BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10512

Length=632
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009613463.1|  PREDICTED: glycogen phosphorylase 1-like           150   1e-37   Nicotiana tomentosiformis
ref|XP_009757122.1|  PREDICTED: glycogen phosphorylase 1-like           148   6e-37   Nicotiana sylvestris
ref|XP_010316777.1|  PREDICTED: glycogen phosphorylase 1-like           137   4e-33   Solanum lycopersicum
ref|XP_006364302.1|  PREDICTED: glycogen phosphorylase 1-like iso...    135   1e-32   Solanum tuberosum [potatoes]
gb|KGN64704.1|  hypothetical protein Csa_1G075580                       135   1e-32   Cucumis sativus [cucumbers]
ref|XP_011653331.1|  PREDICTED: LOW QUALITY PROTEIN: glycogen pho...    135   1e-32   Cucumis sativus [cucumbers]
ref|XP_006364301.1|  PREDICTED: glycogen phosphorylase 1-like iso...    135   2e-32   Solanum tuberosum [potatoes]
ref|XP_008442836.1|  PREDICTED: glycogen phosphorylase 1-like           134   4e-32   Cucumis melo [Oriental melon]
gb|ABN08701.1|  Amino acid-binding ACT                                  129   6e-32   Medicago truncatula
gb|EYU28011.1|  hypothetical protein MIMGU_mgv1a000698mg                133   1e-31   Erythranthe guttata [common monkey flower]
ref|XP_010245593.1|  PREDICTED: glycogen phosphorylase 1-like           131   1e-31   Nelumbo nucifera [Indian lotus]
ref|XP_008811916.1|  PREDICTED: glycogen phosphorylase 1-like           132   2e-31   
ref|XP_010919435.1|  PREDICTED: glycogen phosphorylase 1-like iso...    131   2e-31   
ref|XP_010919434.1|  PREDICTED: glycogen phosphorylase 1-like iso...    131   4e-31   
gb|AES63892.2|  glycogen/starch/alpha-glucan phosphorylase family...    129   2e-30   Medicago truncatula
ref|XP_003593641.1|  Phosphorylase                                      129   2e-30   
ref|XP_004485832.1|  PREDICTED: glycogen phosphorylase 1-like           129   2e-30   Cicer arietinum [garbanzo]
ref|XP_007148122.1|  hypothetical protein PHAVU_006G182300g             128   5e-30   Phaseolus vulgaris [French bean]
ref|XP_010655454.1|  PREDICTED: glycogen phosphorylase 1-like           124   1e-28   Vitis vinifera
ref|XP_006594572.1|  PREDICTED: glycogen phosphorylase 1-like iso...    123   2e-28   Glycine max [soybeans]
ref|XP_006594571.1|  PREDICTED: glycogen phosphorylase 1-like iso...    124   2e-28   Glycine max [soybeans]
ref|XP_004295557.1|  PREDICTED: glycogen phosphorylase 1-like           122   4e-28   Fragaria vesca subsp. vesca
ref|XP_010111178.1|  Glycogen phosphorylase 1                           120   1e-27   
ref|XP_009352966.1|  PREDICTED: glycogen phosphorylase 1-like           119   8e-27   Pyrus x bretschneideri [bai li]
ref|XP_007214555.1|  hypothetical protein PRUPE_ppa000587mg             117   2e-26   
ref|XP_008383688.1|  PREDICTED: glycogen phosphorylase 1-like           116   5e-26   
ref|XP_008225148.1|  PREDICTED: glycogen phosphorylase 1-like           115   1e-25   Prunus mume [ume]
ref|XP_002509431.1|  glycogen phosphorylase, putative                   112   2e-24   
gb|ERN06577.1|  hypothetical protein AMTR_s00058p00140100               108   2e-23   Amborella trichopoda
gb|KJB57492.1|  hypothetical protein B456_009G166800                    107   7e-23   Gossypium raimondii
ref|XP_006384047.1|  hypothetical protein POPTR_0004s04830g             106   1e-22   
ref|XP_012091666.1|  PREDICTED: glycogen phosphorylase 1-like           104   9e-22   Jatropha curcas
ref|XP_011027777.1|  PREDICTED: glycogen phosphorylase 1-like iso...    102   3e-21   Populus euphratica
ref|XP_006844902.2|  PREDICTED: glycogen phosphorylase 1              97.4    2e-19   
ref|WP_013010143.1|  UTP-GlnB uridylyltransferase, GlnD               58.5    9e-07   Denitrovibrio acetiphilus
ref|WP_022846664.1|  uridylyltransferase                              56.6    4e-06   
ref|XP_010066810.1|  PREDICTED: uncharacterized protein LOC104453...  56.2    4e-06   Eucalyptus grandis [rose gum]
ref|WP_029711506.1|  hypothetical protein                             56.6    4e-06   
ref|XP_010066809.1|  PREDICTED: uncharacterized protein LOC104453...  56.2    4e-06   Eucalyptus grandis [rose gum]
ref|WP_028262554.1|  hypothetical protein                             52.4    7e-06   
ref|WP_020053922.1|  hypothetical protein                             55.5    9e-06   
emb|CCQ75691.1|  [Protein-PII] uridylyltransferase                    54.3    2e-05   Magnetospira sp. QH-2
ref|WP_046023540.1|  protein-PII uridylyltransferase                  54.3    2e-05   Magnetospira sp. QH-2
ref|XP_010682711.1|  PREDICTED: uncharacterized protein LOC104897524  53.9    3e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010062190.1|  PREDICTED: uncharacterized protein LOC104449657  53.9    3e-05   Eucalyptus grandis [rose gum]
ref|XP_010554273.1|  PREDICTED: uncharacterized protein LOC104824...  53.9    3e-05   Tarenaya hassleriana [spider flower]
ref|XP_010554272.1|  PREDICTED: uncharacterized protein LOC104824...  53.9    3e-05   Tarenaya hassleriana [spider flower]
ref|XP_008459880.1|  PREDICTED: uncharacterized protein LOC103498...  53.5    3e-05   Cucumis melo [Oriental melon]
ref|XP_008459879.1|  PREDICTED: uncharacterized protein LOC103498...  53.5    4e-05   Cucumis melo [Oriental melon]
ref|WP_002729156.1|  PII uridylyl-transferase                         53.5    5e-05   Phaeospirillum molischianum
emb|CDP11981.1|  unnamed protein product                              53.1    5e-05   Coffea canephora [robusta coffee]
ref|XP_010541607.1|  PREDICTED: uncharacterized protein LOC104815...  53.1    5e-05   
ref|WP_021133435.1|  PII uridylyl-transferase                         53.1    6e-05   Phaeospirillum fulvum
ref|XP_002956558.1|  hypothetical protein VOLCADRAFT_97579            53.1    6e-05   Volvox carteri f. nagariensis
ref|XP_008804075.1|  PREDICTED: uncharacterized protein LOC103717456  52.8    6e-05   Phoenix dactylifera
ref|XP_010926807.1|  PREDICTED: uncharacterized protein LOC105048981  52.8    6e-05   Elaeis guineensis
ref|XP_011036119.1|  PREDICTED: uncharacterized protein LOC105133725  52.8    7e-05   Populus euphratica
ref|XP_002511139.1|  amino acid binding protein, putative             52.8    7e-05   
ref|XP_002297856.1|  hypothetical protein POPTR_0001s13490g           52.4    8e-05   Populus trichocarpa [western balsam poplar]
ref|XP_002304667.1|  hypothetical protein POPTR_0003s16620g           52.4    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010250220.1|  PREDICTED: uncharacterized protein LOC104592...  52.4    1e-04   Nelumbo nucifera [Indian lotus]
ref|WP_034959585.1|  protein-PII uridylyltransferase                  52.0    1e-04   
ref|XP_010250221.1|  PREDICTED: uncharacterized protein LOC104592...  52.0    1e-04   Nelumbo nucifera [Indian lotus]
ref|XP_001699652.1|  hypothetical protein CHLREDRAFT_186726           52.4    1e-04   Chlamydomonas reinhardtii
ref|XP_006573669.1|  PREDICTED: uncharacterized protein LOC100781...  52.0    1e-04   Glycine max [soybeans]
ref|WP_011386820.1|  PII uridylyl-transferase                         52.0    1e-04   Magnetospirillum magneticum
gb|KHN36315.1|  [Protein-PII] uridylyltransferase                     52.0    1e-04   Glycine soja [wild soybean]
ref|WP_038290155.1|  protein-PII uridylyltransferase                  52.0    1e-04   
ref|XP_010090668.1|  [Protein-PII] uridylyltransferase                51.6    1e-04   Morus notabilis
ref|XP_003539257.1|  PREDICTED: uncharacterized protein LOC100811109  51.6    2e-04   Glycine max [soybeans]
ref|WP_028032202.1|  protein-PII uridylyltransferase                  52.0    2e-04   Chelativorans sp. J32
ref|NP_001169709.1|  hypothetical protein                             51.6    2e-04   Zea mays [maize]
gb|KEH40482.1|  four ACT domain ACT domain protein which protein      51.6    2e-04   Medicago truncatula
gb|AGT16037.1|  hypothetical protein SHCRBa_044_D02_F_100             51.6    2e-04   Saccharum hybrid cultivar R570
ref|XP_002876893.1|  hypothetical protein ARALYDRAFT_904656           51.6    2e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_002321721.2|  hypothetical protein POPTR_0015s11240g           51.2    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_007038043.1|  ACT domain repeat 6 isoform 1                    51.6    2e-04   
gb|ADE76039.1|  unknown                                               51.2    2e-04   Picea sitchensis
ref|XP_009785185.1|  PREDICTED: uncharacterized protein LOC104233484  51.2    2e-04   Nicotiana sylvestris
ref|XP_007139290.1|  hypothetical protein PHAVU_008G016800g           51.2    2e-04   Phaseolus vulgaris [French bean]
ref|XP_009792706.1|  PREDICTED: uncharacterized protein LOC104239695  51.2    2e-04   Nicotiana sylvestris
dbj|GAN80842.1|  PII uridylyl-transferase                             51.6    2e-04   Acidocella aminolytica 101 = DSM 11237
ref|XP_006856315.2|  PREDICTED: ACT domain-containing protein ACR...  51.2    2e-04   Amborella trichopoda
ref|XP_010241627.1|  PREDICTED: uncharacterized protein LOC104586168  51.2    2e-04   Nelumbo nucifera [Indian lotus]
ref|WP_020384186.1|  hypothetical protein                             51.2    2e-04   
ref|XP_011627805.1|  PREDICTED: ACT domain-containing protein ACR...  51.2    2e-04   Amborella trichopoda
ref|XP_009613029.1|  PREDICTED: uncharacterized protein LOC104106236  50.8    3e-04   Nicotiana tomentosiformis
ref|WP_029910224.1|  protein-PII uridylyltransferase                  51.2    3e-04   Caulobacter sp. UNC358MFTsu5.1
emb|CDY15069.1|  BnaC03g44300D                                        50.4    3e-04   Brassica napus [oilseed rape]
gb|AAG51584.1|AC011665_5  unknown protein, 3' partial                 48.1    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007038044.1|  ACT domain repeat 6 isoform 2                    50.8    3e-04   
ref|XP_006367527.1|  PREDICTED: uncharacterized protein LOC102594553  50.8    3e-04   Solanum tuberosum [potatoes]
ref|XP_002445807.1|  hypothetical protein SORBIDRAFT_07g026100        50.8    3e-04   Sorghum bicolor [broomcorn]
ref|WP_020698786.1|  hypothetical protein                             51.2    3e-04   Reyranella massiliensis
ref|WP_019460765.1|  MULTISPECIES: PII uridylyl-transferase           51.2    3e-04   Roseomonas
ref|XP_002949341.1|  hypothetical protein VOLCADRAFT_89705            51.2    3e-04   Volvox carteri f. nagariensis
ref|XP_011000958.1|  PREDICTED: uncharacterized protein LOC105108...  50.8    3e-04   Populus euphratica
ref|WP_037226391.1|  protein-PII uridylyltransferase                  50.8    3e-04   Roseomonas gilardii
ref|WP_033310377.1|  hypothetical protein                             50.8    3e-04   
gb|KCW80355.1|  hypothetical protein EUGRSUZ_C01720                   50.8    3e-04   Eucalyptus grandis [rose gum]
ref|XP_008378393.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  50.8    3e-04   
ref|XP_008339767.1|  PREDICTED: uncharacterized protein LOC103402787  50.8    3e-04   
ref|WP_022852282.1|  hypothetical protein                             50.8    3e-04   Geovibrio sp. L21-Ace-BES
ref|XP_010048170.1|  PREDICTED: uncharacterized protein LOC104437016  50.8    3e-04   Eucalyptus grandis [rose gum]
ref|WP_007443480.1|  protein-P-II uridylyltransferase                 48.9    3e-04   
ref|XP_004228427.1|  PREDICTED: uncharacterized protein LOC101262744  50.4    3e-04   Solanum lycopersicum
ref|WP_035943321.1|  hypothetical protein                             50.8    4e-04   
ref|WP_045662741.1|  protein-PII uridylyltransferase                  50.8    4e-04   
gb|ABB88567.1|  PhoB                                                  50.8    4e-04   Chlamydomonas reinhardtii
ref|XP_001694015.1|  starch phosphorylase                             50.8    4e-04   Chlamydomonas reinhardtii
ref|XP_004144160.2|  PREDICTED: ACT domain-containing protein ACR4    50.4    4e-04   Cucumis sativus [cucumbers]
gb|KJS40813.1|  protein-PII uridylyltransferase                       50.8    4e-04   Rhodospirillaceae bacterium BRH_c57
ref|WP_030510868.1|  protein-PII uridylyltransferase                  50.8    4e-04   Microbispora rosea
ref|XP_011020811.1|  PREDICTED: uncharacterized protein LOC105123048  50.4    4e-04   Populus euphratica
ref|XP_009411127.1|  PREDICTED: uncharacterized protein LOC103992926  50.4    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008347951.1|  PREDICTED: uncharacterized protein LOC103411072  50.1    5e-04   
gb|KJB34122.1|  hypothetical protein B456_006G048900                  47.4    5e-04   Gossypium raimondii
gb|AII87677.1|  uridylyltransferase GlnD                              50.4    5e-04   Planktomarina temperata RCA23
ref|WP_008618768.1|  PII uridylyl-transferase                         50.4    5e-04   Magnetospirillum caucaseum
ref|XP_009360670.1|  PREDICTED: uncharacterized protein LOC103951...  50.1    5e-04   Pyrus x bretschneideri [bai li]
ref|WP_044050355.1|  protein-PII uridylyltransferase                  50.4    5e-04   
sp|Q8RQD1.1|GLND_AZOBR  RecName: Full=Bifunctional uridylyltransf...  50.4    5e-04   Azospirillum brasilense
ref|XP_004974011.1|  PREDICTED: uncharacterized protein LOC101766285  50.1    5e-04   Setaria italica
ref|XP_006356716.1|  PREDICTED: uncharacterized protein LOC102587087  50.1    5e-04   Solanum tuberosum [potatoes]
ref|XP_008808483.1|  PREDICTED: uncharacterized protein LOC103720...  50.1    5e-04   Phoenix dactylifera
ref|WP_035670558.1|  protein-PII uridylyltransferase                  50.4    5e-04   Azospirillum brasilense
ref|XP_004297204.1|  PREDICTED: ACT domain-containing protein ACR4    50.1    5e-04   Fragaria vesca subsp. vesca
gb|KHG02132.1|  [Protein-PII] uridylyltransferase                     50.1    5e-04   Gossypium arboreum [tree cotton]
ref|WP_040618441.1|  protein-PII uridylyltransferase                  50.1    6e-04   
ref|WP_028878078.1|  protein-PII uridylyltransferase                  50.1    6e-04   Terasakiella pusilla
ref|XP_010681133.1|  PREDICTED: uncharacterized protein LOC104896128  50.1    6e-04   Beta vulgaris subsp. vulgaris [field beet]
gb|EAP75445.1|  protein-P-II uridylyltransferase                      50.1    6e-04   Roseovarius nubinhibens ISM
ref|WP_035255768.1|  hypothetical protein                             50.1    6e-04   
ref|XP_009404247.1|  PREDICTED: uncharacterized protein LOC103987...  50.1    6e-04   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY65806.1|  BnaA02g35780D                                        50.1    6e-04   Brassica napus [oilseed rape]
ref|XP_009127699.1|  PREDICTED: uncharacterized protein LOC103852547  50.1    6e-04   Brassica rapa
ref|XP_006395679.1|  hypothetical protein EUTSA_v10004191mg           50.1    6e-04   Eutrema salsugineum [saltwater cress]
ref|WP_038530088.1|  protein-PII uridylyltransferase                  50.1    6e-04   Azospirillum brasilense
gb|ACN34303.1|  unknown                                               50.1    6e-04   Zea mays [maize]
ref|WP_029010873.1|  protein-PII uridylyltransferase                  50.1    6e-04   
emb|CDP20649.1|  unnamed protein product                              49.7    6e-04   Coffea canephora [robusta coffee]
gb|ACG60681.1|  unknown protein                                       49.7    6e-04   Brassica oleracea var. alboglabra [Chinese broccoli]
emb|CCC96679.1|  [protein-PII] uridylyltransferase                    50.1    6e-04   Azospirillum brasilense Sp245
ref|XP_004140541.1|  PREDICTED: ACT domain-containing protein ACR...  49.7    6e-04   Cucumis sativus [cucumbers]
ref|XP_009416935.1|  PREDICTED: uncharacterized protein LOC103997445  49.7    6e-04   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX81587.1|  BnaC02g18910D                                        49.7    6e-04   
ref|WP_041810843.1|  protein-PII uridylyltransferase                  50.1    7e-04   Azospirillum brasilense
ref|WP_043365398.1|  protein-PII uridylyltransferase                  50.1    7e-04   
ref|XP_006391062.1|  hypothetical protein EUTSA_v10018526mg           49.7    7e-04   Eutrema salsugineum [saltwater cress]
ref|WP_035248799.1|  protein-PII uridylyltransferase                  50.1    7e-04   Actibacterium atlanticum
dbj|BAJ33767.1|  unnamed protein product                              49.7    7e-04   Eutrema halophilum
ref|XP_006437860.1|  hypothetical protein CICLE_v10031536mg           49.7    7e-04   
ref|WP_010140017.1|  PII uridylyl-transferase                         50.1    7e-04   Oceanicola sp. S124
ref|XP_006484247.1|  PREDICTED: uncharacterized protein LOC102622082  49.7    7e-04   Citrus sinensis [apfelsine]
ref|WP_043336940.1|  protein-PII uridylyltransferase                  49.7    7e-04   
ref|XP_003574833.1|  PREDICTED: uncharacterized protein LOC100821029  49.7    7e-04   Brachypodium distachyon [annual false brome]
gb|ETK33939.1|  PII uridylyl-transferase                              49.7    7e-04   Microbispora sp. ATCC PTA-5024
ref|WP_021999856.1|  uridylyltransferase                              49.7    7e-04   
ref|WP_036328931.1|  protein-PII uridylyltransferase                  49.7    7e-04   Microbispora sp. ATCC PTA-5024
ref|XP_002514875.1|  amino acid binding protein, putative             49.7    8e-04   Ricinus communis
ref|XP_004242056.1|  PREDICTED: uncharacterized protein LOC101244...  49.7    8e-04   
ref|XP_011023953.1|  PREDICTED: uncharacterized protein LOC105125277  49.7    8e-04   Populus euphratica
ref|WP_042464165.1|  protein-PII uridylyltransferase                  49.7    8e-04   Rhodovulum sulfidophilum
ref|XP_010502395.1|  PREDICTED: uncharacterized protein LOC104779692  49.7    8e-04   Camelina sativa [gold-of-pleasure]
emb|CDY26682.1|  BnaA06g13400D                                        48.9    8e-04   Brassica napus [oilseed rape]
ref|XP_010936169.1|  PREDICTED: uncharacterized protein LOC105055...  49.7    8e-04   
gb|KDO70279.1|  hypothetical protein CISIN_1g013090mg                 49.7    8e-04   Citrus sinensis [apfelsine]
ref|WP_020546577.1|  PII uridylyl-transferase                         49.7    8e-04   Nonomuraea coxensis
ref|XP_002280377.1|  PREDICTED: uncharacterized protein LOC100256112  49.7    8e-04   Vitis vinifera
ref|XP_002302203.1|  hypothetical protein POPTR_0002s07550g           49.7    8e-04   Populus trichocarpa [western balsam poplar]
ref|NP_565304.1|  ACT domain-containing protein 5                     49.7    8e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006367493.1|  PREDICTED: uncharacterized protein LOC102581...  49.7    8e-04   Solanum tuberosum [potatoes]
emb|CDX88170.1|  BnaA06g27610D                                        49.7    8e-04   
emb|CAN80840.1|  hypothetical protein VITISV_043834                   49.3    8e-04   Vitis vinifera
gb|KJB50528.1|  hypothetical protein B456_008G175500                  49.7    8e-04   Gossypium raimondii
emb|CDX95965.1|  BnaA07g27660D                                        49.3    9e-04   
gb|AAM93430.1|  ACR5                                                  49.3    9e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010936170.1|  PREDICTED: uncharacterized protein LOC105055...  49.3    9e-04   
ref|XP_006291103.1|  hypothetical protein CARUB_v10017215mg           49.3    9e-04   Capsella rubella
ref|XP_009105454.1|  PREDICTED: uncharacterized protein LOC103831...  49.3    0.001   Brassica rapa
ref|WP_029734360.1|  hypothetical protein                             49.7    0.001   
ref|XP_006367494.1|  PREDICTED: uncharacterized protein LOC102581...  49.3    0.001   Solanum tuberosum [potatoes]
ref|XP_009105455.1|  PREDICTED: uncharacterized protein LOC103831...  49.3    0.001   Brassica rapa
ref|XP_011027407.1|  PREDICTED: uncharacterized protein LOC105127...  49.3    0.001   Populus euphratica
ref|XP_004498368.1|  PREDICTED: uncharacterized protein LOC101494...  49.3    0.001   
ref|XP_004490255.1|  PREDICTED: uncharacterized protein LOC101508...  49.3    0.001   Cicer arietinum [garbanzo]
ref|XP_010550296.1|  PREDICTED: uncharacterized protein LOC104821193  48.1    0.001   Tarenaya hassleriana [spider flower]
ref|XP_004490254.1|  PREDICTED: uncharacterized protein LOC101508...  49.3    0.001   Cicer arietinum [garbanzo]
ref|XP_004490253.1|  PREDICTED: uncharacterized protein LOC101508...  49.3    0.001   Cicer arietinum [garbanzo]
ref|WP_012853747.1|  PII uridylyl-transferase                         49.3    0.001   Thermomonospora curvata
ref|WP_007426993.1|  PII uridylyl-transferase                         49.7    0.001   Oceaniovalibus guishaninsula
ref|WP_040494645.1|  hypothetical protein                             49.3    0.001   
ref|XP_004490252.1|  PREDICTED: uncharacterized protein LOC101508...  49.3    0.001   
ref|XP_010470880.1|  PREDICTED: uncharacterized protein LOC104750738  49.3    0.001   Camelina sativa [gold-of-pleasure]



>ref|XP_009613463.1| PREDICTED: glycogen phosphorylase 1-like [Nicotiana tomentosiformis]
Length=1001

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 117/191 (61%), Gaps = 7/191 (4%)
 Frame = +2

Query  62   TVGSPHAKLHHPSAVTLGRPLSASFTLFPPPTTSVALKASRLRASDGGGQVATEPESS--  235
            T  SP      PS   L RPLS S +     +       + L +S    Q  TE  +S  
Sbjct  10   TFRSPQTNRPFPSFFNLNRPLSTSLS-----SNGSFNHLTVLNSSTSSNQAITETTTSDY  64

Query  236  AAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVT  415
            + I  QND ALDTT+  IRA+NRIGLLQ++TRVF VLGL I +A+VEFEGEF+VK+FFV+
Sbjct  65   STINVQNDDALDTTLFVIRAKNRIGLLQIITRVFKVLGLTIQKAIVEFEGEFFVKKFFVS  124

Query  416  DSHGGKIENDEELDRIRKALMHavdggddgaaapavaasgrgvavrkagLGLQSGKAERM  595
            DS+G KIE  E L++I+ ALM A+D G    +   V+  G  V      LG +  KAE+M
Sbjct  125  DSNGKKIEKAEHLEKIQTALMEAIDTGGVTPSVAVVSGRGVVVRKAGLKLGERKAKAEKM  184

Query  596  FGLMDGFLKND  628
            FGLMDGFLKND
Sbjct  185  FGLMDGFLKND  195



>ref|XP_009757122.1| PREDICTED: glycogen phosphorylase 1-like [Nicotiana sylvestris]
Length=1001

 Score =   148 bits (373),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 94/194 (48%), Positives = 117/194 (60%), Gaps = 13/194 (7%)
 Frame = +2

Query  62   TVGSPHAKLHHPSAVTLGRPLSASFTL---FPPPTTSVALKASRLRASDGGGQVATEPES  232
            T+ SP      PS   L RP S S +    F   T S         +S    Q  TE  +
Sbjct  10   TLRSPQTNRPFPSFFNLNRPFSTSLSSNCSFNHLTVS--------NSSTFSNQAITETTT  61

Query  233  S--AAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRF  406
            S  + I  QND ALDTT+  IRA+NRIGLLQ++TRVF VLGL I +A+VEFEGEF+VK+F
Sbjct  62   SDYSTINVQNDDALDTTLFVIRAKNRIGLLQIITRVFKVLGLTIQKAIVEFEGEFFVKKF  121

Query  407  FVTDSHGGKIENDEELDRIRKALMHavdggddgaaapavaasgrgvavrkagLGLQSGKA  586
            FV+DS+G KIE  E L++I+KALM A+D G    +   V+  G  V      LG +  KA
Sbjct  122  FVSDSNGKKIEKTEHLEKIQKALMEAIDTGGVSPSVAVVSGRGVVVRKAGLNLGERKAKA  181

Query  587  ERMFGLMDGFLKND  628
            E+MFGLMD FLKND
Sbjct  182  EKMFGLMDVFLKND  195



>ref|XP_010316777.1| PREDICTED: glycogen phosphorylase 1-like [Solanum lycopersicum]
Length=1007

 Score =   137 bits (344),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 90/197 (46%), Positives = 117/197 (59%), Gaps = 15/197 (8%)
 Frame = +2

Query  65   VGSPHAKLHHPSAVTLGRPLSASFTLFPPPTTSVALKASRLRASDGGGQVATEPESSAAI  244
            V SP A L  PS   L RP S S  LF    T V + ++   ++    QV TE   +++ 
Sbjct  11   VRSPQANLQFPSIFNLNRPFSTS--LFSNAFTHVKVSSTTSSSN----QVVTETTCTSSS  64

Query  245  A--FQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTD  418
                QND ALDTT+  IRA+NRIGLLQ++TRVF VLGLKI++A++EFEGEF+VK+F+V D
Sbjct  65   TISVQNDDALDTTLFVIRAKNRIGLLQIITRVFKVLGLKIEKAIIEFEGEFFVKKFYVND  124

Query  419  SHGGKIENDEELDRIRKALMHa-------vdggddgaaapavaasgrgvavrkagLGLQS  577
            S+G KIE  E L++I+KAL+ A              A A +           K  LG + 
Sbjct  125  SNGKKIEKVEYLEKIQKALLEAIDGDDGGAGVTAPSAVAVSGRGVVVRKPGLKMELGDRK  184

Query  578  GKAERMFGLMDGFLKND  628
             K E+MFGLMD FLKND
Sbjct  185  AKVEKMFGLMDEFLKND  201



>ref|XP_006364302.1| PREDICTED: glycogen phosphorylase 1-like isoform X2 [Solanum 
tuberosum]
Length=845

 Score =   135 bits (340),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 89/193 (46%), Positives = 113/193 (59%), Gaps = 9/193 (5%)
 Frame = +2

Query  65   VGSPHAKLHHPSAVTLGRPLSASFTLFPPPTTSVALKASRLRASDGGGQVATEPESSAAI  244
            V SP   L  PS   L RP S S +          LK S   +S       T   SS+ I
Sbjct  11   VRSPPTNLPFPSIFNLNRPFSTSLS----SNAFSHLKVSSSTSSSNQAVTETTSTSSSTI  66

Query  245  AFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSH  424
              QND ALDTT+  IRA+NRIGLLQ++TRVF VLGLKI++A++EFEGEF+VK+F+V DS+
Sbjct  67   NVQNDDALDTTLFVIRAKNRIGLLQIITRVFKVLGLKIEKAIIEFEGEFFVKKFYVNDSN  126

Query  425  GGKIENDEELDRIRKALMHavd-----ggddgaaapavaasgrgvavrkagLGLQSGKAE  589
            G KIE  E L++I+KAL+ A+D      G    +A +              LG +  K E
Sbjct  127  GKKIEKMEYLEKIQKALLEAIDGDDGGAGVSAPSAVSGRGVVVRKPGLNMELGGRKAKVE  186

Query  590  RMFGLMDGFLKND  628
            +MFGLMD FLKND
Sbjct  187  KMFGLMDEFLKND  199



>gb|KGN64704.1| hypothetical protein Csa_1G075580 [Cucumis sativus]
Length=998

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 108/178 (61%), Gaps = 5/178 (3%)
 Frame = +2

Query  113  GRPLSASFTLFPPPTTSVALKASR----LRASDGGGQVATEPESSAAIAFQNDGALDTTV  280
             +P  +S T+F PP +  A   S      +AS+G    +    +   I+  N    D+T 
Sbjct  16   SKPSISSPTIFIPPFSVRARNLSSRFVFCQASNGTNPTSETVFAVPTISVDNSEEDDSTA  75

Query  281  VEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELDR  460
              IRARNRIGLLQV+TRVF VLGL ID+A VEFEGE++ K FFV+DSHG KIEN E +DR
Sbjct  76   FVIRARNRIGLLQVITRVFKVLGLSIDKATVEFEGEYFTKTFFVSDSHGNKIENLESIDR  135

Query  461  IRKALMHavd-ggddgaaapavaasgrgvavrkagLGLQSGKAERMFGLMDGFLKNDP  631
            I+KALM A+D      +A PA            +  G ++ KAERMF LMDGFLKNDP
Sbjct  136  IKKALMEAIDGDDLTISARPATRGIVVRKPGLLSTSGERTAKAERMFELMDGFLKNDP  193



>ref|XP_011653331.1| PREDICTED: LOW QUALITY PROTEIN: glycogen phosphorylase 1-like 
[Cucumis sativus]
Length=1053

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 108/178 (61%), Gaps = 5/178 (3%)
 Frame = +2

Query  113  GRPLSASFTLFPPPTTSVALKASR----LRASDGGGQVATEPESSAAIAFQNDGALDTTV  280
             +P  +S T+F PP +  A   S      +AS+G    +    +   I+  N    D+T 
Sbjct  16   SKPSISSPTIFIPPFSVRARNLSSRFVFCQASNGTNPTSETVFAVPTISVDNSEEDDSTA  75

Query  281  VEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELDR  460
              IRARNRIGLLQV+TRVF VLGL ID+A VEFEGE++ K FFV+DSHG KIEN E +DR
Sbjct  76   FVIRARNRIGLLQVITRVFKVLGLSIDKATVEFEGEYFTKTFFVSDSHGNKIENLESIDR  135

Query  461  IRKALMHavd-ggddgaaapavaasgrgvavrkagLGLQSGKAERMFGLMDGFLKNDP  631
            I+KALM A+D      +A PA            +  G ++ KAERMF LMDGFLKNDP
Sbjct  136  IKKALMEAIDGDDLTISARPATRGIVVRKPGLLSTSGERTAKAERMFELMDGFLKNDP  193



>ref|XP_006364301.1| PREDICTED: glycogen phosphorylase 1-like isoform X1 [Solanum 
tuberosum]
Length=1005

 Score =   135 bits (340),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 89/193 (46%), Positives = 113/193 (59%), Gaps = 9/193 (5%)
 Frame = +2

Query  65   VGSPHAKLHHPSAVTLGRPLSASFTLFPPPTTSVALKASRLRASDGGGQVATEPESSAAI  244
            V SP   L  PS   L RP S S +          LK S   +S       T   SS+ I
Sbjct  11   VRSPPTNLPFPSIFNLNRPFSTSLS----SNAFSHLKVSSSTSSSNQAVTETTSTSSSTI  66

Query  245  AFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSH  424
              QND ALDTT+  IRA+NRIGLLQ++TRVF VLGLKI++A++EFEGEF+VK+F+V DS+
Sbjct  67   NVQNDDALDTTLFVIRAKNRIGLLQIITRVFKVLGLKIEKAIIEFEGEFFVKKFYVNDSN  126

Query  425  GGKIENDEELDRIRKALMHavd-----ggddgaaapavaasgrgvavrkagLGLQSGKAE  589
            G KIE  E L++I+KAL+ A+D      G    +A +              LG +  K E
Sbjct  127  GKKIEKMEYLEKIQKALLEAIDGDDGGAGVSAPSAVSGRGVVVRKPGLNMELGGRKAKVE  186

Query  590  RMFGLMDGFLKND  628
            +MFGLMD FLKND
Sbjct  187  KMFGLMDEFLKND  199



>ref|XP_008442836.1| PREDICTED: glycogen phosphorylase 1-like [Cucumis melo]
Length=998

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 110/173 (64%), Gaps = 5/173 (3%)
 Frame = +2

Query  128  ASFTLFPPPTTSVALK-ASRL---RASDGGGQVATEPESSAAIAFQNDGALDTTVVEIRA  295
            +S T+F PP +  A   +SR    +AS+G    +    +   I+  N    ++T   IRA
Sbjct  21   SSRTIFIPPFSVRAKNLSSRFVFRQASNGTNPTSETVFAVPTISVDNSEEDESTAFVIRA  80

Query  296  RNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELDRIRKAL  475
            RNRIGLLQV+TRVF VLGL+ID+A VEFEGE++ K+FFV+DSHG KIEN E +DRI+KAL
Sbjct  81   RNRIGLLQVITRVFKVLGLRIDKATVEFEGEYFTKKFFVSDSHGNKIENLESIDRIKKAL  140

Query  476  MHavd-ggddgaaapavaasgrgvavrkagLGLQSGKAERMFGLMDGFLKNDP  631
            M A+D      +A PA            +  G ++ KAERMF LMDGFLKNDP
Sbjct  141  MEAIDGDDLTISARPATRGIVVRKPGLLSTSGERTAKAERMFELMDGFLKNDP  193



>gb|ABN08701.1| Amino acid-binding ACT [Medicago truncatula]
Length=328

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 123/188 (65%), Gaps = 19/188 (10%)
 Frame = +2

Query  107  TLGRPLSASFTLFPPPTTS---------VALKASRLRASDGGGQVATEPESSAAIAFQND  259
            T+  PL  +   FP P TS          AL  +RLR S      A+ P +S+ I  +N 
Sbjct  3    TISFPLLTNTLSFPNPLTSFPPFSIHFPTALPNNRLRVS------ASSPSTSSTITVENS  56

Query  260  GALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIE  439
             + ++T   IRARN+IGLLQ++TRVF +LGL ID+A VEFEG+++ K+FFVTDSHG KIE
Sbjct  57   TSDNSTAFLIRARNKIGLLQIITRVFKILGLTIDKATVEFEGDYFTKKFFVTDSHGNKIE  116

Query  440  NDEELDRIRKALMHavdggddgaaapavaasgrgvavrkagL----GLQSGKAERMFGLM  607
            +DE L+RI++AL  A+ G  DG    +V+ + RG+ VR+AGL    G +  KAERMF LM
Sbjct  117  DDENLERIKRALTEAIGGNGDGGGKVSVSTANRGIVVRRAGLVEGFGERKAKAERMFSLM  176

Query  608  DGFLKNDP  631
            DGFLKNDP
Sbjct  177  DGFLKNDP  184



>gb|EYU28011.1| hypothetical protein MIMGU_mgv1a000698mg [Erythranthe guttata]
Length=1014

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 117/188 (62%), Gaps = 12/188 (6%)
 Frame = +2

Query  86   LHHPSAVTLGRPLSASFTLFPPPTTSVALKASRLRASDGGGQVATEPE-SSAAIAFQNDG  262
            LH P A +L    +     F P   S+   ++  +AS   G V    E SSAA+ F ND 
Sbjct  29   LHLPFATSLNLQTNR----FNPGLRSLNFFSNPPQASTANGNVDISAEGSSAAVTFLNDD  84

Query  263  ALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIEN  442
            A D TV  I+ARNR+GLLQV+TRVF VLGL I+RA +EFE +F++K+F+VT+S G +IEN
Sbjct  85   AADATVFIIQARNRLGLLQVITRVFKVLGLTIERATIEFEADFFIKKFYVTNSEGKRIEN  144

Query  443  DEELDRIRKALMHavdggddgaaapavaasgrgvavrkagLGLQS-----GKAERMFGLM  607
             E L+RI+ AL+              V A GRGV V+K GLGL+S     GKAERMF LM
Sbjct  145  PENLERIQHALIE--AIDGGDDTRGQVQAGGRGVVVKKLGLGLESSGQSRGKAERMFRLM  202

Query  608  DGFLKNDP  631
            D FLKNDP
Sbjct  203  DEFLKNDP  210



>ref|XP_010245593.1| PREDICTED: glycogen phosphorylase 1-like [Nelumbo nucifera]
Length=644

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 106/152 (70%), Gaps = 9/152 (6%)
 Frame = +2

Query  185  LRASDGGGQVATEPESSAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDR  364
            LRAS    +  TE   +++I+  N+ + D+T  +I+ARNRIGLLQV+TRVF VLGLKI++
Sbjct  53   LRAS---SETITE---TSSISVDNNESDDSTAFQIKARNRIGLLQVITRVFKVLGLKIEK  106

Query  365  AVVEFEGEFYVKRFFVTDSHGGKIENDEELDRIRKALMHavdggddgaaapavaasgrgv  544
            A+VEFEGEF+VK+FFVTDSHG KI +   LD+I+ ALM A+D GD   +  +   S   V
Sbjct  107  AIVEFEGEFFVKKFFVTDSHGRKIVDHGSLDKIKNALMEAIDDGDGVFSVSSSVPSRGIV  166

Query  545  avrkagL---GLQSGKAERMFGLMDGFLKNDP  631
              R   L   G +  KAERMFGLMDGFLKNDP
Sbjct  167  VRRAGLLMESGERRAKAERMFGLMDGFLKNDP  198



>ref|XP_008811916.1| PREDICTED: glycogen phosphorylase 1-like [Phoenix dactylifera]
Length=997

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 109/182 (60%), Gaps = 13/182 (7%)
 Frame = +2

Query  125  SASFTLFPPPTTSVALKASRLRA----SDGGGQVATEPESSAA---IAFQNDGALDTTVV  283
            +A  +L+ PPT   ++   +LR     +  G +   EP +SA    I   N  + D T  
Sbjct  30   AALLSLYKPPTALFSVPKPQLRLLPRRALSGHEDTAEPSASATAATITVDNAQSPDATAF  89

Query  284  EIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELDRI  463
             IRARNRIGLLQV+TRVF VLGL+I+RA VE EGEF+VKRF V DSHG KIE+ E LDRI
Sbjct  90   LIRARNRIGLLQVITRVFRVLGLRIERATVEVEGEFFVKRFLVVDSHGAKIEDPESLDRI  149

Query  464  RKALMHavdggddgaaapavaasgrgvavrkagLGL--QSG----KAERMFGLMDGFLKN  625
             +AL  A+DG  D   A    A      +     GL  +SG    KAERMF LMDGFLKN
Sbjct  150  ERALRDAIDGAADRTPAGPGTARLGSRGLVVRRAGLVPESGAGKAKAERMFSLMDGFLKN  209

Query  626  DP  631
            DP
Sbjct  210  DP  211



>ref|XP_010919435.1| PREDICTED: glycogen phosphorylase 1-like isoform X2 [Elaeis guineensis]
Length=854

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 105/176 (60%), Gaps = 11/176 (6%)
 Frame = +2

Query  137  TLFPPPTTSVALKASRLR-----ASDGGGQVATEPESSAAIAFQNDGALDTTVVEIRARN  301
             L+ PPT   +    +LR     A  G  + A    S+A IA  N  + D T   IRARN
Sbjct  34   CLYKPPTAFFSAPKPQLRLLPRRALSGRDETAEASVSTATIAVDNAESPDATAFVIRARN  93

Query  302  RIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELDRIRKALMH  481
             IGLLQV+TRVF +LGL+I+RA +E EGEF+VKRF V DSHG KIE+ E LDRI +AL  
Sbjct  94   WIGLLQVITRVFKILGLRIERATIEVEGEFFVKRFLVVDSHGAKIEDPESLDRIERALRD  153

Query  482  avdggddgaaapavaasgrgvavrkagLGL--QSG----KAERMFGLMDGFLKNDP  631
            A+DG  D   A    A     ++     GL  +SG    KAERMF LMDGFLKNDP
Sbjct  154  AIDGAADRTPAGPGTARLGSRSLVVRRAGLVPESGEGKAKAERMFSLMDGFLKNDP  209



>ref|XP_010919434.1| PREDICTED: glycogen phosphorylase 1-like isoform X1 [Elaeis guineensis]
Length=1014

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 105/176 (60%), Gaps = 11/176 (6%)
 Frame = +2

Query  137  TLFPPPTTSVALKASRLR-----ASDGGGQVATEPESSAAIAFQNDGALDTTVVEIRARN  301
             L+ PPT   +    +LR     A  G  + A    S+A IA  N  + D T   IRARN
Sbjct  34   CLYKPPTAFFSAPKPQLRLLPRRALSGRDETAEASVSTATIAVDNAESPDATAFVIRARN  93

Query  302  RIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELDRIRKALMH  481
             IGLLQV+TRVF +LGL+I+RA +E EGEF+VKRF V DSHG KIE+ E LDRI +AL  
Sbjct  94   WIGLLQVITRVFKILGLRIERATIEVEGEFFVKRFLVVDSHGAKIEDPESLDRIERALRD  153

Query  482  avdggddgaaapavaasgrgvavrkagLGL--QSG----KAERMFGLMDGFLKNDP  631
            A+DG  D   A    A     ++     GL  +SG    KAERMF LMDGFLKNDP
Sbjct  154  AIDGAADRTPAGPGTARLGSRSLVVRRAGLVPESGEGKAKAERMFSLMDGFLKNDP  209



>gb|AES63892.2| glycogen/starch/alpha-glucan phosphorylase family protein [Medicago 
truncatula]
Length=989

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 123/188 (65%), Gaps = 19/188 (10%)
 Frame = +2

Query  107  TLGRPLSASFTLFPPPTTS---------VALKASRLRASDGGGQVATEPESSAAIAFQND  259
            T+  PL  +   FP P TS          AL  +RLR S      A+ P +S+ I  +N 
Sbjct  3    TISFPLLTNTLSFPNPLTSFPPFSIHFPTALPNNRLRVS------ASSPSTSSTITVENS  56

Query  260  GALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIE  439
             + ++T   IRARN+IGLLQ++TRVF +LGL ID+A VEFEG+++ K+FFVTDSHG KIE
Sbjct  57   TSDNSTAFLIRARNKIGLLQIITRVFKILGLTIDKATVEFEGDYFTKKFFVTDSHGNKIE  116

Query  440  NDEELDRIRKALMHavdggddgaaapavaasgrgvavrkagL----GLQSGKAERMFGLM  607
            +DE L+RI++AL  A+ G  DG    +V+ + RG+ VR+AGL    G +  KAERMF LM
Sbjct  117  DDENLERIKRALTEAIGGNGDGGGKVSVSTANRGIVVRRAGLVEGFGERKAKAERMFSLM  176

Query  608  DGFLKNDP  631
            DGFLKNDP
Sbjct  177  DGFLKNDP  184



>ref|XP_003593641.1| Phosphorylase [Medicago truncatula]
Length=1055

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 123/188 (65%), Gaps = 19/188 (10%)
 Frame = +2

Query  107  TLGRPLSASFTLFPPPTTS---------VALKASRLRASDGGGQVATEPESSAAIAFQND  259
            T+  PL  +   FP P TS          AL  +RLR S      A+ P +S+ I  +N 
Sbjct  3    TISFPLLTNTLSFPNPLTSFPPFSIHFPTALPNNRLRVS------ASSPSTSSTITVENS  56

Query  260  GALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIE  439
             + ++T   IRARN+IGLLQ++TRVF +LGL ID+A VEFEG+++ K+FFVTDSHG KIE
Sbjct  57   TSDNSTAFLIRARNKIGLLQIITRVFKILGLTIDKATVEFEGDYFTKKFFVTDSHGNKIE  116

Query  440  NDEELDRIRKALMHavdggddgaaapavaasgrgvavrkagL----GLQSGKAERMFGLM  607
            +DE L+RI++AL  A+ G  DG    +V+ + RG+ VR+AGL    G +  KAERMF LM
Sbjct  117  DDENLERIKRALTEAIGGNGDGGGKVSVSTANRGIVVRRAGLVEGFGERKAKAERMFSLM  176

Query  608  DGFLKNDP  631
            DGFLKNDP
Sbjct  177  DGFLKNDP  184



>ref|XP_004485832.1| PREDICTED: glycogen phosphorylase 1-like [Cicer arietinum]
Length=1001

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 126/198 (64%), Gaps = 12/198 (6%)
 Frame = +2

Query  62   TVGSPHAKLHH--PSAVTLGRPLSASFTLFPPPTTS--VALKASRLRASDGGGQVATEPE  229
            T+  PH    H  P+ +T   P S+    F P +     A +  RLRAS      +T   
Sbjct  3    TISFPHLTNAHTFPNLLTSFPPFSSP-AHFSPISVHFPTAPRNYRLRAS---TNESTPST  58

Query  230  SSAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFF  409
            S++ I   N  + ++T   IRARNRIGLLQV+TRVF VLGL IDRA+VEFEG+F++KRFF
Sbjct  59   STSTITVDNSDSANSTAFVIRARNRIGLLQVITRVFKVLGLSIDRAIVEFEGDFFIKRFF  118

Query  410  VTDSHGGKIENDEELDRIRKALMHavdggddgaaapavaasgrgvavrkagL----GLQS  577
            VTDSHG KIE+ E L+RI++AL  A+ G  DG  +   + + RG+ VR+AGL    G + 
Sbjct  119  VTDSHGNKIEDLENLERIKRALAEAIGGDGDGTVSVVKSTANRGIVVRRAGLVEGFGERK  178

Query  578  GKAERMFGLMDGFLKNDP  631
             KAERMF LMDGFLKNDP
Sbjct  179  AKAERMFSLMDGFLKNDP  196



>ref|XP_007148122.1| hypothetical protein PHAVU_006G182300g [Phaseolus vulgaris]
 gb|ESW20116.1| hypothetical protein PHAVU_006G182300g [Phaseolus vulgaris]
Length=998

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 89/139 (64%), Gaps = 5/139 (4%)
 Frame = +2

Query  230  SSAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFF  409
            SS+ +A  N  A D+T   IRARNRIGLLQV+TRVF VLGL +DRA VEFEG+F+VK+FF
Sbjct  55   SSSPVAVDNSDAGDSTAFVIRARNRIGLLQVITRVFKVLGLTVDRATVEFEGDFFVKKFF  114

Query  410  VTDSHGGKIENDEELDRIRKALMHav-----dggddgaaapavaasgrgvavrkagLGLQ  574
            VTDSHG KIE+ + L+RI++AL  AV             A               G G +
Sbjct  115  VTDSHGNKIEDSDSLERIKRALAEAVGGDGDGTVLVARPAAGNPGVVVRRPGLVEGDGER  174

Query  575  SGKAERMFGLMDGFLKNDP  631
              KAERMF LMDGFLKNDP
Sbjct  175  RAKAERMFSLMDGFLKNDP  193



>ref|XP_010655454.1| PREDICTED: glycogen phosphorylase 1-like [Vitis vinifera]
Length=1000

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 116/197 (59%), Gaps = 11/197 (6%)
 Frame = +2

Query  62   TVGSPHAKLHH-------PSAVTLGRPLSASFTLFPPPTTSVALKASRLRASDGGGQVAT  220
            T+ SP    HH       P ++ L RP      L P P  S     S +     G   A 
Sbjct  3    TISSPLLVFHHRPSDFSSPQSLNLHRPFPVQ--LKPLPRHSFICN-SWVGPKPAGPSTAD  59

Query  221  EPESSAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVK  400
               ++  +      + D+T   IRARN+IGLLQV+TRVF VLGL ID+A VEFEG+F+ +
Sbjct  60   VNSATPTVTVDAAVSTDSTSFVIRARNKIGLLQVITRVFKVLGLHIDKATVEFEGDFFTQ  119

Query  401  RFFVTDSHGGKIENDEELDRIRKALMHavdggddgaaapavaasgrgvavrkagLGLQSG  580
            +FFVTDSHG KIE+ E LDRI KAL+ A+DGG       +V  S RG+ VR+AGLG +  
Sbjct  120  KFFVTDSHGRKIEDQENLDRITKALLEAIDGGGGWGTETSVGPSTRGIVVRRAGLGPKP-  178

Query  581  KAERMFGLMDGFLKNDP  631
            +AERMF LMD FL NDP
Sbjct  179  QAERMFALMDRFLSNDP  195



>ref|XP_006594572.1| PREDICTED: glycogen phosphorylase 1-like isoform X2 [Glycine 
max]
Length=841

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 85/136 (63%), Gaps = 7/136 (5%)
 Frame = +2

Query  245  AFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSH  424
            A  N  + D+T   IRARN+IGLLQV+TRVF VLGL +DRA VEFEG+F+VK FFVTDSH
Sbjct  62   AVDNSDSADSTAFVIRARNQIGLLQVITRVFKVLGLTVDRATVEFEGDFFVKTFFVTDSH  121

Query  425  GGKIENDEELDRIRKALMHavd-------ggddgaaapavaasgrgvavrkagLGLQSGK  583
            G KIE+ + L RI++AL  A+        G      + A              +G +  K
Sbjct  122  GNKIEDSDSLQRIKRALAEAIAGEDDGGNGTISVTRSAANRGIVVRRPGLAEAIGERRAK  181

Query  584  AERMFGLMDGFLKNDP  631
            AERMF LMDGFLKNDP
Sbjct  182  AERMFSLMDGFLKNDP  197



>ref|XP_006594571.1| PREDICTED: glycogen phosphorylase 1-like isoform X1 [Glycine 
max]
Length=1002

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 85/136 (63%), Gaps = 7/136 (5%)
 Frame = +2

Query  245  AFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSH  424
            A  N  + D+T   IRARN+IGLLQV+TRVF VLGL +DRA VEFEG+F+VK FFVTDSH
Sbjct  62   AVDNSDSADSTAFVIRARNQIGLLQVITRVFKVLGLTVDRATVEFEGDFFVKTFFVTDSH  121

Query  425  GGKIENDEELDRIRKALMHavd-------ggddgaaapavaasgrgvavrkagLGLQSGK  583
            G KIE+ + L RI++AL  A+        G      + A              +G +  K
Sbjct  122  GNKIEDSDSLQRIKRALAEAIAGEDDGGNGTISVTRSAANRGIVVRRPGLAEAIGERRAK  181

Query  584  AERMFGLMDGFLKNDP  631
            AERMF LMDGFLKNDP
Sbjct  182  AERMFSLMDGFLKNDP  197



>ref|XP_004295557.1| PREDICTED: glycogen phosphorylase 1-like [Fragaria vesca subsp. 
vesca]
Length=1009

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 92/128 (72%), Gaps = 6/128 (5%)
 Frame = +2

Query  260  GALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIE  439
            G    T+  IRARNRIGLL ++TRVF VLGL++++A VEFEG+F+VKRFFVTDS G +IE
Sbjct  76   GGAPATLFVIRARNRIGLLGIITRVFNVLGLRVEKATVEFEGDFFVKRFFVTDSRGARIE  135

Query  440  NDEELDRIRKALMHavdggddgaaapavaasgrgvavrkagLGLQSG----KAERMFGLM  607
            + + LDRI+KAL+      D      A   + RGV VR+ GLGL SG    KAERMFGLM
Sbjct  136  DRDSLDRIQKALLD--AIDDCAGTVSAGPTTTRGVVVRRPGLGLGSGDRAAKAERMFGLM  193

Query  608  DGFLKNDP  631
            DGFLKNDP
Sbjct  194  DGFLKNDP  201



>ref|XP_010111178.1| Glycogen phosphorylase 1 [Morus notabilis]
 gb|EXC30569.1| Glycogen phosphorylase 1 [Morus notabilis]
Length=892

 Score =   120 bits (302),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 70/132 (53%), Positives = 85/132 (64%), Gaps = 12/132 (9%)
 Frame = +2

Query  254  NDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGK  433
            N  + ++T+  IRAR RIGLLQVV RVFGVLGL+IDRA VEFEG+F+VK+FFVTDS G K
Sbjct  19   NSDSDESTLFVIRARTRIGLLQVVARVFGVLGLRIDRASVEFEGDFFVKKFFVTDSRGKK  78

Query  434  IENDEELDRIRKALMHavdggddgaaapavaasgrgvavrkagLGLQSG------KAERM  595
            I++ E L+RIR AL+              V+       V    LGL +G      KAERM
Sbjct  79   IDDAESLERIRSALIE------AIDGDGDVSVGPATRGVVVRRLGLGTGSEERRAKAERM  132

Query  596  FGLMDGFLKNDP  631
            F +MD FLKNDP
Sbjct  133  FEMMDRFLKNDP  144



>ref|XP_009352966.1| PREDICTED: glycogen phosphorylase 1-like [Pyrus x bretschneideri]
Length=1030

 Score =   119 bits (297),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 105/181 (58%), Gaps = 16/181 (9%)
 Frame = +2

Query  110  LGRPLSASFTLFPPPTTSVA--LKASRLRASDGGGQVATE-PESSAAIAFQNDGALDTTV  280
            + +P+ AS    P   T VA  + AS  +       V  E PES +  +         TV
Sbjct  51   VAKPIHASAASVPYTRTRVAKPIHASAAQPPSATSSVTVEIPESESDPS--------ATV  102

Query  281  VEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELDR  460
              IRARNRIGLLQV+TRVF VLGL +D+A VEFEGE++VKRFFVTDS G KI + E L+R
Sbjct  103  FVIRARNRIGLLQVITRVFKVLGLHVDKATVEFEGEYFVKRFFVTDSRGAKISDPESLER  162

Query  461  IRKALMHavdg-gddgaaapavaasgrgvavrkagLGLQSG----KAERMFGLMDGFLKN  625
            I+ AL  A++  G       +    G  V    +GLGL  G    KAERMF LMDGFLKN
Sbjct  163  IKNALAEAIEDGGSVSVGPTSPTTRGVVVRRPGSGLGLTFGSDGAKAERMFALMDGFLKN  222

Query  626  D  628
            D
Sbjct  223  D  223



>ref|XP_007214555.1| hypothetical protein PRUPE_ppa000587mg [Prunus persica]
 gb|EMJ15754.1| hypothetical protein PRUPE_ppa000587mg [Prunus persica]
Length=1086

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 102/178 (57%), Gaps = 28/178 (16%)
 Frame = +2

Query  110  LGRPLSASFTLFPPPTTSVALKASRLRASDGGGQVATEPESSAAIAFQNDGALDTTVVEI  289
            + +P+ AS +  P   +SV ++ S             E ES  +           T+  I
Sbjct  125  VAKPIRASASQLPSAASSVTVENS-------------ESESDPS----------CTLFVI  161

Query  290  RARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELDRIRK  469
            RARNRIGLLQV+T VF VLGL +++A VEFEG+F+VKRFFVTDSHG KI + + LDRI+K
Sbjct  162  RARNRIGLLQVITGVFKVLGLHVEKATVEFEGDFFVKRFFVTDSHGAKIADPDSLDRIKK  221

Query  470  ALMHavdggddgaaapavaasgrgvav-----rkagLGLQSGKAERMFGLMDGFLKND  628
            AL  A++ G   +  PA   +   +           LG  S KAERMF LMDGFLKND
Sbjct  222  ALTDAIEDGGTVSMGPASPTTRGVMVRRPGSGLGMSLGSDSAKAERMFRLMDGFLKND  279



>ref|XP_008383688.1| PREDICTED: glycogen phosphorylase 1-like [Malus domestica]
Length=1012

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 106/182 (58%), Gaps = 19/182 (10%)
 Frame = +2

Query  107  TLGRPLSASFTLFPPPTTSVA--LKASRLRASDGGGQVATE-PESSAAIAFQNDGALDTT  277
            T  RP  +S    P   T VA  ++AS  +       V  E PES +  +         T
Sbjct  35   TCSRPRRSSV---PYTRTRVAKPIRASAAQPPSATSSVTVEIPESESDPS--------AT  83

Query  278  VVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELD  457
            V  IRARNRIGLLQV+TRVF VLGL +D+A VEFEGE++VKRFFVTDS G KI + E L+
Sbjct  84   VFVIRARNRIGLLQVITRVFKVLGLHVDKATVEFEGEYFVKRFFVTDSRGAKISDPENLE  143

Query  458  RIRKALMHavdggddgaaa-pavaasgrgvavrkagLGLQSG----KAERMFGLMDGFLK  622
            RI+ AL  A++ G   +    +    G  V    +GLGL  G    KAERMF LMDGFLK
Sbjct  144  RIKNALAEAIEDGGSISVGPTSPTTRGVVVRRPGSGLGLTFGSDGAKAERMFALMDGFLK  203

Query  623  ND  628
            ND
Sbjct  204  ND  205



>ref|XP_008225148.1| PREDICTED: glycogen phosphorylase 1-like [Prunus mume]
Length=1012

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 99/178 (56%), Gaps = 28/178 (16%)
 Frame = +2

Query  110  LGRPLSASFTLFPPPTTSVALKASRLRASDGGGQVATEPESSAAIAFQNDGALDTTVVEI  289
            + +P+ AS +  P   +SV ++ S   +   G                       T+  I
Sbjct  51   VAKPIRASASQLPSAASSVTVENSESESDPSG-----------------------TLFVI  87

Query  290  RARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELDRIRK  469
            RARNRIGLLQV+T VF VLGL +++A VEFEG+F+VK+FFVTDSHG KI + + LDRI+K
Sbjct  88   RARNRIGLLQVITGVFKVLGLHVEKATVEFEGDFFVKKFFVTDSHGAKIADPKSLDRIKK  147

Query  470  ALMHavdggddgaaapavaasgrgvav-----rkagLGLQSGKAERMFGLMDGFLKND  628
            AL  A++ G   +  P    +   +           LG  S KAERMF LMDGFLKND
Sbjct  148  ALTDAIEDGGTVSMGPTSPTTRGVMVRRPGSGLGMSLGSDSAKAERMFRLMDGFLKND  205



>ref|XP_002509431.1| glycogen phosphorylase, putative [Ricinus communis]
 gb|EEF50818.1| glycogen phosphorylase, putative [Ricinus communis]
Length=949

 Score =   112 bits (279),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 85/193 (44%), Positives = 112/193 (58%), Gaps = 14/193 (7%)
 Frame = +2

Query  77   HAKLHHPSAVTLGRP-----LSASFTLFPP-PTTSVALKASRLRASDGGGQVATEPESSA  238
            H+KL  PS      P      + S+  F    +TS +L AS    +     + T   S  
Sbjct  10   HSKLSFPSIKPFSTPSNNLSTATSYVSFRSFASTSESLIASTTTTAVAVTTIQTANLSDP  69

Query  239  AIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTD  418
                  D   + T   I ARNRIGLLQV+TRVF +LGL+I++A VE EG+ + K F+VTD
Sbjct  70   ------DATANATAFVIHARNRIGLLQVITRVFKLLGLRIEKATVELEGDHFAKTFYVTD  123

Query  419  SHGGKIENDEELDRIRKALMHavdggddgaaapavaasgrgvavrkagLGLQSGKA--ER  592
            SHG +IE+ E LD+I+KAL+ A+DGGD+      V  + RGVAVR+       GKA  +R
Sbjct  124  SHGNRIEDAESLDKIKKALIDAIDGGDEANEVKKVGCTQRGVAVRRRLGSSSEGKAKVDR  183

Query  593  MFGLMDGFLKNDP  631
            MFGLMD FL+NDP
Sbjct  184  MFGLMDRFLENDP  196



>gb|ERN06577.1| hypothetical protein AMTR_s00058p00140100 [Amborella trichopoda]
Length=1001

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 106/187 (57%), Gaps = 18/187 (10%)
 Frame = +2

Query  71   SPHAKLHHPSAVTLGRPLSASFTLFPPPTTSVALKASRLRASDGGGQVATEPES-SAAIA  247
            S + +LHH S  TL +P S S T   P +   +L +  L           E E+  A ++
Sbjct  26   SLYPRLHHISLSTLLKPYSLSRTRNSPTSLYASLSSETL-----------ESETLDATVS  74

Query  248  FQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHG  427
            F N  + D T   ++A  RIGLLQV+TRVF +LGL +++A VEF G F++K+F VT+SHG
Sbjct  75   FDNQTSPDFTTFIVKANIRIGLLQVITRVFKILGLTVEKATVEFHGGFFIKKFSVTNSHG  134

Query  428  GKIENDEELDRIRKALMHavdggddgaaapavaasgrgvavrkagLGLQSGKAERMFGLM  607
             KIE +E L +I KAL+ A++       AP+   S R           Q+ +AE +F LM
Sbjct  135  QKIEEEESLKKISKALLDAMNEKGPVVTAPSRGISTRRAPPS------QARRAEVVFKLM  188

Query  608  DGFLKND  628
            DG+LKND
Sbjct  189  DGYLKND  195



>gb|KJB57492.1| hypothetical protein B456_009G166800 [Gossypium raimondii]
Length=999

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 101/162 (62%), Gaps = 7/162 (4%)
 Frame = +2

Query  146  PPPTTSVALKASRLRASDGGGQVATEPESSAAIAFQNDGALDTTVVEIRARNRIGLLQVV  325
            PP T S A +     A++    V  E      ++ +ND   ++TV  IRARNR GLLQV+
Sbjct  40   PPLTFSAAKRPPATSATNSSSSVTVE-----TVSPENDA--NSTVFVIRARNRTGLLQVI  92

Query  326  TRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELDRIRKALMHavdggddg  505
            TRVF +LGL +++A V+FE +++V  FFVTDS G KI++ + L+ I KAL+ A+DG DD 
Sbjct  93   TRVFNILGLSVEKATVDFEEDYFVMTFFVTDSRGNKIDDQKSLESINKALIDAIDGDDDA  152

Query  506  aaapavaasgrgvavrkagLGLQSGKAERMFGLMDGFLKNDP  631
            A + A    G  V   +   G + G+AERM GLMD FLKNDP
Sbjct  153  ALSVAPPDRGVVVRKPRLDFGERKGQAERMLGLMDVFLKNDP  194



>ref|XP_006384047.1| hypothetical protein POPTR_0004s04830g [Populus trichocarpa]
 gb|ERP61844.1| hypothetical protein POPTR_0004s04830g [Populus trichocarpa]
Length=739

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 121/204 (59%), Gaps = 23/204 (11%)
 Frame = +2

Query  77   HAKLHHPSAVTLGRPLSASFTLFPPPTTSVALK------ASRLRASDGGGQVATEPESSA  238
             +KL  PS      P SA F      + S AL        SR  AS       T   ++A
Sbjct  10   QSKLTFPSTTAAASPSSAFFVSTNKLSFSTALLHVTSHITSRTLASTNQSLSTT---TTA  66

Query  239  AIAFQNDGALD--TTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFE-------GEF  391
             I   N+   D  TT + IRARNRIGLLQV+TRVF +LGL+I++A VEF+       GE 
Sbjct  67   TIEINNNDPSDPHTTAIVIRARNRIGLLQVITRVFKILGLRIEKATVEFDEGGGGGGGEC  126

Query  392  YVKRFFVTDSHGGKIENDEELDRIRKALMHavdggddgaaapavaasgrgvavrkagLGL  571
            ++K F+V+DSHG +IE+D+ L++I+KAL  A+DGG       + +++G+GV VR++G GL
Sbjct  127  FIKTFYVSDSHGNRIEDDQSLEKIKKALFDAIDGGAGEVKVGSSSSTGKGVVVRRSG-GL  185

Query  572  QSGK----AERMFGLMDGFLKNDP  631
            + G+     E MFGLMD FLK+DP
Sbjct  186  RGGETRVGVENMFGLMDRFLKSDP  209



>ref|XP_012091666.1| PREDICTED: glycogen phosphorylase 1-like [Jatropha curcas]
Length=1024

 Score =   104 bits (259),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 89/137 (65%), Gaps = 5/137 (4%)
 Frame = +2

Query  233  SAAIAFQNDGALD----TTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVK  400
            S ++  ++D   D    +T   I ARNRIGLLQV+TRVF VLGL++++A VEF+ ++  K
Sbjct  84   STSVVVESDNHSDPSTGSTAFIIHARNRIGLLQVITRVFKVLGLRVEKATVEFDDDYITK  143

Query  401  RFFVTDSHGGKIENDEELDRIRKALMHavdggddgaaapavaasgrgvavrkagLGLQSG  580
             F+VTDS+G KIE+ E LD+I++ L+ A+DGGD        +     V  R   LG    
Sbjct  144  TFYVTDSNGNKIEDAERLDKIKEQLIDAIDGGDGVGEVKVGSTGRGVVMRRTG-LGEGRA  202

Query  581  KAERMFGLMDGFLKNDP  631
            KAERMFGLMD FLKNDP
Sbjct  203  KAERMFGLMDRFLKNDP  219



>ref|XP_011027777.1| PREDICTED: glycogen phosphorylase 1-like isoform X1 [Populus 
euphratica]
 ref|XP_011027778.1| PREDICTED: glycogen phosphorylase 1-like isoform X2 [Populus 
euphratica]
Length=1015

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 103/146 (71%), Gaps = 13/146 (9%)
 Frame = +2

Query  230  SSAAIAFQNDGALD--TTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFE------G  385
            ++A I   N+   D  TT + IRARNRIGLLQV+TRVF +LGL+I++A VEF+      G
Sbjct  66   TAATIEISNNDPSDPHTTAIVIRARNRIGLLQVITRVFKILGLRIEKATVEFDEGGGGGG  125

Query  386  EFYVKRFFVTDSHGGKIENDEELDRIRKALMHavdggddgaaapavaasgrgvavrkagL  565
            E ++K F+V+DSHG +IE+D+ L++I+KAL  A+DGGD      +  ++G+GV VR++G 
Sbjct  126  ECFIKTFYVSDSHGNRIEDDQSLEKIKKALFDAIDGGDGEVKVGSSNSTGKGVVVRRSG-  184

Query  566  GLQSGK----AERMFGLMDGFLKNDP  631
            GL  G+     ERMFGLMD FLK+DP
Sbjct  185  GLGGGETRVGVERMFGLMDRFLKSDP  210



>ref|XP_006844902.2| PREDICTED: glycogen phosphorylase 1 [Amborella trichopoda]
Length=966

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 83/131 (63%), Gaps = 6/131 (5%)
 Frame = +2

Query  236  AAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVT  415
            A ++F N  + D T   ++A  RIGLLQV+TRVF +LGL +++A VEF G F++K+F VT
Sbjct  36   ATVSFDNQTSPDFTTFIVKANIRIGLLQVITRVFKILGLTVEKATVEFHGGFFIKKFSVT  95

Query  416  DSHGGKIENDEELDRIRKALMHavdggddgaaapavaasgrgvavrkagLGLQSGKAERM  595
            +SHG KIE +E L +I KAL+ A++       AP+   S R           Q+ +AE +
Sbjct  96   NSHGQKIEEEESLKKISKALLDAMNEKGPVVTAPSRGISTRRAPPS------QARRAEVV  149

Query  596  FGLMDGFLKND  628
            F LMDG+LKND
Sbjct  150  FKLMDGYLKND  160



>ref|WP_013010143.1| UTP-GlnB uridylyltransferase, GlnD [Denitrovibrio acetiphilus]
 gb|ADD67612.1| UTP-GlnB uridylyltransferase, GlnD [Denitrovibrio acetiphilus 
DSM 12809]
Length=863

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            I F ND + + T+V+I A++RIGLL  + R F    L ++RA +  + +  V  F++ D 
Sbjct  777  IVFDNDVSTNYTIVDIYAKDRIGLLYDILRSFNKQELNVERAKISTDVDRVVDSFYLVDK  836

Query  422  HGGKIENDEELDRIRKAL  475
            HG KI +   LD IR  L
Sbjct  837  HGKKITDQRVLDNIRGEL  854



>ref|WP_022846664.1| uridylyltransferase [Desulfurobacterium sp. TC5-1]
Length=868

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/85 (31%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = +2

Query  224  PESSAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKR  403
            P+ +  + F N  +   T+VE+   +R+GLL  +TR     G K+ RA++  EG   +  
Sbjct  778  PKPATKVKFDNKTSEKYTIVEVSTWDRLGLLYAITRELVNAGTKLRRAIISTEGNRVIDS  837

Query  404  FFVTDSHGGKIENDEELDRIRKALM  478
            F++TD    KI ++ +L+ IR+ ++
Sbjct  838  FYITDMEHNKITDEGKLNEIRERIL  862



>ref|XP_010066810.1| PREDICTED: uncharacterized protein LOC104453874 isoform X2 [Eucalyptus 
grandis]
Length=442

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   + TV+++ + NR G+L  V +V   L L I +A +  +G +++  F VTD 
Sbjct  23   VVIDNETCKNATVIQVDSANRPGILLEVVQVLTDLNLIITKAYISSDGGWFMDVFNVTDQ  82

Query  422  HGGKIENDEELDRIRKAL  475
             G KI NDE LD I+K L
Sbjct  83   DGNKIMNDEILDYIKKVL  100



>ref|WP_029711506.1| hypothetical protein [BRC1 bacterium SCGC AAA257-C11]
Length=878

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/74 (38%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +2

Query  254  NDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGK  433
            ND +   TV+E+R  +R G+LQ +T     + L I  A +  EG      F+V D+ GGK
Sbjct  794  NDISAKYTVIEVRCTDRRGVLQALTSELSAMNLNIHFARIITEGNRITNVFYVADTGGGK  853

Query  434  IENDEELDRIRKAL  475
            I+ D+ ++R+R+AL
Sbjct  854  IQQDKTIERLREAL  867



>ref|XP_010066809.1| PREDICTED: uncharacterized protein LOC104453874 isoform X1 [Eucalyptus 
grandis]
 gb|KCW64855.1| hypothetical protein EUGRSUZ_G02423 [Eucalyptus grandis]
Length=446

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   + TV+++ + NR G+L  V +V   L L I +A +  +G +++  F VTD 
Sbjct  27   VVIDNETCKNATVIQVDSANRPGILLEVVQVLTDLNLIITKAYISSDGGWFMDVFNVTDQ  86

Query  422  HGGKIENDEELDRIRKAL  475
             G KI NDE LD I+K L
Sbjct  87   DGNKIMNDEILDYIKKVL  104



>ref|WP_028262554.1| hypothetical protein, partial [BRC1 bacterium SCGC AAA252-M09]
Length=88

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            + F N+ + + T++EIR  +R GLL ++TR      L I R++V  E    V  F+VTD 
Sbjct  1    VVFDNNSSRECTIIEIRTADRPGLLYLITRALSDCQLNIQRSIVTTEAYGVVDVFYVTDL  60

Query  422  HGGKIENDEELDRIRKALM  478
               KI +D +  +I + ++
Sbjct  61   DYNKIYDDAQRQKIEQTIL  79



>ref|WP_020053922.1| hypothetical protein [alpha proteobacterium SCGC AAA015-N04]
Length=958

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            + F N+ + D +++EI+ +N  G+L ++T++   LGL+I  A +   G+  V  F++ + 
Sbjct  865  VIFDNNSSDDYSILEIKCKNAPGVLYIITKIIASLGLQIKTANISSYGDRVVDIFYIKNV  924

Query  422  HGGKIENDEELDRIRKAL  475
             G K+++D  +D+++K++
Sbjct  925  FGQKVDDDLTMDKVKKSI  942



>emb|CCQ75691.1| [Protein-PII] uridylyltransferase [Magnetospira sp. QH-2]
Length=938

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N  + D TV+E+  R+R GLL  VT       L+I RA +   GE  V  F+V D 
Sbjct  847  VLMDNKASTDHTVIEVNGRDRTGLLYDVTATLTAQNLQIGRAHISTYGERAVDVFYVKDL  906

Query  422  HGGKIENDEELDRIRKALM  478
             G KI ++  ++RIR+ LM
Sbjct  907  FGLKIWDESRMERIRQELM  925



>ref|WP_046023540.1| protein-PII uridylyltransferase [Magnetospira sp. QH-2]
Length=919

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N  + D TV+E+  R+R GLL  VT       L+I RA +   GE  V  F+V D 
Sbjct  828  VLMDNKASTDHTVIEVNGRDRTGLLYDVTATLTAQNLQIGRAHISTYGERAVDVFYVKDL  887

Query  422  HGGKIENDEELDRIRKALM  478
             G KI ++  ++RIR+ LM
Sbjct  888  FGLKIWDESRMERIRQELM  906



>ref|XP_010682711.1| PREDICTED: uncharacterized protein LOC104897524 [Beta vulgaris 
subsp. vulgaris]
Length=451

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N  + +TT++++ + N+ G L  V +V   + L I RA +  +GE+++  F VTD 
Sbjct  26   VTVDNSSSRNTTLIKVDSANKRGSLLEVVQVLNDMNLIIRRAYISSDGEWFMDVFHVTDQ  85

Query  422  HGGKIENDEELDRIRKAL  475
            HG K+  D+  +RI+++L
Sbjct  86   HGNKLCEDDVAERIQQSL  103



>ref|XP_010062190.1| PREDICTED: uncharacterized protein LOC104449657 [Eucalyptus grandis]
 ref|XP_010062191.1| PREDICTED: uncharacterized protein LOC104449657 [Eucalyptus grandis]
 ref|XP_010062192.1| PREDICTED: uncharacterized protein LOC104449657 [Eucalyptus grandis]
 gb|KCW69260.1| hypothetical protein EUGRSUZ_F02763 [Eucalyptus grandis]
Length=450

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            ++  N    D T+V++ + N+ G+L  V ++   L L I +A +  +G +++  F VTD 
Sbjct  25   VSVDNSSCSDCTLVKVDSMNKPGILLEVVQILSDLDLIITKAYISSDGGWFMDVFHVTDH  84

Query  422  HGGKIENDEELDRIRKAL  475
            HG KI + + +D I KAL
Sbjct  85   HGKKITDSKTIDYIEKAL  102



>ref|XP_010554273.1| PREDICTED: uncharacterized protein LOC104824054 isoform X2 [Tarenaya 
hassleriana]
Length=432

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   D TVV++ + NR G+L  V +V   L L I +A V  +G +++  F VTD 
Sbjct  6    VVIDNEVCKDATVVKVDSVNRPGILLEVVQVLTDLNLSIRKAYVSSDGGWFMDVFNVTDQ  65

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD IRKAL
Sbjct  66   DGNKVTDELVLDYIRKAL  83



>ref|XP_010554272.1| PREDICTED: uncharacterized protein LOC104824054 isoform X1 [Tarenaya 
hassleriana]
Length=453

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   D TVV++ + NR G+L  V +V   L L I +A V  +G +++  F VTD 
Sbjct  27   VVIDNEVCKDATVVKVDSVNRPGILLEVVQVLTDLNLSIRKAYVSSDGGWFMDVFNVTDQ  86

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD IRKAL
Sbjct  87   DGNKVTDELVLDYIRKAL  104



>ref|XP_008459880.1| PREDICTED: uncharacterized protein LOC103498865 isoform X2 [Cucumis 
melo]
Length=451

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND +   T++++ + N+ G L  V +V   L L I RA +  +GE+++  F VTD 
Sbjct  26   VTIDNDSSRKATLIKVDSANKRGSLLEVVQVLNDLNLIIRRAYISSDGEWFMDVFHVTDQ  85

Query  422  HGGKIENDEELDRIRKAL  475
            HG K+  ++  +RI+++L
Sbjct  86   HGNKLSENDVAERIQQSL  103



>ref|XP_008459879.1| PREDICTED: uncharacterized protein LOC103498865 isoform X1 [Cucumis 
melo]
Length=452

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND +   T++++ + N+ G L  V +V   L L I RA +  +GE+++  F VTD 
Sbjct  26   VTIDNDSSRKATLIKVDSANKRGSLLEVVQVLNDLNLIIRRAYISSDGEWFMDVFHVTDQ  85

Query  422  HGGKIENDEELDRIRKAL  475
            HG K+  ++  +RI+++L
Sbjct  86   HGNKLSENDVAERIQQSL  103



>ref|WP_002729156.1| PII uridylyl-transferase [Phaeospirillum molischianum]
 emb|CCG41773.1| (Protein-PII) uridylyltransferase [Phaeospirillum molischianum 
DSM 120]
Length=924

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +2

Query  275  TVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEEL  454
            TV+EI  R+R GLL  +T     LGL+I  A +   GE  V  F+V D  G K+E++ +L
Sbjct  840  TVIEINGRDRPGLLYDITSAMTQLGLQISSAHISTYGERVVDVFYVKDVFGHKVEHERKL  899

Query  455  DRIRKALM  478
            +RIR  L+
Sbjct  900  ERIRVTLL  907



>emb|CDP11981.1| unnamed protein product [Coffea canephora]
Length=447

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +2

Query  239  AIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTD  418
            ++A  N    D T+V++ + N+ G+L  V ++   L L I +A +  +G +++  F VTD
Sbjct  24   SVAVDNTSCKDCTLVKVDSLNKPGILLEVVQILSDLDLIITKAYISSDGGWFMDVFHVTD  83

Query  419  SHGGKIENDEELDRIRKAL  475
             HG KI     ++ I KAL
Sbjct  84   QHGNKITESNTIEHIEKAL  102



>ref|XP_010541607.1| PREDICTED: uncharacterized protein LOC104815024 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010541608.1| PREDICTED: uncharacterized protein LOC104815024 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010541610.1| PREDICTED: uncharacterized protein LOC104815024 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010541611.1| PREDICTED: uncharacterized protein LOC104815024 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010541612.1| PREDICTED: uncharacterized protein LOC104815024 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010541613.1| PREDICTED: uncharacterized protein LOC104815024 isoform X1 [Tarenaya 
hassleriana]
Length=488

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   D TVV++ + N+ GLL  V ++   +   I+++ +  +GE+++  F V D 
Sbjct  27   VYIDNDSIQDCTVVKVNSENKQGLLLEVVQILTDMNFIINKSYISSDGEWFMDVFHVKDE  86

Query  422  HGGKIENDEELDRIRKAL  475
            HG K+ +   ++ I +A+
Sbjct  87   HGNKVTDQSVINHIEQAI  104



>ref|WP_021133435.1| PII uridylyl-transferase [Phaeospirillum fulvum]
 gb|EPY00500.1| PII uridylyl-transferase [Phaeospirillum fulvum MGU-K5]
Length=924

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +2

Query  275  TVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEEL  454
            TV+EI  R+R GLL  +T     LGL+I  A +   GE  V  F+V D  G K+E++ +L
Sbjct  840  TVIEINGRDRPGLLYDITSAMTQLGLQISSAHISTYGERVVDVFYVKDVFGHKVEHERKL  899

Query  455  DRIRKALM  478
            +RIR  L+
Sbjct  900  ERIRVTLL  907



>ref|XP_002956558.1| hypothetical protein VOLCADRAFT_97579 [Volvox carteri f. nagariensis]
 gb|EFJ42325.1| hypothetical protein VOLCADRAFT_97579 [Volvox carteri f. nagariensis]
Length=763

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   D TV+ I + NR G L  V +    LGL I  A +  +G ++V  FFVT++
Sbjct  58   VVIDNDTYDDMTVITIDSANRPGTLIEVVQCLTELGLSIRCARISSDGGWFVDEFFVTET  117

Query  422  HGGKIENDEELDRIRKAL  475
              GK+ +  +++ IRK L
Sbjct  118  PKGKLLDPRKINIIRKVL  135



>ref|XP_008804075.1| PREDICTED: uncharacterized protein LOC103717456 [Phoenix dactylifera]
Length=448

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND + D TV+++ + N+ G+L  V +V   L L + +A V  +G +++  F VTD 
Sbjct  26   VVIDNDASDDATVIQVDSVNKHGILLEVVQVLTDLNLIVTKAYVSSDGNWFMDVFNVTDR  85

Query  422  HGGKIENDEELDRIRKAL  475
            +G K+ + E L+ I+K+L
Sbjct  86   NGNKLRDKEILNYIQKSL  103



>ref|XP_010926807.1| PREDICTED: uncharacterized protein LOC105048981 [Elaeis guineensis]
Length=448

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND + D TV+++ + N+ G+L  V +V   L L I +A V  +G +++  F VTD 
Sbjct  26   VFIDNDASDDATVIQVDSVNKHGILLEVVQVLTDLNLIITKAYVSSDGNWFMDVFNVTDR  85

Query  422  HGGKIENDEELDRIRKAL  475
            +G K+ + E L+ I+K+L
Sbjct  86   NGNKLRDKEILNYIQKSL  103



>ref|XP_011036119.1| PREDICTED: uncharacterized protein LOC105133725 [Populus euphratica]
Length=448

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N  +   T++++ + N+ G L  V +V   L L I RA +  +GE+++  F+VTD 
Sbjct  25   VTVDNASSRKATLIKVDSANKRGSLLEVVQVLTDLNLLITRAYISSDGEWFMDVFYVTDQ  84

Query  422  HGGKIENDEELDRIRKAL  475
            HG K+  D+  +RI+++L
Sbjct  85   HGNKLSEDDVAERIQQSL  102



>ref|XP_002511139.1| amino acid binding protein, putative [Ricinus communis]
 gb|EEF51741.1| amino acid binding protein, putative [Ricinus communis]
Length=452

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  230  SSAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFF  409
            +S  +   ND     T+V++   NR G L  V +V   L L I +A +  +G +++  F+
Sbjct  16   NSPRVVIDNDACEHATIVQVDTLNRYGTLLQVVQVLTDLNLIITKAYISSDGVWFMDVFY  75

Query  410  VTDSHGGKIENDEELDRIRKAL  475
            VT + G K+E++  L+ I+KAL
Sbjct  76   VTGNDGNKVEDESILNYIKKAL  97



>ref|XP_002297856.1| hypothetical protein POPTR_0001s13490g [Populus trichocarpa]
 gb|ABK95686.1| unknown [Populus trichocarpa]
 gb|EEE82661.1| hypothetical protein POPTR_0001s13490g [Populus trichocarpa]
Length=448

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N  +   T++++ + N+ G L  V +V   L L I RA +  +GE+++  F+VTD 
Sbjct  25   VTVDNASSRKATLIKVDSANKRGSLLEVVQVLTDLNLIIRRAYISSDGEWFMDVFYVTDQ  84

Query  422  HGGKIENDEELDRIRKAL  475
            HG K+  D+  +RI+++L
Sbjct  85   HGNKLSEDDVAERIQQSL  102



>ref|XP_002304667.1| hypothetical protein POPTR_0003s16620g [Populus trichocarpa]
 gb|EEE79646.1| hypothetical protein POPTR_0003s16620g [Populus trichocarpa]
Length=448

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N  +   T++E+ + N+ G L  V +V   L L I RA +  +GE+++  F VTD 
Sbjct  25   VTVDNASSRTATLIEVDSANKRGSLLEVVQVLTDLNLLIRRAYISSDGEWFMDVFHVTDQ  84

Query  422  HGGKIENDEELDRIRKAL  475
            HG K+  D+  +RI+++L
Sbjct  85   HGNKLSEDDVAERIQQSL  102



>ref|XP_010250220.1| PREDICTED: uncharacterized protein LOC104592510 isoform X1 [Nelumbo 
nucifera]
Length=500

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +2

Query  233  SAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFV  412
            S  +   N+   D TVV++ + N+ GLL  V +    + L I ++ +  +  +++  F V
Sbjct  40   SCQVCIDNESCEDCTVVKVDSVNKQGLLLQVVQALTDMNLHISKSYISSDAGWFMDVFHV  99

Query  413  TDSHGGKIENDEELDRIRKAL  475
            TD HG K+ +   +D I++A+
Sbjct  100  TDEHGSKLTDQNVIDHIQQAI  120



>ref|WP_034959585.1| protein-PII uridylyltransferase, partial [Komagataeibacter kakiaceti]
Length=477

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 41/79 (52%), Gaps = 0/79 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N  +   TVVEI  R+R GLL  VT   G   L+I  A V   G   V  F+V D 
Sbjct  382  VVVDNRASNTCTVVEINGRDRPGLLHDVTAALGEQKLQIASAHVTTYGVRAVDVFYVKDL  441

Query  422  HGGKIENDEELDRIRKALM  478
             G KI + E LDRIR AL+
Sbjct  442  FGLKITDKERLDRIRAALL  460



>ref|XP_010250221.1| PREDICTED: uncharacterized protein LOC104592510 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010250223.1| PREDICTED: uncharacterized protein LOC104592510 isoform X2 [Nelumbo 
nucifera]
Length=484

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +2

Query  233  SAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFV  412
            S  +   N+   D TVV++ + N+ GLL  V +    + L I ++ +  +  +++  F V
Sbjct  24   SCQVCIDNESCEDCTVVKVDSVNKQGLLLQVVQALTDMNLHISKSYISSDAGWFMDVFHV  83

Query  413  TDSHGGKIENDEELDRIRKAL  475
            TD HG K+ +   +D I++A+
Sbjct  84   TDEHGSKLTDQNVIDHIQQAI  104



>ref|XP_001699652.1| hypothetical protein CHLREDRAFT_186726 [Chlamydomonas reinhardtii]
 gb|EDP07348.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=756

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   D TV+ I + NR G L  V +    LGL I  A +  +G ++V  FFVT++
Sbjct  58   VVIDNETYEDVTVITIDSANRPGTLIEVVQCLTELGLSIRCARISSDGGWFVDEFFVTET  117

Query  422  HGGKIENDEELDRIRKAL  475
              GKI +  +++ IRK L
Sbjct  118  PKGKILDQRKINIIRKVL  135



>ref|XP_006573669.1| PREDICTED: uncharacterized protein LOC100781435 isoform X1 [Glycine 
max]
 ref|XP_006573670.1| PREDICTED: uncharacterized protein LOC100781435 isoform X2 [Glycine 
max]
Length=480

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = +2

Query  278  VVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELD  457
            +V+IR  NR+GLL  VTRVF   GL I R  +  EGE  V  FFVTDS G ++ N + ++
Sbjct  358  MVDIRTDNRMGLLSNVTRVFRENGLSISRFEIGTEGEKAVGSFFVTDSSGEEV-NPDIVE  416

Query  458  RIRKA  472
             +R+A
Sbjct  417  LVRQA  421



>ref|WP_011386820.1| PII uridylyl-transferase [Magnetospirillum magneticum]
 dbj|BAE53280.1| UTP:GlnB (protein PII) uridylyltransferase [Magnetospirillum 
magneticum AMB-1]
Length=929

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +2

Query  275  TVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEEL  454
            TVVE+  R+R GLL  +T     +GL+I  A +   GE  V  F+V D  G KIE+  +L
Sbjct  840  TVVEVNGRDRPGLLYDITNAMTNVGLQISSAHISTYGERVVDVFYVKDVFGHKIEHGRKL  899

Query  455  DRIRKALM  478
            D+I+ AL+
Sbjct  900  DQIKAALL  907



>gb|KHN36315.1| [Protein-PII] uridylyltransferase [Glycine soja]
Length=480

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = +2

Query  278  VVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELD  457
            +V+IR  NR+GLL  VTRVF   GL I R  +  EGE  V  FFVTDS G ++ N + ++
Sbjct  358  MVDIRTDNRMGLLSNVTRVFRENGLSISRFEIGTEGEKAVGSFFVTDSSGEEV-NPDIVE  416

Query  458  RIRKA  472
             +R+A
Sbjct  417  LVRQA  421



>ref|WP_038290155.1| protein-PII uridylyltransferase, partial [Zooshikella ganghwensis]
Length=893

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +2

Query  236  AAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVT  415
            A +   N+    TT++EI A +R GLL ++ R+F  LGL I  A +   GE     FF+T
Sbjct  808  AEVTISNNPNNGTTILEIIAPDRPGLLALLGRIFMELGLFIHNAKIATLGERVEDVFFIT  867

Query  416  DSHGGKIENDEELDRIRKAL  475
            D+HG  I + ++ + IR+ +
Sbjct  868  DAHGCPITDADKCEHIRQTI  887



>ref|XP_010090668.1| [Protein-PII] uridylyltransferase [Morus notabilis]
 gb|EXB40332.1| [Protein-PII] uridylyltransferase [Morus notabilis]
Length=451

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N  +   T++++ + NR G L  V +V   L L I RA +  +GE+++  F VTD 
Sbjct  26   VTVDNASSRKATLIKVDSANRRGSLLEVVQVLTDLNLIIRRAYISSDGEWFMDVFHVTDQ  85

Query  422  HGGKIENDEELDRIRKAL  475
            HG K+  D+  +RI+++L
Sbjct  86   HGKKLSEDDVAERIQQSL  103



>ref|XP_003539257.1| PREDICTED: uncharacterized protein LOC100811109 [Glycine max]
Length=459

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +2

Query  278  VVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELD  457
            +V+IR  NR+GLL  VTRVF   GL I R  +  EGE  V  FFVTDS G ++ N   ++
Sbjct  346  MVDIRTENRMGLLSNVTRVFRENGLSISRFEIGTEGEKAVGSFFVTDSSGEQV-NPNIVE  404

Query  458  RIRKA  472
             +R+A
Sbjct  405  LVRQA  409



>ref|WP_028032202.1| protein-PII uridylyltransferase [Chelativorans sp. J32]
Length=935

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = +2

Query  275  TVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEEL  454
            +VVEI   +R GLL  VT V   L L I  A +   GE  +  F+VTD  G KIEN + L
Sbjct  847  SVVEIECLDRPGLLSEVTSVLSDLSLDIASAHITTFGEKVIDTFYVTDLTGSKIENPDRL  906

Query  455  DRIRKALM  478
            D IR+ L+
Sbjct  907  DTIRRQLI  914



>ref|NP_001169709.1| hypothetical protein [Zea mays]
 gb|ACN34615.1| unknown [Zea mays]
 gb|AFW61606.1| hypothetical protein ZEAMMB73_976911 [Zea mays]
Length=473

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND  +  T+V++ + N+ G L  V +V   L L I+RA +  +GE+++  F V D 
Sbjct  29   VTVDNDSDMTATLVKVDSANKYGTLLEVVQVLTDLKLTINRAYISSDGEWFMDVFHVVDQ  88

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ + + +DRI ++L
Sbjct  89   DGNKLYDGQVIDRIEQSL  106



>gb|KEH40482.1| four ACT domain ACT domain protein which protein [Medicago truncatula]
Length=683

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            ++  ND   D T+++I + N+ G+L  V ++   L   I +A +  +G +++  F VTD 
Sbjct  254  VSMDNDSCHDCTLIKIDSVNKPGILLEVVQILTDLDFIITKAYISSDGSWFMDVFHVTDQ  313

Query  422  HGGKIENDEELDRIRKAL  475
             G KI +++ +D I KAL
Sbjct  314  QGKKITDNKIIDFIEKAL  331



>gb|AGT16037.1| hypothetical protein SHCRBa_044_D02_F_100 [Saccharum hybrid cultivar 
R570]
Length=467

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND  +  T+V++ + N+ G L  V +V   L L I+RA +  +GE+++  F V D 
Sbjct  30   VTVDNDSDMTATLVKVDSANKYGTLLEVVQVLTDLKLTINRAYISSDGEWFMDVFHVVDQ  89

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ + + +DRI ++L
Sbjct  90   DGNKLYDGQVIDRIEQSL  107



>ref|XP_002876893.1| hypothetical protein ARALYDRAFT_904656 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53152.1| hypothetical protein ARALYDRAFT_904656 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   D TV+++ + N+ G+L  V +V   L L I +A +  +G +++  F VTD 
Sbjct  27   VVIDNEVCKDVTVIKVDSANKHGILLEVVQVLTELNLTIKKAYISSDGGWFMDVFNVTDQ  86

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD IRK+L
Sbjct  87   DGNKVTDEIVLDYIRKSL  104



>ref|XP_002321721.2| hypothetical protein POPTR_0015s11240g [Populus trichocarpa]
 gb|EEF05848.2| hypothetical protein POPTR_0015s11240g [Populus trichocarpa]
Length=434

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  230  SSAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFF  409
            +S  +   ND     TV+++    R G L  V +V   L L + +A +  +G +++  F+
Sbjct  17   NSPRVVVDNDACEHATVIQVDTVKRQGALLEVVQVLTDLNLVMTKAYMSSDGVWFMNVFY  76

Query  410  VTDSHGGKIENDEELDRIRKAL  475
            VTD HG KI +++ ++ I KAL
Sbjct  77   VTDDHGNKIRDEDIVNCIEKAL  98



>ref|XP_007038043.1| ACT domain repeat 6 isoform 1 [Theobroma cacao]
 gb|EOY22544.1| ACT domain repeat 6 isoform 1 [Theobroma cacao]
Length=538

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND     TV+++ + NR G+L  V +V   L L + +A +  +  +++  F+VTD 
Sbjct  117  VVVDNDACEHATVIQVDSVNRHGILLEVVQVLADLNLVVTKAYISSDAGWFMDVFYVTDY  176

Query  422  HGGKIENDEELDRIRKAL  475
             G KI N+  L  I+K L
Sbjct  177  EGNKIRNERTLSYIQKTL  194



>gb|ADE76039.1| unknown [Picea sitchensis]
Length=454

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   D ++V++ + NR G+L  V +V   L L I +A +  +G +++  F VTD 
Sbjct  25   VCIDNDTCEDCSLVKVESANRHGILLEVVQVLTDLDLIISKAYISSDGRWFMDVFHVTDQ  84

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ +   +D I++AL
Sbjct  85   LGNKLTDQRIIDYIQQAL  102



>ref|XP_009785185.1| PREDICTED: uncharacterized protein LOC104233484 [Nicotiana sylvestris]
Length=442

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   D T++++ + N+ G+L  V +V   L L I +A +  +G +++  F VTD 
Sbjct  17   VVIDNDSCEDATIIQVDSVNKHGILLQVVQVLTDLNLVITKAYISSDGGWFMDVFNVTDQ  76

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++E ++ I+K L
Sbjct  77   DGNKVRDEEIINYIQKTL  94



>ref|XP_007139290.1| hypothetical protein PHAVU_008G016800g [Phaseolus vulgaris]
 gb|ESW11284.1| hypothetical protein PHAVU_008G016800g [Phaseolus vulgaris]
Length=450

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N  +   TV+++ + NR G L  V +V   + L + RA +  +GE+++  F VTD 
Sbjct  26   VTVDNVSSRTDTVIKVDSANRRGSLLEVVQVLTDMNLGVRRAYISSDGEWFMDVFHVTDQ  85

Query  422  HGGKIENDEELDRIRKAL  475
            +G K E D+  DRI+++L
Sbjct  86   NGKKFEQDDVADRIQQSL  103



>ref|XP_009792706.1| PREDICTED: uncharacterized protein LOC104239695 [Nicotiana sylvestris]
Length=449

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N     TT++++ + N+ G L  V +V   L L I RA +  +GE+++  F VTD 
Sbjct  26   VTVDNTSDKKTTLIKVDSANKRGSLLEVVQVLTDLNLIIRRAYISSDGEWFMDVFHVTDQ  85

Query  422  HGGKIENDEELDRIRKAL  475
            HG K+  D   +RI+++L
Sbjct  86   HGNKLSEDNVAERIQQSL  103



>dbj|GAN80842.1| PII uridylyl-transferase [Acidocella aminolytica 101 = DSM 11237]
Length=931

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N  +   TV+E+  R+R GLL  VT      GL+I  A V   G   V  F+V D 
Sbjct  829  VVVDNRASNRHTVIEVNGRDRPGLLHDVTAAISAQGLQIASAHVTTYGVRAVDVFYVKDV  888

Query  422  HGGKIENDEELDRIRKALM  478
             G K+EN+ +L ++R+AL+
Sbjct  889  FGMKVENERKLSQLRRALL  907



>ref|XP_006856315.2| PREDICTED: ACT domain-containing protein ACR4 isoform X1 [Amborella 
trichopoda]
Length=448

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+     TV+++ + N+ G+L  V +V   L L I +A +  +G +++  F VTD 
Sbjct  27   VVIDNESCEHATVIQVDSANKHGILLEVVQVLTDLNLVIKKAYISSDGGWFMDVFNVTDR  86

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++E +D IRK+L
Sbjct  87   DGKKLRDEETMDYIRKSL  104



>ref|XP_010241627.1| PREDICTED: uncharacterized protein LOC104586168 [Nelumbo nucifera]
Length=496

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = +2

Query  233  SAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFV  412
            S  +   N+   D T+V++ + N+ GLL  V +    + L I ++ +  + E+++  F V
Sbjct  24   SCRVCIDNESFEDCTIVKVDSVNKQGLLLQVVQALTEMNLFISKSYISSDAEWFMDVFHV  83

Query  413  TDSHGGKIENDEELDRIRKAL  475
            TD HG K+ +   ++RI++ +
Sbjct  84   TDEHGNKLTDQNVINRIQQVI  104



>ref|WP_020384186.1| hypothetical protein [Candidatus Poribacteria sp. WGA-4E]
Length=883

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/78 (35%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            I   N+ +   T+++IRA++++GLL  ++  F  LGL I  A +  E       F+VTD+
Sbjct  795  IRIDNEASDRATIIDIRAQDQVGLLYTISDAFYKLGLDIHLAKITTEAFIAEDSFYVTDT  854

Query  422  HGGKIENDEELDRIRKAL  475
            +G KI +   L  I+ AL
Sbjct  855  NGAKITDPTRLKNIQDAL  872



>ref|XP_011627805.1| PREDICTED: ACT domain-containing protein ACR4 isoform X2 [Amborella 
trichopoda]
 gb|ERN17782.1| hypothetical protein AMTR_s00047p00143120 [Amborella trichopoda]
Length=438

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+     TV+++ + N+ G+L  V +V   L L I +A +  +G +++  F VTD 
Sbjct  17   VVIDNESCEHATVIQVDSANKHGILLEVVQVLTDLNLVIKKAYISSDGGWFMDVFNVTDR  76

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++E +D IRK+L
Sbjct  77   DGKKLRDEETMDYIRKSL  94



>ref|XP_009613029.1| PREDICTED: uncharacterized protein LOC104106236 [Nicotiana tomentosiformis]
Length=443

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   D T++++ + N+ G+L  V +V   L L I +A +  +G +++  F VTD 
Sbjct  17   VVIDNDSCEDATIIQVDSVNKHGILLQVVQVLTDLNLVITKAYISSDGGWFMDVFNVTDR  76

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++E ++ I+K L
Sbjct  77   DGNKVRDEEIINYIQKTL  94



>ref|WP_029910224.1| protein-PII uridylyltransferase [Caulobacter sp. UNC358MFTsu5.1]
Length=941

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 50/105 (48%), Gaps = 12/105 (11%)
 Frame = +2

Query  176  ASRLRASDGGGQVATEPESSA------------AIAFQNDGALDTTVVEIRARNRIGLLQ  319
            A  L A+  G  VA EP   A             +   N+ + + TVVE   R+R GLLQ
Sbjct  803  ADALEAAGRGEPVAVEPRRGAELSRTAAFSIAPTVVVDNEASNEATVVEASGRDRPGLLQ  862

Query  320  VVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEEL  454
             + R     GL I  A ++  GE  V  F+V  S GGK+E+ +++
Sbjct  863  ALARTLADNGLSIQSAHIDGYGERAVDAFYVQTSEGGKVEDAKKV  907



>emb|CDY15069.1| BnaC03g44300D [Brassica napus]
Length=238

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   + TV+++ + N+ G+L  V +V   L L I +A +  +G +++  F VT+ 
Sbjct  81   VVIDNDVYKNVTVIKVDSANKHGILLEVVQVLTDLNLTIKKAYISSDGGWFMDVFNVTNQ  140

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD IRK+L
Sbjct  141  DGNKVTDEIVLDYIRKSL  158



>gb|AAG51584.1|AC011665_5 unknown protein, 3' partial [Arabidopsis thaliana]
Length=104

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND     TV+ + + N  G+L  V ++   L L I +A +  +G +++  F VTD 
Sbjct  23   VVIDNDSCKKATVIRVDSANEYGILLEVVQILTDLNLTITKAYISSDGGWFMDVFNVTDQ  82

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD I+K+L
Sbjct  83   DGNKVTDEVVLDYIQKSL  100



>ref|XP_007038044.1| ACT domain repeat 6 isoform 2 [Theobroma cacao]
 gb|EOY22545.1| ACT domain repeat 6 isoform 2 [Theobroma cacao]
Length=409

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND     TV+++ + NR G+L  V +V   L L + +A +  +  +++  F+VTD 
Sbjct  17   VVVDNDACEHATVIQVDSVNRHGILLEVVQVLADLNLVVTKAYISSDAGWFMDVFYVTDY  76

Query  422  HGGKIENDEELDRIRKAL  475
             G KI N+  L  I+K L
Sbjct  77   EGNKIRNERTLSYIQKTL  94



>ref|XP_006367527.1| PREDICTED: uncharacterized protein LOC102594553 [Solanum tuberosum]
Length=449

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N     TT++++ + N+ G L  V +V   L L I RA +  +GE+++  F VTD 
Sbjct  25   VTVDNTSDKKTTLIKVDSANKRGSLLEVVQVLSDLNLIIKRAYISSDGEWFMDVFHVTDR  84

Query  422  HGGKIENDEELDRIRKAL  475
            +G K+  D   DRI+++L
Sbjct  85   YGKKLSEDNVADRIQQSL  102


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +2

Query  281  VEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELDR  460
            +E+   +RIGLL  VTR+F   GL + RA V   G   V  F+VTD+ GG ++N E ++ 
Sbjct  339  LELCGDDRIGLLSDVTRIFREYGLSVSRAEVMTRGTQAVNAFYVTDTSGGPVKN-ETIEA  397

Query  461  IRKAL  475
            +RK +
Sbjct  398  VRKEI  402



>ref|XP_002445807.1| hypothetical protein SORBIDRAFT_07g026100 [Sorghum bicolor]
 gb|EES15302.1| hypothetical protein SORBIDRAFT_07g026100 [Sorghum bicolor]
Length=476

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND  +  T+V++ + N+ G L  V +V   L L I+RA +  +GE+++  F V D 
Sbjct  32   VTVDNDSDMTATLVKVDSVNKYGTLLEVVQVLTDLKLTINRAYISSDGEWFMDVFHVVDQ  91

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ + + +DRI ++L
Sbjct  92   DGNKLYDGQVIDRIEQSL  109



>ref|WP_020698786.1| hypothetical protein [Reyranella massiliensis]
Length=930

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 50/96 (52%), Gaps = 6/96 (6%)
 Frame = +2

Query  206  GQVATEPESSAAIAFQ-----NDGALDT-TVVEIRARNRIGLLQVVTRVFGVLGLKIDRA  367
            GQ A+ P+       +     ++ A DT TV+E+  R+R G L VVTR    L L+I  A
Sbjct  816  GQRASWPKRDRVFTVEPRVLIDNNASDTFTVIEVNGRDRPGFLHVVTRALTRLNLQIASA  875

Query  368  VVEFEGEFYVKRFFVTDSHGGKIENDEELDRIRKAL  475
             V   GE  V  F+V D  G K+ N E+L +I  A+
Sbjct  876  HVTTYGERAVDVFYVKDLFGLKVVNQEKLKQIATAV  911



>ref|WP_019460765.1| MULTISPECIES: PII uridylyl-transferase [Roseomonas]
Length=916

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 42/79 (53%), Gaps = 0/79 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N  +   TV+E+ AR+R GLL  VT      GL+I  A +   G   V  F+V D 
Sbjct  816  VVLDNHASASHTVIEVNARDRPGLLHDVTTAISEQGLQIASAHITTYGVRAVDVFYVKDV  875

Query  422  HGGKIENDEELDRIRKALM  478
             G K+EN+ +L  +R AL+
Sbjct  876  FGLKVENERKLASLRSALL  894



>ref|XP_002949341.1| hypothetical protein VOLCADRAFT_89705 [Volvox carteri f. nagariensis]
 gb|EFJ49834.1| hypothetical protein VOLCADRAFT_89705 [Volvox carteri f. nagariensis]
Length=1009

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 72/147 (49%), Gaps = 20/147 (14%)
 Frame = +2

Query  209  QVATEPESSAA-----IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVV  373
            QVA  PES AA     +   N+   + TV+ ++A N+ GLL  +T +F  +G+ + +AVV
Sbjct  57   QVAA-PESPAAQGVVEVFVDNNSDTNFTVINVQAANKPGLLTAITALFRDIGVDVGKAVV  115

Query  374  EFEGEFYVKRFFVTDSHGGKIENDEELDRIR--KALMHavdggddgaaapavaasgrgva  547
            + +       F+V    GGK+ +D+  D +R  + L+ +       +     A       
Sbjct  116  DGDENKINDTFYVRTLTGGKLSDDKAADAVRSLEVLLRSKPSSTGVSRPKFEAQGQG---  172

Query  548  vrkagLGLQSGKAERMFGLMDGFLKND  628
                    QSGKA R++ LMD ++KND
Sbjct  173  --------QSGKA-RLYTLMDTYMKND  190



>ref|XP_011000958.1| PREDICTED: uncharacterized protein LOC105108367 isoform X1 [Populus 
euphratica]
Length=439

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND + D TV+++ + N+ G+L  V +V   + L I +A +  +G++++  F V D 
Sbjct  17   VVIDNDASEDATVIQVDSVNKHGILLKVVQVLTDMNLVITKAYISSDGDWFMDVFNVVDQ  76

Query  422  HGGKIENDEELDRIRKAL  475
             G KI + E +D I++ L
Sbjct  77   DGKKIRDKEVMDYIQRRL  94



>ref|WP_037226391.1| protein-PII uridylyltransferase [Roseomonas gilardii]
Length=920

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 42/79 (53%), Gaps = 0/79 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N  +   TV+E+ AR+R GLL  VT      GL+I  A +   G   V  F+V D 
Sbjct  820  VVLDNHASASHTVIEVNARDRPGLLHDVTTAISEQGLQIASAHITTYGVRAVDVFYVKDV  879

Query  422  HGGKIENDEELDRIRKALM  478
             G K+EN+ +L  +R AL+
Sbjct  880  FGLKVENERKLASLRSALL  898



>ref|WP_033310377.1| hypothetical protein, partial [Maricaulis sp. JL2009]
Length=882

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 51/97 (53%), Gaps = 9/97 (9%)
 Frame = +2

Query  146  PPPTTSVALKASRLRASDGGGQVATEPESSAAIAFQNDGALDTTVVEIRARNRIGLLQVV  325
            PP T  +  +A   RA +     A EPE    + F ++ +   TV+E+  R+R GLL+ +
Sbjct  753  PPETREIEPQA---RAREA--VFAVEPE----VDFDDEASERHTVIEVSGRDRAGLLRDL  803

Query  326  TRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKI  436
             RV    G+ +  A +E  GE  V  F+V D++G KI
Sbjct  804  ARVLADCGMTVGSAHIESRGERAVDVFYVADANGNKI  840



>gb|KCW80355.1| hypothetical protein EUGRSUZ_C01720, partial [Eucalyptus grandis]
Length=478

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +2

Query  233  SAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFV  412
            +  ++  N+   D TV+++ + N+ GLL  V +V   + L I ++ +  +G +++  F V
Sbjct  24   TCRVSIDNESMEDCTVIKVDSVNKQGLLLEVVQVLTDMNLSISKSYISSDGGWFMDVFHV  83

Query  413  TDSHGGKIENDEELDRIRKAL  475
             D HG KI +   +D I++A+
Sbjct  84   KDEHGNKIGDQRVIDYIQQAI  104



>ref|XP_008378393.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103441484 
[Malus domestica]
Length=503

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = +2

Query  233  SAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFV  412
            +  +   N+G  D TVV++ + N+ GLL  V +V   + L I ++ +  +  +++  F V
Sbjct  24   ACQVCIDNEGMEDCTVVKVDSVNKEGLLLEVVQVLTDMNLTITKSYISSDAGWFMDVFHV  83

Query  413  TDSHGGKIENDEELDRIRKAL  475
             D HG K+ +   L+ I++A+
Sbjct  84   KDEHGNKVTDQNVLNYIQQAI  104



>ref|XP_008339767.1| PREDICTED: uncharacterized protein LOC103402787 [Malus domestica]
Length=447

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   + TV+ + + N+ G+L  V +V   L L + +A +  +G +++  F VTD 
Sbjct  27   VVIDNEACKNATVIRVDSANKYGILLEVVQVLTDLNLIVTKAYISSDGGWFMDVFNVTDH  86

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++E LD I+K+L
Sbjct  87   DGNKVTDEEVLDYIQKSL  104



>ref|WP_022852282.1| hypothetical protein [Geovibrio sp. L21-Ace-BES]
Length=863

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            + F N+ +   T+++I  ++R+GLL ++  VF  LGL + +A +  + +  V  F++TD 
Sbjct  777  VVFDNEMSHQYTILDIFTQDRLGLLYIILGVFRRLGLNLIKAKISTDVDRVVDSFYLTDM  836

Query  422  HGGKIENDEELDRIRKALMH  481
            +G KI ++  L+ IR  L+ 
Sbjct  837  NGEKITDERTLEAIRDELIQ  856



>ref|XP_010048170.1| PREDICTED: uncharacterized protein LOC104437016 [Eucalyptus grandis]
Length=488

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +2

Query  233  SAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFV  412
            +  ++  N+   D TV+++ + N+ GLL  V +V   + L I ++ +  +G +++  F V
Sbjct  24   TCRVSIDNESMEDCTVIKVDSVNKQGLLLEVVQVLTDMNLSISKSYISSDGGWFMDVFHV  83

Query  413  TDSHGGKIENDEELDRIRKAL  475
             D HG KI +   +D I++A+
Sbjct  84   KDEHGNKIGDQRVIDYIQQAI  104



>ref|WP_007443480.1| protein-P-II uridylyltransferase, partial [Streptomyces coelicoflavus]
 gb|EHN76681.1| protein-P-II uridylyltransferase, partial [Streptomyces coelicoflavus 
ZG0656]
Length=146

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 38/68 (56%), Gaps = 0/68 (0%)
 Frame = +2

Query  272  TTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEE  451
             TVVE+   +R GLL  ++RVF   GL I  A V   GE  V  F+V D  G KI +++ 
Sbjct  34   ATVVEVSGADRPGLLAALSRVFSDEGLNIRSAHVASYGERAVDSFYVVDRKGRKITSEQR  93

Query  452  LDRIRKAL  475
            +  +R AL
Sbjct  94   VAELRAAL  101



>ref|XP_004228427.1| PREDICTED: uncharacterized protein LOC101262744 [Solanum lycopersicum]
Length=449

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N     TT++++ + N+ G L  V +V   L L I RA +  +GE+++  F VTD 
Sbjct  25   VTVDNTSDQKTTLIKVDSANKRGSLLEVVQVLSDLNLLIKRAYISSDGEWFMDVFHVTDR  84

Query  422  HGGKIENDEELDRIRKAL  475
            +G K+  D   DRI+++L
Sbjct  85   YGKKLYEDNVADRIQQSL  102


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +2

Query  281  VEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELDR  460
            +E+   +RIGLL  VTR+F   GL + RA V   G   V  F+VTD+ GG ++N E ++ 
Sbjct  339  LELCGDDRIGLLSDVTRIFREYGLSVSRAEVMTRGTQAVNAFYVTDTSGGPVKN-ETIEA  397

Query  461  IRKAL  475
            +RK +
Sbjct  398  VRKEI  402



>ref|WP_035943321.1| hypothetical protein [Frankia sp. Iso899]
Length=773

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 37/70 (53%), Gaps = 0/70 (0%)
 Frame = +2

Query  248  FQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHG  427
            + +D A D TV+E+R R+ IGLL  VT      GL I  A +   G + V  F+VTDS G
Sbjct  693  WFDDEATDATVLEVRTRDGIGLLHWVTAALEEAGLDIRSARISSLGSYVVDAFYVTDSDG  752

Query  428  GKIENDEELD  457
              +    + D
Sbjct  753  KPLNESRQAD  762



>ref|WP_045662741.1| protein-PII uridylyltransferase [Rhodospirillaceae bacterium 
BRH_c57]
Length=919

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = +2

Query  275  TVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEEL  454
            TV+E+  R+R G L  VTR    LGL+I  A +   GE  V  F+V D  G K+++  +L
Sbjct  835  TVIEVNGRDRPGFLYDVTRTLTSLGLQISSAHISTYGERVVDVFYVKDVFGMKVDHQTKL  894

Query  455  DRIRKALM  478
             +IR+ LM
Sbjct  895  RQIRENLM  902



>gb|ABB88567.1| PhoB [Chlamydomonas reinhardtii]
 gb|ABB88568.1| PhoB [Chlamydomonas reinhardtii]
Length=1010

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 86/178 (48%), Gaps = 31/178 (17%)
 Frame = +2

Query  146  PPPTTSVALKASRLRA------SDGGG-QVATE---PESSAA-----IAFQNDGALDTTV  280
            P P   VA+ ASR +A      S G G QV+ +   PES A+     + F N      TV
Sbjct  26   PAP---VAVSASRSKAVAPTRRSQGPGRQVSVKVAAPESPASSGEVIVNFDNTTDSGYTV  82

Query  281  VEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELDR  460
            + ++A N+ GLL  +T +F  LG+ + +AVVE + +    +F+V    GGK+  D+  D 
Sbjct  83   ISVQANNKPGLLTSITALFRDLGVDVGKAVVEGDEDRINDKFYVRSLSGGKLSEDKAADC  142

Query  461  IR--KALMHavdggddgaaapavaasgrgvavrkagLGLQSGKAERMFGLMDGFLKND  628
            ++    L+ +   G +         +  G           +GKA R++ LMD ++KND
Sbjct  143  VKALDVLLRSKPTGTEATRPKFENTAATGG----------TGKA-RLYTLMDTYMKND  189



>ref|XP_001694015.1| starch phosphorylase [Chlamydomonas reinhardtii]
 gb|EDP02951.1| starch phosphorylase [Chlamydomonas reinhardtii]
Length=1010

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 86/178 (48%), Gaps = 31/178 (17%)
 Frame = +2

Query  146  PPPTTSVALKASRLRA------SDGGG-QVATE---PESSAA-----IAFQNDGALDTTV  280
            P P   VA+ ASR +A      S G G QV+ +   PES A+     + F N      TV
Sbjct  26   PAP---VAVSASRSKAVAPTRRSQGPGRQVSVKVAAPESPASSGEVIVNFDNTTDSGYTV  82

Query  281  VEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELDR  460
            + ++A N+ GLL  +T +F  LG+ + +AVVE + +    +F+V    GGK+  D+  D 
Sbjct  83   ISVQANNKPGLLTSITALFRDLGVDVGKAVVEGDEDRINDKFYVRSLSGGKLSEDKAADC  142

Query  461  IR--KALMHavdggddgaaapavaasgrgvavrkagLGLQSGKAERMFGLMDGFLKND  628
            ++    L+ +   G +         +  G           +GKA R++ LMD ++KND
Sbjct  143  VKALDVLLRSKPTGTEATRPKFENTAATGG----------TGKA-RLYTLMDTYMKND  189



>ref|XP_004144160.2| PREDICTED: ACT domain-containing protein ACR4 [Cucumis sativus]
 gb|KGN47669.1| hypothetical protein Csa_6G367150 [Cucumis sativus]
Length=448

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   D TV+ + + N+ G+L  V +V   L L + +A +  +G +++  F VTD 
Sbjct  27   VVIDNDACKDATVIRVDSANKHGILLEVVQVLTDLNLIVTKAYISCDGCWFMDVFNVTDQ  86

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD I+++L
Sbjct  87   DGNKVTDEGVLDYIKRSL  104



>gb|KJS40813.1| protein-PII uridylyltransferase [Rhodospirillaceae bacterium 
BRH_c57]
Length=917

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = +2

Query  275  TVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEEL  454
            TV+E+  R+R G L  VTR    LGL+I  A +   GE  V  F+V D  G K+++  +L
Sbjct  833  TVIEVNGRDRPGFLYDVTRTLTSLGLQISSAHISTYGERVVDVFYVKDVFGMKVDHQTKL  892

Query  455  DRIRKALM  478
             +IR+ LM
Sbjct  893  RQIRENLM  900



>ref|WP_030510868.1| protein-PII uridylyltransferase [Microbispora rosea]
Length=782

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = +2

Query  224  PESSAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKR  403
            P +   +   +D +L  +VVE+RA +R GLL  + R FG  GL +  A VE  G   V  
Sbjct  694  PVAPPRVTLVDDASLTASVVEVRAHDRPGLLWRIGRAFGDCGLDVRAARVETLGAEAVDV  753

Query  404  FFVTDSHGGKIENDEELDRIRKALM  478
            F+V D  G  I ++++  ++R+ ++
Sbjct  754  FYVADRTGRPILDEQQRIQVREHVL  778



>ref|XP_011020811.1| PREDICTED: uncharacterized protein LOC105123048 [Populus euphratica]
 ref|XP_011020812.1| PREDICTED: uncharacterized protein LOC105123048 [Populus euphratica]
Length=448

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N      T++++ + N+ G L  V +V   L L I RA +  +GE+++  F VTD 
Sbjct  25   VTVDNASNRKATLIKVDSANKRGSLLEVVQVLTDLNLLITRAYISSDGEWFMDVFHVTDQ  84

Query  422  HGGKIENDEELDRIRKAL  475
            HG K+  D+  +RI+++L
Sbjct  85   HGNKLSEDDVAERIKQSL  102



>ref|XP_009411127.1| PREDICTED: uncharacterized protein LOC103992926 [Musa acuminata 
subsp. malaccensis]
Length=451

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   + TV+ + + N+ G+L  V +V   L L I +A +  +G +++  F V D 
Sbjct  27   VVVDNDSCANATVIRVDSANKYGILLEVVQVLMDLNLIITKAYISSDGGWFMDVFNVRDR  86

Query  422  HGGKIENDEELDRIR  466
             G KIE +++LD+I+
Sbjct  87   DGNKIEKEKDLDKIK  101



>ref|XP_008347951.1| PREDICTED: uncharacterized protein LOC103411072 [Malus domestica]
Length=322

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            ++  N    D T+V++ + N+ G+L  V ++   L L I +A +  +G +++  F VTD 
Sbjct  25   VSVDNSSCSDCTLVKVDSVNKPGILLEVVQILTDLDLIITKAYISSDGGWFMDVFHVTDQ  84

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ + + +D I KAL
Sbjct  85   QGKKVTDSKTIDYIEKAL  102



>gb|KJB34122.1| hypothetical protein B456_006G048900 [Gossypium raimondii]
 gb|KJB34124.1| hypothetical protein B456_006G048900 [Gossypium raimondii]
Length=86

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +2

Query  233  SAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFV  412
               +   N+   D TV+++ + N+ G+L  V +V   + L I +A + F+G +++  + V
Sbjct  6    CCRVVIDNNACEDATVIQVDSVNKHGILLEVVQVLTDMNLTITKAYISFDGGWFMVVYNV  65

Query  413  TDSHGGKIENDEELDRIR  466
             D+ G KI + E +D I+
Sbjct  66   VDNDGNKIRDKEVMDYIQ  83



>gb|AII87677.1| uridylyltransferase GlnD [Planktomarina temperata RCA23]
Length=922

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +2

Query  239  AIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTD  418
            +I+F N+G+   T++E+  R+R+GLL  +TR      + I  AV+   GE  V  F+V D
Sbjct  831  SISFDNEGSEIYTIIEVDTRDRLGLLYDLTRTLAAANVNISSAVIATYGEQVVDTFYVKD  890

Query  419  SHGGKIENDEELDRIRKAL  475
              G K+ +  + D + + L
Sbjct  891  MFGLKLHSKAKRDSLEQKL  909



>ref|WP_008618768.1| PII uridylyl-transferase [Magnetospirillum sp. SO-1]
 gb|EME69226.1| PII uridylyl-transferase [Magnetospirillum sp. SO-1]
Length=926

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +2

Query  275  TVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEEL  454
            TVVE+  R+R GLL  +T     +GL+I  A +   GE  V  F+V D  G KIE+  +L
Sbjct  841  TVVEVNGRDRPGLLYDITNAMTNVGLQISSAHISTYGERVVDVFYVKDVFGHKIEHGRKL  900

Query  455  DRIRKALM  478
            ++I+ AL+
Sbjct  901  EQIKAALL  908



>ref|XP_009360670.1| PREDICTED: uncharacterized protein LOC103951112 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009360671.1| PREDICTED: uncharacterized protein LOC103951112 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009360672.1| PREDICTED: uncharacterized protein LOC103951112 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009360673.1| PREDICTED: uncharacterized protein LOC103951112 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009342844.1| PREDICTED: uncharacterized protein LOC103934817 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009342845.1| PREDICTED: uncharacterized protein LOC103934817 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009342846.1| PREDICTED: uncharacterized protein LOC103934817 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009342847.1| PREDICTED: uncharacterized protein LOC103934817 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009342848.1| PREDICTED: uncharacterized protein LOC103934817 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009342849.1| PREDICTED: uncharacterized protein LOC103934817 isoform X1 [Pyrus 
x bretschneideri]
Length=449

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            ++  N    D T+V++ + N+ G+L  V ++   L L I +A +  +G +++  F VTD 
Sbjct  25   VSIDNSSCSDCTIVKVDSVNKPGILLEVVQILTDLDLIITKAYISSDGGWFMDVFHVTDQ  84

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ + + +D I KAL
Sbjct  85   QGKKVTDSKTIDYIEKAL  102



>ref|WP_044050355.1| protein-PII uridylyltransferase [Planktomarina temperata]
Length=925

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +2

Query  239  AIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTD  418
            +I+F N+G+   T++E+  R+R+GLL  +TR      + I  AV+   GE  V  F+V D
Sbjct  834  SISFDNEGSEIYTIIEVDTRDRLGLLYDLTRTLAAANVNISSAVIATYGEQVVDTFYVKD  893

Query  419  SHGGKIENDEELDRIRKAL  475
              G K+ +  + D + + L
Sbjct  894  MFGLKLHSKAKRDSLEQKL  912



>sp|Q8RQD1.1|GLND_AZOBR RecName: Full=Bifunctional uridylyltransferase/uridylyl-removing 
enzyme; Short=UTase/UR; AltName: Full=Bifunctional [protein-PII] 
modification enzyme; AltName: Full=Bifunctional nitrogen 
sensor protein; Includes: RecName: Full=[Protein-PII] 
uridylyltransferase; Short=PII uridylyltransferase; Short=UTase; 
Includes: RecName: Full=[Protein-PII]-UMP uridylyl-removing 
enzyme; Short=UR [Azospirillum brasilense]
 gb|AAL87737.1|AF149716_1 uridylyltransferase [Azospirillum brasilense]
Length=933

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+ +   TV+E+  R+R GLL  +TR    L L+I  A +   GE  +  F+V D 
Sbjct  847  VLIDNNASTTHTVIEVNGRDRPGLLYDLTRALTNLTLQISSAKISTYGEKAIDVFYVKDV  906

Query  422  HGGKIENDEELDRIRKALMH  481
             G K+ ++ +L +IR+ L+H
Sbjct  907  FGLKVTHENKLAQIRERLLH  926



>ref|XP_004974011.1| PREDICTED: uncharacterized protein LOC101766285 [Setaria italica]
Length=482

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            ++  ND  +  T+V++ + N+ G L  V +V   L L I RA +  +GE+++  F V D 
Sbjct  30   VSVDNDSDMTATLVKVDSANKYGTLLEVVQVLTDLKLTIKRAYITSDGEWFMDVFHVVDQ  89

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ + + +DRI ++L
Sbjct  90   DGNKLYDGQVIDRIEQSL  107



>ref|XP_006356716.1| PREDICTED: uncharacterized protein LOC102587087 [Solanum tuberosum]
Length=447

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            ++  N    D T+V++ + N+ G+L  V ++   L L I +A +  +G +++  F VTD 
Sbjct  25   VSVDNASCKDCTLVKVDSINKPGILLEVVQILSDLDLVITKAYISSDGGWFMDVFHVTDQ  84

Query  422  HGGKIENDEELDRIRKAL  475
            HG K+ ++  +  I KAL
Sbjct  85   HGNKVTDNNTIGHIEKAL  102



>ref|XP_008808483.1| PREDICTED: uncharacterized protein LOC103720522 isoform X1 [Phoenix 
dactylifera]
Length=448

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N    D T+V++ + N+ G+L  V +V   L L I +A +  +G +++  F VTD 
Sbjct  21   VCIDNTTCSDCTLVKVDSMNKPGILLEVVQVLSDLDLFISKAYITSDGRWFMDVFHVTDQ  80

Query  422  HGGKIENDEELDRIRKAL  475
             G KI + + ++ I KAL
Sbjct  81   QGNKITDQKTIEYIEKAL  98



>ref|WP_035670558.1| protein-PII uridylyltransferase [Azospirillum brasilense]
Length=933

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+ +   TV+E+  R+R GLL  +TR    L L+I  A +   GE  +  F+V D 
Sbjct  847  VLIDNNASTTHTVIEVNGRDRPGLLYDLTRALTNLTLQISSAKISTYGEKAIDVFYVKDV  906

Query  422  HGGKIENDEELDRIRKALMH  481
             G K+ ++ +L +IR+ L+H
Sbjct  907  FGLKVTHENKLAQIRERLLH  926



>ref|XP_004297204.1| PREDICTED: ACT domain-containing protein ACR4 [Fragaria vesca 
subsp. vesca]
Length=448

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   + TV+ + + N++G+L  V ++   L L + +A +  +G +++  F VTD 
Sbjct  27   VVIDNEACKNATVIRVDSANKLGILLEVVQILTDLNLIVTKAYISSDGGWFMDVFNVTDQ  86

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD IRK+L
Sbjct  87   DGNKVTDEGVLDYIRKSL  104



>gb|KHG02132.1| [Protein-PII] uridylyltransferase [Gossypium arboreum]
Length=445

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   + TV+ + + NR G+L  V ++   + L I +A +  +G +++  F VTD 
Sbjct  25   VVIDNESCKNATVIRVDSANRHGILLEVVQILTDINLIITKAYISSDGNWFMDVFNVTDQ  84

Query  422  HGGKIENDEELDRIRKAL  475
             G KI ++  LD IRK+L
Sbjct  85   DGNKILDEGILDYIRKSL  102



>ref|WP_040618441.1| protein-PII uridylyltransferase [Roseovarius nubinhibens]
Length=921

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 4/82 (5%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            I F NDG+   T++E+  R+R GLL  +TR    L + I+ AV+   GE  V  F+V D 
Sbjct  831  ITFDNDGSEIYTIIEVDTRDRPGLLYDLTRTLAALNVYINSAVIATYGEQVVDTFYVKDM  890

Query  422  HGGKIENDEE---LDR-IRKAL  475
             G K  ++ +   LDR +R+A+
Sbjct  891  FGLKFHSEAKQRSLDRKLREAI  912



>ref|WP_028878078.1| protein-PII uridylyltransferase [Terasakiella pusilla]
Length=929

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +2

Query  275  TVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEEL  454
            TVVE+  R+R+G L  VTR    LGL+I+ A +   GE  V  F+V D  G K+ ++ +L
Sbjct  840  TVVEVNGRDRLGFLYDVTRTLSELGLQINSAHIATFGERAVDVFYVKDVFGLKVNSETKL  899

Query  455  DRIRKALM  478
              IR+ L+
Sbjct  900  KSIREKLL  907



>ref|XP_010681133.1| PREDICTED: uncharacterized protein LOC104896128 [Beta vulgaris 
subsp. vulgaris]
Length=448

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   + TV+++ + NR G+L  V ++   L L I +A +  +G +++  F V D 
Sbjct  27   VVIDNESCKNATVIQVDSANRHGILLEVVQILTDLNLVITKAYISSDGGWFMDVFNVIDQ  86

Query  422  HGGKIENDEELDRIRKAL  475
             G KI ++E LD I+K+L
Sbjct  87   DGNKITDEEILDYIQKSL  104



>gb|EAP75445.1| protein-P-II uridylyltransferase [Roseovarius nubinhibens ISM]
Length=923

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 4/82 (5%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            I F NDG+   T++E+  R+R GLL  +TR    L + I+ AV+   GE  V  F+V D 
Sbjct  833  ITFDNDGSEIYTIIEVDTRDRPGLLYDLTRTLAALNVYINSAVIATYGEQVVDTFYVKDM  892

Query  422  HGGKIENDEE---LDR-IRKAL  475
             G K  ++ +   LDR +R+A+
Sbjct  893  FGLKFHSEAKQRSLDRKLREAI  914



>ref|WP_035255768.1| hypothetical protein, partial [Desulfatiglans anilini]
Length=805

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 49/98 (50%), Gaps = 0/98 (0%)
 Frame = +2

Query  188  RASDGGGQVATEPESSAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRA  367
            +AS     V  +P     +   N  +   TVVE+ A +RIGLL  +T     LGL I  A
Sbjct  704  KASRSVLDVQRKPAHPPEVGVDNRASDFFTVVEVFADDRIGLLYRITHTLFSLGLDIRIA  763

Query  368  VVEFEGEFYVKRFFVTDSHGGKIENDEELDRIRKALMH  481
             +  +G+     F+V D  G K+E+   ++ IR AL+H
Sbjct  764  KISTKGDQIADVFYVRDLEGQKVEDPGRVEEIRMALLH  801



>ref|XP_009404247.1| PREDICTED: uncharacterized protein LOC103987622 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=451

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   D TV+ + + N+ G+L  V +V   L L I +A +  +G +++  F VTD 
Sbjct  28   VVIDNDSCGDATVIRVDSVNKHGILLEVVQVLTDLDLVIRKAYISSDGSWFMDVFNVTDC  87

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++E +  I+K+L
Sbjct  88   DGNKLWDEEIISYIKKSL  105



>emb|CDY65806.1| BnaA02g35780D [Brassica napus]
Length=453

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   + TV+ + + N  G+L  V ++   L L I +A +  +G +++  F VTD 
Sbjct  23   VVIDNDSCKNATVIRVDSANEYGILLEVVQILTDLNLTITKAYISSDGGWFMDVFNVTDQ  82

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD I+K+L
Sbjct  83   DGNKVTDEVVLDYIQKSL  100



>ref|XP_009127699.1| PREDICTED: uncharacterized protein LOC103852547 [Brassica rapa]
Length=457

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   + TV+ + + N  G+L  V ++   L L I +A +  +G +++  F VTD 
Sbjct  27   VVIDNDSCKNATVIRVDSANEYGILLEVVQILTDLNLTITKAYISSDGGWFMDVFNVTDQ  86

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD I+K+L
Sbjct  87   DGNKVTDEVVLDYIQKSL  104



>ref|XP_006395679.1| hypothetical protein EUTSA_v10004191mg [Eutrema salsugineum]
 gb|ESQ32965.1| hypothetical protein EUTSA_v10004191mg [Eutrema salsugineum]
Length=454

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            ++  ND   + TV+++ + N+ G+L  V +V   L L I +A +  +G +++  F VTD 
Sbjct  27   VSIDNDVCKNVTVIKVDSANKHGILLEVVQVLTDLNLTIKKAYISSDGGWFMDVFNVTDQ  86

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  L+ IRK+L
Sbjct  87   DGNKVTDEIVLEYIRKSL  104



>ref|WP_038530088.1| protein-PII uridylyltransferase [Azospirillum brasilense]
 gb|EZQ07265.1| protein-PII uridylyltransferase [Azospirillum brasilense]
 gb|AIB13026.1| protein-PII uridylyltransferase [Azospirillum brasilense]
Length=933

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+ +   TV+E+  R+R GLL  +TR    L L+I  A +   GE  +  F+V D 
Sbjct  847  VLIDNNASTTHTVIEVNGRDRPGLLYDLTRALTNLTLQISSAKISTYGEKAIDVFYVKDV  906

Query  422  HGGKIENDEELDRIRKALMH  481
             G K+ ++ +L +IR+ L+H
Sbjct  907  FGLKVTHESKLAQIRERLLH  926



>gb|ACN34303.1| unknown [Zea mays]
Length=437

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (52%), Gaps = 0/81 (0%)
 Frame = +2

Query  233  SAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFV  412
            S  +   ND   + TV+ +   N+ G+L    +V   L L I +A +  +G +++  F V
Sbjct  9    SCRVVIDNDSCGNATVIRVDRVNKHGILLEAVQVLVDLNLVITKAYISSDGNWFMHVFNV  68

Query  413  TDSHGGKIENDEELDRIRKAL  475
            TD  G K+ N E +D I+K L
Sbjct  69   TDQDGSKLHNREVIDHIQKCL  89



>ref|WP_029010873.1| protein-PII uridylyltransferase [Azospirillum halopraeferens]
Length=945

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+ +   TV+E+  R+R GLL  +TR    L L+I  A +   GE  +  F+V D 
Sbjct  826  VLIDNNASTTHTVIEVNGRDRPGLLYDLTRALSNLSLQISSAKIATYGEKAIDVFYVKDV  885

Query  422  HGGKIENDEELDRIRKALMH  481
             G K+ ++ +L +IR+ L+H
Sbjct  886  FGLKVGHEAKLAQIRERLLH  905



>emb|CDP20649.1| unnamed protein product [Coffea canephora]
Length=443

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   D T++++ +  + G+L  V +V   L L I +A +  +G +++  F V D 
Sbjct  17   VVIDNDSCEDATIIQVYSVKKHGILLHVVQVLTDLDLVITKAYISLDGGWFMDVFNVIDR  76

Query  422  HGGKIENDEELDRIRKAL  475
             G K++ +E +D I+K L
Sbjct  77   SGNKVQEEEVIDHIKKTL  94



>gb|ACG60681.1| unknown protein [Brassica oleracea var. alboglabra]
Length=446

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   + TV+ + + N  G+L  V ++   L L I +A +  +G +++  F VTD 
Sbjct  17   VVIDNDSCKNATVIRVDSANEYGILLEVVQILTDLNLTITKAYISSDGGWFMDVFNVTDQ  76

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD I+K+L
Sbjct  77   DGNKVTDEVVLDYIQKSL  94



>emb|CCC96679.1| [protein-PII] uridylyltransferase [Azospirillum brasilense Sp245]
Length=935

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+ +   TV+E+  R+R GLL  +TR    L L+I  A +   GE  +  F+V D 
Sbjct  849  VLIDNNASTTHTVIEVNGRDRPGLLYDLTRALTNLTLQISSAKISTYGEKAIDVFYVKDV  908

Query  422  HGGKIENDEELDRIRKALMH  481
             G K+ ++ +L +IR+ L+H
Sbjct  909  FGLKVTHESKLAQIRERLLH  928



>ref|XP_004140541.1| PREDICTED: ACT domain-containing protein ACR4-like [Cucumis sativus]
 gb|KGN46439.1| hypothetical protein Csa_6G093100 [Cucumis sativus]
Length=451

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND +   T++++ + N+ G L  V +V   L L I RA +  +GE+++  F VTD 
Sbjct  26   VTVDNDSSRKATLIKVDSANKRGSLLEVVQVLNDLNLIIRRAYISSDGEWFMDVFHVTDQ  85

Query  422  HGGKIENDEELDRIRKAL  475
             G K+  ++  +RI+++L
Sbjct  86   RGNKLSENDVAERIQQSL  103



>ref|XP_009416935.1| PREDICTED: uncharacterized protein LOC103997445 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416936.1| PREDICTED: uncharacterized protein LOC103997445 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416937.1| PREDICTED: uncharacterized protein LOC103997445 [Musa acuminata 
subsp. malaccensis]
Length=440

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N    D T+V++ + N+ G+L  V +V   L L I +A +  +G +++  F VTD 
Sbjct  21   VCIDNVTCNDCTLVKVDSVNKPGILLEVVQVLSDLDLAISKAYITSDGTWFMDVFHVTDQ  80

Query  422  HGGKIENDEELDRIRKAL  475
             G KI   + +D I KAL
Sbjct  81   QGRKITEKKTIDYIEKAL  98



>emb|CDX81587.1| BnaC02g18910D [Brassica napus]
Length=453

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   + TV+ + + N  G+L  V ++   L L I +A +  +G +++  F VTD 
Sbjct  23   VVIDNDSCKNATVIRVDSANEYGILLEVVQILTDLNLTITKAYISSDGGWFMDVFNVTDQ  82

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD I+K+L
Sbjct  83   DGNKVTDEVVLDYIQKSL  100



>ref|WP_041810843.1| protein-PII uridylyltransferase [Azospirillum brasilense]
Length=933

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+ +   TV+E+  R+R GLL  +TR    L L+I  A +   GE  +  F+V D 
Sbjct  847  VLIDNNASTTHTVIEVNGRDRPGLLYDLTRALTNLTLQISSAKISTYGEKAIDVFYVKDV  906

Query  422  HGGKIENDEELDRIRKALMH  481
             G K+ ++ +L +IR+ L+H
Sbjct  907  FGLKVTHESKLAQIRERLLH  926



>ref|WP_043365398.1| protein-PII uridylyltransferase, partial [Belnapia sp. F-4-1]
Length=916

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 51/104 (49%), Gaps = 6/104 (6%)
 Frame = +2

Query  182  RLRASDGGGQVATEPESSAAI------AFQNDGALDTTVVEIRARNRIGLLQVVTRVFGV  343
            RLR  D   +V  EP    A+       F N  +   TV+E+  R+R GLL  VT     
Sbjct  809  RLRLRDEIRKVRREPARLRAVTVPPRVVFDNHASNTHTVIEVNGRDRPGLLHDVTAAISD  868

Query  344  LGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELDRIRKAL  475
             GL+I  A +   G   V  F+V D  G K+EN+ +L  +R+A+
Sbjct  869  QGLQIASAHITTYGVRAVDVFYVKDVFGLKVENERKLAPLRRAV  912



>ref|XP_006391062.1| hypothetical protein EUTSA_v10018526mg [Eutrema salsugineum]
 gb|ESQ28348.1| hypothetical protein EUTSA_v10018526mg [Eutrema salsugineum]
Length=455

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   + TV+ + + N  G+L  V ++   L L I +A +  +G +++  F VTD 
Sbjct  27   VVIDNDSCKNATVIRVDSANEYGILLEVVQILTDLNLTITKAYISSDGGWFMDVFNVTDQ  86

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD I+K+L
Sbjct  87   DGNKVTDEVVLDYIQKSL  104



>ref|WP_035248799.1| protein-PII uridylyltransferase [Actibacterium atlanticum]
 gb|KCV82903.1| PII uridylyl-transferase [Actibacterium atlanticum]
Length=936

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 0/83 (0%)
 Frame = +2

Query  227  ESSAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRF  406
            E   AI F NDG+   T++E+  R+R GLL  +TRVF    + I  AV+   G   V  F
Sbjct  841  EFPTAITFDNDGSEIYTIIEVDTRDRPGLLFDLTRVFAKHNISIASAVIATYGAQVVDSF  900

Query  407  FVTDSHGGKIENDEELDRIRKAL  475
            +V D  G KI +  + + + K L
Sbjct  901  YVKDLFGLKIHSKLKQEALEKKL  923



>dbj|BAJ33767.1| unnamed protein product [Thellungiella halophila]
Length=451

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   + TV+ + + N  G+L  V ++   L L I +A +  +G +++  F VTD 
Sbjct  23   VVIDNDSCKNATVIRVDSANEYGILLEVVQILTDLNLTITKAYISSDGGWFMDVFNVTDQ  82

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD I+K+L
Sbjct  83   DGNKVTDEVVLDYIQKSL  100



>ref|XP_006437860.1| hypothetical protein CICLE_v10031536mg [Citrus clementina]
 gb|ESR51100.1| hypothetical protein CICLE_v10031536mg [Citrus clementina]
Length=445

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   + TV+ + + N+ G+L  V +V   L L + +A +  +G +++  F VTD 
Sbjct  23   VVIDNEACKNATVIRVDSANKHGILLEVVQVLTDLNLIVTKAYISSDGCWFMDVFNVTDE  82

Query  422  HGGKIENDEELDRIRKAL  475
             G KI ++  LD IRK L
Sbjct  83   DGNKITDEGILDYIRKCL  100



>ref|WP_010140017.1| PII uridylyl-transferase [Oceanicola sp. S124]
Length=921

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +2

Query  233  SAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFV  412
            S ++AF N+G+   T++E+  R+R GLL  +TR      ++I  AV+   GE  V  F+V
Sbjct  828  STSVAFDNEGSEIYTIIEVDTRDRPGLLHDLTRTLAASNVQISSAVIATYGEQVVDTFYV  887

Query  413  TDSHGGKIEND  445
             D  G K+ +D
Sbjct  888  KDMFGLKLFSD  898



>ref|XP_006484247.1| PREDICTED: uncharacterized protein LOC102622082 [Citrus sinensis]
Length=449

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   + TV+ + + N+ G+L  V +V   L L + +A +  +G +++  F VTD 
Sbjct  27   VVIDNEACKNATVIRVDSANKHGILLEVVQVLTDLNLIVTKAYISSDGCWFMDVFNVTDE  86

Query  422  HGGKIENDEELDRIRKAL  475
             G KI ++  LD IRK L
Sbjct  87   DGNKITDEGILDYIRKCL  104



>ref|WP_043336940.1| protein-PII uridylyltransferase, partial [Belnapia moabensis]
Length=859

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 52/106 (49%), Gaps = 6/106 (6%)
 Frame = +2

Query  176  ASRLRASDGGGQVATEPESSAAI------AFQNDGALDTTVVEIRARNRIGLLQVVTRVF  337
            + RLR  D   +V  EP    A+       F N  +   TV+E+  R+R GLL  VT   
Sbjct  750  SGRLRLRDEIRKVRREPARLRAVTVPPRVVFDNHASNTHTVIEVNGRDRPGLLHDVTAAI  809

Query  338  GVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELDRIRKAL  475
               GL+I  A +   G   V  F+V D  G K+EN+ +L  +R+A+
Sbjct  810  SDQGLQIASAHITTYGVRAVDVFYVKDVFGLKVENERKLAPLRRAV  855



>ref|XP_003574833.1| PREDICTED: uncharacterized protein LOC100821029 [Brachypodium 
distachyon]
Length=472

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+  +  T+V++ + N+ G L  V +V   L L I+RA +  +GE+++  F V D 
Sbjct  29   VTVDNESDITATLVKVDSANKYGTLLEVVQVLTDLKLTINRAYISSDGEWFMDVFHVVDE  88

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ + + +DRI ++L
Sbjct  89   EGNKLYDGQVIDRIEQSL  106



>gb|ETK33939.1| PII uridylyl-transferase [Microbispora sp. ATCC PTA-5024]
Length=769

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  254  NDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGK  433
            +D +  +TVVE+RA +R GLL  + R FG  GL +  A VE  G   V  F+V D  G  
Sbjct  691  DDASTTSTVVEVRAHDRPGLLWRIGRAFGECGLDVRAARVETLGAEAVDVFYVADRTGRP  750

Query  434  IENDEELDRIRKALM  478
            I ++++  ++R+ ++
Sbjct  751  ITDEQQRLQVREHVL  765



>ref|WP_021999856.1| uridylyltransferase [Acetobacter sp. CAG:977]
 emb|CCZ22220.1| uridylyltransferase [Acetobacter sp. CAG:977]
Length=828

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N  +   +++EI A + +G L  VTR   +  LKI  A +   G   V  F+VTD 
Sbjct  739  VLIDNSASDSCSLIEINASDAVGFLHTVTRAMTLADLKIVSAHIYTYGSKVVDVFYVTDQ  798

Query  422  HGGKIENDEELDRIRKALM  478
            +G KI +DE+  +I+ +L+
Sbjct  799  NGNKITDDEKAAQIKTSLL  817



>ref|WP_036328931.1| protein-PII uridylyltransferase [Microbispora sp. ATCC PTA-5024]
Length=768

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  254  NDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGK  433
            +D +  +TVVE+RA +R GLL  + R FG  GL +  A VE  G   V  F+V D  G  
Sbjct  690  DDASTTSTVVEVRAHDRPGLLWRIGRAFGECGLDVRAARVETLGAEAVDVFYVADRTGRP  749

Query  434  IENDEELDRIRKALM  478
            I ++++  ++R+ ++
Sbjct  750  ITDEQQRLQVREHVL  764



>ref|XP_002514875.1| amino acid binding protein, putative [Ricinus communis]
 gb|EEF47429.1| amino acid binding protein, putative [Ricinus communis]
Length=450

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N  +   T++++ + N+ G L  V +V   L L I RA +  +GE+++  F VTD 
Sbjct  26   VTVDNATSRKATLIKVDSANKRGSLLEVVQVLTDLDLLIRRAYISSDGEWFMDVFHVTDQ  85

Query  422  HGGKIENDEELDRIRKAL  475
            HG K+  D+  +RI+++L
Sbjct  86   HGNKLSEDDVAERIQQSL  103



>ref|XP_004242056.1| PREDICTED: uncharacterized protein LOC101244297 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322946.1| PREDICTED: uncharacterized protein LOC101244297 isoform X1 [Solanum 
lycopersicum]
Length=447

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            ++  N    D T+V++ + N+ G+L  V ++   L L I +A +  +G +++  F VTD 
Sbjct  25   VSVDNATCRDCTLVKVDSINKPGILLEVVQILSDLDLVITKAYISSDGGWFMDVFHVTDQ  84

Query  422  HGGKIENDEELDRIRKAL  475
            HG K+ ++  +  I KAL
Sbjct  85   HGNKVTDNNTIGHIEKAL  102



>ref|XP_011023953.1| PREDICTED: uncharacterized protein LOC105125277 [Populus euphratica]
Length=438

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  230  SSAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFF  409
            +S  +   ND     TV+++    R G L  V +V   L L + +A +  +G +++  F+
Sbjct  17   NSPRVVVDNDACEHATVIQVDTVKRQGALLEVVQVLTDLNLVMTKAYMSSDGVWFMNVFY  76

Query  410  VTDSHGGKIENDEELDRIRKAL  475
            VTD HG KI ++   + I KAL
Sbjct  77   VTDDHGNKIRDEGIFNCIEKAL  98



>ref|WP_042464165.1| protein-PII uridylyltransferase [Rhodovulum sulfidophilum]
Length=938

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 48/84 (57%), Gaps = 4/84 (5%)
 Frame = +2

Query  239  AIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTD  418
            +I F NDG+   T++E+  R+R GLL  +TRVF    + I  A++   G   V  F+V D
Sbjct  847  SITFDNDGSEIYTIIEVDTRDRPGLLYDLTRVFATSNIYIASAMIATYGAQVVDSFYVKD  906

Query  419  SHGGKI---ENDEELDR-IRKALM  478
            S G K+      E L+R +R+A++
Sbjct  907  SFGLKLYARSRQESLERKLREAIV  930



>ref|XP_010502395.1| PREDICTED: uncharacterized protein LOC104779692 [Camelina sativa]
Length=456

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   D TV+++ + N+ G+L  V +V   L L I +A +  +G +++  F VTD 
Sbjct  27   VVIDNEVCKDVTVIKVDSANKHGILLEVVQVLTELNLTIKKAYISSDGGWFMDVFNVTDH  86

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ +D  L+ IR +L
Sbjct  87   EGNKVTDDMVLEYIRTSL  104



>emb|CDY26682.1| BnaA06g13400D [Brassica napus]
Length=228

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +2

Query  236  AAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVT  415
            + +   ND   + TV+++ + N+ G+L  V +V   L L I +A +  +G +++  F VT
Sbjct  51   SKVVIDNDVYKNVTVIKVDSANKHGILLEVVQVLTDLNLTIKKAYISSDGGWFMDVFNVT  110

Query  416  DSHGGKIENDEELDRIRKAL  475
            +  G K+ ++  LD IRK+L
Sbjct  111  NQDGNKVNDEIVLDYIRKSL  130



>ref|XP_010936169.1| PREDICTED: uncharacterized protein LOC105055860 isoform X2 [Elaeis 
guineensis]
Length=569

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +2

Query  281  VEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELDR  460
            +++  RNR GLL  VTR F   GL + RA     GE  V  F+VTD+HGG++ + E ++ 
Sbjct  445  LDLCTRNRQGLLSDVTRAFRENGLSLTRAECTTRGETAVGTFYVTDAHGGEV-DPERMEA  503

Query  461  IRKAL  475
            +R+ +
Sbjct  504  VRREV  508



>gb|KDO70279.1| hypothetical protein CISIN_1g013090mg [Citrus sinensis]
Length=449

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   + TV+ + + N+ G+L  V +V   L L + +A +  +G +++  F VTD 
Sbjct  27   VVIDNEACKNATVIRVDSANKHGILLEVVQVLTDLNLIVTKAYISSDGCWFMDVFNVTDE  86

Query  422  HGGKIENDEELDRIRKAL  475
             G KI ++  LD IRK L
Sbjct  87   DGNKITDEGILDYIRKCL  104



>ref|WP_020546577.1| PII uridylyl-transferase [Nonomuraea coxensis]
Length=741

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = +2

Query  254  NDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGK  433
            +D +   TVVE+RA +R GLL  + R FG  GL +  A VE  G   V  F+V D  G  
Sbjct  663  DDASATATVVEVRAHDRPGLLWRIGRAFGECGLDVRAARVETLGAEAVDVFYVVDRAGRP  722

Query  434  IENDEELDRIRKALM  478
            + +D +  ++R  ++
Sbjct  723  LSDDAQRAQVRDHVL  737



>ref|XP_002280377.1| PREDICTED: uncharacterized protein LOC100256112 [Vitis vinifera]
 emb|CBI15703.3| unnamed protein product [Vitis vinifera]
Length=440

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND     TV+E+ + NR G+L  V +V   L L I +A +  +G +++  F VTD 
Sbjct  17   VVIDNDSCGHATVIEVDSANRHGILLQVVQVLTDLNLIITKAYISSDGGWFMDVFNVTDH  76

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++E L+ ++K L
Sbjct  77   DGNKLRDEEILNYLQKTL  94



>ref|XP_002302203.1| hypothetical protein POPTR_0002s07550g [Populus trichocarpa]
 ref|XP_006386335.1| ACT domain-containing family protein [Populus trichocarpa]
 gb|EEE81476.1| hypothetical protein POPTR_0002s07550g [Populus trichocarpa]
 gb|ERP64132.1| ACT domain-containing family protein [Populus trichocarpa]
Length=444

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            ++  N    D+T+V++ + N+ G+L  V +V   L L I +A +  +G +++  F VTD 
Sbjct  25   VSVDNTSCNDSTLVKVDSMNKPGILLEVVQVLTDLDLIITKAYISSDGGWFMDVFHVTDQ  84

Query  422  HGGKIENDEELDRIRKAL  475
             G KI + + +D I KAL
Sbjct  85   QGKKITDIKTIDYIEKAL  102



>ref|NP_565304.1| ACT domain-containing protein 5 [Arabidopsis thaliana]
 ref|NP_001030965.1| ACT domain-containing protein 5 [Arabidopsis thaliana]
 sp|Q9ZPQ8.2|ACR5_ARATH RecName: Full=ACT domain-containing protein ACR5; AltName: Full=Protein 
ACT DOMAIN REPEATS 5 [Arabidopsis thaliana]
 gb|AAD20075.2| putative uridylyl transferase [Arabidopsis thaliana]
 gb|AAN41308.1| putative uridylyl transferase [Arabidopsis thaliana]
 dbj|BAH20165.1| AT2G03730 [Arabidopsis thaliana]
 gb|AEC05742.1| ACT domain-containing protein 5 [Arabidopsis thaliana]
 gb|AEC05743.1| ACT domain-containing protein 5 [Arabidopsis thaliana]
Length=456

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   D TV+++ + N+ G+L  V +V   L L I +A +  +G +++  F VTD 
Sbjct  27   VVIDNEVCKDVTVIKVDSANKHGILLEVVQVLTELNLTIKKAYISSDGGWFMDVFNVTDQ  86

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  L+ IRK+L
Sbjct  87   DGNKVTDEIVLEYIRKSL  104



>ref|XP_006367493.1| PREDICTED: uncharacterized protein LOC102581080 isoform X1 [Solanum 
tuberosum]
Length=448

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   + TV+++ + N+ G+L  V +V   L L I +A +  +G +++  F VT+ 
Sbjct  27   VVIDNDSCKNATVIQVDSANKHGILLEVVQVLTDLNLVITKAYISSDGGWFMDVFNVTNQ  86

Query  422  HGGKIENDEELDRIRKAL  475
             G KI ++  LD I K+L
Sbjct  87   EGNKITDEAMLDYIMKSL  104



>emb|CDX88170.1| BnaA06g27610D [Brassica napus]
Length=499

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/80 (28%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +2

Query  236  AAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVT  415
             ++   ND   D TVV++ + N+ GLL  V ++   + L I ++ +  +G +++  F V 
Sbjct  25   CSVYIDNDSIQDCTVVKVNSENKQGLLLEVVQILTDMNLIITKSYISSDGGWFMDVFHVK  84

Query  416  DSHGGKIENDEELDRIRKAL  475
            D HG K+ +   ++ I+ A+
Sbjct  85   DEHGSKLTDKTVINHIKHAI  104



>emb|CAN80840.1| hypothetical protein VITISV_043834 [Vitis vinifera]
Length=440

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND     TV+E+ + NR G+L  V +V   L L I +A +  +G +++  F VTD 
Sbjct  17   VVIDNDSCGHATVIEVDSANRHGILLQVVQVLTDLNLIITKAYISSDGGWFMDVFNVTDH  76

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++E L+ ++K L
Sbjct  77   DGNKLRDEEILNYLQKTL  94



>gb|KJB50528.1| hypothetical protein B456_008G175500 [Gossypium raimondii]
Length=459

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   + TV+ + + NR G+L  V ++   + L I +A +  +G +++  F VTD 
Sbjct  39   VVIDNESCKNATVIRVDSANRHGILLEVVQILTDINLIITKAYISSDGNWFMDVFNVTDQ  98

Query  422  HGGKIENDEELDRIRKAL  475
             G KI ++  LD IRK+L
Sbjct  99   GGNKILDEGILDYIRKSL  116



>emb|CDX95965.1| BnaA07g27660D [Brassica napus]
Length=455

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   + TV+ + + N  G+L  V ++   L L I +A +  +G +++  F VTD 
Sbjct  28   VVIDNDSCKEATVIRVDSANEYGILLEVVQILTDLDLTITKAYISSDGGWFMDVFNVTDQ  87

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD I+K+L
Sbjct  88   DGNKVTDEVVLDYIQKSL  105



>gb|AAM93430.1| ACR5 [Arabidopsis thaliana]
Length=446

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   D TV+++ + N+ G+L  V +V   L L I +A +  +G +++  F VTD 
Sbjct  17   VVIDNEVCKDVTVIKVDSANKHGILLEVVQVLTELNLTIKKAYISSDGGWFMDVFNVTDQ  76

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  L+ IRK+L
Sbjct  77   DGNKVTDEIVLEYIRKSL  94



>ref|XP_010936170.1| PREDICTED: uncharacterized protein LOC105055860 isoform X3 [Elaeis 
guineensis]
Length=501

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +2

Query  281  VEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDSHGGKIENDEELDR  460
            +++  RNR GLL  VTR F   GL + RA     GE  V  F+VTD+HGG++ + E ++ 
Sbjct  377  LDLCTRNRQGLLSDVTRAFRENGLSLTRAECTTRGETAVGTFYVTDAHGGEV-DPERMEA  435

Query  461  IRKAL  475
            +R+ +
Sbjct  436  VRREV  440



>ref|XP_006291103.1| hypothetical protein CARUB_v10017215mg [Capsella rubella]
 gb|EOA24001.1| hypothetical protein CARUB_v10017215mg [Capsella rubella]
Length=456

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   D TV+++ + N+ G+L  V +V   L L I +A +  +G +++  F VTD 
Sbjct  27   VVIDNEVCKDVTVIKVDSANKHGILLEVVQVLTELNLTIKKAYISSDGGWFMDVFNVTDQ  86

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ +D  L+ IR +L
Sbjct  87   EGNKVTDDIVLEYIRTSL  104



>ref|XP_009105454.1| PREDICTED: uncharacterized protein LOC103831311 isoform X1 [Brassica 
rapa]
Length=454

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   + TV+ + + N  G+L  V ++   L L I +A +  +G +++  F VTD 
Sbjct  27   VVIDNDSCKEATVIRVDSANEYGILLEVVQILTDLDLTITKAYISSDGGWFMDVFNVTDQ  86

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD I+K+L
Sbjct  87   DGNKVTDEVVLDYIQKSL  104



>ref|WP_029734360.1| hypothetical protein, partial [Deferrisoma camini]
Length=802

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = +2

Query  224  PESSAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKR  403
            P     +A +N  +   TVVEIRA +R+GLL  V R     G  I  A +       V  
Sbjct  709  PTVPPEVAVENGASRRYTVVEIRAADRLGLLYDVARTLAEEGCTIRIAKITTSLNRAVDA  768

Query  404  FFVTDSH-GGKIENDEELDRIRKALM  478
            F+V D+  GGKI   E ++R+R+AL+
Sbjct  769  FYVEDAEAGGKITEPERVERLRRALV  794



>ref|XP_006367494.1| PREDICTED: uncharacterized protein LOC102581080 isoform X2 [Solanum 
tuberosum]
Length=438

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   + TV+++ + N+ G+L  V +V   L L I +A +  +G +++  F VT+ 
Sbjct  17   VVIDNDSCKNATVIQVDSANKHGILLEVVQVLTDLNLVITKAYISSDGGWFMDVFNVTNQ  76

Query  422  HGGKIENDEELDRIRKAL  475
             G KI ++  LD I K+L
Sbjct  77   EGNKITDEAMLDYIMKSL  94



>ref|XP_009105455.1| PREDICTED: uncharacterized protein LOC103831311 isoform X2 [Brassica 
rapa]
Length=450

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND   + TV+ + + N  G+L  V ++   L L I +A +  +G +++  F VTD 
Sbjct  23   VVIDNDSCKEATVIRVDSANEYGILLEVVQILTDLDLTITKAYISSDGGWFMDVFNVTDQ  82

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD I+K+L
Sbjct  83   DGNKVTDEVVLDYIQKSL  100



>ref|XP_011027407.1| PREDICTED: uncharacterized protein LOC105127720 isoform X1 [Populus 
euphratica]
 ref|XP_011027408.1| PREDICTED: uncharacterized protein LOC105127720 isoform X1 [Populus 
euphratica]
 ref|XP_011027409.1| PREDICTED: uncharacterized protein LOC105127720 isoform X1 [Populus 
euphratica]
 ref|XP_011027410.1| PREDICTED: uncharacterized protein LOC105127720 isoform X1 [Populus 
euphratica]
 ref|XP_011027411.1| PREDICTED: uncharacterized protein LOC105127720 isoform X1 [Populus 
euphratica]
 ref|XP_011027412.1| PREDICTED: uncharacterized protein LOC105127720 isoform X1 [Populus 
euphratica]
Length=444

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            ++  N    D+T+V++ + N+ G+L  V +V   L L I +A +  +G +++  F VTD 
Sbjct  25   VSVDNTSCNDSTLVKVDSMNKPGILLEVVQVLTDLDLIITKAYISSDGGWFMDVFHVTDQ  84

Query  422  HGGKIENDEELDRIRKAL  475
             G KI + + +D I KAL
Sbjct  85   QGKKITDIKTIDYIEKAL  102



>ref|XP_004498368.1| PREDICTED: uncharacterized protein LOC101494165 isoform X3 [Cicer 
arietinum]
Length=369

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            ++  ND   D T+++I + N+ G+L  V ++   L   I +A +  +G +++  F VTD 
Sbjct  25   VSMDNDSCPDCTLIKIDSVNKPGILLEVVQILTDLDFIITKAYISSDGGWFMDVFHVTDQ  84

Query  422  HGGKIENDEELDRIRKAL  475
             G KI + + +D I KAL
Sbjct  85   QGKKITDSKIIDFIEKAL  102



>ref|XP_004490255.1| PREDICTED: uncharacterized protein LOC101508719 isoform X6 [Cicer 
arietinum]
Length=442

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   + TV+ + + N+ G+L  V ++   L L I +A +  +G +++  F VTD 
Sbjct  24   VVIDNEACKNATVIRVDSANKHGILLEVVQILTDLNLIITKAYISSDGGWFMDVFNVTDQ  83

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD IRK+L
Sbjct  84   DGNKVTDEAILDYIRKSL  101



>ref|XP_010550296.1| PREDICTED: uncharacterized protein LOC104821193, partial [Tarenaya 
hassleriana]
Length=179

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (52%), Gaps = 0/81 (0%)
 Frame = +2

Query  233  SAAIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFV  412
            S  +   N+     TV+ + + N  G+L  V ++   L L + +A +  +G +++  F V
Sbjct  10   SPRVVIDNESCKTATVIRVDSANEYGILLEVVQILSDLNLTVSKAYISSDGGWFMDVFNV  69

Query  413  TDSHGGKIENDEELDRIRKAL  475
            TD  G K+ ++  LD I K+L
Sbjct  70   TDQEGNKVTDEIVLDYIHKSL  90



>ref|XP_004490254.1| PREDICTED: uncharacterized protein LOC101508719 isoform X5 [Cicer 
arietinum]
Length=450

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   + TV+ + + N+ G+L  V ++   L L I +A +  +G +++  F VTD 
Sbjct  32   VVIDNEACKNATVIRVDSANKHGILLEVVQILTDLNLIITKAYISSDGGWFMDVFNVTDQ  91

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD IRK+L
Sbjct  92   DGNKVTDEAILDYIRKSL  109



>ref|XP_004490253.1| PREDICTED: uncharacterized protein LOC101508719 isoform X4 [Cicer 
arietinum]
Length=450

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   + TV+ + + N+ G+L  V ++   L L I +A +  +G +++  F VTD 
Sbjct  32   VVIDNEACKNATVIRVDSANKHGILLEVVQILTDLNLIITKAYISSDGGWFMDVFNVTDQ  91

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD IRK+L
Sbjct  92   DGNKVTDEAILDYIRKSL  109



>ref|WP_012853747.1| PII uridylyl-transferase [Thermomonospora curvata]
 gb|ACY98963.1| UTP-GlnB uridylyltransferase, GlnD [Thermomonospora curvata DSM 
43183]
Length=780

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 42/79 (53%), Gaps = 0/79 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +    D +   TVVE+RA +R GLL  + +  G  GL++D+A V+  G   V  F+V D+
Sbjct  698  VTIVEDASDTATVVEVRAHDRPGLLWRIGQAIGACGLQVDKARVDTLGAEAVDVFYVVDA  757

Query  422  HGGKIENDEELDRIRKALM  478
             G  +     L  +R+ ++
Sbjct  758  QGRPLREPAALSALREKVL  776



>ref|WP_007426993.1| PII uridylyl-transferase [Oceaniovalibus guishaninsula]
 gb|EKE43860.1| PII uridylyl-transferase [Oceaniovalibus guishaninsula JLT2003]
Length=930

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 39/69 (57%), Gaps = 0/69 (0%)
 Frame = +2

Query  239  AIAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTD  418
            +IAF N+G+   T+VE+  R+R GLL  +TR   +  + I  AV+   G   V  F+V D
Sbjct  838  SIAFDNEGSEIYTIVEVDTRDRPGLLYDLTRTLAIAHISISSAVIATYGAQVVDTFYVKD  897

Query  419  SHGGKIEND  445
              G KI +D
Sbjct  898  MFGLKIYSD  906



>ref|WP_040494645.1| hypothetical protein, partial [Ilumatobacter nonamiensis]
Length=716

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 43/80 (54%), Gaps = 0/80 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            + F   G+ + TV+E+RA +++G+L  +T+  G LGL I  A V+  G   V  F+V   
Sbjct  634  VKFIEGGSSNATVIEVRAVSKVGILHRITKALGELGLDIRHATVQTIGMEVVDTFYVRTR  693

Query  422  HGGKIENDEELDRIRKALMH  481
             G  + +      I KAL+H
Sbjct  694  AGDLVMSSPHRKEIHKALLH  713



>ref|XP_004490252.1| PREDICTED: uncharacterized protein LOC101508719 isoform X3 [Cicer 
arietinum]
Length=472

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   N+   + TV+ + + N+ G+L  V ++   L L I +A +  +G +++  F VTD 
Sbjct  54   VVIDNEACKNATVIRVDSANKHGILLEVVQILTDLNLIITKAYISSDGGWFMDVFNVTDQ  113

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD IRK+L
Sbjct  114  DGNKVTDEAILDYIRKSL  131



>ref|XP_010470880.1| PREDICTED: uncharacterized protein LOC104750738 [Camelina sativa]
Length=455

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +2

Query  242  IAFQNDGALDTTVVEIRARNRIGLLQVVTRVFGVLGLKIDRAVVEFEGEFYVKRFFVTDS  421
            +   ND     TV+ + + N  G+L  V ++   L L I +A +  +G +++  F VTD 
Sbjct  27   VVIDNDSCKKATVIRVDSANEYGILLEVVQILTDLNLTISKAYISSDGGWFMDVFNVTDQ  86

Query  422  HGGKIENDEELDRIRKAL  475
             G K+ ++  LD I+K+L
Sbjct  87   DGNKVTDEVVLDYIQKSL  104



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 941888806496