 (74%), Positives = 185/229 (81%), Gaps = 10/229 (4%)
 Frame = +3

Query  57   MSQPTSNPNKR-----SSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQH  221
            MSQPT+NP KR      S  SS + T G           MKKAKSQA+ CS+D NKNGQH
Sbjct  1    MSQPTTNPKKRFIPTNPSSSSSSTPTTGGTGGRTPAYSSMKKAKSQALPCSID-NKNGQH  59

Query  222  HVHFYPDVDEDPS--SASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakp  395
             VHF  D+D DPS  S+ MED +   +S     TANLSRKKAT PQPAKKLVIKL+KAKP
Sbjct  60   -VHFSSDID-DPSGNSSMMEDSNIDASSVAGGVTANLSRKKATPPQPAKKLVIKLLKAKP  117

Query  396  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET  575
            TLPTNFEENTWATLKSAI+AIFLKQPDPCDLEKLYQAVNDLCLHKMGG+LYQRIEKECE+
Sbjct  118  TLPTNFEENTWATLKSAISAIFLKQPDPCDLEKLYQAVNDLCLHKMGGNLYQRIEKECES  177

Query  576  HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            HIA AL+SLVGQSEDLVVFLSLVE+CWQDFCDQ+L IRGIALYLDRTYV
Sbjct  178  HIAAALRSLVGQSEDLVVFLSLVERCWQDFCDQMLMIRGIALYLDRTYV  226



>ref|XP_011096567.1| PREDICTED: cullin-4-like [Sesamum indicum]
Length=846

 Score =   286 bits (731),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 166/247 (67%), Positives = 179/247 (72%), Gaps = 30/247 (12%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGD--------------GAPPLHRPPPMKKAKSQAVACSLDTNK  209
            S PN  ++P +S SA  G               G       P MKKAKSQAVACSLD NK
Sbjct  2    SQPNTSTTPATSASAVPGKRSSSPRSSTTPTATGVGAASVVPAMKKAKSQAVACSLDGNK  61

Query  210  NGQH----HVHFY------PDVDEDPSSASMEDLDSPGASATRAA------TANLSRKKA  341
            NGQ     HVHF       P +++DPS  +ME   S  A   R +      TANLSRKKA
Sbjct  62   NGQQQITPHVHFAEPPVHSPMMEDDPSDVAMEASPSSTAFGRRVSASGGGVTANLSRKKA  121

Query  342  TLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLC  521
            T PQP KKLVIKLVKAKPTLP+NFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLC
Sbjct  122  TPPQPTKKLVIKLVKAKPTLPSNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLC  181

Query  522  LHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIAL  701
            LHKMGGSLYQRIE+ECE  I+ ALQ+LVGQSEDL VFLSLVEKCWQDFCDQ+L IRGIAL
Sbjct  182  LHKMGGSLYQRIERECEEFISAALQTLVGQSEDLAVFLSLVEKCWQDFCDQMLMIRGIAL  241

Query  702  YLDRTYV  722
            YLDRTYV
Sbjct  242  YLDRTYV  248



>ref|NP_001234356.1| cullin 4 [Solanum lycopersicum]
 gb|ABX09988.1| cullin 4 [Solanum lycopersicum]
Length=785

 Score =   278 bits (711),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 168/190 (88%), Gaps = 5/190 (3%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSAS--MEDLDSPGASATRAATANLSR  332
            MKKAKSQA+ CS+D+ KNGQH VHF  D+D DPS  S  MED +   +S     TANLSR
Sbjct  1    MKKAKSQALPCSIDS-KNGQH-VHFSSDID-DPSGNSPMMEDCNIDSSSVAGGVTANLSR  57

Query  333  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  512
            KKAT PQPAKKLVIKL+KAKPTLPTNFEENTWATLKSAI+AIFLKQPDPCDLEKLYQAVN
Sbjct  58   KKATPPQPAKKLVIKLLKAKPTLPTNFEENTWATLKSAISAIFLKQPDPCDLEKLYQAVN  117

Query  513  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRG  692
            DLCLHKMGG+LYQRIEKECE+HIA AL+SLVGQ+EDLVVFLSLVE+CWQDFCDQ+L IRG
Sbjct  118  DLCLHKMGGNLYQRIEKECESHIAAALRSLVGQNEDLVVFLSLVERCWQDFCDQMLMIRG  177

Query  693  IALYLDRTYV  722
            IALYLDRTYV
Sbjct  178  IALYLDRTYV  187



>ref|XP_011085242.1| PREDICTED: cullin-4 [Sesamum indicum]
Length=844

 Score =   276 bits (705),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 167/205 (81%), Gaps = 18/205 (9%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQH----HVHFY------PDVDEDPSSASMEDLDSPG-----  293
            MKKAKSQAVACSLD NKNGQ     HVHF       P +++DP+  ++E   SP      
Sbjct  43   MKKAKSQAVACSLDGNKNGQQQIAPHVHFAEPPAHSPMIEDDPNDVALET-SSPSNAFGR  101

Query  294  --ASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLK  467
              A++    TANLSRKKAT PQP KKLVIKLVKAKPTLP NFEENTWATLKSAI+AIFLK
Sbjct  102  GLAASAGGVTANLSRKKATPPQPTKKLVIKLVKAKPTLPNNFEENTWATLKSAISAIFLK  161

Query  468  QPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVE  647
            QPDPCDLEKLYQAVNDLCLHKMGGSLYQRIE ECE +I+ ALQSLVGQSEDLVVFLSLVE
Sbjct  162  QPDPCDLEKLYQAVNDLCLHKMGGSLYQRIENECEAYISAALQSLVGQSEDLVVFLSLVE  221

Query  648  KCWQDFCDQILTIRGIALYLDRTYV  722
            KCWQDFCDQ+L IRGIALYLDRTYV
Sbjct  222  KCWQDFCDQMLMIRGIALYLDRTYV  246



>gb|KJB66936.1| hypothetical protein B456_010G166800 [Gossypium raimondii]
Length=788

 Score =   273 bits (698),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 176/225 (78%), Gaps = 10/225 (4%)
 Frame = +3

Query  57   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFY  236
            MS P   P KRS   ++ +A++   + P H  PPMKKAKSQAVACSLD N+NG HH H  
Sbjct  1    MSLP---PTKRS--ITNVTASSSSSSSP-HFQPPMKKAKSQAVACSLDPNRNGLHHHHNN  54

Query  237  PD---VDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPT  407
             D   V  DPSS  + D DS  A A   A ANLSRKKAT PQPAKKLVIKLVKAKPTLPT
Sbjct  55   QDDNNVLFDPSSMPLHD-DSKSADARTPAAANLSRKKATPPQPAKKLVIKLVKAKPTLPT  113

Query  408  NFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAV  587
            NFE  TWATLKSAI AIFLK+PD CDLEKLYQAVNDLCLHKMGGSLYQRIEKECE HI+ 
Sbjct  114  NFEVETWATLKSAITAIFLKRPDSCDLEKLYQAVNDLCLHKMGGSLYQRIEKECEEHIST  173

Query  588  ALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            AL+SLVGQS DLVVFLSLVEKCWQD CDQ+L IR IALYLDRTYV
Sbjct  174  ALRSLVGQSPDLVVFLSLVEKCWQDLCDQMLMIRSIALYLDRTYV  218



>ref|XP_007025065.1| Cullin-4B isoform 2, partial [Theobroma cacao]
 gb|EOY27687.1| Cullin-4B isoform 2, partial [Theobroma cacao]
Length=653

 Score =   270 bits (690),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 163/195 (84%), Gaps = 3/195 (2%)
 Frame = +3

Query  144  HRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE--DPSSASMEDLDSPGASATRAAT  317
            H  P MKKAKSQAVACSLD NKNG HH H   D D   DPSS +++D DS    A   A 
Sbjct  28   HFQPSMKKAKSQAVACSLDPNKNGLHHHHNQDDNDVVFDPSSMALDD-DSKPDDARAPAA  86

Query  318  ANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKL  497
            ANLSRKKAT PQPAKKLVIKLVKAKPTLPTNFEE TWA LKSAINAIFLKQPD CDLEKL
Sbjct  87   ANLSRKKATPPQPAKKLVIKLVKAKPTLPTNFEEETWAKLKSAINAIFLKQPDSCDLEKL  146

Query  498  YQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQI  677
            YQAVN+LCLHKMGGSLYQRIEKECE HI+ AL+SLVGQS DLVVFLSLVEKCWQD CDQ+
Sbjct  147  YQAVNNLCLHKMGGSLYQRIEKECEEHISAALRSLVGQSPDLVVFLSLVEKCWQDLCDQM  206

Query  678  LTIRGIALYLDRTYV  722
            L IRGIALYLDRTYV
Sbjct  207  LMIRGIALYLDRTYV  221



>gb|KJB66935.1| hypothetical protein B456_010G166800 [Gossypium raimondii]
Length=816

 Score =   273 bits (698),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 176/225 (78%), Gaps = 10/225 (4%)
 Frame = +3

Query  57   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFY  236
            MS P   P KRS   ++ +A++   + P H  PPMKKAKSQAVACSLD N+NG HH H  
Sbjct  1    MSLP---PTKRS--ITNVTASSSSSSSP-HFQPPMKKAKSQAVACSLDPNRNGLHHHHNN  54

Query  237  PD---VDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPT  407
             D   V  DPSS  + D DS  A A   A ANLSRKKAT PQPAKKLVIKLVKAKPTLPT
Sbjct  55   QDDNNVLFDPSSMPLHD-DSKSADARTPAAANLSRKKATPPQPAKKLVIKLVKAKPTLPT  113

Query  408  NFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAV  587
            NFE  TWATLKSAI AIFLK+PD CDLEKLYQAVNDLCLHKMGGSLYQRIEKECE HI+ 
Sbjct  114  NFEVETWATLKSAITAIFLKRPDSCDLEKLYQAVNDLCLHKMGGSLYQRIEKECEEHIST  173

Query  588  ALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            AL+SLVGQS DLVVFLSLVEKCWQD CDQ+L IR IALYLDRTYV
Sbjct  174  ALRSLVGQSPDLVVFLSLVEKCWQDLCDQMLMIRSIALYLDRTYV  218



>ref|XP_007025064.1| Cullin-4B isoform 1 [Theobroma cacao]
 gb|EOY27686.1| Cullin-4B isoform 1 [Theobroma cacao]
Length=819

 Score =   271 bits (693),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 163/195 (84%), Gaps = 3/195 (2%)
 Frame = +3

Query  144  HRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE--DPSSASMEDLDSPGASATRAAT  317
            H  P MKKAKSQAVACSLD NKNG HH H   D D   DPSS +++D DS    A   A 
Sbjct  28   HFQPSMKKAKSQAVACSLDPNKNGLHHHHNQDDNDVVFDPSSMALDD-DSKPDDARAPAA  86

Query  318  ANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKL  497
            ANLSRKKAT PQPAKKLVIKLVKAKPTLPTNFEE TWA LKSAINAIFLKQPD CDLEKL
Sbjct  87   ANLSRKKATPPQPAKKLVIKLVKAKPTLPTNFEEETWAKLKSAINAIFLKQPDSCDLEKL  146

Query  498  YQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQI  677
            YQAVN+LCLHKMGGSLYQRIEKECE HI+ AL+SLVGQS DLVVFLSLVEKCWQD CDQ+
Sbjct  147  YQAVNNLCLHKMGGSLYQRIEKECEEHISAALRSLVGQSPDLVVFLSLVEKCWQDLCDQM  206

Query  678  LTIRGIALYLDRTYV  722
            L IRGIALYLDRTYV
Sbjct  207  LMIRGIALYLDRTYV  221



>ref|XP_009759464.1| PREDICTED: cullin-4 [Nicotiana sylvestris]
Length=821

 Score =   269 bits (688),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 168/237 (71%), Positives = 180/237 (76%), Gaps = 29/237 (12%)
 Frame = +3

Query  57   MSQPTSNPNKRSSPY----------SSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTN  206
            MSQPT+NP KRSS +          S+ S   G G P       MKKAKSQAV       
Sbjct  1    MSQPTTNPKKRSSFFISTNPSSSTPSTGSGDVGSGGPAY---SLMKKAKSQAV-------  50

Query  207  KNGQHHVHFYPDVDEDPS--SASMED--LDSPG-ASATRAATANLSRKKATLPQpakklv  371
             NGQH VHF  D  EDPS  SA MED  +D+P  AS     TANLSRKKAT PQPAKKLV
Sbjct  51   -NGQH-VHF--DNLEDPSGNSAMMEDSNMDAPSRASVGGGVTANLSRKKATPPQPAKKLV  106

Query  372  iklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQ  551
            IKLVKAKPTLPTNFEENTWATLKSAI+AIFLKQ +PCDLE LYQAVNDLCLHKMGGSLYQ
Sbjct  107  IKLVKAKPTLPTNFEENTWATLKSAISAIFLKQRNPCDLEALYQAVNDLCLHKMGGSLYQ  166

Query  552  RIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            RIEKECE+HIA AL+SL GQSEDLVVFLSLVE+ WQDFCDQ+L IRGIAL+LDRTYV
Sbjct  167  RIEKECESHIAAALRSLAGQSEDLVVFLSLVERRWQDFCDQMLMIRGIALFLDRTYV  223



>ref|XP_009599227.1| PREDICTED: cullin-4 [Nicotiana tomentosiformis]
Length=821

 Score =   268 bits (685),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 166/237 (70%), Positives = 179/237 (76%), Gaps = 29/237 (12%)
 Frame = +3

Query  57   MSQPTSNPNKRSSPY----------SSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTN  206
            MSQPT+NP KRSS +          ++ S   G G P       MKKAKSQAV       
Sbjct  1    MSQPTTNPKKRSSIFISTNTSSSTPTTGSGNVGSGTPAY---SLMKKAKSQAV-------  50

Query  207  KNGQHHVHFYPDVDEDPSSAS--MED--LDSPG-ASATRAATANLSRKKATLPQpakklv  371
             NGQH VHF  D  EDPSS S  MED  +D+P   S     TANLSRKKAT PQPAKKLV
Sbjct  51   -NGQH-VHF--DNLEDPSSNSSMMEDSNMDAPSRVSVGGGVTANLSRKKATPPQPAKKLV  106

Query  372  iklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQ  551
            IKLVKAKPTLPTNFEENTWATLKSAI+AIFLKQ +PC+LE LYQAVNDLCLHKMGGSLYQ
Sbjct  107  IKLVKAKPTLPTNFEENTWATLKSAISAIFLKQRNPCELEALYQAVNDLCLHKMGGSLYQ  166

Query  552  RIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            RIEKECE+HIA AL+SL GQSEDLVVFLSLVE+ WQDFCDQ+L IRGIALYLDRTYV
Sbjct  167  RIEKECESHIAAALRSLAGQSEDLVVFLSLVERRWQDFCDQMLMIRGIALYLDRTYV  223



>gb|EYU43260.1| hypothetical protein MIMGU_mgv1a001310mg [Erythranthe guttata]
Length=843

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 158/248 (64%), Positives = 182/248 (73%), Gaps = 29/248 (12%)
 Frame = +3

Query  57   MSQPT----SNPNKRSS---PYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNG  215
            MSQ T    +NPNKRSS   P ++    A   A P+   P +KKAKSQ V+CSLD N NG
Sbjct  1    MSQRTNSSSTNPNKRSSSTNPNANTPIAAAAAASPIF--PALKKAKSQGVSCSLDGNMNG  58

Query  216  QH------HVHFY------PDVDEDPSSASMEDLDSP-------GASATRAATANLSRKK  338
            Q       HVHF       P +++DP+ A + D  SP       GA++    T+NLSRKK
Sbjct  59   QQQQQPTPHVHFAETPALSPMIEDDPNDAVL-DASSPSSAFGRVGATSCGGITSNLSRKK  117

Query  339  ATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDL  518
            AT PQP KKLVIKL +AKPTLP+NFEE TW  LKSAI+ IFLKQP+PCDLEKLYQAVN+L
Sbjct  118  ATPPQPTKKLVIKLFRAKPTLPSNFEETTWEILKSAISTIFLKQPNPCDLEKLYQAVNNL  177

Query  519  CLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIA  698
            CLHK+GG+LYQRIEKECE HI+ ALQSLVGQSEDLVVFLSLVE CWQDFCDQ+L IRGIA
Sbjct  178  CLHKLGGNLYQRIEKECEFHISAALQSLVGQSEDLVVFLSLVENCWQDFCDQMLMIRGIA  237

Query  699  LYLDRTYV  722
            L+LDRTYV
Sbjct  238  LFLDRTYV  245



>gb|KJB69828.1| hypothetical protein B456_011G044900 [Gossypium raimondii]
Length=786

 Score =   262 bits (669),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 158/196 (81%), Gaps = 3/196 (2%)
 Frame = +3

Query  144  HRPPPMKKAKSQAVACSLDTNKNGQHHVHFYP---DVDEDPSSASMEDLDSPGASATRAA  314
            H  P MKKAKSQAVACSLD NKNG H+ H      DV  DPSS    D DS    A   A
Sbjct  28   HFQPSMKKAKSQAVACSLDPNKNGLHNHHNNQGDNDVVFDPSSPMSLDDDSKSDDARAPA  87

Query  315  TANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEK  494
             ANLSRKKAT PQPAKKLVIK VKAKPT+PTNFEE TWA LKSAINAIFLKQPD CDLEK
Sbjct  88   AANLSRKKATPPQPAKKLVIKFVKAKPTVPTNFEEETWAKLKSAINAIFLKQPDSCDLEK  147

Query  495  LYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  674
            LYQAVNDLCLH+MGGSLYQRIEKECE  I+ AL+SLVGQS DLVVFLSLVEKCWQD CDQ
Sbjct  148  LYQAVNDLCLHRMGGSLYQRIEKECEARISAALRSLVGQSPDLVVFLSLVEKCWQDLCDQ  207

Query  675  ILTIRGIALYLDRTYV  722
            +L IRGIALYLDRTYV
Sbjct  208  MLMIRGIALYLDRTYV  223



>ref|XP_009360892.1| PREDICTED: cullin-4 [Pyrus x bretschneideri]
Length=831

 Score =   263 bits (671),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 167/229 (73%), Gaps = 12/229 (5%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFY-----  236
            S+PNKRSS  +    ++     P    PPMKKAKSQAVACSLD +KNG HH H +     
Sbjct  5    SHPNKRSSAINHSGTSSSSSLNPSSAGPPMKKAKSQAVACSLDPSKNGLHHHHHHHPHTH  64

Query  237  ----PDVDE--DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakp-  395
                PD D   DPSS S+++   P   + R   ANLSRKKA  PQP+ K ++  +     
Sbjct  65   PSQDPDNDAVFDPSSMSLDEDLKPDDPSPRGIAANLSRKKAQPPQPSTKKLVIKLVKAKP  124

Query  396  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET  575
            TLPTNFEE TWA LKSAI+AIFLK+PD CDLEKLYQAVNDLCLHKMGGSLYQRIEKECE 
Sbjct  125  TLPTNFEEETWAKLKSAISAIFLKKPDSCDLEKLYQAVNDLCLHKMGGSLYQRIEKECER  184

Query  576  HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            HIA ALQSLVGQS DLVVFLSLVE+CWQD CDQ+L IRGIALYLDRTYV
Sbjct  185  HIAAALQSLVGQSPDLVVFLSLVERCWQDLCDQMLMIRGIALYLDRTYV  233



>gb|KJB69827.1| hypothetical protein B456_011G044900 [Gossypium raimondii]
Length=821

 Score =   262 bits (669),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 158/196 (81%), Gaps = 3/196 (2%)
 Frame = +3

Query  144  HRPPPMKKAKSQAVACSLDTNKNGQHHVHFYP---DVDEDPSSASMEDLDSPGASATRAA  314
            H  P MKKAKSQAVACSLD NKNG H+ H      DV  DPSS    D DS    A   A
Sbjct  28   HFQPSMKKAKSQAVACSLDPNKNGLHNHHNNQGDNDVVFDPSSPMSLDDDSKSDDARAPA  87

Query  315  TANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEK  494
             ANLSRKKAT PQPAKKLVIK VKAKPT+PTNFEE TWA LKSAINAIFLKQPD CDLEK
Sbjct  88   AANLSRKKATPPQPAKKLVIKFVKAKPTVPTNFEEETWAKLKSAINAIFLKQPDSCDLEK  147

Query  495  LYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  674
            LYQAVNDLCLH+MGGSLYQRIEKECE  I+ AL+SLVGQS DLVVFLSLVEKCWQD CDQ
Sbjct  148  LYQAVNDLCLHRMGGSLYQRIEKECEARISAALRSLVGQSPDLVVFLSLVEKCWQDLCDQ  207

Query  675  ILTIRGIALYLDRTYV  722
            +L IRGIALYLDRTYV
Sbjct  208  MLMIRGIALYLDRTYV  223



>gb|KHG10035.1| Cullin-4 -like protein [Gossypium arboreum]
Length=823

 Score =   261 bits (666),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 155/196 (79%), Gaps = 3/196 (2%)
 Frame = +3

Query  144  HRPPPMKKAKSQAVACSLDTNKNGQHHVHFYP---DVDEDPSSASMEDLDSPGASATRAA  314
            H    MKKAKSQAVACSLD NKNG H+ H      DV  DPSS    D DS        A
Sbjct  23   HFQQSMKKAKSQAVACSLDPNKNGLHNHHNNQGDNDVVFDPSSPMALDDDSKSDDGRAPA  82

Query  315  TANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEK  494
             ANLSRKKAT PQPAKKLVIK VKAKPT+P NFEE TWA LKSAINAIFLKQPD CDLEK
Sbjct  83   AANLSRKKATPPQPAKKLVIKFVKAKPTVPMNFEEETWAKLKSAINAIFLKQPDSCDLEK  142

Query  495  LYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  674
            LYQAVNDLCLH+MGGSLYQRIEKECE  I+ AL+SLVGQS DLVVFLSLVEKCWQD CDQ
Sbjct  143  LYQAVNDLCLHRMGGSLYQRIEKECEARISAALKSLVGQSPDLVVFLSLVEKCWQDLCDQ  202

Query  675  ILTIRGIALYLDRTYV  722
            +L IRGIALYLDRTYV
Sbjct  203  MLMIRGIALYLDRTYV  218



>ref|XP_008225565.1| PREDICTED: cullin-4 [Prunus mume]
Length=821

 Score =   259 bits (661),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 158/229 (69%), Positives = 175/229 (76%), Gaps = 13/229 (6%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYP----  239
            S+P KRSS  ++ + ++   +      PPMKKAKSQAVACSLD +KNG HH H +     
Sbjct  5    SHPTKRSSAINNNTISSTSSSLNPSSGPPMKKAKSQAVACSLDPSKNGLHHHHHHHPHTH  64

Query  240  -------DVDEDPSSASM-EDLDSPGASATRAATANLSRKKATLPQpakklviklvkakp  395
                   DV  DPS+ ++ EDL S   S +RA  ANLSRKKA  PQP KKLVIKL+KAKP
Sbjct  65   PSQDSDNDVVFDPSTMALDEDLKSDDPS-SRAVAANLSRKKAQPPQPTKKLVIKLLKAKP  123

Query  396  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET  575
            TLPTNFEE TWA LKSAI AIFLK+PD CD EKLYQAVNDLCLHKMGGSLYQRIEKECE 
Sbjct  124  TLPTNFEEETWAKLKSAICAIFLKKPDSCDSEKLYQAVNDLCLHKMGGSLYQRIEKECER  183

Query  576  HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            HIA ALQSLVGQS DLVVFLSLVE+CWQD CDQ+L IRGIALYLDRTYV
Sbjct  184  HIAAALQSLVGQSPDLVVFLSLVERCWQDLCDQMLMIRGIALYLDRTYV  232



>gb|KGN65538.1| hypothetical protein Csa_1G435830 [Cucumis sativus]
Length=278

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 155/194 (80%), Gaps = 13/194 (7%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLD------SPGASATRAATA  320
            MKK KSQ     LD NKNG HH   + D D DPSS  ++D D      SP   A+R+   
Sbjct  49   MKKTKSQP----LDPNKNGLHH---HDDPDFDPSSMPLDDEDLKPPHHSPLIGASRSVAT  101

Query  321  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  500
            NLSRKKAT PQPAKKLVIKL+KAKPTLP NFEE+TWA LKSAI AIFLKQP+ CDLEKLY
Sbjct  102  NLSRKKATPPQPAKKLVIKLLKAKPTLPANFEEDTWAKLKSAICAIFLKQPNSCDLEKLY  161

Query  501  QAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQIL  680
            QAVNDLCLHKMGG+LY+RIEKECE HI+ ALQSLVGQS DLVVFL+ VEKCWQDFCDQ+L
Sbjct  162  QAVNDLCLHKMGGNLYRRIEKECEVHISAALQSLVGQSPDLVVFLAYVEKCWQDFCDQML  221

Query  681  TIRGIALYLDRTYV  722
             IRGIALYLDRTYV
Sbjct  222  MIRGIALYLDRTYV  235



>ref|XP_007214632.1| hypothetical protein PRUPE_ppa001433mg [Prunus persica]
 gb|EMJ15831.1| hypothetical protein PRUPE_ppa001433mg [Prunus persica]
Length=830

 Score =   259 bits (661),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 158/229 (69%), Positives = 176/229 (77%), Gaps = 13/229 (6%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYP----  239
            S+P KRSS  ++ ++++   +      PPMKKAKSQAVACSLD +KNG HH H +     
Sbjct  5    SHPTKRSSAINNNTSSSTSSSLNPSSGPPMKKAKSQAVACSLDPSKNGLHHHHHHHPHTH  64

Query  240  -------DVDEDPSSASM-EDLDSPGASATRAATANLSRKKATLPQpakklviklvkakp  395
                   DV  DPS+ ++ EDL S   S +RA  ANLSRKKA  PQP KKLVIKL+KAKP
Sbjct  65   PSQDPDNDVVFDPSTMALDEDLKSDDPS-SRAVAANLSRKKAQPPQPTKKLVIKLLKAKP  123

Query  396  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET  575
            TLPTNFEE TWA LKSAI AIFLK+PD CD EKLYQAVNDLCLHKMGGSLYQRIEKECE 
Sbjct  124  TLPTNFEEETWAKLKSAICAIFLKKPDSCDSEKLYQAVNDLCLHKMGGSLYQRIEKECER  183

Query  576  HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            HIA ALQSLVGQS DLVVFLSLVE+CWQD CDQ+L IRGIALYLDRTYV
Sbjct  184  HIAAALQSLVGQSPDLVVFLSLVERCWQDLCDQMLMIRGIALYLDRTYV  232



>ref|XP_008349190.1| PREDICTED: cullin-4-like [Malus domestica]
Length=579

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 168/232 (72%), Gaps = 15/232 (6%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRP---PPMKKAKSQAVACSLDTNKNGQHHVHFY--  236
            S+PNKRSS  +    ++   +  L+     PPMKKAKSQAVA SLD +KNG HH H +  
Sbjct  5    SHPNKRSSAINHSGTSSSSSSSSLNPSSAGPPMKKAKSQAVAGSLDXSKNGLHHHHHHHP  64

Query  237  -------PDVDE--DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvka  389
                   PD D   DPSS S+++   P   + R   ANLSRKKA  PQP+ K ++  +  
Sbjct  65   HTHPSQDPDNDAVFDPSSMSLDEDLKPDDPSPRGIAANLSRKKAQPPQPSTKKLVIKLVK  124

Query  390  kp-TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKE  566
               TLPTNFEE TWA LKSAI+AIFLK+PD CDLEKLYQAVNDLCLHKMGGSLYQRIEKE
Sbjct  125  AKPTLPTNFEEETWAKLKSAISAIFLKKPDSCDLEKLYQAVNDLCLHKMGGSLYQRIEKE  184

Query  567  CETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            CE HIA ALQSLVGQS DLVVFLSLVE+CWQD CDQ+L IRGIALYLDRTYV
Sbjct  185  CERHIAAALQSLVGQSPDLVVFLSLVERCWQDLCDQMLMIRGIALYLDRTYV  236



>gb|KHG21020.1| Cullin-4 -like protein [Gossypium arboreum]
Length=786

 Score =   256 bits (653),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 155/189 (82%), Gaps = 2/189 (1%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHF-YPDVDEDPSSASMEDLDSPGASATRAATANLSRK  335
            M KAKSQAVA S+D NKNG HH H    DV  DPSS S+ D DS        ATANLSRK
Sbjct  1    MTKAKSQAVAGSIDPNKNGLHHHHQDGNDVVFDPSSMSLGD-DSKSGVPRSPATANLSRK  59

Query  336  KATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVND  515
            KAT PQPAKKLVIK VKAKPT+PTNFEE TWA LKSAINAIFLKQPD CDLEKLYQ VN+
Sbjct  60   KATPPQPAKKLVIKFVKAKPTMPTNFEEETWAKLKSAINAIFLKQPDSCDLEKLYQDVNN  119

Query  516  LCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGI  695
            LCLHK+GGSLYQRIEKECE HI+ AL+SLVGQS DLVVFLSLVEKCWQD CDQ+L IR I
Sbjct  120  LCLHKLGGSLYQRIEKECEEHISAALRSLVGQSPDLVVFLSLVEKCWQDLCDQMLMIRSI  179

Query  696  ALYLDRTYV  722
            ALYLDRTYV
Sbjct  180  ALYLDRTYV  188



>gb|KJB68315.1| hypothetical protein B456_010G238300 [Gossypium raimondii]
Length=703

 Score =   252 bits (644),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 154/189 (81%), Gaps = 2/189 (1%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHF-YPDVDEDPSSASMEDLDSPGASATRAATANLSRK  335
            M KAKS +VA S+D NKNG HH H    DV  DPSS S+ D DS        ATANLSRK
Sbjct  1    MTKAKSHSVAGSIDPNKNGLHHHHQDGNDVVFDPSSMSLGD-DSKSGVPRSPATANLSRK  59

Query  336  KATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVND  515
            KAT PQPAKKLVIK VKAKPT+PTNFEE TWA LKSAINAIFLKQPD CDLEKLYQ VN+
Sbjct  60   KATPPQPAKKLVIKFVKAKPTMPTNFEEETWAKLKSAINAIFLKQPDSCDLEKLYQDVNN  119

Query  516  LCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGI  695
            LCLHK+GGSLYQRIEKECE HI+ AL+SLVGQS DLVVFLSLVEKCWQD CDQ+L IR I
Sbjct  120  LCLHKLGGSLYQRIEKECEEHISAALRSLVGQSPDLVVFLSLVEKCWQDLCDQMLMIRSI  179

Query  696  ALYLDRTYV  722
            ALYLDRTYV
Sbjct  180  ALYLDRTYV  188



>gb|KJB68319.1| hypothetical protein B456_010G238300 [Gossypium raimondii]
Length=759

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 154/189 (81%), Gaps = 2/189 (1%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHF-YPDVDEDPSSASMEDLDSPGASATRAATANLSRK  335
            M KAKS +VA S+D NKNG HH H    DV  DPSS S+ D DS        ATANLSRK
Sbjct  1    MTKAKSHSVAGSIDPNKNGLHHHHQDGNDVVFDPSSMSLGD-DSKSGVPRSPATANLSRK  59

Query  336  KATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVND  515
            KAT PQPAKKLVIK VKAKPT+PTNFEE TWA LKSAINAIFLKQPD CDLEKLYQ VN+
Sbjct  60   KATPPQPAKKLVIKFVKAKPTMPTNFEEETWAKLKSAINAIFLKQPDSCDLEKLYQDVNN  119

Query  516  LCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGI  695
            LCLHK+GGSLYQRIEKECE HI+ AL+SLVGQS DLVVFLSLVEKCWQD CDQ+L IR I
Sbjct  120  LCLHKLGGSLYQRIEKECEEHISAALRSLVGQSPDLVVFLSLVEKCWQDLCDQMLMIRSI  179

Query  696  ALYLDRTYV  722
            ALYLDRTYV
Sbjct  180  ALYLDRTYV  188



>ref|XP_006449702.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
 gb|ESR62942.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
Length=804

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 168/218 (77%), Gaps = 14/218 (6%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDT-NKNGQHHVHFYPDVD  248
            S PNKR         TA +     + P  MKKAKSQAVACS+DT NKNG HH +   D  
Sbjct  2    SLPNKR---------TASNNNSNNYSPSAMKKAKSQAVACSVDTANKNGLHHDN---DAV  49

Query  249  EDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTW  428
             DPSS S++D   P     +AA ANLSRKKA  PQPAKKLVIKL+KAKPTLPTNFEE+TW
Sbjct  50   FDPSSISLDDDLKPDEPRQQAA-ANLSRKKAQPPQPAKKLVIKLLKAKPTLPTNFEEDTW  108

Query  429  ATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVG  608
            A LK AI AIFLKQP  CDLEKLYQAVNDLCLHKMGG+LYQRIEKECE HI+ A++SLVG
Sbjct  109  AKLKLAIKAIFLKQPTSCDLEKLYQAVNDLCLHKMGGNLYQRIEKECEEHISAAIRSLVG  168

Query  609  QSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            QS DLVVFLSLVE+CWQD CDQ+L IRGIALYLDRTYV
Sbjct  169  QSPDLVVFLSLVERCWQDLCDQMLMIRGIALYLDRTYV  206



>gb|KDO78192.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=739

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 168/218 (77%), Gaps = 14/218 (6%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDT-NKNGQHHVHFYPDVD  248
            S PNKR         TA +     + P  MKKAKSQAVACS+DT NKNG HH +   D  
Sbjct  2    SLPNKR---------TASNNNSNNYSPSAMKKAKSQAVACSVDTANKNGLHHDN---DAV  49

Query  249  EDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTW  428
             DPSS S++D   P     +AA ANLSRKKA  PQPAKKLVIKL+KAKPTLPTNFEE+TW
Sbjct  50   FDPSSISLDDDLKPDEPRQQAA-ANLSRKKAQPPQPAKKLVIKLLKAKPTLPTNFEEDTW  108

Query  429  ATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVG  608
            A LK AI AIFLKQP  CDLEKLYQAVNDLCLHKMGG+LYQRIEKECE HI+ A++SLVG
Sbjct  109  AKLKLAIKAIFLKQPTSCDLEKLYQAVNDLCLHKMGGNLYQRIEKECEEHISAAIRSLVG  168

Query  609  QSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            QS DLVVFLSLVE+CWQD CDQ+L IRGIALYLDRTYV
Sbjct  169  QSPDLVVFLSLVERCWQDLCDQMLMIRGIALYLDRTYV  206



>gb|KJB68318.1| hypothetical protein B456_010G238300 [Gossypium raimondii]
Length=786

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 154/189 (81%), Gaps = 2/189 (1%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHF-YPDVDEDPSSASMEDLDSPGASATRAATANLSRK  335
            M KAKS +VA S+D NKNG HH H    DV  DPSS S+ D DS        ATANLSRK
Sbjct  1    MTKAKSHSVAGSIDPNKNGLHHHHQDGNDVVFDPSSMSLGD-DSKSGVPRSPATANLSRK  59

Query  336  KATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVND  515
            KAT PQPAKKLVIK VKAKPT+PTNFEE TWA LKSAINAIFLKQPD CDLEKLYQ VN+
Sbjct  60   KATPPQPAKKLVIKFVKAKPTMPTNFEEETWAKLKSAINAIFLKQPDSCDLEKLYQDVNN  119

Query  516  LCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGI  695
            LCLHK+GGSLYQRIEKECE HI+ AL+SLVGQS DLVVFLSLVEKCWQD CDQ+L IR I
Sbjct  120  LCLHKLGGSLYQRIEKECEEHISAALRSLVGQSPDLVVFLSLVEKCWQDLCDQMLMIRSI  179

Query  696  ALYLDRTYV  722
            ALYLDRTYV
Sbjct  180  ALYLDRTYV  188



>ref|XP_006467459.1| PREDICTED: cullin-4-like isoform X1 [Citrus sinensis]
 gb|KDO78189.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=804

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 168/218 (77%), Gaps = 14/218 (6%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDT-NKNGQHHVHFYPDVD  248
            S PNKR         TA +     + P  MKKAKSQAVACS+DT NKNG HH +   D  
Sbjct  2    SLPNKR---------TASNNNSNNYSPSAMKKAKSQAVACSVDTANKNGLHHDN---DAV  49

Query  249  EDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTW  428
             DPSS S++D   P     +AA ANLSRKKA  PQPAKKLVIKL+KAKPTLPTNFEE+TW
Sbjct  50   FDPSSISLDDDLKPDEPRQQAA-ANLSRKKAQPPQPAKKLVIKLLKAKPTLPTNFEEDTW  108

Query  429  ATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVG  608
            A LK AI AIFLKQP  CDLEKLYQAVNDLCLHKMGG+LYQRIEKECE HI+ A++SLVG
Sbjct  109  AKLKLAIKAIFLKQPTSCDLEKLYQAVNDLCLHKMGGNLYQRIEKECEEHISAAIRSLVG  168

Query  609  QSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            QS DLVVFLSLVE+CWQD CDQ+L IRGIALYLDRTYV
Sbjct  169  QSPDLVVFLSLVERCWQDLCDQMLMIRGIALYLDRTYV  206



>ref|XP_006467460.1| PREDICTED: cullin-4-like isoform X2 [Citrus sinensis]
Length=783

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 158/189 (84%), Gaps = 5/189 (3%)
 Frame = +3

Query  159  MKKAKSQAVACSLDT-NKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRK  335
            MKKAKSQAVACS+DT NKNG HH +   D   DPSS S++D   P     +AA ANLSRK
Sbjct  1    MKKAKSQAVACSVDTANKNGLHHDN---DAVFDPSSISLDDDLKPDEPRQQAA-ANLSRK  56

Query  336  KATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVND  515
            KA  PQPAKKLVIKL+KAKPTLPTNFEE+TWA LK AI AIFLKQP  CDLEKLYQAVND
Sbjct  57   KAQPPQPAKKLVIKLLKAKPTLPTNFEEDTWAKLKLAIKAIFLKQPTSCDLEKLYQAVND  116

Query  516  LCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGI  695
            LCLHKMGG+LYQRIEKECE HI+ A++SLVGQS DLVVFLSLVE+CWQD CDQ+L IRGI
Sbjct  117  LCLHKMGGNLYQRIEKECEEHISAAIRSLVGQSPDLVVFLSLVERCWQDLCDQMLMIRGI  176

Query  696  ALYLDRTYV  722
            ALYLDRTYV
Sbjct  177  ALYLDRTYV  185



>gb|KDO78190.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=792

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 168/218 (77%), Gaps = 14/218 (6%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDT-NKNGQHHVHFYPDVD  248
            S PNKR         TA +     + P  MKKAKSQAVACS+DT NKNG HH +   D  
Sbjct  2    SLPNKR---------TASNNNSNNYSPSAMKKAKSQAVACSVDTANKNGLHHDN---DAV  49

Query  249  EDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTW  428
             DPSS S++D   P     +AA ANLSRKKA  PQPAKKLVIKL+KAKPTLPTNFEE+TW
Sbjct  50   FDPSSISLDDDLKPDEPRQQAA-ANLSRKKAQPPQPAKKLVIKLLKAKPTLPTNFEEDTW  108

Query  429  ATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVG  608
            A LK AI AIFLKQP  CDLEKLYQAVNDLCLHKMGG+LYQRIEKECE HI+ A++SLVG
Sbjct  109  AKLKLAIKAIFLKQPTSCDLEKLYQAVNDLCLHKMGGNLYQRIEKECEEHISAAIRSLVG  168

Query  609  QSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            QS DLVVFLSLVE+CWQD CDQ+L IRGIALYLDRTYV
Sbjct  169  QSPDLVVFLSLVERCWQDLCDQMLMIRGIALYLDRTYV  206



>ref|XP_006449703.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
 gb|ESR62943.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
Length=805

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 168/218 (77%), Gaps = 14/218 (6%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDT-NKNGQHHVHFYPDVD  248
            S PNKR         TA +     + P  MKKAKSQAVACS+DT NKNG HH +   D  
Sbjct  2    SLPNKR---------TASNNNSNNYSPSAMKKAKSQAVACSVDTANKNGLHHDN---DAV  49

Query  249  EDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTW  428
             DPSS S++D   P     +AA ANLSRKKA  PQPAKKLVIKL+KAKPTLPTNFEE+TW
Sbjct  50   FDPSSISLDDDLKPDEPRQQAA-ANLSRKKAQPPQPAKKLVIKLLKAKPTLPTNFEEDTW  108

Query  429  ATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVG  608
            A LK AI AIFLKQP  CDLEKLYQAVNDLCLHKMGG+LYQRIEKECE HI+ A++SLVG
Sbjct  109  AKLKLAIKAIFLKQPTSCDLEKLYQAVNDLCLHKMGGNLYQRIEKECEEHISAAIRSLVG  168

Query  609  QSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            QS DLVVFLSLVE+CWQD CDQ+L IRGIALYLDRTYV
Sbjct  169  QSPDLVVFLSLVERCWQDLCDQMLMIRGIALYLDRTYV  206



>gb|KDO78191.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=805

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 168/218 (77%), Gaps = 14/218 (6%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDT-NKNGQHHVHFYPDVD  248
            S PNKR         TA +     + P  MKKAKSQAVACS+DT NKNG HH +   D  
Sbjct  2    SLPNKR---------TASNNNSNNYSPSAMKKAKSQAVACSVDTANKNGLHHDN---DAV  49

Query  249  EDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTW  428
             DPSS S++D   P     +AA ANLSRKKA  PQPAKKLVIKL+KAKPTLPTNFEE+TW
Sbjct  50   FDPSSISLDDDLKPDEPRQQAA-ANLSRKKAQPPQPAKKLVIKLLKAKPTLPTNFEEDTW  108

Query  429  ATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVG  608
            A LK AI AIFLKQP  CDLEKLYQAVNDLCLHKMGG+LYQRIEKECE HI+ A++SLVG
Sbjct  109  AKLKLAIKAIFLKQPTSCDLEKLYQAVNDLCLHKMGGNLYQRIEKECEEHISAAIRSLVG  168

Query  609  QSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            QS DLVVFLSLVE+CWQD CDQ+L IRGIALYLDRTYV
Sbjct  169  QSPDLVVFLSLVERCWQDLCDQMLMIRGIALYLDRTYV  206



>ref|XP_012072113.1| PREDICTED: cullin-4 [Jatropha curcas]
 gb|KDP37982.1| hypothetical protein JCGZ_04625 [Jatropha curcas]
Length=821

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 162/198 (82%), Gaps = 9/198 (5%)
 Frame = +3

Query  153  PPMKKAKSQAV-ACS-LD--TNKNGQHHVHFYP----DVDEDPSSASMEDLDSPGASATR  308
            PPMKKAKSQAV ACS L+  +NKNG HH +       D+  DPSS +++D D      + 
Sbjct  27   PPMKKAKSQAVSACSPLEPTSNKNGLHHFNSATAPENDIVFDPSSMTLDD-DPKLDDRSP  85

Query  309  AATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDL  488
               ANLSRKKAT PQPAKKLVIKL+KAKPTLPTNFEE+TWA L+SAI AIFLKQPD CDL
Sbjct  86   PPAANLSRKKATPPQPAKKLVIKLLKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPDSCDL  145

Query  489  EKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFC  668
            EKLYQAVNDLCLHKMGG+LYQRIEKECE HI+ ALQSLVGQS DLVVFLSLVE+CWQD C
Sbjct  146  EKLYQAVNDLCLHKMGGNLYQRIEKECEAHISAALQSLVGQSPDLVVFLSLVERCWQDMC  205

Query  669  DQILTIRGIALYLDRTYV  722
            DQ+L IRGIALYLDRTYV
Sbjct  206  DQMLMIRGIALYLDRTYV  223



>ref|XP_006352972.1| PREDICTED: cullin-4-like [Solanum tuberosum]
Length=797

 Score =   247 bits (631),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 148/188 (79%), Gaps = 11/188 (6%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKK  338
            MKKAKSQA A   D NKNGQ   H     DE     SM      G       T+NLSRKK
Sbjct  23   MKKAKSQAAAT--DDNKNGQQQHHKVESTDE--PCVSMIQYSGGGV------TSNLSRKK  72

Query  339  ATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDL  518
            AT P P K+LVIKL KAKPTLPTNFEENTWATLKSAI+AIFLKQPDPCDLEKLYQAVNDL
Sbjct  73   AT-PPPKKQLVIKLNKAKPTLPTNFEENTWATLKSAISAIFLKQPDPCDLEKLYQAVNDL  131

Query  519  CLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIA  698
            CLHKMGGSLYQRIEKECE HI   LQSLVGQSEDLVVFLSLVE+CWQDFCDQ+L IRGIA
Sbjct  132  CLHKMGGSLYQRIEKECEAHIVAVLQSLVGQSEDLVVFLSLVERCWQDFCDQMLMIRGIA  191

Query  699  LYLDRTYV  722
            L+LDRTYV
Sbjct  192  LFLDRTYV  199



>ref|XP_008371761.1| PREDICTED: cullin-4 [Malus domestica]
Length=834

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 153/201 (76%), Gaps = 11/201 (5%)
 Frame = +3

Query  153  PPMKKAKSQAVACSLDTNKNGQHHVHFY--------PDVDE--DPSSASMEDLDSPGASA  302
            PPMKKAKSQAVACSLD +KNG HH H +        PD D   DPSS S++D   P   +
Sbjct  36   PPMKKAKSQAVACSLDPSKNGLHHHHHHPHTHPTQDPDNDXVFDPSSMSLDDDLRPDDPS  95

Query  303  TRAATANLSRKKATLPQpakklviklvkakp-TLPTNFEENTWATLKSAINAIFLKQPDP  479
             R   ANLSRKKA  PQP+ K ++  +     TLPTNFEE TWA LKSAI AIFLK+PD 
Sbjct  96   PRGVAANLSRKKAQPPQPSTKKLVIKLVKAKPTLPTNFEEETWAKLKSAICAIFLKKPDS  155

Query  480  CDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQ  659
            CDLEKLYQAV DLCLHKMGGSLYQRIEKECE HIA ALQSLVGQS DLVVFLSLVE+CWQ
Sbjct  156  CDLEKLYQAVTDLCLHKMGGSLYQRIEKECERHIAAALQSLVGQSPDLVVFLSLVERCWQ  215

Query  660  DFCDQILTIRGIALYLDRTYV  722
            D CDQ+L IRGIALYLDRTYV
Sbjct  216  DLCDQMLMIRGIALYLDRTYV  236



>gb|AAL27655.2| putative cullin protein [Olea europaea]
Length=816

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 168/218 (77%), Gaps = 24/218 (11%)
 Frame = +3

Query  120  AGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQH---HVHFYPD-----VDEDPSSASME  275
            A DGA      P MKKAKSQA+A SLD NKNGQ    HVHF P      +DED +     
Sbjct  7    ADDGASI---SPRMKKAKSQALAYSLD-NKNGQQSVPHVHFDPSANSSMIDEDSNDVV--  60

Query  276  DLDSPGASAT--------RAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  431
             LD+  +S +           TANL+RKKAT PQPAKKLVIKLVKAKP LPT+FEENTWA
Sbjct  61   -LDASASSNSFGRVVGGGGGVTANLARKKATPPQPAKKLVIKLVKAKPMLPTDFEENTWA  119

Query  432  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  611
            TLKSAI AIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLY+RIEKECE++I+ ALQSLVGQ
Sbjct  120  TLKSAIIAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYRRIEKECESYISAALQSLVGQ  179

Query  612  SEDLVVFLSLVE-KCWQDFCDQILTIRGIALYLDRTYV  722
            S+DLVVFLSL + KCWQDFCDQ+L I GIALYLDRTYV
Sbjct  180  SQDLVVFLSLGQKKCWQDFCDQMLMIPGIALYLDRTYV  217



>ref|XP_011013417.1| PREDICTED: cullin-4-like [Populus euphratica]
Length=811

 Score =   246 bits (629),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 156/194 (80%), Gaps = 9/194 (5%)
 Frame = +3

Query  153  PPMKKAKSQAV-ACS-LDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRA--ATA  320
            PPMKKAK QA  ACS LD NKNG+HH     DV  DPSS S++D   P     R   A A
Sbjct  25   PPMKKAKCQAASACSPLDYNKNGRHHSD---DVVFDPSSMSLDD--DPKLVDYRPPPAAA  79

Query  321  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  500
            NLSRKKATLPQPAKKLVIKLVKAKPTLPTNFEE+TWA L+SAI AIFLKQP PCDLEKLY
Sbjct  80   NLSRKKATLPQPAKKLVIKLVKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPAPCDLEKLY  139

Query  501  QAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQIL  680
            QAVNDLCLHKMGG+LY RIEKECE H++ ALQSLVGQS DL VFL LV  CW+D CDQ+L
Sbjct  140  QAVNDLCLHKMGGNLYLRIEKECEEHVSAALQSLVGQSPDLEVFLKLVATCWKDLCDQML  199

Query  681  TIRGIALYLDRTYV  722
             IRGIALYLDRTYV
Sbjct  200  MIRGIALYLDRTYV  213



>gb|EPS64061.1| cullin 4, partial [Genlisea aurea]
Length=763

 Score =   245 bits (626),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 158/202 (78%), Gaps = 13/202 (6%)
 Frame = +3

Query  150  PPPMKKAKSQAVACSLDTNKNGQHHVHFYPD---VDEDPSSASMEDLDSPGASA------  302
            PP MKKAKSQAVACS+D  +    H    P    + ED + ++ME   SP A++      
Sbjct  29   PPTMKKAKSQAVACSIDAPQQQIPHFAETPAHSPMIEDDADSAMEA--SPPANSFGRVVS  86

Query  303  --TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPD  476
                  TANLSRKKAT PQPAKK VIKL KAKPTLP+NFEENTWATLKSAI+AIFLK+PD
Sbjct  87   GSGGGVTANLSRKKATPPQPAKKFVIKLNKAKPTLPSNFEENTWATLKSAISAIFLKRPD  146

Query  477  PCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCW  656
            PCD EKLYQAV+DLCLHKMGGSLYQRIEKECE +I+ AL  LVGQSEDL VFLSLVE+CW
Sbjct  147  PCDSEKLYQAVSDLCLHKMGGSLYQRIEKECEAYISFALHFLVGQSEDLAVFLSLVERCW  206

Query  657  QDFCDQILTIRGIALYLDRTYV  722
            QDFCDQ+L IRGIALYLDRTYV
Sbjct  207  QDFCDQMLMIRGIALYLDRTYV  228



>ref|XP_004149667.1| PREDICTED: cullin-4 [Cucumis sativus]
Length=833

 Score =   246 bits (628),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 155/194 (80%), Gaps = 13/194 (7%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLD------SPGASATRAATA  320
            MKK KSQ     LD NKNG HH   + D D DPSS  ++D D      SP   A+R+   
Sbjct  49   MKKTKSQP----LDPNKNGLHH---HDDPDFDPSSMPLDDEDLKPPHHSPLIGASRSVAT  101

Query  321  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  500
            NLSRKKAT PQPAKKLVIKL+KAKPTLP NFEE+TWA LKSAI AIFLKQP+ CDLEKLY
Sbjct  102  NLSRKKATPPQPAKKLVIKLLKAKPTLPANFEEDTWAKLKSAICAIFLKQPNSCDLEKLY  161

Query  501  QAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQIL  680
            QAVNDLCLHKMGG+LY+RIEKECE HI+ ALQSLVGQS DLVVFL+ VEKCWQDFCDQ+L
Sbjct  162  QAVNDLCLHKMGGNLYRRIEKECEVHISAALQSLVGQSPDLVVFLAYVEKCWQDFCDQML  221

Query  681  TIRGIALYLDRTYV  722
             IRGIALYLDRTYV
Sbjct  222  MIRGIALYLDRTYV  235



>ref|XP_002270764.2| PREDICTED: cullin-4 [Vitis vinifera]
Length=828

 Score =   246 bits (627),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 150/237 (63%), Positives = 168/237 (71%), Gaps = 28/237 (12%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYP----  239
            S+P KRS   ++ S++ G  +P     PPMKKAKSQAVACSLD  KNG       P    
Sbjct  2    SHPTKRSLSNTTTSSSGG-ASPHF---PPMKKAKSQAVACSLDP-KNGLQPPPHPPPPSS  56

Query  240  ----DVDEDPSSASMEDL-----------DSPGASATRAATANLSRKKATLPQpakklvi  374
                D D DPS+ +++D              P A      TANLSRKKAT PQPAKK ++
Sbjct  57   HHFPDDDFDPSAMALDDDLKPDDADAAACSRPSAGGV---TANLSRKKATPPQPAKKQLV  113

Query  375  klvkakp-TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQ  551
              +     TLPTNFEE+TWA LKSAI+AIFLKQPDPCDLEKLYQAVNDLCLHKMGG+LYQ
Sbjct  114  IKLLKAKPTLPTNFEEDTWAKLKSAISAIFLKQPDPCDLEKLYQAVNDLCLHKMGGNLYQ  173

Query  552  RIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            RIEKECE+HI  ALQSLVGQS DLVVFLSLVEKCWQD CDQ+L IRGIALYLDRTYV
Sbjct  174  RIEKECESHIRAALQSLVGQSPDLVVFLSLVEKCWQDLCDQMLMIRGIALYLDRTYV  230



>ref|XP_011011309.1| PREDICTED: cullin-4-like isoform X2 [Populus euphratica]
Length=655

 Score =   241 bits (614),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 154/191 (81%), Gaps = 5/191 (3%)
 Frame = +3

Query  156  PMKKAKSQAV-ACS-LDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  329
            PMKKAKSQA  ACS LD NKNG +H     DV  DPSS S++D        T  A ANLS
Sbjct  23   PMKKAKSQAASACSPLDHNKNGLYHSD---DVVFDPSSMSLDDDLKLVDYRTPPAAANLS  79

Query  330  RKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAV  509
            RKKAT PQPAKKLVIKLVKAKPTLPTNFEE+TWA L+SAI AIFLKQP PCDLEKLYQAV
Sbjct  80   RKKATPPQPAKKLVIKLVKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPAPCDLEKLYQAV  139

Query  510  NDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIR  689
             DLCLHKMGG+LY RIEKECETHI+ ALQSLVGQS DLVVFL LVE+CW D CDQ+L IR
Sbjct  140  TDLCLHKMGGNLYLRIEKECETHISAALQSLVGQSPDLVVFLKLVEECWHDLCDQMLMIR  199

Query  690  GIALYLDRTYV  722
             IALYLDRTY+
Sbjct  200  SIALYLDRTYL  210



>ref|XP_006377605.1| hypothetical protein POPTR_0011s08280g [Populus trichocarpa]
 gb|ERP55402.1| hypothetical protein POPTR_0011s08280g [Populus trichocarpa]
Length=741

 Score =   242 bits (617),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 154/194 (79%), Gaps = 9/194 (5%)
 Frame = +3

Query  153  PPMKKAKSQAV-ACS-LDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRA--ATA  320
            PPMKKAK QA  ACS LD NKNG HH     DV  DPSS S++D   P     R   A A
Sbjct  25   PPMKKAKCQAASACSPLDYNKNGLHHSD---DVVFDPSSMSLDD--DPKLVDYRPPPAAA  79

Query  321  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  500
            NLSRKKATLPQPAKKLVIKLVKAKPTLPTNFEE+TWA L+SAI AIFLKQP  CDLEKLY
Sbjct  80   NLSRKKATLPQPAKKLVIKLVKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPALCDLEKLY  139

Query  501  QAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQIL  680
            QAVNDLCLHKMGG+LY RIEKECE HI+ ALQSLVGQS DL VFL LV  CW+D CDQ+L
Sbjct  140  QAVNDLCLHKMGGNLYLRIEKECEAHISAALQSLVGQSPDLEVFLKLVATCWKDLCDQML  199

Query  681  TIRGIALYLDRTYV  722
             IRGIALYLDRTYV
Sbjct  200  MIRGIALYLDRTYV  213



>ref|XP_008444359.1| PREDICTED: cullin-4 [Cucumis melo]
Length=829

 Score =   243 bits (620),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 155/194 (80%), Gaps = 13/194 (7%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASM--EDLDSPGAS----ATRAATA  320
            MKK KSQ     LD NKNG HH   + D D DPSS  +  EDL  P  S    A+R+   
Sbjct  45   MKKTKSQP----LDPNKNGLHH---HDDPDFDPSSMPLDDEDLKPPHHSSLIGASRSVAT  97

Query  321  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  500
            NLSRKKAT PQPAKKLVIKL+KAKPTLP NFEE+TWA LKSAI AIFLKQP+ CDLEKLY
Sbjct  98   NLSRKKATPPQPAKKLVIKLLKAKPTLPANFEEDTWAKLKSAICAIFLKQPNSCDLEKLY  157

Query  501  QAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQIL  680
            QAVNDLCLHKMGG+LY+RIEKECE HI+ ALQSLVGQS DLVVFL+ VEKCWQDFCDQ+L
Sbjct  158  QAVNDLCLHKMGGNLYRRIEKECEVHISAALQSLVGQSPDLVVFLAYVEKCWQDFCDQML  217

Query  681  TIRGIALYLDRTYV  722
             IRGIALYLDRTYV
Sbjct  218  MIRGIALYLDRTYV  231



>ref|XP_006377604.1| hypothetical protein POPTR_0011s08280g [Populus trichocarpa]
 gb|ERP55401.1| hypothetical protein POPTR_0011s08280g [Populus trichocarpa]
Length=811

 Score =   242 bits (618),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 154/194 (79%), Gaps = 9/194 (5%)
 Frame = +3

Query  153  PPMKKAKSQAV-ACS-LDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRA--ATA  320
            PPMKKAK QA  ACS LD NKNG HH     DV  DPSS S++D   P     R   A A
Sbjct  25   PPMKKAKCQAASACSPLDYNKNGLHHSD---DVVFDPSSMSLDD--DPKLVDYRPPPAAA  79

Query  321  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  500
            NLSRKKATLPQPAKKLVIKLVKAKPTLPTNFEE+TWA L+SAI AIFLKQP  CDLEKLY
Sbjct  80   NLSRKKATLPQPAKKLVIKLVKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPALCDLEKLY  139

Query  501  QAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQIL  680
            QAVNDLCLHKMGG+LY RIEKECE HI+ ALQSLVGQS DL VFL LV  CW+D CDQ+L
Sbjct  140  QAVNDLCLHKMGGNLYLRIEKECEAHISAALQSLVGQSPDLEVFLKLVATCWKDLCDQML  199

Query  681  TIRGIALYLDRTYV  722
             IRGIALYLDRTYV
Sbjct  200  MIRGIALYLDRTYV  213



>ref|XP_011011308.1| PREDICTED: cullin-4-like isoform X1 [Populus euphratica]
Length=808

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 154/191 (81%), Gaps = 5/191 (3%)
 Frame = +3

Query  156  PMKKAKSQAV-ACS-LDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  329
            PMKKAKSQA  ACS LD NKNG +H     DV  DPSS S++D        T  A ANLS
Sbjct  23   PMKKAKSQAASACSPLDHNKNGLYHSD---DVVFDPSSMSLDDDLKLVDYRTPPAAANLS  79

Query  330  RKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAV  509
            RKKAT PQPAKKLVIKLVKAKPTLPTNFEE+TWA L+SAI AIFLKQP PCDLEKLYQAV
Sbjct  80   RKKATPPQPAKKLVIKLVKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPAPCDLEKLYQAV  139

Query  510  NDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIR  689
             DLCLHKMGG+LY RIEKECETHI+ ALQSLVGQS DLVVFL LVE+CW D CDQ+L IR
Sbjct  140  TDLCLHKMGGNLYLRIEKECETHISAALQSLVGQSPDLVVFLKLVEECWHDLCDQMLMIR  199

Query  690  GIALYLDRTYV  722
             IALYLDRTY+
Sbjct  200  SIALYLDRTYL  210



>ref|XP_002305340.2| hypothetical protein POPTR_0004s14020g [Populus trichocarpa]
 gb|EEE85851.2| hypothetical protein POPTR_0004s14020g [Populus trichocarpa]
Length=813

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 154/191 (81%), Gaps = 5/191 (3%)
 Frame = +3

Query  156  PMKKAKSQAV-ACS-LDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  329
            PMKKAKSQA  ACS LD NKNG +H     DV  DPSS S++D        T  A ANLS
Sbjct  28   PMKKAKSQAASACSPLDHNKNGLYHSD---DVVFDPSSMSLDDDLKLVDYRTPPAAANLS  84

Query  330  RKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAV  509
            RKKAT PQPAKKLVIKLVKAKPTLPTNFEE+TWA L+SAI AIFLKQP  CDLEKLYQAV
Sbjct  85   RKKATPPQPAKKLVIKLVKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPALCDLEKLYQAV  144

Query  510  NDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIR  689
            NDLCLHKMGG+LY RIEKECETHI+ ALQSLVGQS DLVVFL LVE+CW D CDQ+L IR
Sbjct  145  NDLCLHKMGGNLYLRIEKECETHISAALQSLVGQSPDLVVFLKLVEECWHDLCDQMLMIR  204

Query  690  GIALYLDRTYV  722
             IALYLDRTYV
Sbjct  205  SIALYLDRTYV  215



>ref|XP_002519675.1| cullin, putative [Ricinus communis]
 gb|EEF42648.1| cullin, putative [Ricinus communis]
Length=807

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 159/209 (76%), Gaps = 21/209 (10%)
 Frame = +3

Query  153  PPMKKAKSQAV-ACS-LDT--NKNGQHHVHFYP--------DVDEDPSSASMEDLDSPGA  296
            PPMKKAKSQAV ACS LDT  NKNG HH  F P        DV  DPSS    D D    
Sbjct  26   PPMKKAKSQAVSACSPLDTTTNKNGIHH--FNPSTTAAAENDVVFDPSSMMSLDDDPKLD  83

Query  297  SATRA-------ATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINA  455
                        A ANLSRKKAT PQPAKKLVIKLVKAKPTLP NFEE+TWA L+SAI A
Sbjct  84   DDHHRSHHHHPPAAANLSRKKATPPQPAKKLVIKLVKAKPTLPINFEEDTWAKLQSAIKA  143

Query  456  IFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFL  635
            IFLKQPD CDLEKLYQAVNDLCLHKMGG+LYQ+IEKECE HI+ AL+SLVGQS DLVVFL
Sbjct  144  IFLKQPDSCDLEKLYQAVNDLCLHKMGGNLYQQIEKECEAHISAALRSLVGQSPDLVVFL  203

Query  636  SLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            SLVE+CWQD CDQ+L IRGIALYLDRTYV
Sbjct  204  SLVERCWQDLCDQMLMIRGIALYLDRTYV  232



>ref|XP_010247871.1| PREDICTED: cullin-4-like isoform X2 [Nelumbo nucifera]
Length=725

 Score =   239 bits (610),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 166/235 (71%), Gaps = 25/235 (11%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDV--  245
            S+ NKR  P  S S T+G+   P      MKKAKSQAV CSL+  KNG            
Sbjct  2    SHHNKR--PNCSTSNTSGNSGGPF---SSMKKAKSQAVTCSLE--KNGLQQQQQQNHGQH  54

Query  246  ----DEDPSSASMEDL-----DSP------GASATRAATA-NLSRKKATLPQpakklvik  377
                DED +    +DL     D+P      G S T    A NLSRKKAT PQPAKKLVIK
Sbjct  55   HHFDDEDSAMVVDDDLKVDTVDAPLLALGVGCSGTTTGIAANLSRKKATPPQPAKKLVIK  114

Query  378  lvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  557
            LVK KP LPT+FEE+TW TLKSAI+AIFLKQPDPCD EKLYQAV DLCLHKMGG+LYQRI
Sbjct  115  LVKDKPKLPTSFEEDTWVTLKSAISAIFLKQPDPCDSEKLYQAVCDLCLHKMGGNLYQRI  174

Query  558  EKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            EKECE HI+ ALQSLVGQS DLVVFLSLVEKCWQD CDQ+L IRGIALYLDRTYV
Sbjct  175  EKECEAHISAALQSLVGQSPDLVVFLSLVEKCWQDLCDQMLMIRGIALYLDRTYV  229



>gb|KCW73811.1| hypothetical protein EUGRSUZ_E02414 [Eucalyptus grandis]
Length=801

 Score =   240 bits (612),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 158/203 (78%), Gaps = 15/203 (7%)
 Frame = +3

Query  159  MKKAKSQAVACSLDT---NKNGQH---------HVHFYP--DVDEDPSSASMED-LDSPG  293
            MKKAKSQAVA SLD+   +KNG H            F P  DV  DP++ S+ED + S  
Sbjct  1    MKKAKSQAVAGSLDSTTAHKNGLHPHPAKQQSQQPGFDPESDVVFDPATMSLEDGMKSDD  60

Query  294  ASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQP  473
              A  +  ANLSRKKAT PQPAKKLVIKL+KAKPTLPTNFEE+TWA LK+AINAIFLKQP
Sbjct  61   MVAGHSVAANLSRKKATPPQPAKKLVIKLLKAKPTLPTNFEEDTWAKLKAAINAIFLKQP  120

Query  474  DPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKC  653
              C LE  YQAVNDLCLHK+GG+LYQRIEKECETHI+  LQ+LVGQS DL VFLSLVE+C
Sbjct  121  VSCSLEDYYQAVNDLCLHKLGGNLYQRIEKECETHISAVLQTLVGQSPDLAVFLSLVERC  180

Query  654  WQDFCDQILTIRGIALYLDRTYV  722
            WQDFCDQ+L IRGIALYLDRTYV
Sbjct  181  WQDFCDQMLMIRGIALYLDRTYV  203



>gb|KCW73810.1| hypothetical protein EUGRSUZ_E02414 [Eucalyptus grandis]
Length=801

 Score =   240 bits (612),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 158/203 (78%), Gaps = 15/203 (7%)
 Frame = +3

Query  159  MKKAKSQAVACSLDT---NKNGQH---------HVHFYP--DVDEDPSSASMED-LDSPG  293
            MKKAKSQAVA SLD+   +KNG H            F P  DV  DP++ S+ED + S  
Sbjct  1    MKKAKSQAVAGSLDSTTAHKNGLHPHPAKQQSQQPGFDPESDVVFDPATMSLEDGMKSDD  60

Query  294  ASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQP  473
              A  +  ANLSRKKAT PQPAKKLVIKL+KAKPTLPTNFEE+TWA LK+AINAIFLKQP
Sbjct  61   MVAGHSVAANLSRKKATPPQPAKKLVIKLLKAKPTLPTNFEEDTWAKLKAAINAIFLKQP  120

Query  474  DPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKC  653
              C LE  YQAVNDLCLHK+GG+LYQRIEKECETHI+  LQ+LVGQS DL VFLSLVE+C
Sbjct  121  VSCSLEDYYQAVNDLCLHKLGGNLYQRIEKECETHISAVLQTLVGQSPDLAVFLSLVERC  180

Query  654  WQDFCDQILTIRGIALYLDRTYV  722
            WQDFCDQ+L IRGIALYLDRTYV
Sbjct  181  WQDFCDQMLMIRGIALYLDRTYV  203



>ref|XP_010056896.1| PREDICTED: cullin-4 [Eucalyptus grandis]
Length=838

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 158/203 (78%), Gaps = 15/203 (7%)
 Frame = +3

Query  159  MKKAKSQAVACSLDT---NKNGQH---------HVHFYP--DVDEDPSSASMED-LDSPG  293
            MKKAKSQAVA SLD+   +KNG H            F P  DV  DP++ S+ED + S  
Sbjct  38   MKKAKSQAVAGSLDSTTAHKNGLHPHPAKQQSQQPGFDPESDVVFDPATMSLEDGMKSDD  97

Query  294  ASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQP  473
              A  +  ANLSRKKAT PQPAKKLVIKL+KAKPTLPTNFEE+TWA LK+AINAIFLKQP
Sbjct  98   MVAGHSVAANLSRKKATPPQPAKKLVIKLLKAKPTLPTNFEEDTWAKLKAAINAIFLKQP  157

Query  474  DPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKC  653
              C LE  YQAVNDLCLHK+GG+LYQRIEKECETHI+  LQ+LVGQS DL VFLSLVE+C
Sbjct  158  VSCSLEDYYQAVNDLCLHKLGGNLYQRIEKECETHISAVLQTLVGQSPDLAVFLSLVERC  217

Query  654  WQDFCDQILTIRGIALYLDRTYV  722
            WQDFCDQ+L IRGIALYLDRTYV
Sbjct  218  WQDFCDQMLMIRGIALYLDRTYV  240



>ref|XP_010247870.1| PREDICTED: cullin-4-like isoform X1 [Nelumbo nucifera]
Length=827

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 166/235 (71%), Gaps = 25/235 (11%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDV--  245
            S+ NKR  P  S S T+G+   P      MKKAKSQAV CSL+  KNG            
Sbjct  2    SHHNKR--PNCSTSNTSGNSGGPF---SSMKKAKSQAVTCSLE--KNGLQQQQQQNHGQH  54

Query  246  ----DEDPSSASMEDL-----DSP------GASATRAATA-NLSRKKATLPQpakklvik  377
                DED +    +DL     D+P      G S T    A NLSRKKAT PQPAKKLVIK
Sbjct  55   HHFDDEDSAMVVDDDLKVDTVDAPLLALGVGCSGTTTGIAANLSRKKATPPQPAKKLVIK  114

Query  378  lvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  557
            LVK KP LPT+FEE+TW TLKSAI+AIFLKQPDPCD EKLYQAV DLCLHKMGG+LYQRI
Sbjct  115  LVKDKPKLPTSFEEDTWVTLKSAISAIFLKQPDPCDSEKLYQAVCDLCLHKMGGNLYQRI  174

Query  558  EKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            EKECE HI+ ALQSLVGQS DLVVFLSLVEKCWQD CDQ+L IRGIALYLDRTYV
Sbjct  175  EKECEAHISAALQSLVGQSPDLVVFLSLVEKCWQDLCDQMLMIRGIALYLDRTYV  229



>emb|CBI30911.3| unnamed protein product [Vitis vinifera]
Length=802

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 152/208 (73%), Gaps = 24/208 (12%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHFYP--------DVDEDPSSASMEDL-----------  281
            MKKAKSQAVACSLD  KNG       P        D D DPS+ +++D            
Sbjct  1    MKKAKSQAVACSLDP-KNGLQPPPHPPPPSSHHFPDDDFDPSAMALDDDLKPDDADAAAC  59

Query  282  DSPGASATRAATANLSRKKATLPQpakklviklvkakp-TLPTNFEENTWATLKSAINAI  458
              P A      TANLSRKKAT PQPAKK ++  +     TLPTNFEE+TWA LKSAI+AI
Sbjct  60   SRPSAGGV---TANLSRKKATPPQPAKKQLVIKLLKAKPTLPTNFEEDTWAKLKSAISAI  116

Query  459  FLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLS  638
            FLKQPDPCDLEKLYQAVNDLCLHKMGG+LYQRIEKECE+HI  ALQSLVGQS DLVVFLS
Sbjct  117  FLKQPDPCDLEKLYQAVNDLCLHKMGGNLYQRIEKECESHIRAALQSLVGQSPDLVVFLS  176

Query  639  LVEKCWQDFCDQILTIRGIALYLDRTYV  722
            LVEKCWQD CDQ+L IRGIALYLDRTYV
Sbjct  177  LVEKCWQDLCDQMLMIRGIALYLDRTYV  204



>ref|XP_010274939.1| PREDICTED: cullin-4-like [Nelumbo nucifera]
Length=837

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 161/211 (76%), Gaps = 28/211 (13%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTN----------KNGQHHVHFYPDVDEDPSSASMED------LDSP  290
            MKKAKSQAVACSL+ N           + QHH+      D+D SS  ++D      +D+ 
Sbjct  34   MKKAKSQAVACSLEKNGLQQQQQQQQNHAQHHL-----FDDDDSSMIVDDDIKVDAVDAT  88

Query  291  ------GASAT-RAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAI  449
                  G+S T     ANLSRKKAT PQPAKKLVIKLVKAKP LPTNFEE+TWATLKSAI
Sbjct  89   PIALGVGSSGTPHGVAANLSRKKATPPQPAKKLVIKLVKAKPKLPTNFEEDTWATLKSAI  148

Query  450  NAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVV  629
            +AIFLKQPD CD EKLYQAV DLCLHKMGG+LYQRIEKECE+HI+ ALQSLVGQS DLVV
Sbjct  149  SAIFLKQPDSCDSEKLYQAVCDLCLHKMGGNLYQRIEKECESHISAALQSLVGQSPDLVV  208

Query  630  FLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            FL+LVEKCWQD CDQ+L IRGIALYLDRTYV
Sbjct  209  FLALVEKCWQDLCDQMLMIRGIALYLDRTYV  239



>emb|CAN75926.1| hypothetical protein VITISV_010491 [Vitis vinifera]
Length=806

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 152/208 (73%), Gaps = 24/208 (12%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHFYP--------DVDEDPSSASMEDL-----------  281
            MKKAKSQAVACSLD  KNG       P        D D DPS+ +++D            
Sbjct  1    MKKAKSQAVACSLDP-KNGLQPPPHPPPPSSHHFPDDDFDPSAMALDDDLKPDDADAAAC  59

Query  282  DSPGASATRAATANLSRKKATLPQpakklviklvkakp-TLPTNFEENTWATLKSAINAI  458
              P A      TANLSRKKAT PQPAKK ++  +     TLPTNFEE+TWA LKSAI+AI
Sbjct  60   SRPSAGGV---TANLSRKKATPPQPAKKQLVIKLLKAKPTLPTNFEEDTWAKLKSAISAI  116

Query  459  FLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLS  638
            FLKQPDPCDLEKLYQAVNDLCLHKMGG+LYQRIEKECE+HI  ALQSLVGQS DLVVFLS
Sbjct  117  FLKQPDPCDLEKLYQAVNDLCLHKMGGNLYQRIEKECESHIRAALQSLVGQSPDLVVFLS  176

Query  639  LVEKCWQDFCDQILTIRGIALYLDRTYV  722
            LVEKCWQD CDQ+L IRGIALYLDRTYV
Sbjct  177  LVEKCWQDLCDQMLMIRGIALYLDRTYV  204



>ref|XP_010110959.1| hypothetical protein L484_021653 [Morus notabilis]
 gb|EXC29345.1| hypothetical protein L484_021653 [Morus notabilis]
Length=862

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 144/194 (74%), Gaps = 9/194 (5%)
 Frame = +3

Query  153  PPMKKAKSQAVACSLDTNKNGQHHVHF-YPDVDEDPSSASMEDLDSPGASATRAATANLS  329
            PPMKK KSQA+ACSLD NKNG HH +    DV  DPS A  ED   P  S    A ANLS
Sbjct  35   PPMKKTKSQAMACSLDPNKNGLHHNNQDNNDVVFDPSMALDED---PKPSD--GAAANLS  89

Query  330  RKKATLPQ---pakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  500
            RKKAT P        +     K KP LP NFE+ TWA LKSAI AIFLK+ D CDLEKLY
Sbjct  90   RKKATPPHPPGKKFVIKFNKDKEKPKLPVNFEDETWAKLKSAICAIFLKRRDSCDLEKLY  149

Query  501  QAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQIL  680
            QAVN+LCLHK+G +LYQRIE+ECETHIA AL++LVGQS DLVVFLSLVE+CWQD CDQIL
Sbjct  150  QAVNNLCLHKLGANLYQRIERECETHIAAALRALVGQSPDLVVFLSLVERCWQDLCDQIL  209

Query  681  TIRGIALYLDRTYV  722
             IRGIALYLDRTYV
Sbjct  210  MIRGIALYLDRTYV  223



>ref|XP_008787804.1| PREDICTED: cullin-4-like isoform X2 [Phoenix dactylifera]
Length=846

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 145/240 (60%), Positives = 166/240 (69%), Gaps = 19/240 (8%)
 Frame = +3

Query  60   SQPTSNPNKRSSPYSSCSATAGDGAP---PLHRPPPMKKAKSQA-VACSLDTNKNGQH--  221
            S  +S    R++ + S S+    G+P    +     MKK KSQ   A +++  KNG H  
Sbjct  9    SSVSSGGGNRTTTHGSTSSGGVIGSPLSPSIASSSAMKKFKSQPPAAAAVEREKNGLHLH  68

Query  222  HVHF---------YPDVDEDPSSASMEDLDSPGASA--TRAATANLSRKKATLPQ--pak  362
              HF          P  +EDP     EDL +  ++A  +    ANLSRKKAT PQ    K
Sbjct  69   STHFDPAAAAAAAQPAEEEDPMLVDQEDLKAGASTAITSTGVAANLSRKKATPPQPLAKK  128

Query  363  klviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGS  542
            +LVIKLVK KPTLPTNFEE+TWATLKSAI AIFLKQPDPCD EKLYQAV+DLCLHKMGG+
Sbjct  129  QLVIKLVKGKPTLPTNFEEDTWATLKSAITAIFLKQPDPCDSEKLYQAVSDLCLHKMGGN  188

Query  543  LYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            LYQRIEKECE HI+  L SLVGQS DLVVFLSLVEKCWQDFCDQ+L IRGIALYLDRTYV
Sbjct  189  LYQRIEKECEVHISTTLSSLVGQSPDLVVFLSLVEKCWQDFCDQMLMIRGIALYLDRTYV  248



>ref|XP_008787803.1| PREDICTED: cullin-4-like isoform X1 [Phoenix dactylifera]
Length=871

 Score =   237 bits (604),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 145/240 (60%), Positives = 166/240 (69%), Gaps = 19/240 (8%)
 Frame = +3

Query  60   SQPTSNPNKRSSPYSSCSATAGDGAP---PLHRPPPMKKAKSQA-VACSLDTNKNGQH--  221
            S  +S    R++ + S S+    G+P    +     MKK KSQ   A +++  KNG H  
Sbjct  9    SSVSSGGGNRTTTHGSTSSGGVIGSPLSPSIASSSAMKKFKSQPPAAAAVEREKNGLHLH  68

Query  222  HVHF---------YPDVDEDPSSASMEDLDSPGASA--TRAATANLSRKKATLPQ--pak  362
              HF          P  +EDP     EDL +  ++A  +    ANLSRKKAT PQ    K
Sbjct  69   STHFDPAAAAAAAQPAEEEDPMLVDQEDLKAGASTAITSTGVAANLSRKKATPPQPLAKK  128

Query  363  klviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGS  542
            +LVIKLVK KPTLPTNFEE+TWATLKSAI AIFLKQPDPCD EKLYQAV+DLCLHKMGG+
Sbjct  129  QLVIKLVKGKPTLPTNFEEDTWATLKSAITAIFLKQPDPCDSEKLYQAVSDLCLHKMGGN  188

Query  543  LYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            LYQRIEKECE HI+  L SLVGQS DLVVFLSLVEKCWQDFCDQ+L IRGIALYLDRTYV
Sbjct  189  LYQRIEKECEVHISTTLSSLVGQSPDLVVFLSLVEKCWQDFCDQMLMIRGIALYLDRTYV  248



>gb|KHN06973.1| Cullin-4 [Glycine soja]
Length=788

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 159/217 (73%), Gaps = 28/217 (13%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE  251
            S P KRSS       TAG    P   PPPMKKAKS  +  S  +            D   
Sbjct  2    SLPTKRSS-------TAGSSLSP---PPPMKKAKSLLLHSSSSS------------DAVL  39

Query  252  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  431
            DPSS  ++D D P A A     ANL+RKKAT PQPAKKL+IKL KAKPTLPTNFEE+TWA
Sbjct  40   DPSSMPLDD-DLPNARA-----ANLARKKATPPQPAKKLLIKLHKAKPTLPTNFEEDTWA  93

Query  432  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  611
             LKSAI AIFLKQP+ CDLEKLYQAVNDLCL+KMGG+LYQRIEKECE HI+ ALQSLVGQ
Sbjct  94   KLKSAIRAIFLKQPNSCDLEKLYQAVNDLCLYKMGGNLYQRIEKECEAHISAALQSLVGQ  153

Query  612  SEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            S DLVVFLSLVE+CWQD CDQ+L IRGIALYLDRTYV
Sbjct  154  SPDLVVFLSLVERCWQDLCDQMLMIRGIALYLDRTYV  190



>ref|XP_009408525.1| PREDICTED: cullin-4-like [Musa acuminata subsp. malaccensis]
Length=847

 Score =   234 bits (598),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 153/205 (75%), Gaps = 19/205 (9%)
 Frame = +3

Query  159  MKKAKSQ-AVACSLDTNKNGQHHVHF-----------YPDVDEDPSSASMEDLDSPGASA  302
            MKKAK   A ACSL+  KNG HH HF            P  +ED      E+L  PGAS 
Sbjct  47   MKKAKPLPAAACSLEKEKNGLHH-HFDTAAAAAAVAARPGKEEDAMLVDQEEL-KPGASV  104

Query  303  TRAAT---ANLSRKKATLPQ--pakklviklvkakpTLPTNFEENTWATLKSAINAIFLK  467
              A T   ANLSRKKAT PQ    K+LVIK VK KP++P NFEE+TWATLKSAINAIFLK
Sbjct  105  PVAMTGVAANLSRKKATPPQPSAKKQLVIKFVKGKPSVPANFEEDTWATLKSAINAIFLK  164

Query  468  QPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVE  647
            + DPCD EKLYQAV+DLCLHKMGG+LYQR+++ECE HI+ AL SLVGQS DLVVFLSLVE
Sbjct  165  RRDPCDSEKLYQAVDDLCLHKMGGNLYQRVQRECEIHISRALSSLVGQSPDLVVFLSLVE  224

Query  648  KCWQDFCDQILTIRGIALYLDRTYV  722
            KCWQDFCDQ+LTIRGIAL LDRTYV
Sbjct  225  KCWQDFCDQMLTIRGIALVLDRTYV  249



>ref|XP_009398338.1| PREDICTED: cullin-4-like [Musa acuminata subsp. malaccensis]
Length=842

 Score =   233 bits (593),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 160/229 (70%), Gaps = 19/229 (8%)
 Frame = +3

Query  90   SSPYSSCSATAGDGAPPLHRPPPMKKAKSQ-AVACSLDTNKNGQHHVHFYPDV-------  245
             +P S+  A+ G         P MKKAK Q A  CSL+  KNG H    + +        
Sbjct  17   GTPNSNSGASGGATHISPELSPAMKKAKPQLAATCSLEKEKNGLHPQPHHSNTTAAAAVA  76

Query  246  -----DEDPSSASMEDLDSPGASATRAAT---ANLSRKKATLPQ--pakklviklvkakp  395
                 ++D      E+L  PGASA    T   ANLSRKKAT PQ    K+LVIKLVK KP
Sbjct  77   AQSGEEDDAMLVDQEEL-KPGASAPVMVTGVAANLSRKKATPPQPSVKKQLVIKLVKGKP  135

Query  396  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET  575
            +LP NFEE+TWATLKSAI AIFLKQPDPCD EKLYQAV+DLCLHKMGG+LYQRI+KECET
Sbjct  136  SLPKNFEEDTWATLKSAITAIFLKQPDPCDSEKLYQAVSDLCLHKMGGNLYQRIQKECET  195

Query  576  HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            HI+  + SLVGQS DLVVFLSLVEKCWQDFCDQ+LTIRGIAL LDRT+V
Sbjct  196  HISSTMSSLVGQSPDLVVFLSLVEKCWQDFCDQMLTIRGIALVLDRTFV  244



>ref|XP_010941311.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4-like [Elaeis guineensis]
Length=846

 Score =   232 bits (592),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 138/224 (62%), Positives = 154/224 (69%), Gaps = 17/224 (8%)
 Frame = +3

Query  102  SSCSATAGDGAPPLHRPPPMKKAKSQA-VACSLDTNKNGQH--HVHFYPDVDE-------  251
            SS        +P       MKK KSQ   A +++  KNG H    HF P           
Sbjct  25   SSGGVIGSPVSPSATSSSAMKKFKSQPPAAAAVEREKNGLHPHSTHFDPAAAAEAAAQPA  84

Query  252  ---DPSSASMEDLDSPGASA--TRAATANLSRKKATLPQ--pakklviklvkakpTLPTN  410
               DP     EDL +  ++A  +    ANLSRKKAT PQ    K+L+IKLVK KPTLPTN
Sbjct  85   GEEDPMLVDQEDLKAGASTAITSTGVAANLSRKKATPPQPLAKKQLIIKLVKGKPTLPTN  144

Query  411  FEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVA  590
            FEE+TWATLKSAI AIFLKQPDPCD EKLYQAV+DLCLHKMGG+LYQRIEKECE HI+  
Sbjct  145  FEEDTWATLKSAITAIFLKQPDPCDSEKLYQAVSDLCLHKMGGNLYQRIEKECEVHISTT  204

Query  591  LQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            L +LVGQS DLVVFLSLVEKCWQDFCDQ+L IRGIALYLDRTYV
Sbjct  205  LFALVGQSPDLVVFLSLVEKCWQDFCDQMLMIRGIALYLDRTYV  248



>ref|XP_010923713.1| PREDICTED: cullin-4-like isoform X2 [Elaeis guineensis]
Length=845

 Score =   231 bits (590),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 156/215 (73%), Gaps = 19/215 (9%)
 Frame = +3

Query  132  APPLHRPPPMKKAKSQ------AVACSLDTNKNGQHHVH---FYPDV-----DEDPSSAS  269
            +P +     MKKAK Q      A A S++  KNG H VH   + P       +ED     
Sbjct  34   SPSVTTSSSMKKAKCQPAAAAAAAAVSVEREKNGLH-VHPTRYDPAAAQSAEEEDSMLLD  92

Query  270  MEDLDSPGASA--TRAATANLSRKKATLPQ--pakklviklvkakpTLPTNFEENTWATL  437
             EDL +  ++A  T    ANLSRKKAT PQ    K+LVIKLVK KPTLPTNFEE+TWATL
Sbjct  93   QEDLKAGASTAITTTGVAANLSRKKATPPQPSTKKQLVIKLVKGKPTLPTNFEEDTWATL  152

Query  438  KSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSE  617
            KSAI AIFLKQPDPCD EKLYQAV+DLCLHKMGG+LYQRI+KECE HI+  L SLVGQS 
Sbjct  153  KSAITAIFLKQPDPCDSEKLYQAVSDLCLHKMGGNLYQRIQKECEVHISATLSSLVGQSP  212

Query  618  DLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            DLVVFLSLVEKCWQDFCDQIL IRGIALYLDRTYV
Sbjct  213  DLVVFLSLVEKCWQDFCDQILMIRGIALYLDRTYV  247



>ref|XP_010923712.1| PREDICTED: cullin-4-like isoform X1 [Elaeis guineensis]
Length=870

 Score =   231 bits (589),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 156/215 (73%), Gaps = 19/215 (9%)
 Frame = +3

Query  132  APPLHRPPPMKKAKSQ------AVACSLDTNKNGQHHVH---FYPDV-----DEDPSSAS  269
            +P +     MKKAK Q      A A S++  KNG H VH   + P       +ED     
Sbjct  34   SPSVTTSSSMKKAKCQPAAAAAAAAVSVEREKNGLH-VHPTRYDPAAAQSAEEEDSMLLD  92

Query  270  MEDLDSPGASA--TRAATANLSRKKATLPQ--pakklviklvkakpTLPTNFEENTWATL  437
             EDL +  ++A  T    ANLSRKKAT PQ    K+LVIKLVK KPTLPTNFEE+TWATL
Sbjct  93   QEDLKAGASTAITTTGVAANLSRKKATPPQPSTKKQLVIKLVKGKPTLPTNFEEDTWATL  152

Query  438  KSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSE  617
            KSAI AIFLKQPDPCD EKLYQAV+DLCLHKMGG+LYQRI+KECE HI+  L SLVGQS 
Sbjct  153  KSAITAIFLKQPDPCDSEKLYQAVSDLCLHKMGGNLYQRIQKECEVHISATLSSLVGQSP  212

Query  618  DLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            DLVVFLSLVEKCWQDFCDQIL IRGIALYLDRTYV
Sbjct  213  DLVVFLSLVEKCWQDFCDQILMIRGIALYLDRTYV  247



>ref|XP_004233125.1| PREDICTED: cullin-4 [Solanum lycopersicum]
Length=802

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 133/176 (76%), Gaps = 7/176 (4%)
 Frame = +3

Query  198  DTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklvik  377
            D NKNGQ     +    +D    SM      G       T+NLSRKKAT PQP KK ++ 
Sbjct  35   DDNKNGQQQQQHHHHHHKDEPCVSMIQYSGGGV------TSNLSRKKATPPQPPKKQLVI  88

Query  378  lvkakp-TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQR  554
             +     TLPTNFEENTWATLKSAI+AIFLKQPDPCDLEKLYQAV DLCLHKMGGSLYQR
Sbjct  89   KLNKAKPTLPTNFEENTWATLKSAISAIFLKQPDPCDLEKLYQAVTDLCLHKMGGSLYQR  148

Query  555  IEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            IEKECE HI   LQSLVGQSEDLVVFLS+V++CWQDFCDQ+L IRGIALYLDRTYV
Sbjct  149  IEKECEAHIVAVLQSLVGQSEDLVVFLSVVQRCWQDFCDQMLMIRGIALYLDRTYV  204



>ref|XP_010666663.1| PREDICTED: cullin-4 [Beta vulgaris subsp. vulgaris]
Length=825

 Score =   230 bits (587),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 152/236 (64%), Gaps = 23/236 (10%)
 Frame = +3

Query  57   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFY  236
            MS P +N    SSP S+ +        P      MKK KSQ    SLDT        +  
Sbjct  1    MSPPNNNKRPASSPTSTHTNLTSSSFSP-----SMKKPKSQ----SLDTRNALHSAFNSS  51

Query  237  PDVDEDPSSASMEDLD-------------SPGASATRAATANLSRKKATLPQpakklvik  377
              VD+DP+S  +++ D             S  A  +   TANLSRKKAT P P+ K ++ 
Sbjct  52   SAVDDDPASVIVDNDDDLKSNAVISSSANSRSAPISGGVTANLSRKKATPPNPSTKKLVI  111

Query  378  lvkakp-TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQR  554
             +     TLP NFEE TWATLKSAINAIFLKQPD CDLEKLYQAVNDLCLHKMGGSLYQR
Sbjct  112  KLVKAKPTLPPNFEEVTWATLKSAINAIFLKQPDSCDLEKLYQAVNDLCLHKMGGSLYQR  171

Query  555  IEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            IEKE E H++  L SLVGQS DLVVFLSLVEKCWQD CDQ+L IRGIALYLDRTYV
Sbjct  172  IEKESEAHVSTVLHSLVGQSPDLVVFLSLVEKCWQDLCDQMLMIRGIALYLDRTYV  227



>gb|KHN47328.1| Cullin-4 [Glycine soja]
Length=777

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 152/217 (70%), Gaps = 38/217 (18%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE  251
            S P KRSS       TAG    P   PPPMKKAKS  +  S D +               
Sbjct  2    SLPTKRSS-------TAGSSLSP---PPPMKKAKSLLLRSSSDDH---------------  36

Query  252  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  431
                    D   P A A     ANL+RKKAT PQPAKKL+IKL KAKPTLPTNFEE+TWA
Sbjct  37   --------DAVLPNARA-----ANLARKKATPPQPAKKLLIKLHKAKPTLPTNFEEDTWA  83

Query  432  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  611
             LKSAI AIFLKQP+ CDLEKLYQAVNDLCL+KMGG+LYQRIEKECE HI+ ALQSLVGQ
Sbjct  84   KLKSAICAIFLKQPNSCDLEKLYQAVNDLCLYKMGGNLYQRIEKECEAHISAALQSLVGQ  143

Query  612  SEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            S DLVVFLSLVE+CWQD CDQ+L IRGIALYLDRTYV
Sbjct  144  SPDLVVFLSLVERCWQDLCDQMLMIRGIALYLDRTYV  180



>ref|XP_003546083.1| PREDICTED: cullin-4-like [Glycine max]
Length=788

 Score =   224 bits (571),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 136/157 (87%), Gaps = 6/157 (4%)
 Frame = +3

Query  252  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  431
            DPSS  ++D D P A A     ANL+RKKAT PQPAKKL+IKL KAKPTLPTNFEE+TWA
Sbjct  40   DPSSMPLDD-DLPNARA-----ANLARKKATPPQPAKKLLIKLHKAKPTLPTNFEEDTWA  93

Query  432  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  611
             LKSAI AIFLKQP+ CDLEKLYQAVNDLCL+KMGG+LYQRIEKECE HI+ ALQSLVGQ
Sbjct  94   KLKSAIRAIFLKQPNSCDLEKLYQAVNDLCLYKMGGNLYQRIEKECEAHISAALQSLVGQ  153

Query  612  SEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            S DLVVFLSLVE+CWQD CDQ+L IRGIAL+LDRTYV
Sbjct  154  SPDLVVFLSLVERCWQDLCDQMLMIRGIALFLDRTYV  190



>ref|XP_007147910.1| hypothetical protein PHAVU_006G165300g [Phaseolus vulgaris]
 gb|ESW19904.1| hypothetical protein PHAVU_006G165300g [Phaseolus vulgaris]
Length=787

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 131/149 (88%), Gaps = 5/149 (3%)
 Frame = +3

Query  276  DLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINA  455
            D D P A A     ANLSRKKAT PQPAKKL+IKL KAKPTLPTNFEE+TWA LKSAI A
Sbjct  46   DDDLPNARA-----ANLSRKKATPPQPAKKLLIKLHKAKPTLPTNFEEDTWAKLKSAICA  100

Query  456  IFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFL  635
            IFLKQP+ CDLEKLYQAVNDLCL+KMGG+LYQRIEKECE+HI+ ALQSLVGQS DLVVFL
Sbjct  101  IFLKQPNSCDLEKLYQAVNDLCLYKMGGNLYQRIEKECESHISAALQSLVGQSPDLVVFL  160

Query  636  SLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            SLVE+CWQD CDQ+L IRGIALYLDRTYV
Sbjct  161  SLVERCWQDLCDQMLMIRGIALYLDRTYV  189



>ref|XP_008809585.1| PREDICTED: cullin-4-like [Phoenix dactylifera]
 ref|XP_008809586.1| PREDICTED: cullin-4-like [Phoenix dactylifera]
Length=841

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 134/167 (80%), Gaps = 6/167 (4%)
 Frame = +3

Query  237  PDVDEDPSSASMEDLDSPGASA---TRAATANLSRKKATLPQ--pakklviklvkakpTL  401
            P  +ED      +DL + GAS    T    ANLSRKKAT PQ    K+LVIKLVK KPTL
Sbjct  78   PAEEEDSMLVDQDDLKA-GASTDITTTGVAANLSRKKATPPQPSAKKQLVIKLVKGKPTL  136

Query  402  PTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHI  581
            P NFEE+TWATLKSAI AIFLKQPDPCD EKLYQAV+DLCLHKMGG+LYQRI+KECE HI
Sbjct  137  PKNFEEDTWATLKSAITAIFLKQPDPCDSEKLYQAVSDLCLHKMGGNLYQRIQKECEVHI  196

Query  582  AVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            +  L SLVGQS DLVVFLSLVEKCWQDFCDQ+L IRGIALYLDRTYV
Sbjct  197  SATLSSLVGQSPDLVVFLSLVEKCWQDFCDQMLMIRGIALYLDRTYV  243



>ref|XP_003593913.1| Cullin [Medicago truncatula]
 gb|AES64164.1| ubiquitin-protein ligase, cullin 4 [Medicago truncatula]
Length=768

 Score =   218 bits (555),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 142/188 (76%), Gaps = 15/188 (8%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKK  338
            MKKAKS   + + D        V F   +D+D     ++  D P   A     ANL+RKK
Sbjct  22   MKKAKS---SSTFD-------DVVFDSSMDDD-----LKPTDLPRGGAASNMAANLARKK  66

Query  339  ATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDL  518
            AT PQPAKKL+I+L K  PT+P+NFE+ TWA LKSAI AIFLKQPD CDLEKLYQAVNDL
Sbjct  67   ATPPQPAKKLLIRLHKGNPTVPSNFEDKTWAILKSAICAIFLKQPDSCDLEKLYQAVNDL  126

Query  519  CLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIA  698
            C+HKMGG+LYQRIEKECE HI+ ALQSLVGQS DL+VFLSLVE+CWQD CDQ+L IRGIA
Sbjct  127  CIHKMGGNLYQRIEKECEVHISAALQSLVGQSPDLIVFLSLVERCWQDLCDQMLMIRGIA  186

Query  699  LYLDRTYV  722
            L+LDRTYV
Sbjct  187  LFLDRTYV  194



>ref|XP_003593912.1| Cullin [Medicago truncatula]
 gb|AES64163.1| ubiquitin-protein ligase, cullin 4 [Medicago truncatula]
Length=792

 Score =   218 bits (555),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 142/188 (76%), Gaps = 15/188 (8%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKK  338
            MKKAKS   + + D        V F   +D+D     ++  D P   A     ANL+RKK
Sbjct  22   MKKAKS---SSTFD-------DVVFDSSMDDD-----LKPTDLPRGGAASNMAANLARKK  66

Query  339  ATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDL  518
            AT PQPAKKL+I+L K  PT+P+NFE+ TWA LKSAI AIFLKQPD CDLEKLYQAVNDL
Sbjct  67   ATPPQPAKKLLIRLHKGNPTVPSNFEDKTWAILKSAICAIFLKQPDSCDLEKLYQAVNDL  126

Query  519  CLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIA  698
            C+HKMGG+LYQRIEKECE HI+ ALQSLVGQS DL+VFLSLVE+CWQD CDQ+L IRGIA
Sbjct  127  CIHKMGGNLYQRIEKECEVHISAALQSLVGQSPDLIVFLSLVERCWQDLCDQMLMIRGIA  186

Query  699  LYLDRTYV  722
            L+LDRTYV
Sbjct  187  LFLDRTYV  194



>ref|XP_003593911.1| Cullin [Medicago truncatula]
Length=794

 Score =   218 bits (554),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 142/188 (76%), Gaps = 15/188 (8%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKK  338
            MKKAKS   + + D        V F   +D+D     ++  D P   A     ANL+RKK
Sbjct  22   MKKAKS---SSTFD-------DVVFDSSMDDD-----LKPTDLPRGGAASNMAANLARKK  66

Query  339  ATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDL  518
            AT PQPAKKL+I+L K  PT+P+NFE+ TWA LKSAI AIFLKQPD CDLEKLYQAVNDL
Sbjct  67   ATPPQPAKKLLIRLHKGNPTVPSNFEDKTWAILKSAICAIFLKQPDSCDLEKLYQAVNDL  126

Query  519  CLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIA  698
            C+HKMGG+LYQRIEKECE HI+ ALQSLVGQS DL+VFLSLVE+CWQD CDQ+L IRGIA
Sbjct  127  CIHKMGGNLYQRIEKECEVHISAALQSLVGQSPDLIVFLSLVERCWQDLCDQMLMIRGIA  186

Query  699  LYLDRTYV  722
            L+LDRTYV
Sbjct  187  LFLDRTYV  194



>ref|XP_003524860.1| PREDICTED: cullin-4-like [Glycine max]
Length=775

 Score =   216 bits (550),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 141/190 (74%), Gaps = 20/190 (11%)
 Frame = +3

Query  153  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  332
            PPMKKAKS      +D+  +          V + P++AS    D P A A  AA  NLSR
Sbjct  8    PPMKKAKS------IDSKNDDA--------VLKSPAAAS----DDPNAPALVAA--NLSR  47

Query  333  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  512
            KKAT P P KKL+IK  K  PTLP NFEE+TWA LKSAI AIFLKQP  CDLE LYQAVN
Sbjct  48   KKATPPHPPKKLLIKFHKGIPTLPPNFEEDTWAKLKSAIGAIFLKQPVSCDLENLYQAVN  107

Query  513  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRG  692
            DLCL+KMGG+LYQRIEKECE HI+ ALQSLVGQS DL+VFLSLVE+CWQD CDQ+L IRG
Sbjct  108  DLCLYKMGGNLYQRIEKECEAHISAALQSLVGQSPDLIVFLSLVERCWQDLCDQMLMIRG  167

Query  693  IALYLDRTYV  722
            IAL+LDRTYV
Sbjct  168  IALFLDRTYV  177



>ref|XP_008383554.1| PREDICTED: cullin-4-like, partial [Malus domestica]
Length=458

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +3

Query  396  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET  575
            TLPTNFEE TWA LKSAI+AIFLK+PD CDLEKLYQAVNDLCLHKMGGSLYQRIEKECE 
Sbjct  7    TLPTNFEEETWAKLKSAISAIFLKKPDSCDLEKLYQAVNDLCLHKMGGSLYQRIEKECER  66

Query  576  HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            HIA ALQSLVGQS DLVVFLSLVE+CWQD CDQ+L IRGIALYLDRTYV
Sbjct  67   HIAAALQSLVGQSPDLVVFLSLVERCWQDLCDQMLMIRGIALYLDRTYV  115



>ref|XP_006585082.1| PREDICTED: cullin-4-like isoform X2 [Glycine max]
Length=757

 Score =   211 bits (538),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 134/190 (71%), Gaps = 26/190 (14%)
 Frame = +3

Query  153  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  332
            PPMKKAKS                      +D   ++AS  D   P A A  AA  NLSR
Sbjct  8    PPMKKAKS----------------------IDSKNAAASASD--DPNAPALIAA--NLSR  41

Query  333  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  512
            KKAT P P KK +I+  K  PTLP NFEE TWA LKSAI AIF+KQP  CDLE LYQAVN
Sbjct  42   KKATPPHPPKKFLIRFHKGVPTLPPNFEEETWAKLKSAIGAIFMKQPVSCDLENLYQAVN  101

Query  513  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRG  692
            DLCL+KMGG+LYQRI KECE HI+VALQSLVGQS DL+VFLSLVE+CWQD CDQ+L IRG
Sbjct  102  DLCLYKMGGNLYQRITKECEEHISVALQSLVGQSPDLIVFLSLVERCWQDLCDQLLMIRG  161

Query  693  IALYLDRTYV  722
            IAL+LDRTYV
Sbjct  162  IALFLDRTYV  171



>ref|XP_003532695.2| PREDICTED: cullin-4-like isoform X1 [Glycine max]
Length=769

 Score =   212 bits (539),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 134/190 (71%), Gaps = 26/190 (14%)
 Frame = +3

Query  153  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  332
            PPMKKAKS                      +D   ++AS  D   P A A  AA  NLSR
Sbjct  8    PPMKKAKS----------------------IDSKNAAASASD--DPNAPALIAA--NLSR  41

Query  333  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  512
            KKAT P P KK +I+  K  PTLP NFEE TWA LKSAI AIF+KQP  CDLE LYQAVN
Sbjct  42   KKATPPHPPKKFLIRFHKGVPTLPPNFEEETWAKLKSAIGAIFMKQPVSCDLENLYQAVN  101

Query  513  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRG  692
            DLCL+KMGG+LYQRI KECE HI+VALQSLVGQS DL+VFLSLVE+CWQD CDQ+L IRG
Sbjct  102  DLCLYKMGGNLYQRITKECEEHISVALQSLVGQSPDLIVFLSLVERCWQDLCDQLLMIRG  161

Query  693  IALYLDRTYV  722
            IAL+LDRTYV
Sbjct  162  IALFLDRTYV  171



>ref|XP_004486019.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4-like [Cicer arietinum]
Length=787

 Score =   210 bits (534),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 145/217 (67%), Gaps = 28/217 (13%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE  251
            S P KRSS  +S S               MKK KS +           QHH     D   
Sbjct  2    SLPTKRSSGATSTS---------------MKKFKSHS---------QQQHH----DDAVL  33

Query  252  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  431
            DPSS SM   D   ++A     ANLSRKKAT PQP KKL+IK  KAKPTLPTNFEE TWA
Sbjct  34   DPSSLSMPLDDDLKSNARSVMAANLSRKKATPPQPLKKLLIKFHKAKPTLPTNFEEETWA  93

Query  432  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  611
             LKSAI AIFLKQP+ C+ E LYQAV+ LC +KMGG+LY+RIEKECE HI+ ALQSLVGQ
Sbjct  94   NLKSAICAIFLKQPNSCEKENLYQAVSSLCSYKMGGNLYERIEKECEVHISAALQSLVGQ  153

Query  612  SEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            S DLVVFL LVE+CWQD CDQ+L IR IALYLDRTYV
Sbjct  154  SPDLVVFLYLVERCWQDLCDQMLMIRDIALYLDRTYV  190



>gb|KHN12460.1| Cullin-4 [Glycine soja]
Length=760

 Score =   209 bits (532),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 124/157 (79%), Gaps = 2/157 (1%)
 Frame = +3

Query  252  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  431
            D  +A+    D P A A  AA  NLSRKKAT P P KK +I+  K  PTLP NFEE TWA
Sbjct  8    DSKNAAASASDDPNAPALIAA--NLSRKKATPPHPPKKFLIRFHKGVPTLPPNFEEETWA  65

Query  432  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  611
             LKSAI AIF+KQP  CDLE LYQAVNDLCL+KMGG+LYQRI KECE HI+VALQSLVGQ
Sbjct  66   KLKSAIGAIFMKQPVSCDLENLYQAVNDLCLYKMGGNLYQRITKECEEHISVALQSLVGQ  125

Query  612  SEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            S DL+VFLSLVE+CWQD CDQ+L IRGIAL+LDRTYV
Sbjct  126  SPDLIVFLSLVERCWQDLCDQLLMIRGIALFLDRTYV  162



>ref|XP_009101534.1| PREDICTED: cullin-4-like [Brassica rapa]
Length=783

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 145/220 (66%), Gaps = 39/220 (18%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQH---HVHFYPD  242
            S P KRS+    CSA + D +      PPMKK+K            NG H    V F  D
Sbjct  2    SLPTKRST----CSAASTDSSLS---SPPMKKSK------------NGLHASDKVGFSMD  42

Query  243  VDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEEN  422
             D  PSSA                 ANLSRKKATLP P KKLVIKL KAKP+LPTNFE+ 
Sbjct  43   EDPAPSSA-----------------ANLSRKKATLPHPTKKLVIKLNKAKPSLPTNFEDT  85

Query  423  TWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSL  602
            TW  L+SAI AIFLKQP P DLE+LYQAV+DLCLHK+ G LY+RIEKECE HI+ ALQSL
Sbjct  86   TWENLQSAIRAIFLKQPFPFDLERLYQAVDDLCLHKLEGKLYERIEKECEEHISSALQSL  145

Query  603  VGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            VGQ  DL VFLSLVEKCWQDFCDQ+L IR IAL LDR YV
Sbjct  146  VGQDTDLSVFLSLVEKCWQDFCDQMLMIRSIALSLDRKYV  185



>ref|XP_006836434.1| PREDICTED: cullin-4 [Amborella trichopoda]
 gb|ERM99287.1| hypothetical protein AMTR_s00092p00163840 [Amborella trichopoda]
Length=822

 Score =   207 bits (528),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 123/146 (84%), Gaps = 1/146 (1%)
 Frame = +3

Query  285  SPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFL  464
            S G S T  A ANLSRKKAT PQP KKLVI+  K KP LPTNFEE+TWA LKSAI+AI L
Sbjct  80   SAGCSGTGMA-ANLSRKKATPPQPTKKLVIRPFKDKPKLPTNFEEDTWAKLKSAISAILL  138

Query  465  KQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLV  644
            KQP  C LE+LYQAVNDLCLHKMGG+LY+RI+KECE HI+  +QSLVGQS DLVVFLSLV
Sbjct  139  KQPVSCSLEELYQAVNDLCLHKMGGNLYKRIQKECEEHISKTIQSLVGQSPDLVVFLSLV  198

Query  645  EKCWQDFCDQILTIRGIALYLDRTYV  722
            EKCWQD CDQ+L IRGIALYLDRTYV
Sbjct  199  EKCWQDLCDQLLMIRGIALYLDRTYV  224



>ref|XP_006398310.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
 gb|ESQ39763.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
Length=539

 Score =   204 bits (518),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 147/217 (68%), Gaps = 23/217 (11%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE  251
            S P KRS+  SS S  + D +     PPPMKKAK            NG H     P+   
Sbjct  2    SLPTKRSTC-SSASPASTDSS--YSSPPPMKKAK------------NGLHTPSSQPNA-A  45

Query  252  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  431
            D     MED  +P A       ANLSRKKATLPQP+KKLVIKL KAKP+LPTNFEE TW 
Sbjct  46   DKVGFPMEDDATPAA-------ANLSRKKATLPQPSKKLVIKLNKAKPSLPTNFEEITWE  98

Query  432  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  611
             L+SAI AIFLK+P   DLE+LYQAV++LCLHK+ G LY+RIEKECE HI+ ALQSLVGQ
Sbjct  99   KLQSAIRAIFLKKPVSFDLERLYQAVDNLCLHKLEGKLYERIEKECEEHISAALQSLVGQ  158

Query  612  SEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
              DL VFLSLVE CWQDFCDQ+L IR IAL LDR YV
Sbjct  159  DTDLSVFLSLVENCWQDFCDQMLMIRSIALSLDRKYV  195



>ref|XP_006398309.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
 gb|ESQ39762.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
Length=578

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 147/217 (68%), Gaps = 23/217 (11%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE  251
            S P KRS+  SS S  + D +     PPPMKKAK            NG H     P+   
Sbjct  2    SLPTKRSTC-SSASPASTDSS--YSSPPPMKKAK------------NGLHTPSSQPNA-A  45

Query  252  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  431
            D     MED  +P A       ANLSRKKATLPQP+KKLVIKL KAKP+LPTNFEE TW 
Sbjct  46   DKVGFPMEDDATPAA-------ANLSRKKATLPQPSKKLVIKLNKAKPSLPTNFEEITWE  98

Query  432  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  611
             L+SAI AIFLK+P   DLE+LYQAV++LCLHK+ G LY+RIEKECE HI+ ALQSLVGQ
Sbjct  99   KLQSAIRAIFLKKPVSFDLERLYQAVDNLCLHKLEGKLYERIEKECEEHISAALQSLVGQ  158

Query  612  SEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
              DL VFLSLVE CWQDFCDQ+L IR IAL LDR YV
Sbjct  159  DTDLSVFLSLVENCWQDFCDQMLMIRSIALSLDRKYV  195



>gb|KHN46079.1| Cullin-4 [Glycine soja]
Length=764

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 122/151 (81%), Gaps = 3/151 (2%)
 Frame = +3

Query  279  LDSPGASA---TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAI  449
            L SP A++      A   LSRKKAT P P KKL+IK  K  PTLP NFEE+TWA LKSAI
Sbjct  16   LKSPAAASDDPNAPALVILSRKKATPPHPPKKLLIKFHKGIPTLPPNFEEDTWAKLKSAI  75

Query  450  NAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVV  629
             AIFLKQP  CDLE LYQAVNDLCL+KMGG+LYQRIEKECE HI+ ALQSLVGQS DL+V
Sbjct  76   GAIFLKQPVSCDLENLYQAVNDLCLYKMGGNLYQRIEKECEAHISAALQSLVGQSPDLIV  135

Query  630  FLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            FLSLVE+CWQD CDQ+L IRGIAL+LDRTYV
Sbjct  136  FLSLVERCWQDLCDQMLMIRGIALFLDRTYV  166



>gb|KHN29857.1| Cullin-4 [Glycine soja]
Length=276

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +3

Query  396  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET  575
            TLPTNFEE+TWA LKSAI AIFLKQP+ CDLEKLYQAVNDLCL+KMG +L+Q+IEKECE 
Sbjct  7    TLPTNFEEDTWAKLKSAICAIFLKQPNSCDLEKLYQAVNDLCLYKMGVNLHQQIEKECEA  66

Query  576  HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            HI+ ALQSLVGQS DLVVFLSLVE+CWQD CDQ+L IRGIALYLDRTYV
Sbjct  67   HISAALQSLVGQSPDLVVFLSLVERCWQDLCDQMLMIRGIALYLDRTYV  115



>ref|XP_006398308.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
 gb|ESQ39761.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
Length=793

 Score =   204 bits (518),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 147/217 (68%), Gaps = 23/217 (11%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE  251
            S P KRS+  SS S  + D +     PPPMKKAK            NG H     P+   
Sbjct  2    SLPTKRSTC-SSASPASTDSS--YSSPPPMKKAK------------NGLHTPSSQPNA-A  45

Query  252  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  431
            D     MED  +P A       ANLSRKKATLPQP+KKLVIKL KAKP+LPTNFEE TW 
Sbjct  46   DKVGFPMEDDATPAA-------ANLSRKKATLPQPSKKLVIKLNKAKPSLPTNFEEITWE  98

Query  432  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  611
             L+SAI AIFLK+P   DLE+LYQAV++LCLHK+ G LY+RIEKECE HI+ ALQSLVGQ
Sbjct  99   KLQSAIRAIFLKKPVSFDLERLYQAVDNLCLHKLEGKLYERIEKECEEHISAALQSLVGQ  158

Query  612  SEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
              DL VFLSLVE CWQDFCDQ+L IR IAL LDR YV
Sbjct  159  DTDLSVFLSLVENCWQDFCDQMLMIRSIALSLDRKYV  195



>emb|CDX77644.1| BnaC07g18980D [Brassica napus]
Length=767

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 131/172 (76%), Gaps = 7/172 (4%)
 Frame = +3

Query  207  KNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvk  386
            KNG H     P+   D +  SME+  +P A+A      NLSRKKATLPQP KKLVIKL K
Sbjct  5    KNGLHAPSSQPNAS-DKAVFSMEEDPAPSAAA------NLSRKKATLPQPTKKLVIKLNK  57

Query  387  akpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKE  566
            AKP+LPTNFE+ TW  L+SAI AIFLKQP P DLE+LYQAV DLCLHK+ G LY+RIEKE
Sbjct  58   AKPSLPTNFEDTTWENLQSAIRAIFLKQPFPFDLERLYQAVGDLCLHKLEGKLYERIEKE  117

Query  567  CETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            CE HI+ AL+SLVGQ  DL VFLSLVEKCWQDFCDQ+L IR IAL LDR YV
Sbjct  118  CEEHISAALESLVGQDTDLSVFLSLVEKCWQDFCDQMLMIRSIALSLDRKYV  169



>ref|XP_006414121.1| hypothetical protein EUTSA_v10024458mg [Eutrema salsugineum]
 gb|ESQ55574.1| hypothetical protein EUTSA_v10024458mg [Eutrema salsugineum]
Length=789

 Score =   201 bits (511),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 134/190 (71%), Gaps = 19/190 (10%)
 Frame = +3

Query  153  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  332
            PPMKKAK            NG H      + D D  + SMED  +P A       ANLSR
Sbjct  21   PPMKKAK------------NGLHQTPQSQEDDNDKEAFSMEDDPTPAA-------ANLSR  61

Query  333  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  512
            KKATLPQP KKLVIKL KAKPTLPTNFEENTWA L+SAI AIFL +P   D E LYQAV+
Sbjct  62   KKATLPQPTKKLVIKLNKAKPTLPTNFEENTWAKLQSAIQAIFLMKPVTFDFEGLYQAVD  121

Query  513  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRG  692
            +LCLHK+   LYQ+IEKECE HI+ ALQSLVGQ+ DL VFLSLVEK WQDFCDQ+L IR 
Sbjct  122  NLCLHKLEEKLYQQIEKECEEHISAALQSLVGQNTDLSVFLSLVEKRWQDFCDQMLMIRS  181

Query  693  IALYLDRTYV  722
            IAL LDR YV
Sbjct  182  IALSLDRKYV  191



>emb|CDY35152.1| BnaA09g17890D [Brassica napus]
Length=786

 Score =   201 bits (511),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 134/191 (70%), Gaps = 29/191 (15%)
 Frame = +3

Query  150  PPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  329
            PPPMKK+K            NG H    +P  DEDP               T +A ANLS
Sbjct  27   PPPMKKSK------------NGLHSP--FPMEDEDP---------------TPSAAANLS  57

Query  330  RKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAV  509
            RKKATLP P KKLVIKL KAKPTLPTNFE+ TWA L+SAI AIFLK+P   DLE+LYQAV
Sbjct  58   RKKATLPHPTKKLVIKLNKAKPTLPTNFEDTTWANLQSAIRAIFLKKPFSFDLERLYQAV  117

Query  510  NDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIR  689
            +DLCLHK+ G LY+R++KECE HI+ AL SLVGQ  DL VFLSLVEKCWQDFCDQ+L IR
Sbjct  118  DDLCLHKLEGKLYERMQKECEEHISAALHSLVGQDTDLSVFLSLVEKCWQDFCDQMLMIR  177

Query  690  GIALYLDRTYV  722
             IAL LDR YV
Sbjct  178  SIALSLDRKYV  188



>emb|CDY43957.1| BnaA02g24350D [Brassica napus]
Length=776

 Score =   201 bits (511),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 136/190 (72%), Gaps = 22/190 (12%)
 Frame = +3

Query  153  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  332
            PPMKKAK            NG H     P  D+       ED D P  SA     ANLSR
Sbjct  11   PPMKKAK------------NGLHT----PSADKVGFPMEEEDED-PTPSA-----ANLSR  48

Query  333  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  512
            KKATLPQP+KKLVIKL KAKP+LPTNFE+ TW  L+SAI AIFLK P P DLE+LYQAV+
Sbjct  49   KKATLPQPSKKLVIKLNKAKPSLPTNFEDTTWDNLQSAIRAIFLKHPFPFDLERLYQAVD  108

Query  513  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRG  692
            +LCLHK+ G LY+RIEKECE HI+VALQSLVGQ  DL VFLSLVEKCWQDFCDQ+L IR 
Sbjct  109  NLCLHKLEGKLYKRIEKECEEHISVALQSLVGQDTDLSVFLSLVEKCWQDFCDQMLMIRS  168

Query  693  IALYLDRTYV  722
            IAL LDR YV
Sbjct  169  IALSLDRKYV  178



>ref|XP_002863417.1| hypothetical protein ARALYDRAFT_916814 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39676.1| hypothetical protein ARALYDRAFT_916814 [Arabidopsis lyrata subsp. 
lyrata]
Length=791

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 134/190 (71%), Gaps = 20/190 (11%)
 Frame = +3

Query  153  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  332
            PPMKKAK            N  HH   +P+   D     ME+  +P A       ANLSR
Sbjct  24   PPMKKAK------------NDLHHSPQHPNT-ADKVGFHMEEDPTPAA-------ANLSR  63

Query  333  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  512
            KKATLPQP KKLVIKL KAKPTLPTNFEE TW  L+SAI AIFLK+P   DLE LYQAV+
Sbjct  64   KKATLPQPTKKLVIKLNKAKPTLPTNFEETTWEKLQSAIRAIFLKKPFSFDLESLYQAVD  123

Query  513  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRG  692
            +LCLHK+ G LY +IEKECE HI+ ALQSLVGQ+ DL VFLSLVEKCWQDFCDQ+L IR 
Sbjct  124  NLCLHKLEGKLYDQIEKECEEHISAALQSLVGQNTDLTVFLSLVEKCWQDFCDQMLMIRS  183

Query  693  IALYLDRTYV  722
            IAL LDR YV
Sbjct  184  IALTLDRKYV  193



>ref|XP_004981509.1| PREDICTED: cullin-4-like isoform X1 [Setaria italica]
Length=839

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 148/239 (62%), Gaps = 23/239 (10%)
 Frame = +3

Query  57   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAK---SQAVACSLDTNKNGQH--  221
            MSQP +   +   P+SS +A+    +P    PP MKKAK   + A + +  T KNG H  
Sbjct  1    MSQPHAASKR---PFSSTTASPSLTSPA---PPLMKKAKHPAAAASSSAGTTEKNGIHLD  54

Query  222  ----------HVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklv  371
                            + D +   A  EDL +P A A+    ANL RKKATLPQP+    
Sbjct  55   AAVAAAGGGGSGRTNGEEDTEMVLADQEDLPAPSAQASAGVAANLFRKKATLPQPSTSAR  114

Query  372  i--klvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSL  545
               ++   +P LP NFEE+TWA LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +L
Sbjct  115  KPLRIKIGQPKLPKNFEEDTWAILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANL  174

Query  546  YQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            Y+RI+KECE HIA  + +LVGQS DLVVFLSLV++ WQDFCDQ+L IRGIAL LD  YV
Sbjct  175  YERIKKECEIHIAEKISALVGQSPDLVVFLSLVQRTWQDFCDQMLIIRGIALLLDVKYV  233



>ref|XP_004981510.1| PREDICTED: cullin-4-like isoform X2 [Setaria italica]
Length=831

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 148/239 (62%), Gaps = 23/239 (10%)
 Frame = +3

Query  57   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAK---SQAVACSLDTNKNGQH--  221
            MSQP +   +   P+SS +A+    +P    PP MKKAK   + A + +  T KNG H  
Sbjct  1    MSQPHAASKR---PFSSTTASPSLTSPA---PPLMKKAKHPAAAASSSAGTTEKNGIHLD  54

Query  222  ----------HVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklv  371
                            + D +   A  EDL +P A A+    ANL RKKATLPQP+    
Sbjct  55   AAVAAAGGGGSGRTNGEEDTEMVLADQEDLPAPSAQASAGVAANLFRKKATLPQPSTSAR  114

Query  372  i--klvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSL  545
               ++   +P LP NFEE+TWA LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +L
Sbjct  115  KPLRIKIGQPKLPKNFEEDTWAILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANL  174

Query  546  YQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            Y+RI+KECE HIA  + +LVGQS DLVVFLSLV++ WQDFCDQ+L IRGIAL LD  YV
Sbjct  175  YERIKKECEIHIAEKISALVGQSPDLVVFLSLVQRTWQDFCDQMLIIRGIALLLDVKYV  233



>emb|CDY33461.1| BnaA06g36120D [Brassica napus]
Length=761

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 131/178 (74%), Gaps = 17/178 (10%)
 Frame = +3

Query  195  LDTNKNGQHHVHFYPD--VDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakkl  368
            +  +KNG H     P+  +DEDP+ +               A ANLSRKKATLP P KKL
Sbjct  1    MKKSKNGLHAPSSQPNASMDEDPAPS---------------AAANLSRKKATLPHPTKKL  45

Query  369  viklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLY  548
            VIKL KAKP+LPTNFE+ TW  L+SAI AIFLKQP P DLE+LYQAV+DLCLHK+ G LY
Sbjct  46   VIKLNKAKPSLPTNFEDTTWENLQSAIRAIFLKQPFPFDLERLYQAVDDLCLHKLEGKLY  105

Query  549  QRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            +RIEKECE HI+ ALQSLVGQ  DL VFLSLVEKCWQDFCDQ+L IR IAL LDR YV
Sbjct  106  ERIEKECEEHISSALQSLVGQDTDLSVFLSLVEKCWQDFCDQMLMIRSIALSLDRKYV  163



>ref|NP_568658.1| cullin4 [Arabidopsis thaliana]
 sp|Q8LGH4.1|CUL4_ARATH RecName: Full=Cullin-4; Short=AtCUL4 [Arabidopsis thaliana]
 gb|AAM60859.1| cullin [Arabidopsis thaliana]
 gb|AED95353.1| cullin4 [Arabidopsis thaliana]
Length=792

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 132/190 (69%), Gaps = 19/190 (10%)
 Frame = +3

Query  153  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  332
            PPMKKAK            N  HH   +P+  +      ME+  +P A       ANLSR
Sbjct  24   PPMKKAK------------NDLHHSPQHPNTADKVVGFHMEEDPTPAA-------ANLSR  64

Query  333  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  512
            KKATLPQP KK VIKL KAKPTLPTNFEENTW  L+SAI AIFLK+    DLE LYQAV+
Sbjct  65   KKATLPQPTKKFVIKLNKAKPTLPTNFEENTWEKLQSAIRAIFLKKKISFDLESLYQAVD  124

Query  513  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRG  692
            +LCLHK+ G LY +IEKECE HI+ ALQSLVGQ+ DL VFLS VEKCWQDFCDQ+L IR 
Sbjct  125  NLCLHKLDGKLYDQIEKECEEHISAALQSLVGQNTDLTVFLSRVEKCWQDFCDQMLMIRS  184

Query  693  IALYLDRTYV  722
            IAL LDR YV
Sbjct  185  IALTLDRKYV  194



>ref|XP_010495750.1| PREDICTED: cullin-4-like [Camelina sativa]
Length=743

 Score =   198 bits (503),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 132/190 (69%), Gaps = 20/190 (11%)
 Frame = +3

Query  153  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  332
            PPMKKAK            N  HH   +P+   D     ME+  +P A       ANLSR
Sbjct  24   PPMKKAK------------NDLHHSPQHPNA-ADKVGFPMEEDPTPAA-------ANLSR  63

Query  333  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  512
            KKATLPQP KKLVIKL KAKPTLP NFEE TW  L+SAI AIFLK+P     E LYQAV+
Sbjct  64   KKATLPQPTKKLVIKLNKAKPTLPKNFEETTWEQLQSAIRAIFLKKPFSFHFESLYQAVD  123

Query  513  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRG  692
            DLC+HK+ G LYQ+IEKECE HI+ ALQSLVGQ+ DL VFLSLVEKCWQDFCDQ+L IR 
Sbjct  124  DLCMHKLAGKLYQQIEKECEEHISAALQSLVGQNTDLTVFLSLVEKCWQDFCDQMLMIRS  183

Query  693  IALYLDRTYV  722
            IAL LDR YV
Sbjct  184  IALTLDRKYV  193



>ref|XP_009114369.1| PREDICTED: cullin-4-like [Brassica rapa]
Length=786

 Score =   198 bits (503),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 133/191 (70%), Gaps = 29/191 (15%)
 Frame = +3

Query  150  PPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  329
            PPPMKK+K            NG H    +P  DEDP               T +A ANLS
Sbjct  27   PPPMKKSK------------NGLHSP--FPMEDEDP---------------TPSAAANLS  57

Query  330  RKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAV  509
            RKKATLP P KKLVIKL KAKPTLPTNFE+ TWA L+SAI AIFLK+P   DLE+LYQAV
Sbjct  58   RKKATLPHPTKKLVIKLNKAKPTLPTNFEDTTWANLQSAIRAIFLKKPFSFDLERLYQAV  117

Query  510  NDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIR  689
            + LCLHK+ G LY+R++KECE HI+ AL SLVGQ  DL VFLSLVEKCWQDFCDQ+L IR
Sbjct  118  DALCLHKLEGKLYERMQKECEEHISAALHSLVGQDTDLSVFLSLVEKCWQDFCDQMLMIR  177

Query  690  GIALYLDRTYV  722
             IAL LDR YV
Sbjct  178  SIALSLDRKYV  188



>ref|XP_010484784.1| PREDICTED: cullin-4-like [Camelina sativa]
Length=784

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 132/190 (69%), Gaps = 20/190 (11%)
 Frame = +3

Query  153  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  332
            PPMKKAK            N  HH   +P+   D     ME+  +P A       ANLSR
Sbjct  24   PPMKKAK------------NDLHHSPQHPNA-ADKVGFPMEEDPTPAA-------ANLSR  63

Query  333  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  512
            KKATLPQP KKLVIKL KAKPTLP NFEE TW  L+SAI AIFLK+P     E LYQAV+
Sbjct  64   KKATLPQPTKKLVIKLNKAKPTLPKNFEETTWEQLQSAIRAIFLKKPFSFHFESLYQAVD  123

Query  513  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRG  692
            DLC+HK+ G LYQ+IEKECE HI+ ALQSLVGQ+ DL VFLSLVEKCWQDFCDQ+L IR 
Sbjct  124  DLCMHKLAGKLYQQIEKECEEHISAALQSLVGQNTDLTVFLSLVEKCWQDFCDQMLMIRS  183

Query  693  IALYLDRTYV  722
            IAL LDR YV
Sbjct  184  IALTLDRKYV  193



>gb|AAM14063.1| putative cullin [Arabidopsis thaliana]
Length=792

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 131/190 (69%), Gaps = 19/190 (10%)
 Frame = +3

Query  153  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  332
            PPMKK K            N  HH   +P+  +      ME+  +P A       ANLSR
Sbjct  24   PPMKKTK------------NDLHHSPQHPNTADKVVGFHMEEDPTPAA-------ANLSR  64

Query  333  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  512
            KKATLPQP KK VIKL KAKPTLPTNFEENTW  L+SAI AIFLK+    DLE LYQAV+
Sbjct  65   KKATLPQPTKKFVIKLNKAKPTLPTNFEENTWEKLQSAIRAIFLKKKISFDLESLYQAVD  124

Query  513  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRG  692
            +LCLHK+ G LY +IEKECE HI+ ALQSLVGQ+ DL VFLS VEKCWQDFCDQ+L IR 
Sbjct  125  NLCLHKLDGKLYDQIEKECEEHISAALQSLVGQNTDLTVFLSRVEKCWQDFCDQMLMIRS  184

Query  693  IALYLDRTYV  722
            IAL LDR YV
Sbjct  185  IALTLDRKYV  194



>emb|CDX87735.1| BnaC02g32140D [Brassica napus]
Length=780

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 131/172 (76%), Gaps = 11/172 (6%)
 Frame = +3

Query  207  KNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvk  386
            KNG H     P  D+      ME+ + P  SA     ANLSRKKATLPQP+KKLVIKL K
Sbjct  22   KNGLHT----PSADK--VGFPMEEEEDPTPSA-----ANLSRKKATLPQPSKKLVIKLNK  70

Query  387  akpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKE  566
            AKP+LPTNFE+ TW  L+SAI AIFLK P P DLE+LYQAV++LCLH++ G LY+RIEKE
Sbjct  71   AKPSLPTNFEDTTWDNLQSAIRAIFLKHPFPFDLERLYQAVDNLCLHRLEGKLYKRIEKE  130

Query  567  CETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            CE HI+VALQSLVGQ  DL VFLSLVEKCWQDFCDQ+L IR IAL LDR YV
Sbjct  131  CEEHISVALQSLVGQDTDLSVFLSLVEKCWQDFCDQMLMIRSIALSLDRKYV  182



>gb|KFK31486.1| cullin [Arabis alpina]
Length=793

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 138/192 (72%), Gaps = 24/192 (13%)
 Frame = +3

Query  153  PPMKKAKSQAVACSLDTNKNGQHHVHF--YPDVDEDPSSASMEDLDSPGASATRAATANL  326
            PPMKK+K+      L T  + QH  +   +P ++EDP+ A+                ANL
Sbjct  26   PPMKKSKN-----GLHTPPSSQHQSNAAGFP-MEEDPTPAA----------------ANL  63

Query  327  SRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQA  506
            SRKKATLP P KKLVIKL KAKPTLPTNFEE TW  L+SAI AIFLK+P   DLE+LYQA
Sbjct  64   SRKKATLPHPTKKLVIKLNKAKPTLPTNFEETTWENLQSAIIAIFLKKPFSFDLERLYQA  123

Query  507  VNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTI  686
            V++LCLHK+ G LY+RIEKECE HI+ ALQSLVGQ  DL VFLSLVEKCWQDFCDQ+L I
Sbjct  124  VDNLCLHKLEGKLYERIEKECEEHISAALQSLVGQDTDLSVFLSLVEKCWQDFCDQMLMI  183

Query  687  RGIALYLDRTYV  722
            R IAL LDR YV
Sbjct  184  RSIALSLDRKYV  195



>emb|CDY03235.1| BnaC09g19210D [Brassica napus]
Length=790

 Score =   196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 134/194 (69%), Gaps = 32/194 (16%)
 Frame = +3

Query  153  PPMKKAKSQAVACSLDTNKNGQH----HVHFYPDVDEDPSSASMEDLDSPGASATRAATA  320
            PPMKK+K            NG H     V F P  DEDP               T +A A
Sbjct  27   PPMKKSK------------NGLHTPSDKVPF-PMEDEDP---------------TPSAAA  58

Query  321  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  500
            NLSRKKATLPQP KKLVIKL KAKPTLPTNFE+ TW  L+SAI AIFLK+P   DLE+LY
Sbjct  59   NLSRKKATLPQPTKKLVIKLNKAKPTLPTNFEDTTWDNLQSAIRAIFLKKPFSFDLERLY  118

Query  501  QAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQIL  680
            QAV+DLCLHK+ G LY+R++KECE HI+ AL SLVGQ  DL VFLSLVEKCWQDFCDQ+L
Sbjct  119  QAVDDLCLHKLEGKLYERMQKECEEHISAALHSLVGQDTDLSVFLSLVEKCWQDFCDQML  178

Query  681  TIRGIALYLDRTYV  722
             IR IAL LDR YV
Sbjct  179  MIRSIALSLDRKYV  192



>ref|XP_010441611.1| PREDICTED: cullin-4 [Camelina sativa]
Length=791

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 132/190 (69%), Gaps = 20/190 (11%)
 Frame = +3

Query  153  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  332
            PPMKKAK            N  HH   +P+   D     ME+  +P A       ANLSR
Sbjct  24   PPMKKAK------------NDLHHSPQHPNA-ADKVGFPMEEDPTPAA-------ANLSR  63

Query  333  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  512
            KKATLPQP KKLVIKL KAKP+LP NFEE TW  L+SAI AIFLK+P     E LYQAV+
Sbjct  64   KKATLPQPTKKLVIKLNKAKPSLPKNFEETTWQQLQSAIRAIFLKKPFSFHFESLYQAVD  123

Query  513  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRG  692
            DLC+HK+ G LYQ+IEKECE HI+ ALQSLVGQ+ DL VFLSLVEKCWQDFCDQ+L IR 
Sbjct  124  DLCMHKLAGKLYQQIEKECEEHISAALQSLVGQNTDLTVFLSLVEKCWQDFCDQMLMIRS  183

Query  693  IALYLDRTYV  722
            IAL LDR YV
Sbjct  184  IALTLDRKYV  193



>ref|XP_006281916.1| hypothetical protein CARUB_v10028121mg [Capsella rubella]
 gb|EOA14814.1| hypothetical protein CARUB_v10028121mg [Capsella rubella]
Length=791

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 131/190 (69%), Gaps = 20/190 (11%)
 Frame = +3

Query  153  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  332
            PPMKKAK            N  HH   +P+   D     ME+  +P A       ANLSR
Sbjct  24   PPMKKAK------------NDLHHSPQHPNA-ADKVGFPMEEDPTPAA-------ANLSR  63

Query  333  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  512
            KKATLPQP KKLVIKL K KPTLP NFEE TW  L+SAI AIFLK+P    LE LYQAV+
Sbjct  64   KKATLPQPTKKLVIKLNKVKPTLPKNFEETTWENLQSAIRAIFLKKPFSFHLESLYQAVD  123

Query  513  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRG  692
            + CLHK+ G LYQ+IEKECE HI+ ALQSLVGQ+ D+ VFLSLVEKCWQDFCDQ+L IR 
Sbjct  124  NFCLHKLDGKLYQQIEKECEEHISAALQSLVGQNTDMTVFLSLVEKCWQDFCDQMLKIRS  183

Query  693  IALYLDRTYV  722
            IAL LDR YV
Sbjct  184  IALTLDRKYV  193



>ref|XP_010529158.1| PREDICTED: cullin-4 [Tarenaya hassleriana]
Length=788

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 134/191 (70%), Gaps = 21/191 (11%)
 Frame = +3

Query  150  PPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  329
            PPPMKKAK            NG HH    P   +D     M++       + RA  +NLS
Sbjct  23   PPPMKKAK------------NGLHHP---PQPHDDKEVFPMDE------DSARAPASNLS  61

Query  330  RKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAV  509
            RKKAT PQPAKKLVIKL KAKPTLPTNFEE TW  L+SAI AIF+K+P   DLE LYQAV
Sbjct  62   RKKATPPQPAKKLVIKLNKAKPTLPTNFEETTWEKLQSAIRAIFMKKPVSFDLEGLYQAV  121

Query  510  NDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIR  689
            ++LCLHKM G LYQ+IEKECE HI+ ALQSLVG+S D  VFLSLVEKCWQ+F DQ+L IR
Sbjct  122  DNLCLHKMEGKLYQQIEKECEEHISAALQSLVGKSTDFSVFLSLVEKCWQNFSDQMLMIR  181

Query  690  GIALYLDRTYV  722
             IAL LDR YV
Sbjct  182  SIALSLDRKYV  192



>ref|XP_009128848.1| PREDICTED: cullin-4 [Brassica rapa]
Length=785

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 128/172 (74%), Gaps = 10/172 (6%)
 Frame = +3

Query  207  KNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvk  386
            KNG H     P  D+       ED D P  SA     ANLSRKKATLPQP+KKLVIKL K
Sbjct  26   KNGLHP----PSADKVGFPMEEEDED-PTPSA-----ANLSRKKATLPQPSKKLVIKLNK  75

Query  387  akpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKE  566
            AKP+LPTNFE+ TW  L+SAI AIFLKQP   DLE+LYQAV++LCLHK+ G LYQRI+KE
Sbjct  76   AKPSLPTNFEDTTWDNLQSAIRAIFLKQPFSFDLERLYQAVDNLCLHKLEGKLYQRIQKE  135

Query  567  CETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            CE HI+ ALQSLVGQ  DL VFLSLVE CWQDFCDQ+L IR IAL LDR YV
Sbjct  136  CEEHISAALQSLVGQDTDLSVFLSLVENCWQDFCDQMLMIRSIALSLDRKYV  187



>ref|XP_011460204.1| PREDICTED: cullin-4 [Fragaria vesca subsp. vesca]
Length=797

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 124/190 (65%), Gaps = 21/190 (11%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQ-HHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRK  335
            MKKAKSQ+   S    KNG  HH H   D D+D                 RA   NLSRK
Sbjct  29   MKKAKSQSQPDS----KNGLFHHHHNSSDNDDD---------------GRRAQPDNLSRK  69

Query  336  KATLPQpakklviklvkakp-TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  512
            KA  PQP KK  +         +P N EE TW  LKSAI AIF K+P  C LE+LYQAV 
Sbjct  70   KAQPPQPGKKQFVIKPFKAKPAVPKNLEEETWEILKSAICAIFEKKPVSCVLEELYQAVY  129

Query  513  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRG  692
            +LC+HKMGGSLYQRIEKECE HIA ALQSLVGQS DLVVFLSLVE+CWQD C QIL IR 
Sbjct  130  NLCVHKMGGSLYQRIEKECERHIAAALQSLVGQSPDLVVFLSLVERCWQDLCAQILMIRD  189

Query  693  IALYLDRTYV  722
            IALYLDRTYV
Sbjct  190  IALYLDRTYV  199



>emb|CAC85265.1| cullin 4 [Arabidopsis thaliana]
Length=742

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +3

Query  312  ATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLE  491
            A ANLSRKKATLPQP KK VIKL KAKPTLPTNFEENTW  L+SAI AIFLK+    DLE
Sbjct  8    AAANLSRKKATLPQPTKKFVIKLNKAKPTLPTNFEENTWEKLQSAIRAIFLKKKISFDLE  67

Query  492  KLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCD  671
             LYQAV++LCLHK+ G LY +IEKECE HI+ ALQSLVGQ+ DL VFLS VEKCWQDFCD
Sbjct  68   SLYQAVDNLCLHKLDGKLYDQIEKECEEHISAALQSLVGQNTDLTVFLSRVEKCWQDFCD  127

Query  672  QILTIRGIALYLDRTYV  722
            Q+L IR IAL LDR YV
Sbjct  128  QMLMIRSIALTLDRKYV  144



>gb|KFK28509.1| cullin 4 [Arabis alpina]
Length=782

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 125/164 (76%), Gaps = 9/164 (5%)
 Frame = +3

Query  237  PDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakp--TLPTN  410
            P   +D +  SME+   P A       ANLSRKKATLPQP KKLVIKL K K   +LPTN
Sbjct  28   PHSHDDDNDYSMEEDHIPAA-------ANLSRKKATLPQPTKKLVIKLNKVKGKPSLPTN  80

Query  411  FEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVA  590
            FEE+TWA L+++INAIFL +P P DLE+LYQAV++ CLHK+   LYQRIEKECE HI+ A
Sbjct  81   FEESTWANLQASINAIFLMKPVPYDLERLYQAVDNFCLHKLEEKLYQRIEKECEEHISAA  140

Query  591  LQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            LQ+LVGQ+ DL VFLSLVEKCWQDFCDQ+L IR IAL LDR YV
Sbjct  141  LQALVGQNTDLSVFLSLVEKCWQDFCDQMLMIRSIALTLDRKYV  184



>ref|XP_006650698.1| PREDICTED: cullin-4-like [Oryza brachyantha]
Length=829

 Score =   190 bits (482),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 122/238 (51%), Positives = 146/238 (61%), Gaps = 23/238 (10%)
 Frame = +3

Query  57   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAK---SQAVACSLDTNKNGQHHV  227
            MS P +   KR  P+SS SA++     P H    MKKAK   S + +    T KNG   +
Sbjct  1    MSHPHATAPKRPGPFSSSSASSPTSPAPPH----MKKAKFPGSSSSSAPGATEKNG---L  53

Query  228  HFYPDV------------DEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklv  371
            H  P V            D +   A  E+L +P AS      ANL RKKATLPQP+    
Sbjct  54   HVDPAVVARSGGRTNGEEDAEMVLADQEELPAPSASPPAGVAANLFRKKATLPQPSAARK  113

Query  372  iklvkakp-TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLY  548
               +K     LPTNFEE+TWA LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY
Sbjct  114  PLRIKIGQPKLPTNFEEDTWAILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLY  173

Query  549  QRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            +RI+KECE HI+  + +LVGQS DLVVFLSLV++ WQDFCDQ+L IRGIAL LD  YV
Sbjct  174  ERIKKECEVHISAKISALVGQSPDLVVFLSLVQRTWQDFCDQMLIIRGIALLLDVKYV  231



>gb|EMT18857.1| Cullin-4B [Aegilops tauschii]
Length=758

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 116/157 (74%), Gaps = 4/157 (3%)
 Frame = +3

Query  264  ASMEDLDSPGASATRAATANLSRKKATLPQ----pakklviklvkakpTLPTNFEENTWA  431
            A  ++L +P ASA    TANL RKKATLPQ     A +  +++   +P LP NFEE+TWA
Sbjct  4    ADQDELRAPNASAPGGGTANLFRKKATLPQPPATAATRKPLRIKIGQPKLPKNFEEDTWA  63

Query  432  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  611
             LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+R++KECE HI+  + +LVGQ
Sbjct  64   ILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERVKKECEIHISAKISALVGQ  123

Query  612  SEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            S DLVVFLSLV++ WQDFCDQ+L IRGIAL LD  YV
Sbjct  124  SPDLVVFLSLVQRTWQDFCDQMLIIRGIALLLDVKYV  160



>dbj|BAK02870.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=832

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 116/157 (74%), Gaps = 4/157 (3%)
 Frame = +3

Query  264  ASMEDLDSPGASATRAATANLSRKKATLPQ----pakklviklvkakpTLPTNFEENTWA  431
            A  ++L +P ASA    TANL RKKATLPQ     A +  +++   +P LP NFEE+TWA
Sbjct  78   ADQDELRAPNASAPGGGTANLFRKKATLPQPPATAATRKPLRIKIGQPKLPKNFEEDTWA  137

Query  432  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  611
             LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+R++KECE HI+  + +LVGQ
Sbjct  138  ILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERVKKECEIHISAKISALVGQ  197

Query  612  SEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            S DLVVFLSLV++ WQDFCDQ+L IRGIAL LD  YV
Sbjct  198  SPDLVVFLSLVQRTWQDFCDQMLIIRGIALLLDVKYV  234



>ref|XP_003558082.1| PREDICTED: cullin-4 [Brachypodium distachyon]
Length=830

 Score =   187 bits (475),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 110/157 (70%), Gaps = 4/157 (3%)
 Frame = +3

Query  264  ASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpT----LPTNFEENTWA  431
            A  ++L +P AS     TANL RKKATLPQP+     +           LP NFEE+TWA
Sbjct  76   ADQDELRAPSASVPGGVTANLFRKKATLPQPSATSATRKPLRIKIGQPKLPKNFEEDTWA  135

Query  432  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  611
             LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+R++KECE HIA  + +LVGQ
Sbjct  136  ILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERVKKECEIHIAAKISALVGQ  195

Query  612  SEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            S DLVVFLSLV + WQDFCDQ+L IRGIAL LD  YV
Sbjct  196  SPDLVVFLSLVHRTWQDFCDQMLIIRGIALLLDVKYV  232



>tpg|DAA51790.1| TPA: hypothetical protein ZEAMMB73_453479, partial [Zea mays]
Length=635

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 129/202 (64%), Gaps = 14/202 (7%)
 Frame = +3

Query  159  MKKAKS-QAVACSLDT-NKNGQH----------HVHFYPDVDEDPSSASMEDLDSPGASA  302
            MKKAK   A A S+ T  KNG H                + D +      ++L +P A A
Sbjct  33   MKKAKHPAATASSVGTVEKNGIHLDTAAAAATGGGRTNGEEDAEMVLVDQDELPAPSAPA  92

Query  303  TRAATANLSRKKATLPQpakklvi--klvkakpTLPTNFEENTWATLKSAINAIFLKQPD  476
            +    ANL RKKATLPQP+       ++   +P LP NFEE+TW  LK AI AIFLKQ  
Sbjct  93   SAGVAANLFRKKATLPQPSTSARKPLRIRIGQPKLPKNFEEDTWTILKDAITAIFLKQKL  152

Query  477  PCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCW  656
             CD+EKLYQA  DLCLHK+G +LY+RI+KECE HIA  + +LVGQS DLVVFLSLV++ W
Sbjct  153  SCDVEKLYQAAGDLCLHKLGANLYERIKKECEIHIAEKISALVGQSPDLVVFLSLVQRTW  212

Query  657  QDFCDQILTIRGIALYLDRTYV  722
            QDFCDQ+L IRGIAL LD  YV
Sbjct  213  QDFCDQMLIIRGIALLLDVKYV  234



>ref|XP_002466340.1| hypothetical protein SORBIDRAFT_01g005920 [Sorghum bicolor]
 gb|EER93338.1| hypothetical protein SORBIDRAFT_01g005920 [Sorghum bicolor]
Length=834

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = +3

Query  246  DEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklvi--klvkakpTLPTNFEE  419
            D +   A  ++L +P A A+    ANL RKKATLPQP+       ++   +P LP NFEE
Sbjct  76   DAEMVLADQDELPAPSAPASAGVAANLFRKKATLPQPSTSARKPLRIKIGQPKLPKNFEE  135

Query  420  NTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQS  599
            +TWA LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+RI+KECE HIA  + +
Sbjct  136  DTWAILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERIKKECEIHIAEKISA  195

Query  600  LVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            LVGQS DLVVFLSLV++ WQDFCDQ+L IRGIAL LD  YV
Sbjct  196  LVGQSPDLVVFLSLVQRTWQDFCDQMLIIRGIALLLDVKYV  236



>gb|ACA52121.1| cullin 4 [Vitis vinifera]
Length=153

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  459  FLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLS  638
            FLKQPDPCDLEKLYQAVNDLCLHKMGG+LYQRIEKECE+HI  ALQSLVGQS DLVVFLS
Sbjct  1    FLKQPDPCDLEKLYQAVNDLCLHKMGGNLYQRIEKECESHIRAALQSLVGQSPDLVVFLS  60

Query  639  LVEKCWQDFCDQILTIRGIALYLDRTYV  722
            LVEKCWQD CDQ+L IRGIALYLDRTYV
Sbjct  61   LVEKCWQDLCDQMLMIRGIALYLDRTYV  88



>gb|EEE60060.1| hypothetical protein OsJ_12866 [Oryza sativa Japonica Group]
Length=804

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 115/160 (72%), Gaps = 1/160 (1%)
 Frame = +3

Query  246  DEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakp-TLPTNFEEN  422
            D +   A  E+L +P ASA     ANL RKKATLPQP+       +K     LPTNFEE+
Sbjct  47   DAEMVLADQEELAAPSASAPAGVAANLFRKKATLPQPSAARKPLRIKIGQPKLPTNFEED  106

Query  423  TWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSL  602
            TWA LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+RI+KECE HI+  + +L
Sbjct  107  TWAILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERIKKECEVHISAKISAL  166

Query  603  VGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            VGQS DLVVFLSLV++ WQDFCDQ+L IRGIAL LD  YV
Sbjct  167  VGQSPDLVVFLSLVQRTWQDFCDQMLIIRGIALLLDVKYV  206



>gb|AAT75245.1| putative cullin protein [Oryza sativa Japonica Group]
Length=813

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 115/160 (72%), Gaps = 1/160 (1%)
 Frame = +3

Query  246  DEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakp-TLPTNFEEN  422
            D +   A  E+L +P ASA     ANL RKKATLPQP+       +K     LPTNFEE+
Sbjct  47   DAEMVLADQEELAAPSASAPAGVAANLFRKKATLPQPSAARKPLRIKIGQPKLPTNFEED  106

Query  423  TWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSL  602
            TWA LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+RI+KECE HI+  + +L
Sbjct  107  TWAILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERIKKECEVHISAKISAL  166

Query  603  VGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            VGQS DLVVFLSLV++ WQDFCDQ+L IRGIAL LD  YV
Sbjct  167  VGQSPDLVVFLSLVQRTWQDFCDQMLIIRGIALLLDVKYV  206



>gb|ABF99238.1| Cullin-4B, putative, expressed [Oryza sativa Japonica Group]
Length=836

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 115/160 (72%), Gaps = 1/160 (1%)
 Frame = +3

Query  246  DEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakp-TLPTNFEEN  422
            D +   A  E+L +P ASA     ANL RKKATLPQP+       +K     LPTNFEE+
Sbjct  79   DAEMVLADQEELAAPSASAPAGVAANLFRKKATLPQPSAARKPLRIKIGQPKLPTNFEED  138

Query  423  TWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSL  602
            TWA LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+RI+KECE HI+  + +L
Sbjct  139  TWAILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERIKKECEVHISAKISAL  198

Query  603  VGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            VGQS DLVVFLSLV++ WQDFCDQ+L IRGIAL LD  YV
Sbjct  199  VGQSPDLVVFLSLVQRTWQDFCDQMLIIRGIALLLDVKYV  238



>ref|XP_008644442.1| PREDICTED: cullin-4 [Zea mays]
 gb|AFW67428.1| hypothetical protein ZEAMMB73_322823 [Zea mays]
Length=831

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 124/202 (61%), Gaps = 14/202 (7%)
 Frame = +3

Query  159  MKKAKSQAVACS------------LDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASA  302
            MKKAK  A A S            LDT            + D D    + + L +P   A
Sbjct  32   MKKAKHPAAASSSSVGTVEKNGIQLDTVAAAMGGGRTNGEEDADMVLVNQDKLPAPSVPA  91

Query  303  TRAATANLSRKKATLPQpakklvi--klvkakpTLPTNFEENTWATLKSAINAIFLKQPD  476
            +    ANL RKKATLPQP+       ++   +P LP NFEE+TW+ LK AI AIFLKQ  
Sbjct  92   SAGVAANLFRKKATLPQPSTSARKPLRIKIGQPKLPKNFEEDTWSILKDAITAIFLKQKL  151

Query  477  PCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCW  656
             CD+EKLYQA  DLCLHK+G +LY RI+KEC  HIA  + +LVGQS DLVVFLSLV++ W
Sbjct  152  SCDVEKLYQAAGDLCLHKLGANLYDRIKKECGIHIAEKISALVGQSPDLVVFLSLVQRTW  211

Query  657  QDFCDQILTIRGIALYLDRTYV  722
            QDFCDQ+L IRGIAL LD  YV
Sbjct  212  QDFCDQMLIIRGIALLLDVKYV  233



>ref|XP_002984123.1| ubiquitin-protein ligase, cullin 4 [Selaginella moellendorffii]
 gb|EFJ14633.1| ubiquitin-protein ligase, cullin 4 [Selaginella moellendorffii]
Length=766

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = +3

Query  291  GASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQ  470
            G S +   TANLSRKKAT PQP KKLVIK  K KP LP NFE+ TW  +++A++AI +KQ
Sbjct  25   GGSNSTGTTANLSRKKATPPQPTKKLVIKPFKDKPKLPANFEDATWDKIRAAVSAIHVKQ  84

Query  471  PDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEK  650
            P  C LE+LYQ V DLCLHK+ G+LYQR+++ECETHI+  L +LVGQS D VVFLS VE+
Sbjct  85   PVSCSLEQLYQNVEDLCLHKLSGNLYQRLQQECETHISAKLNALVGQSPDPVVFLSHVER  144

Query  651  CWQDFCDQILTIRGIALYLDRTYV  722
            CWQD CDQ+L IR IALYLDRTYV
Sbjct  145  CWQDHCDQMLMIRSIALYLDRTYV  168



>ref|XP_002972211.1| ubiquitin-protein ligase, Cullin 4 [Selaginella moellendorffii]
 gb|EFJ26297.1| ubiquitin-protein ligase, Cullin 4 [Selaginella moellendorffii]
Length=766

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = +3

Query  291  GASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQ  470
            G S +   TANLSRKKAT PQP KKLVIK  K KP LP NFE+ TW  +++A++AI +KQ
Sbjct  25   GGSNSTGTTANLSRKKATPPQPTKKLVIKPFKDKPKLPANFEDATWDKIRAAVSAIHVKQ  84

Query  471  PDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEK  650
            P  C LE+LYQ V DLCLHK+ G+LYQR+++ECETHI+  L +LVGQS D VVFLS VE+
Sbjct  85   PVSCSLEQLYQNVEDLCLHKLSGNLYQRLQQECETHISAKLYALVGQSPDPVVFLSHVER  144

Query  651  CWQDFCDQILTIRGIALYLDRTYV  722
            CWQD CDQ+L IR IALYLDRTYV
Sbjct  145  CWQDHCDQMLMIRSIALYLDRTYV  168



>ref|XP_001764780.1| predicted protein [Physcomitrella patens]
 gb|EDQ70479.1| predicted protein [Physcomitrella patens]
Length=745

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 114/146 (78%), Gaps = 4/146 (3%)
 Frame = +3

Query  285  SPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFL  464
            SPG       TANLSRKKAT PQPA+KLVIK  K KP LP +FEE TWA L+ A+ AI L
Sbjct  6    SPGI----GTTANLSRKKATPPQPARKLVIKPFKEKPKLPKDFEEVTWAKLREAVTAIHL  61

Query  465  KQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLV  644
            KQP  C LE+LY+AV DLCLHKM G+LY+R+++ECE+HI+V L+ LVG+S D VVFLS V
Sbjct  62   KQPVNCSLEELYRAVEDLCLHKMAGNLYRRLQQECESHISVKLRDLVGRSPDSVVFLSHV  121

Query  645  EKCWQDFCDQILTIRGIALYLDRTYV  722
            E CWQD CDQ+L IR IALYLDRTYV
Sbjct  122  ESCWQDHCDQMLLIRSIALYLDRTYV  147



>ref|XP_010518764.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4-like [Tarenaya hassleriana]
Length=788

 Score =   172 bits (437),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 132/193 (68%), Gaps = 28/193 (15%)
 Frame = +3

Query  150  PPPMKKAKSQAVACSLDTNKNGQHH--VHFYPDVDEDPSSASMEDLDSPGASATRAATAN  323
            PPPMKKAK            NG HH     +P +DEDP+ A+             +A AN
Sbjct  27   PPPMKKAK------------NGLHHHDKEVFP-MDEDPAPAA-------------SAAAN  60

Query  324  LSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQ  503
            LSRKK+T PQPAKKLVIKL KAKP LPTNFEE TWA L+SAI AIF K+    DLE LYQ
Sbjct  61   LSRKKSTPPQPAKKLVIKLNKAKPILPTNFEETTWAKLQSAIRAIFKKEAVSFDLEGLYQ  120

Query  504  AVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILT  683
            AV++LCLHKM G LYQ+IEKECE HI+ AL SLVG+S DL  FLS+V+ CW DF DQ+L 
Sbjct  121  AVDNLCLHKMEGKLYQQIEKECEDHISAALLSLVGKSTDLSGFLSVVKNCWLDFSDQMLM  180

Query  684  IRGIALYLDRTYV  722
            IR IAL LDR YV
Sbjct  181  IRSIALSLDRKYV  193



>tpg|DAA51791.1| TPA: hypothetical protein ZEAMMB73_453479, partial [Zea mays]
Length=517

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP NFEE+TW  LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+RI+KECE H
Sbjct  9    LPKNFEEDTWTILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERIKKECEIH  68

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            IA  + +LVGQS DLVVFLSLV++ WQDFCDQ+L IRGIAL LD  YV
Sbjct  69   IAEKISALVGQSPDLVVFLSLVQRTWQDFCDQMLIIRGIALLLDVKYV  116



>ref|XP_001776334.1| predicted protein [Physcomitrella patens]
 gb|EDQ58833.1| predicted protein [Physcomitrella patens]
Length=768

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 112/147 (76%), Gaps = 4/147 (3%)
 Frame = +3

Query  282  DSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIF  461
            ++PG       TANLSRKKAT P PAKKLVIK  K KP LP NFEE TW  +K A+ AI 
Sbjct  28   NNPGV----GTTANLSRKKATPPPPAKKLVIKPFKDKPKLPANFEEVTWVKIKEAVTAIH  83

Query  462  LKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSL  641
            LKQP  C LE+LY+AV DLC+HKM G+LY+R++ ECE+HI++ L+ L G+S D VVFLS 
Sbjct  84   LKQPVNCSLEELYRAVEDLCVHKMAGNLYKRLQLECESHISIKLRDLAGRSPDAVVFLSH  143

Query  642  VEKCWQDFCDQILTIRGIALYLDRTYV  722
            VE+CWQD C+Q+L IR IALYLDRTYV
Sbjct  144  VERCWQDHCNQMLVIRSIALYLDRTYV  170



>gb|KHG11994.1| Cullin-4 -like protein [Gossypium arboreum]
Length=571

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 108/153 (71%), Gaps = 12/153 (8%)
 Frame = +3

Query  57   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFY  236
            MS P   P KRS      +ATA   + P H  PPMKKAKSQAVACSLD N+NG HH H  
Sbjct  1    MSLP---PTKRSI----TNATASSSSSP-HFQPPMKKAKSQAVACSLDPNRNGLHHHHNN  52

Query  237  PD---VDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPT  407
             D   V  DPSS  + D DS  A A   A ANLSRKKAT PQPAKKLVIKLVKAKPTLPT
Sbjct  53   QDDNNVLFDPSSMPLHD-DSKSADACAPAAANLSRKKATPPQPAKKLVIKLVKAKPTLPT  111

Query  408  NFEENTWATLKSAINAIFLKQPDPCDLEKLYQA  506
            NFE  TWATLKSAI AIFLKQPD CDLEKLYQA
Sbjct  112  NFEVETWATLKSAIIAIFLKQPDSCDLEKLYQA  144



>ref|XP_005825979.1| hypothetical protein GUITHDRAFT_160035 [Guillardia theta CCMP2712]
 gb|EKX38999.1| hypothetical protein GUITHDRAFT_160035 [Guillardia theta CCMP2712]
Length=789

 Score =   129 bits (323),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 76/108 (70%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP  FEE+TW  LK +++A+  +QP     E+LY+AV DLC+HK+G +LY R++ +CE H
Sbjct  89   LPETFEEDTWKKLKMSVHAVHREQPVEQSFEELYKAVEDLCIHKLGPNLYSRLQNDCEEH  148

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   ++SLVGQ +D  +FL  VE CWQ  C+Q+  IR I LYLDRTYV
Sbjct  149  IKSEIESLVGQPDDATIFLETVEACWQKHCNQMSLIRSIFLYLDRTYV  196



>gb|KJB66937.1| hypothetical protein B456_010G166800 [Gossypium raimondii]
Length=662

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  531  MGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLD  710
            MGGSLYQRIEKECE HI+ AL+SLVGQS DLVVFLSLVEKCWQD CDQ+L IR IALYLD
Sbjct  1    MGGSLYQRIEKECEEHISTALRSLVGQSPDLVVFLSLVEKCWQDLCDQMLMIRSIALYLD  60

Query  711  RTYV  722
            RTYV
Sbjct  61   RTYV  64



>gb|KDO78193.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=662

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  531  MGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLD  710
            MGG+LYQRIEKECE HI+ A++SLVGQS DLVVFLSLVE+CWQD CDQ+L IRGIALYLD
Sbjct  1    MGGNLYQRIEKECEEHISAAIRSLVGQSPDLVVFLSLVERCWQDLCDQMLMIRGIALYLD  60

Query  711  RTYV  722
            RTYV
Sbjct  61   RTYV  64



>ref|XP_006449701.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
 gb|ESR62941.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
Length=662

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  531  MGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLD  710
            MGG+LYQRIEKECE HI+ A++SLVGQS DLVVFLSLVE+CWQD CDQ+L IRGIALYLD
Sbjct  1    MGGNLYQRIEKECEEHISAAIRSLVGQSPDLVVFLSLVERCWQDLCDQMLMIRGIALYLD  60

Query  711  RTYV  722
            RTYV
Sbjct  61   RTYV  64



>gb|KIZ03018.1| cullin 4 [Monoraphidium neglectum]
Length=404

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 76/109 (70%), Gaps = 1/109 (1%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP NFE++TWA L+ A++A+  K+   C LE+LY+AV D+C HKM  SLY+R++  C+ H
Sbjct  30   LPANFEQDTWAKLEDAVDAVHCKRTVACSLEELYRAVEDMCSHKMQDSLYRRLQAACDAH  89

Query  579  IAVALQSLVGQSE-DLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I  A+ +L  Q + D V FL   +  WQD+C Q+LT+R I LYLDRT+V
Sbjct  90   IQRAMGTLQDQVQLDAVSFLDRADAVWQDYCAQMLTVRCIFLYLDRTFV  138



>ref|XP_006598170.1| PREDICTED: cullin-4-like [Glycine max]
Length=123

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  531  MGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLD  710
            MG +L+Q+IEKECE HI+ ALQSLVGQS DLVVF SLVE+CWQD CDQ+L IRGIALYLD
Sbjct  1    MGVNLHQQIEKECEAHISAALQSLVGQSPDLVVFRSLVERCWQDLCDQMLMIRGIALYLD  60

Query  711  RTYV  722
            RTYV
Sbjct  61   RTYV  64



>emb|CBJ49182.1| conserved unknown protein [Ectocarpus siliculosus]
Length=750

 Score =   120 bits (300),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 74/108 (69%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP  FE++TW  L+ A+ AI  KQP     E+LY+AV DLC+HKMG +LY R+  EC +H
Sbjct  38   LPEQFEDSTWEMLQRAVVAIQTKQPIDTSREELYRAVEDLCVHKMGANLYDRLRDECGSH  97

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
                ++SLVGQ+ D   FL LV++ WQD C  +LT+R + LYLDR++V
Sbjct  98   TRREMESLVGQTPDCNAFLQLVDRNWQDHCSSMLTLRNVFLYLDRSFV  145



>ref|XP_005644988.1| Cullin-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20444.1| Cullin-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=733

 Score =   117 bits (292),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 70/109 (64%), Gaps = 1/109 (1%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP +FE  TW  L+ A+ A+  K+P  C LE+LY  V D+CLHKM   LY  ++KEC+ H
Sbjct  27   LPADFEARTWGKLREAVLAVHAKRPVSCSLEELYGLVEDMCLHKMADRLYVNLQKECDRH  86

Query  579  IAVALQSL-VGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            ++  L  L   Q  D V+FL  V  CW+D CDQ+L IR I LYLDRTYV
Sbjct  87   VSEQLTKLATDQIMDPVLFLGKVAACWKDHCDQMLIIRSIFLYLDRTYV  135



>gb|KJE89856.1| Cullin 4 [Capsaspora owczarzaki ATCC 30864]
Length=833

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 74/108 (69%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+E+ TW  L++A+ A+   +P    LE LY+AV +LCL   G +LY+R+  ECE+H
Sbjct  134  LPPNYEQETWQKLQAAVRAVHEARPIDSYLEVLYEAVENLCLLGGGATLYERLTAECESH  193

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            + +  + L   SED V FLS+V+ CWQ  C+Q++TIR I L+LDRTYV
Sbjct  194  LRLEAEKLSVASEDPVTFLSVVDACWQAHCEQMITIRSIFLHLDRTYV  241



>ref|XP_004349795.2| Cullin 4 [Capsaspora owczarzaki ATCC 30864]
Length=837

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 74/108 (69%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+E+ TW  L++A+ A+   +P    LE LY+AV +LCL   G +LY+R+  ECE+H
Sbjct  134  LPPNYEQETWQKLQAAVRAVHEARPIDSYLEVLYEAVENLCLLGGGATLYERLTAECESH  193

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            + +  + L   SED V FLS+V+ CWQ  C+Q++TIR I L+LDRTYV
Sbjct  194  LRLEAEKLSVASEDPVTFLSVVDACWQAHCEQMITIRSIFLHLDRTYV  241



>ref|XP_002947918.1| hypothetical protein VOLCADRAFT_57881 [Volvox carteri f. nagariensis]
 gb|EFJ50906.1| hypothetical protein VOLCADRAFT_57881, partial [Volvox carteri 
f. nagariensis]
Length=755

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 71/109 (65%), Gaps = 1/109 (1%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP NFEE TW+ L+  I A+  K+P  C LE+LY AV D+C+HKM   LY R+++EC++H
Sbjct  4    LPANFEEATWSKLRDCIMAVHCKRPVSCSLEELYTAVQDMCMHKMADKLYSRLQQECDSH  63

Query  579  IAVALQSLVG-QSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I+  + SL    S + V FL  V   WQD C Q+L  R I LYLDRT+V
Sbjct  64   ISAHVSSLSDCLSLEAVPFLDRVAAVWQDHCSQMLMTRQIFLYLDRTHV  112



>ref|XP_002504743.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66001.1| predicted protein [Micromonas sp. RCC299]
Length=777

 Score =   109 bits (272),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 49/109 (45%), Positives = 71/109 (65%), Gaps = 2/109 (2%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP +FEE++W  L +A++A+  K+P     E LY+ V D+CLHK+G  LY R+   CE+H
Sbjct  45   LPADFEEDSWRMLSNAVDAVHQKRPVSESFETLYRRVEDVCLHKLGAGLYARLRASCESH  104

Query  579  IAVALQSLVGQ--SEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTY  719
            +   + +L G+  +ED V FL+ V+  W D CD  LTIR + LYLDRT+
Sbjct  105  VRERVATLRGRDGAEDPVAFLNRVDDVWGDHCDATLTIRSVFLYLDRTH  153



>ref|XP_001703219.1| cullin [Chlamydomonas reinhardtii]
 gb|EDO96515.1| cullin [Chlamydomonas reinhardtii]
Length=782

 Score =   108 bits (270),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 72/111 (65%), Gaps = 5/111 (5%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP NFEE+TW+ L+  I A+  K+P    LE+LY AV D+C+HKM   LY R++KEC+ H
Sbjct  41   LPANFEESTWSKLRDCIIAVHCKRPVSNSLEELYTAVQDMCMHKMADKLYTRLQKECDAH  100

Query  579  IAVALQSL---VGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            IA  + SL   +G   D V +L  V+  WQD C Q+L  R I LYLDRT+V
Sbjct  101  IAAHVGSLGDCLGL--DAVPYLDRVDSVWQDHCSQMLLTRQIFLYLDRTHV  149



>ref|XP_011674419.1| PREDICTED: cullin-4A [Strongylocentrotus purpuratus]
Length=504

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 0/109 (0%)
 Frame = +3

Query  396  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET  575
             LP N+++ TW  LK A+ AI   +P    LE+LYQAV ++C HKM  SLY ++++ CE 
Sbjct  101  VLPANYQQQTWDRLKEAVQAIHKSRPIKYSLEELYQAVENMCSHKMSASLYDQLKEVCEQ  160

Query  576  HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            H+A        +  D + +L  +  CWQD C Q++ IR I L+LDRTYV
Sbjct  161  HVASQTGQFTSEMTDSLTYLKQLNTCWQDHCRQMIMIRSIFLFLDRTYV  209



>ref|XP_006823839.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4B-like [Saccoglossus 
kowalevskii]
Length=808

 Score =   108 bits (270),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N++E TW  LK A+ AI         LE+LYQAV ++C HKM  SLY +++  CE H
Sbjct  99   LPENYQERTWGKLKEAVQAIHKHTSIKYSLEELYQAVENMCSHKMSASLYDKLKIVCEEH  158

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            +   +   +G S D V +L ++  CW D C Q++ IR I L+LDRTYV
Sbjct  159  VKAQISLFIGDSTDSVSYLKILNNCWLDHCRQMIMIRSIFLFLDRTYV  206



>ref|XP_008171287.1| PREDICTED: cullin-4B isoform X2 [Chrysemys picta bellii]
Length=780

 Score =   108 bits (269),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  43   TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  102

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  103  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  162

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  163  HCRQMIMIRSIFLFLDRTYV  182



>ref|XP_010139394.1| PREDICTED: cullin-4B [Buceros rhinoceros silvestris]
Length=885

 Score =   107 bits (268),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 64/140 (46%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  KAKP LP N+ + TW  LK A+ AI        
Sbjct  148  TKAASSTVSSFANSKPGSAKKLVIKNFKAKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  207

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  208  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  267

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  268  HCRQMIMIRSIFLFLDRTYV  287



>ref|XP_009899852.1| PREDICTED: cullin-4B [Picoides pubescens]
Length=887

 Score =   107 bits (268),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKEKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  270  HCRQMIMIRSIFLFLDRTYV  289



>dbj|BAB64445.1| hypothetical protein [Macaca fascicularis]
Length=324

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  208  LPENYTDETWQKLKEAVEAIQNSSSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  267

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct  268  IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV  315



>ref|XP_005022179.1| PREDICTED: cullin-4B [Anas platyrhynchos]
Length=886

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  149  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  208

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  209  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  268

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  269  HCRQMIMIRSIFLFLDRTYV  288



>ref|XP_010287736.1| PREDICTED: cullin-4B [Phaethon lepturus]
Length=887

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  270  HCRQMIMIRSIFLFLDRTYV  289



>ref|XP_009968477.1| PREDICTED: cullin-4B [Tyto alba]
Length=887

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  270  HCRQMIMIRSIFLFLDRTYV  289



>ref|XP_010020149.1| PREDICTED: cullin-4B [Nestor notabilis]
Length=887

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  270  HCRQMIMIRSIFLFLDRTYV  289



>ref|XP_009915406.1| PREDICTED: cullin-4B isoform X1 [Haliaeetus albicilla]
 ref|XP_010567268.1| PREDICTED: cullin-4B isoform X1 [Haliaeetus leucocephalus]
 ref|XP_011576339.1| PREDICTED: cullin-4B isoform X1 [Aquila chrysaetos canadensis]
Length=887

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  270  HCRQMIMIRSIFLFLDRTYV  289



>ref|XP_009871272.1| PREDICTED: cullin-4B [Apaloderma vittatum]
Length=887

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  270  HCRQMIMIRSIFLFLDRTYV  289



>ref|XP_009578947.1| PREDICTED: cullin-4B [Fulmarus glacialis]
Length=887

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  270  HCRQMIMIRSIFLFLDRTYV  289



>ref|XP_009487693.1| PREDICTED: cullin-4B [Pelecanus crispus]
 ref|XP_009470592.1| PREDICTED: cullin-4B [Nipponia nippon]
 ref|XP_009634699.1| PREDICTED: cullin-4B [Egretta garzetta]
 ref|XP_009816067.1| PREDICTED: cullin-4B [Gavia stellata]
 ref|XP_009705121.1| PREDICTED: cullin-4B [Cariama cristata]
 ref|XP_010125781.1| PREDICTED: cullin-4B [Chlamydotis macqueenii]
Length=887

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  270  HCRQMIMIRSIFLFLDRTYV  289



>ref|XP_009273579.1| PREDICTED: cullin-4B [Aptenodytes forsteri]
 ref|XP_009329115.1| PREDICTED: cullin-4B [Pygoscelis adeliae]
 ref|XP_010309825.1| PREDICTED: cullin-4B [Balearica regulorum gibbericeps]
Length=887

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  270  HCRQMIMIRSIFLFLDRTYV  289



>ref|XP_009073198.1| PREDICTED: cullin-4B [Acanthisitta chloris]
Length=887

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  270  HCRQMIMIRSIFLFLDRTYV  289



>ref|XP_005432498.1| PREDICTED: cullin-4B [Falco cherrug]
Length=887

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  270  HCRQMIMIRSIFLFLDRTYV  289



>ref|XP_005045907.1| PREDICTED: cullin-4B [Ficedula albicollis]
Length=888

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  151  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  210

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  211  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  270

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  271  HCRQMIMIRSIFLFLDRTYV  290



>ref|XP_003208504.1| PREDICTED: cullin-4B [Meleagris gallopavo]
Length=884

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  147  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  206

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  207  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  266

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  267  HCRQMIMIRSIFLFLDRTYV  286



>ref|XP_010162624.1| PREDICTED: cullin-4B [Caprimulgus carolinensis]
Length=886

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  149  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  208

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  209  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  268

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  269  HCRQMIMIRSIFLFLDRTYV  288



>ref|XP_005504485.1| PREDICTED: cullin-4B [Columba livia]
Length=887

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  270  HCRQMIMIRSIFLFLDRTYV  289



>ref|XP_005484500.1| PREDICTED: cullin-4B [Zonotrichia albicollis]
 ref|XP_005419871.1| PREDICTED: cullin-4B [Geospiza fortis]
 ref|XP_005526275.1| PREDICTED: cullin-4B [Pseudopodoces humilis]
 ref|XP_008928928.1| PREDICTED: cullin-4B [Manacus vitellinus]
Length=887

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  270  HCRQMIMIRSIFLFLDRTYV  289



>ref|XP_005148357.1| PREDICTED: cullin-4B [Melopsittacus undulatus]
Length=887

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  270  HCRQMIMIRSIFLFLDRTYV  289



>ref|XP_009943501.1| PREDICTED: cullin-4B [Opisthocomus hoazin]
Length=888

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  151  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  210

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  211  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  270

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  271  HCRQMIMIRSIFLFLDRTYV  290



>ref|XP_002196531.1| PREDICTED: cullin-4B [Taeniopygia guttata]
Length=888

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  151  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  210

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  211  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  270

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  271  HCRQMIMIRSIFLFLDRTYV  290



>ref|XP_007060188.1| PREDICTED: cullin-4B [Chelonia mydas]
Length=883

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  146  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  205

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  206  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  265

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  266  HCRQMIMIRSIFLFLDRTYV  285



>ref|XP_010150094.1| PREDICTED: cullin-4B [Eurypyga helias]
Length=885

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  148  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  207

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  208  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  267

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  268  HCRQMIMIRSIFLFLDRTYV  287



>ref|XP_009564621.1| PREDICTED: cullin-4B [Cuculus canorus]
Length=885

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  148  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  207

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  208  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  267

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  268  HCRQMIMIRSIFLFLDRTYV  287



>ref|XP_009088610.1| PREDICTED: cullin-4B [Serinus canaria]
Length=887

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  270  HCRQMIMIRSIFLFLDRTYV  289



>ref|XP_009981623.1| PREDICTED: cullin-4B [Tauraco erythrolophus]
Length=888

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  151  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  210

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  211  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  270

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  271  HCRQMIMIRSIFLFLDRTYV  290



>ref|XP_005241130.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4B [Falco peregrinus]
Length=887

 Score =   107 bits (267),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  270  HCRQMIMIRSIFLFLDRTYV  289



>ref|XP_008638702.1| PREDICTED: cullin-4B [Corvus brachyrhynchos]
 ref|XP_010405981.1| PREDICTED: cullin-4B [Corvus cornix cornix]
Length=885

 Score =   107 bits (267),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  148  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  207

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  208  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  267

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  268  HCRQMIMIRSIFLFLDRTYV  287



>ref|XP_009670270.1| PREDICTED: cullin-4B [Struthio camelus australis]
Length=886

 Score =   107 bits (267),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  149  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  208

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  209  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  268

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  269  HCRQMIMIRSIFLFLDRTYV  288



>ref|XP_007436244.1| PREDICTED: cullin-4B [Python bivittatus]
Length=908

 Score =   107 bits (267),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  171  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  230

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  231  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  290

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  291  HCRQMIMIRSIFLFLDRTYV  310



>ref|XP_005767862.1| hypothetical protein EMIHUDRAFT_427672 [Emiliania huxleyi CCMP1516]
 gb|EOD15433.1| hypothetical protein EMIHUDRAFT_427672 [Emiliania huxleyi CCMP1516]
Length=768

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 69/108 (64%), Gaps = 2/108 (2%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP NFE+ TWA L  A+ A+  K+     LE+LY+ V D+C+  M    Y +++ ECE H
Sbjct  27   LPANFEQATWAKLLDAVRAVHGKRAVNHSLEELYRGVEDMCVQHMAARTYDKLQAECEAH  86

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            +  ++++L  Q+ D   FLSLV  CW   C+++LT+R I LYLDRTYV
Sbjct  87   VEASIEAL--QTPDTSAFLSLVHGCWSAHCEEMLTLRSIFLYLDRTYV  132



>ref|XP_005782887.1| hypothetical protein EMIHUDRAFT_468368 [Emiliania huxleyi CCMP1516]
 gb|EOD30458.1| hypothetical protein EMIHUDRAFT_468368 [Emiliania huxleyi CCMP1516]
Length=701

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 69/108 (64%), Gaps = 2/108 (2%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP NFE+ TWA L  A+ A+  K+     LE+LY+ V D+C+  M    Y +++ ECE H
Sbjct  27   LPANFEQATWAKLLDAVRAVHGKRAVNHSLEELYRGVEDMCVQHMAARTYDKLQAECEAH  86

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            +  ++++L  Q+ D   FLSLV  CW   C+++LT+R I LYLDRTYV
Sbjct  87   VEASIEAL--QTPDTSAFLSLVHGCWSAHCEEMLTLRSIFLYLDRTYV  132



>ref|XP_006803308.1| PREDICTED: cullin-4B-like [Neolamprologus brichardi]
Length=674

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  159  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCFHKISAKLYKQLRAVCEDH  218

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      + D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  219  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  266



>gb|EEC76292.1| hypothetical protein OsI_13805 [Oryza sativa Indica Group]
Length=744

 Score =   105 bits (263),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 62/102 (61%), Positives = 73/102 (72%), Gaps = 1/102 (1%)
 Frame = +3

Query  264  ASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvka-kpTLPTNFEENTWATLK  440
            A  E+L +P ASA     ANL RKKATLPQP+       +K  +P LPTNFEE+TWA LK
Sbjct  53   ADQEELAAPSASAPAGVAANLFRKKATLPQPSAARKPLRIKIGQPKLPTNFEEDTWAILK  112

Query  441  SAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKE  566
             AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+RI+KE
Sbjct  113  DAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERIKKE  154



>ref|XP_011478226.1| PREDICTED: cullin-4B [Oryzias latipes]
Length=860

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  158  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCFHKVSAKLYKQLRAACEDH  217

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      + D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  218  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  265



>ref|XP_003445252.1| PREDICTED: cullin-4B [Oreochromis niloticus]
Length=868

 Score =   105 bits (263),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  163  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCFHKISAKLYKQLRAVCEDH  222

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      + D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  223  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  270



>ref|XP_004545810.1| PREDICTED: cullin-4B-like [Maylandia zebra]
 ref|XP_005722969.1| PREDICTED: cullin-4B-like [Pundamilia nyererei]
Length=865

 Score =   105 bits (263),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  160  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCFHKISAKLYKQLRAVCEDH  219

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      + D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  220  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  267



>ref|XP_005913219.1| PREDICTED: cullin-4B-like [Haplochromis burtoni]
Length=865

 Score =   105 bits (263),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  160  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCFHKISAKLYKQLRAVCEDH  219

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      + D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  220  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  267



>ref|XP_008935860.1| PREDICTED: cullin-4B [Merops nubicus]
Length=881

 Score =   105 bits (262),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 86/140 (61%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  144  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYIDETWQKLKGAVEAIQNSTSIKY  203

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+   LY+++   CE HI   +      S D V+FL  ++KCWQD
Sbjct  204  NLEELYQAVENLCSYKISSKLYKQLRHICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  263

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  264  HCRQMIMIRSIFLFLDRTYV  283



>gb|ESA04652.1| hypothetical protein GLOINDRAFT_85233, partial [Rhizophagus irregularis 
DAOM 181602]
Length=769

 Score =   105 bits (261),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 52/108 (48%), Positives = 67/108 (62%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+EE TW+ L++A+ AIF  Q     LE+LY+A  +LCLHKM  SLY+R+  E E H
Sbjct  54   LPDNYEEVTWSKLQAAVQAIFNYQRIGTSLEELYKACENLCLHKMAPSLYKRLAGEIEEH  113

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            + V    L     +    L +V KCWQ  C+Q+  IR I LYLDRTYV
Sbjct  114  LKVEKTKLENNLNENDTLLIVVNKCWQAHCEQMGLIRSIFLYLDRTYV  161



>ref|XP_005790994.1| hypothetical protein EMIHUDRAFT_224320 [Emiliania huxleyi CCMP1516]
 gb|EOD38565.1| hypothetical protein EMIHUDRAFT_224320 [Emiliania huxleyi CCMP1516]
Length=395

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 2/108 (2%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP NFE+ TWA L  A+ A+  K+     LE+LY+ V D+C+  M    Y +++ ECE H
Sbjct  211  LPANFEQATWAKLLDAVRAVHGKRAVNHSLEELYRGVEDMCVQHMAARTYDKLQAECEAH  270

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            +  ++++L  Q+ D   FLSLV  CW   C+++LT+  I LYLDRTYV
Sbjct  271  VEASIEAL--QTPDTSAFLSLVHGCWSAHCEEMLTLHSIFLYLDRTYV  316



>ref|XP_006115461.1| PREDICTED: cullin-4B [Pelodiscus sinensis]
Length=882

 Score =   105 bits (261),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  145  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  204

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  205  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  264

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  265  HCRQMIMIRSIFLFLDRTYV  284



>ref|XP_005307468.2| PREDICTED: cullin-4B isoform X1 [Chrysemys picta bellii]
Length=883

 Score =   105 bits (261),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  146  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  205

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  206  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  265

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  266  HCRQMIMIRSIFLFLDRTYV  285



>ref|XP_003229259.1| PREDICTED: cullin-4B [Anolis carolinensis]
Length=897

 Score =   105 bits (261),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 48/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  192  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  251

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  252  IKAQIHQFREDSLDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  299



>ref|XP_010210224.1| PREDICTED: cullin-4B [Tinamus guttatus]
Length=883

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  146  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  205

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  206  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  265

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  266  HCRQMIMIRSIFLFLDRTYV  285



>ref|XP_006260081.1| PREDICTED: cullin-4B [Alligator mississippiensis]
Length=890

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  153  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  212

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  213  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  272

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  273  HCRQMIMIRSIFLFLDRTYV  292



>ref|XP_006028559.1| PREDICTED: cullin-4B [Alligator sinensis]
Length=891

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  154  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  213

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  214  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  273

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  274  HCRQMIMIRSIFLFLDRTYV  293



>ref|XP_420335.2| PREDICTED: cullin-4B [Gallus gallus]
Length=883

 Score =   104 bits (260),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 48/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  178  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  237

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  238  IKAQIHQFREDSLDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  285



>dbj|BAC41443.3| mKIAA0695 protein [Mus musculus]
Length=737

 Score =   104 bits (259),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+  +LY+++ + CE H
Sbjct  61   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISANLYKQLRQICEDH  120

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct  121  IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV  168



>ref|XP_010206238.1| PREDICTED: cullin-4B [Colius striatus]
Length=888

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  151  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  210

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  211  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  270

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  271  HCRQMIMIRSIFLFLDRTYV  290



>ref|XP_008324704.1| PREDICTED: cullin-4B [Cynoglossus semilaevis]
Length=821

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  160  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISAKLYKQLRAVCEDH  219

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      + D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  220  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  267



>ref|XP_008491853.1| PREDICTED: cullin-4B [Calypte anna]
Length=887

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  270  HCRQMIMIRSIFLFLDRTYV  289



>ref|XP_009887578.1| PREDICTED: cullin-4B [Charadrius vociferus]
Length=887

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  270  HCRQMIMIRSIFLFLDRTYV  289



>ref|XP_001656862.1| AAEL003466-PB [Aedes aegypti]
 ref|XP_001656863.1| AAEL003466-PA [Aedes aegypti]
 gb|EAT45256.1| AAEL003466-PB [Aedes aegypti]
 gb|EAT45257.1| AAEL003466-PA [Aedes aegypti]
Length=759

 Score =   104 bits (259),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 0/109 (0%)
 Frame = +3

Query  396  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET  575
            TLP N++E+TW  L++A+ AI    P    LE+LYQAV ++C HKM   LY  +    E 
Sbjct  51   TLPENYQEHTWQKLRAAVVAIQTSTPIEYSLEELYQAVENMCSHKMDSQLYVNLTALAEQ  110

Query  576  HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            H+   +   + +S D +V+L  + +CWQ  C Q++ IR I LYLDRTYV
Sbjct  111  HVKANITPFLAESVDKLVYLKKMNECWQSHCQQMIMIRSIFLYLDRTYV  159



>ref|XP_010073509.1| PREDICTED: cullin-4B [Pterocles gutturalis]
Length=885

 Score =   104 bits (260),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 48/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  180  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  239

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  240  IKAQIHQFREDSLDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  287



>ref|XP_010764721.1| PREDICTED: cullin-4B [Notothenia coriiceps]
Length=861

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 67/108 (62%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  156  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISAKLYKQLRAVCEDH  215

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   ++     + D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  216  IKSQIEQFREDALDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  263



>dbj|BAC27992.1| unnamed protein product [Mus musculus]
 gb|AAP84984.1| cullin 4B [Mus musculus]
Length=970

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+  +LY+++ + CE H
Sbjct  265  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISANLYKQLRQICEDH  324

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct  325  IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV  372



>ref|NP_001103612.1| cullin-4B [Mus musculus]
 ref|NP_082564.3| cullin-4B [Mus musculus]
 sp|A2A432.1|CUL4B_MOUSE RecName: Full=Cullin-4B; Short=CUL-4B [Mus musculus]
 gb|EDL29019.1| cullin 4B [Mus musculus]
Length=970

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+  +LY+++ + CE H
Sbjct  265  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISANLYKQLRQICEDH  324

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct  325  IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV  372



>ref|XP_007569758.1| PREDICTED: cullin-4B [Poecilia formosa]
Length=868

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  163  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISAKLYKQLRTVCEDH  222

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      + D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  223  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  270



>ref|XP_008418856.1| PREDICTED: cullin-4B [Poecilia reticulata]
Length=872

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  167  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISAKLYKQLRTVCEDH  226

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      + D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  227  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  274



>ref|XP_005799582.1| PREDICTED: cullin-4B-like [Xiphophorus maculatus]
Length=867

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  162  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISAKLYKQLRTVCEDH  221

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      + D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  222  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  269



>ref|XP_008274104.1| PREDICTED: cullin-4B [Stegastes partitus]
Length=870

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  165  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISAKLYKQLRAVCEDH  224

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      + D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  225  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  272



>ref|XP_003970600.1| PREDICTED: cullin-4B [Takifugu rubripes]
Length=862

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  157  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISAKLYKQLRAVCEDH  216

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      + D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  217  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  264



>ref|XP_009556241.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4A [Cuculus canorus]
Length=773

 Score =   103 bits (258),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 54/144 (38%), Positives = 82/144 (57%), Gaps = 0/144 (0%)
 Frame = +3

Query  291  GASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQ  470
            GA A+ + T   +    T P    +L++     +P LP N+ ++TW  L  A+ AI    
Sbjct  32   GARASSSTTRQAATALITRPAAGSQLLVFSFTERPKLPDNYTQDTWQKLHEAVEAIQSSI  91

Query  471  PDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEK  650
                +LE+LYQAV +LC +K+  +LY+++ + CE H+   +      S D +VFL  + K
Sbjct  92   SIKYNLEELYQAVENLCSYKVSATLYKQLRQVCEDHVKAQILQFREDSLDSLVFLKKINK  151

Query  651  CWQDFCDQILTIRGIALYLDRTYV  722
            CWQD C Q++ IR I L+LDRTYV
Sbjct  152  CWQDHCRQMIMIRSIFLFLDRTYV  175



>dbj|BAE36141.1| unnamed protein product [Mus musculus]
Length=917

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+  +LY+++ + CE H
Sbjct  212  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISANLYKQLRQICEDH  271

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct  272  IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV  319



>gb|EWM25493.1| ubiquitin-protein cullin 4 [Nannochloropsis gaditana]
Length=828

 Score =   103 bits (258),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 50/112 (45%), Positives = 70/112 (63%), Gaps = 4/112 (4%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP NFE+ TW  L+ A+ A+  K       E+LY+AV +LC+HKMG  LY R+  EC  H
Sbjct  53   LPENFEDATWEVLRQAVVAVQSKTAVAISYEELYRAVENLCVHKMGARLYDRLRMECARH  112

Query  579  IAVALQSLV-GQSE---DLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            +A  + +L  G  E   D  +FL+ V+  WQD C+ +LTIR I LY+DR++V
Sbjct  113  VAAVVGTLASGGVEGFMDPALFLAKVDDVWQDHCEHMLTIRNIFLYMDRSFV  164



>dbj|BAB28222.2| unnamed protein product [Mus musculus]
Length=915

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+  +LY+++ + CE H
Sbjct  210  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISANLYKQLRQICEDH  269

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct  270  IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV  317



>ref|XP_010730305.1| PREDICTED: cullin-4B [Larimichthys crocea]
Length=893

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  162  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISAKLYKQLRAVCEDH  221

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      + D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  222  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  269



>ref|XP_006632966.1| PREDICTED: cullin-4B-like [Lepisosteus oculatus]
Length=860

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+   TW  LK A+ AI        +LE+LYQAV +LC HK+  +LY+++   CE H
Sbjct  155  LPENYTNETWQKLKGAVEAIQNSTSIKYNLEELYQAVENLCSHKISANLYKQLRVVCEDH  214

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      + D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  215  IKAQIHQFREDALDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  262



>ref|XP_005083198.1| PREDICTED: cullin-4B [Mesocricetus auratus]
Length=797

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  267  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  326

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  ++KCWQ+ C Q++ IR I L+LDRTYV
Sbjct  327  IKAQIHQFREDSLDSVLFLKKIDKCWQNHCRQMIMIRSIFLFLDRTYV  374



>ref|XP_009506519.1| PREDICTED: cullin-4B, partial [Phalacrocorax carbo]
Length=719

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  14   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  73

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  74   IKAQIHQFREDSLDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  121



>ref|XP_006003900.1| PREDICTED: cullin-4B [Latimeria chalumnae]
Length=845

 Score =   103 bits (257),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  140  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISSNLYKQLRQVCEDH  199

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      + D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  200  IKAQIHQFREDTLDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  247



>ref|XP_009534475.1| hypothetical protein PHYSODRAFT_361833 [Phytophthora sojae]
 gb|EGZ09614.1| hypothetical protein PHYSODRAFT_361833 [Phytophthora sojae]
Length=766

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 69/109 (63%), Gaps = 1/109 (1%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP  FEE+TWA L++A+ A+  KQ      E+LY++V D+C  KM   LY ++E+ C  H
Sbjct  49   LPEAFEEDTWAKLQAAVQAVHAKQTSALSREELYRSVEDMCTWKMAARLYTKLEETCAVH  108

Query  579  IAVALQSLVGQSE-DLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            +   ++ L+  S  D+ +FL  V K W+D C+ +L IR I LYLDRTYV
Sbjct  109  VRGRVEDLLQYSAGDMNLFLEAVHKLWEDHCEDMLVIRTIFLYLDRTYV  157



>ref|XP_006076682.1| PREDICTED: cullin-4A [Bubalus bubalis]
Length=723

 Score =   103 bits (256),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 47/108 (44%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ ++TW  L  A+ AI        +LE+LYQAV +LC HK+  +LYQ++ + CE H
Sbjct  18   LPDNYTQDTWQKLHEAVRAIQSSTSIRYNLEELYQAVENLCSHKVSPTLYQQLRQACEGH  77

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            +   +      S D V+FL  +  CWQD C Q++ IR I L+LDRTYV
Sbjct  78   VQAQILQFREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYV  125



>ref|XP_001510185.3| PREDICTED: cullin-4B [Ornithorhynchus anatinus]
Length=779

 Score =   103 bits (256),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 47/108 (44%), Positives = 67/108 (62%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  74   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  133

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  ++ CWQD C Q++ IR I L+LDRTYV
Sbjct  134  IKAQIHQFREDSLDSVLFLKKIDTCWQDHCRQMIMIRSIFLFLDRTYV  181



>ref|XP_011974798.1| PREDICTED: cullin-4A isoform X2 [Ovis aries musimon]
Length=761

 Score =   103 bits (256),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 47/108 (44%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ ++TW  L  A+ AI        +LE+LYQAV +LC HK+  +LYQ++ + CE H
Sbjct  56   LPDNYTQDTWQKLHEAVKAIQSSTSIRYNLEELYQAVENLCSHKVSPTLYQQLRQACEGH  115

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            +   +      S D V+FL  +  CWQD C Q++ IR I L+LDRTYV
Sbjct  116  VQAQILQFREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYV  163



>ref|XP_005998125.1| PREDICTED: cullin-4A [Latimeria chalumnae]
Length=753

 Score =   103 bits (256),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 46/108 (43%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ ++TW  L  A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  48   LPDNYTQDTWQKLNEAVRAIQASTSIKYNLEELYQAVENLCSYKVSPTLYKQLRQVCEDH  107

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            +   +      S D V+FL+ + KCWQD C Q++ IR I L+LDRTYV
Sbjct  108  VKAQIHQFREDSLDSVLFLTKINKCWQDHCRQMIMIRSIFLFLDRTYV  155



>ref|XP_001638137.1| predicted protein [Nematostella vectensis]
 gb|EDO46074.1| predicted protein [Nematostella vectensis]
Length=256

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 8/116 (7%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N++E TW  LK A+ AI  K      LE+LY+AV ++C HKM  +LY +++ ECE H
Sbjct  14   LPDNYKEATWLKLKEAVCAIHHKTSIQYSLEELYKAVENMCSHKMAATLYSQLKAECEQH  73

Query  579  IAVALQSLVG--------QSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            +   L    G         S D V++L  +++CW+  C Q++ IR I LYLDRTYV
Sbjct  74   VKSNLVQFTGYPFQFLGHHSMDSVLYLGKLKQCWEGHCRQMIMIRSIFLYLDRTYV  129



>pdb|4A0L|E Chain E, Structure Of Ddb1-Ddb2-Cul4b-Rbx1 Bound To A 12 Bp Abasic 
Site Containing Dna-Duplex
 pdb|4A0L|H Chain H, Structure Of Ddb1-Ddb2-Cul4b-Rbx1 Bound To A 12 Bp Abasic 
Site Containing Dna-Duplex
Length=726

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 46/108 (43%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  21   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  80

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct  81   IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV  128



>ref|XP_007254497.1| PREDICTED: cullin-4B-like [Astyanax mexicanus]
Length=863

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 65/108 (60%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+   TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  158  LPENYTHETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISPKLYKQLRAVCEDH  217

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  218  IKAQIDQFREDSLDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  265



>pdb|4A0C|C Chain C, Structure Of The Cand1-Cul4b-Rbx1 Complex
 pdb|4A0C|E Chain E, Structure Of The Cand1-Cul4b-Rbx1 Complex
Length=741

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 46/108 (43%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  36   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  95

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct  96   IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV  143



>ref|XP_007891612.1| PREDICTED: cullin-4B [Callorhinchus milii]
Length=847

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 67/108 (62%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+   TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  142  LPDNYTNETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKVSANLYKQLRQVCEDH  201

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  202  IKAQIHQFREDSLDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  249



>ref|NP_001120891.1| cullin 4B [Xenopus (Silurana) tropicalis]
 gb|AAI66184.1| cul4b protein [Xenopus (Silurana) tropicalis]
Length=847

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  142  LPENYTDETWQKLKGAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  201

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      + D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  202  IKAQIHQFREDALDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  249



>pdb|4A64|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human 
Cul4b At 2.57a Resolution
 pdb|4A64|B Chain B, Crystal Structure Of The N-Terminal Domain Of Human 
Cul4b At 2.57a Resolution
 pdb|4A64|C Chain C, Crystal Structure Of The N-Terminal Domain Of Human 
Cul4b At 2.57a Resolution
 pdb|4A64|D Chain D, Crystal Structure Of The N-Terminal Domain Of Human 
Cul4b At 2.57a Resolution
Length=354

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  5    LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  64

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct  65   IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV  112



>ref|NP_001116316.1| cullin-4B [Danio rerio]
Length=864

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 65/108 (60%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+   TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  159  LPENYTNETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISAKLYKQLRVVCEDH  218

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      + D V+FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  219  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  266



>ref|XP_006877534.1| PREDICTED: cullin-4B isoform X1 [Chrysochloris asiatica]
Length=898

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  193  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEEH  252

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  ++KCWQ+ C Q++ IR I L+LDRTYV
Sbjct  253  IKAQIHQFREDSLDSVLFLKKIDKCWQNHCRQMIMIRSIFLFLDRTYV  300



>ref|XP_008988097.1| PREDICTED: cullin-4B isoform X5 [Callithrix jacchus]
Length=738

 Score =   102 bits (254),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 46/108 (43%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  12   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  71

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct  72   IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV  119



>ref|XP_864628.3| PREDICTED: cullin-4B isoform 3 [Canis lupus familiaris]
Length=912

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  207  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  266

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  ++KCWQ+ C Q++ IR I L+LDRTYV
Sbjct  267  IKAQIHQFREDSLDSVLFLKKIDKCWQNHCRQMIMIRSIFLFLDRTYV  314



>ref|XP_008154341.1| PREDICTED: cullin-4B isoform X1 [Eptesicus fuscus]
Length=914

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  209  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  268

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  ++KCWQ+ C Q++ IR I L+LDRTYV
Sbjct  269  IKAQIHQFREDSLDSVLFLKKIDKCWQNHCRQMIMIRSIFLFLDRTYV  316



>ref|XP_004713105.1| PREDICTED: cullin-4B isoform X2 [Echinops telfairi]
Length=891

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 93/156 (60%), Gaps = 5/156 (3%)
 Frame = +3

Query  255  PSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWAT  434
            PS AS+   +    S+T A++   S+     P  AKKLVIK  K KP LP N+ + TW  
Sbjct  143  PSVASVHHTNGLAKSSTTASSFANSK-----PGSAKKLVIKNFKDKPKLPENYTDETWQK  197

Query  435  LKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQS  614
            LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S
Sbjct  198  LKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEEHIKAQIHQFREDS  257

Query  615  EDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
             D V+FL  ++KCWQ+ C Q++ IR I L+LDRTYV
Sbjct  258  LDSVLFLKKIDKCWQNHCRQMIMIRSIFLFLDRTYV  293



>gb|EGW01006.1| Cullin-4B, partial [Cricetulus griseus]
Length=834

 Score =   102 bits (255),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  129  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  188

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  ++KCWQ+ C Q++ IR I L+LDRTYV
Sbjct  189  IRAQIHQFREDSLDSVLFLKKIDKCWQNHCRQMIMIRSIFLFLDRTYV  236



>ref|XP_004713104.1| PREDICTED: cullin-4B isoform X1 [Echinops telfairi]
Length=893

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 93/156 (60%), Gaps = 5/156 (3%)
 Frame = +3

Query  255  PSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWAT  434
            PS AS+   +    S+T A++   S+     P  AKKLVIK  K KP LP N+ + TW  
Sbjct  143  PSVASVHHTNGLAKSSTTASSFANSK-----PGSAKKLVIKNFKDKPKLPENYTDETWQK  197

Query  435  LKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQS  614
            LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S
Sbjct  198  LKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEEHIKAQIHQFREDS  257

Query  615  EDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
             D V+FL  ++KCWQ+ C Q++ IR I L+LDRTYV
Sbjct  258  LDSVLFLKKIDKCWQNHCRQMIMIRSIFLFLDRTYV  293



>gb|KFW86599.1| Cullin-4B [Manacus vitellinus]
Length=887

 Score =   102 bits (255),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 61/140 (44%), Positives = 87/140 (62%), Gaps = 0/140 (0%)
 Frame = +3

Query  303  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  482
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  483  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  662
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +         +V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREYPFLVVLFLKKIDKCWQD  269

Query  663  FCDQILTIRGIALYLDRTYV  722
             C Q++ IR I L+LDRTYV
Sbjct  270  HCRQMIMIRSIFLFLDRTYV  289



>ref|XP_004478393.1| PREDICTED: cullin-4B [Dasypus novemcinctus]
Length=831

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  192  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  251

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  ++KCWQ+ C Q++ IR I L+LDRTYV
Sbjct  252  IKAQIHQFREDSLDSVLFLKKIDKCWQNHCRQMIMIRSIFLFLDRTYV  299



>ref|XP_010592963.1| PREDICTED: cullin-4B isoform X3 [Loxodonta africana]
Length=810

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  196  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  255

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  ++KCWQ+ C Q++ IR I L+LDRTYV
Sbjct  256  IKAQIHQFREGSLDSVLFLKKIDKCWQNHCRQMIMIRSIFLFLDRTYV  303



>ref|XP_010829841.1| PREDICTED: cullin-4A, partial [Bison bison bison]
Length=727

 Score =   102 bits (254),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 47/108 (44%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ ++TW  L  A+ AI        +LE+LYQAV +LC HK+  +LYQ++ + CE H
Sbjct  33   LPDNYTQDTWQKLHEAVRAIQSSTSIRYNLEELYQAVENLCSHKVSPTLYQQLRQACEGH  92

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            +   +      S D V+FL  +  CWQD C Q++ IR I L+LDRTYV
Sbjct  93   VQAQILQFREDSLDSVLFLKKMNTCWQDHCRQMIMIRSIFLFLDRTYV  140



>ref|XP_006981625.1| PREDICTED: cullin-4B isoform X1 [Peromyscus maniculatus bairdii]
Length=901

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  194  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  253

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  ++KCWQ+ C Q++ IR I L+LDRTYV
Sbjct  254  IKAQIHQFREDSLDSVLFLKKIDKCWQNHCRQMIMIRSIFLFLDRTYV  301



>ref|XP_006981626.1| PREDICTED: cullin-4B isoform X2 [Peromyscus maniculatus bairdii]
Length=894

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  189  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  248

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  ++KCWQ+ C Q++ IR I L+LDRTYV
Sbjct  249  IKAQIHQFREDSLDSVLFLKKIDKCWQNHCRQMIMIRSIFLFLDRTYV  296



>ref|XP_008832150.1| PREDICTED: cullin-4B [Nannospalax galili]
Length=894

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  189  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  248

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  ++KCWQ+ C Q++ IR I L+LDRTYV
Sbjct  249  IKAQIHQFREDSLDSVLFLKKIDKCWQNHCRQMIMIRSIFLFLDRTYV  296



>ref|XP_005673908.1| PREDICTED: cullin-4B-like [Sus scrofa]
Length=666

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  227  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  286

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct  287  IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV  334



>ref|XP_004379637.1| PREDICTED: cullin-4B isoform 1 [Trichechus manatus latirostris]
Length=896

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  191  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  250

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  ++KCWQ+ C Q++ IR I L+LDRTYV
Sbjct  251  IKAQIHQFREDSLDSVLFLKKIDKCWQNHCRQMIMIRSIFLFLDRTYV  298



>ref|XP_003800032.1| PREDICTED: cullin-4A [Otolemur garnettii]
Length=759

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ ++TW  L+ A+ A+       C+LE+LYQAV +LC HK+  +LY+++ + CE H
Sbjct  54   LPDNYTQDTWQKLREAVRAVQSSTSVRCNLEELYQAVENLCSHKVSPTLYKQLRQVCEDH  113

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            +   +      S D V+FL  +  CWQD C Q++ IR I L+LDRTYV
Sbjct  114  VQAQILQFREDSLDSVLFLKKMNACWQDHCRQMIMIRSIFLFLDRTYV  161



>ref|XP_007951543.1| PREDICTED: cullin-4B [Orycteropus afer afer]
Length=909

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  207  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEEH  266

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  ++KCWQ+ C Q++ IR I L+LDRTYV
Sbjct  267  IKAQIHQFREDSLDSVLFLKKIDKCWQNHCRQMIMIRSIFLFLDRTYV  314



>tpg|DAA23688.1| TPA: cullin 4A [Bos taurus]
Length=723

 Score =   102 bits (253),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 47/108 (44%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ ++TW  L  A+ AI        +LE+LYQAV +LC HK+  +LYQ++ + CE H
Sbjct  18   LPDNYTQDTWQKLHEAVRAIQSSTSIRYNLEELYQAVENLCSHKVSPTLYQQLRQACEGH  77

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            +   +      S D V+FL  +  CWQD C Q++ IR I L+LDRTYV
Sbjct  78   VQAQILQFREDSLDSVLFLKKMNTCWQDHCRQMIMIRSIFLFLDRTYV  125



>ref|XP_003774810.1| PREDICTED: cullin-4B [Sarcophilus harrisii]
Length=902

 Score =   102 bits (254),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  197  LPENYTDETWQKLKDAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEEH  256

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  ++KCWQ+ C Q++ IR I L+LDRTYV
Sbjct  257  IKSQIHQFREDSLDSVLFLKKIDKCWQNHCRQMIMIRSIFLFLDRTYV  304



>ref|XP_010894682.1| PREDICTED: cullin-4B isoform X3 [Esox lucius]
Length=855

 Score =   102 bits (254),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 47/108 (44%), Positives = 64/108 (59%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+   TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  150  LPENYTHETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISAKLYKQLRVVCEDH  209

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      + D  +FL  ++KCWQD C Q++ IR I L+LDRTYV
Sbjct  210  IKAQINQFREDALDSTLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYV  257



>ref|XP_006191373.1| PREDICTED: cullin-4B-like isoform X2 [Camelus ferus]
 ref|XP_009437856.1| PREDICTED: cullin-4B isoform X2 [Pan troglodytes]
Length=780

 Score =   102 bits (253),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 46/108 (43%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  75   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  134

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct  135  IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV  182



>dbj|BAA31670.2| KIAA0695 protein [Homo sapiens]
Length=781

 Score =   102 bits (253),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 46/108 (43%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  399  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  578
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  76   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  135

Query  579  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV  722
            I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct  136  IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV  183



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1337034311616