BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10419

Length=1411
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006344398.1|  PREDICTED: pantothenate kinase 2-like isofor...    694   0.0      Solanum tuberosum [potatoes]
ref|XP_009793996.1|  PREDICTED: pantothenate kinase 2 isoform X1        692   0.0      Nicotiana sylvestris
ref|XP_004236210.1|  PREDICTED: pantothenate kinase 2                   691   0.0      
ref|XP_009793998.1|  PREDICTED: pantothenate kinase 2 isoform X2        689   0.0      Nicotiana sylvestris
ref|XP_007210380.1|  hypothetical protein PRUPE_ppa001094mg             689   0.0      Prunus persica
ref|XP_009600890.1|  PREDICTED: pantothenate kinase 2                   688   0.0      
ref|XP_010243061.1|  PREDICTED: pantothenate kinase 2 isoform X1        688   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_007036235.1|  Pantothenate kinase 2 isoform 2                    687   0.0      
ref|XP_002511391.1|  Pantothenate kinase, putative                      685   0.0      
ref|XP_004298946.1|  PREDICTED: pantothenate kinase 2                   684   0.0      Fragaria vesca subsp. vesca
ref|XP_011071870.1|  PREDICTED: pantothenate kinase 2                   683   0.0      Sesamum indicum [beniseed]
gb|KJB53155.1|  hypothetical protein B456_008G295400                    676   0.0      Gossypium raimondii
ref|XP_008239770.1|  PREDICTED: pantothenate kinase 2                   681   0.0      Prunus mume [ume]
emb|CDP12422.1|  unnamed protein product                                677   0.0      Coffea canephora [robusta coffee]
ref|XP_002279079.1|  PREDICTED: pantothenate kinase 2                   681   0.0      Vitis vinifera
gb|KCW49280.1|  hypothetical protein EUGRSUZ_K02840                     680   0.0      Eucalyptus grandis [rose gum]
ref|XP_012080051.1|  PREDICTED: pantothenate kinase 2                   680   0.0      Jatropha curcas
gb|EYU42581.1|  hypothetical protein MIMGU_mgv1a001050mg                679   0.0      Erythranthe guttata [common monkey flower]
ref|XP_010037560.1|  PREDICTED: pantothenate kinase 2                   679   0.0      Eucalyptus grandis [rose gum]
gb|KJB53156.1|  hypothetical protein B456_008G295400                    677   0.0      Gossypium raimondii
ref|XP_008356598.1|  PREDICTED: pantothenate kinase 2-like              677   0.0      
emb|CBI15019.3|  unnamed protein product                                678   0.0      Vitis vinifera
ref|XP_006439829.1|  hypothetical protein CICLE_v10018751mg             672   0.0      
gb|KCW49278.1|  hypothetical protein EUGRSUZ_K02840                     675   0.0      Eucalyptus grandis [rose gum]
gb|KJB53157.1|  hypothetical protein B456_008G295400                    673   0.0      Gossypium raimondii
ref|XP_009363012.1|  PREDICTED: pantothenate kinase 2                   674   0.0      Pyrus x bretschneideri [bai li]
ref|XP_011028555.1|  PREDICTED: pantothenate kinase 2-like              674   0.0      Populus euphratica
ref|XP_006439830.1|  hypothetical protein CICLE_v10018751mg             672   0.0      Citrus clementina [clementine]
ref|XP_007036234.1|  Pantothenate kinase 2 isoform 1                    674   0.0      
ref|XP_008438456.1|  PREDICTED: pantothenate kinase 2                   671   0.0      Cucumis melo [Oriental melon]
ref|XP_004152477.1|  PREDICTED: pantothenate kinase 2                   671   0.0      Cucumis sativus [cucumbers]
gb|KHG28314.1|  hypothetical protein F383_13494                         671   0.0      Gossypium arboreum [tree cotton]
gb|KJB39191.1|  hypothetical protein B456_007G001600                    661   0.0      Gossypium raimondii
ref|XP_008795923.1|  PREDICTED: pantothenate kinase 2-like isofor...    667   0.0      Phoenix dactylifera
ref|XP_008795922.1|  PREDICTED: pantothenate kinase 2-like isofor...    667   0.0      
ref|XP_011001529.1|  PREDICTED: pantothenate kinase 2-like              666   0.0      Populus euphratica
ref|XP_010678776.1|  PREDICTED: pantothenate kinase 2                   665   0.0      Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010101220.1|  Pantothenate kinase 2                              665   0.0      Morus notabilis
ref|XP_010940070.1|  PREDICTED: pantothenate kinase 2-like isofor...    664   0.0      Elaeis guineensis
ref|XP_010940068.1|  PREDICTED: pantothenate kinase 2-like isofor...    664   0.0      Elaeis guineensis
ref|XP_002318651.1|  hypothetical protein POPTR_0012s08310g             662   0.0      
ref|XP_008393029.1|  PREDICTED: pantothenate kinase 2                   661   0.0      
gb|KJB39190.1|  hypothetical protein B456_007G001600                    662   0.0      Gossypium raimondii
tpg|DAA62461.1|  TPA: hypothetical protein ZEAMMB73_754388              642   0.0      
gb|KHN19302.1|  Pantothenate kinase 2                                   642   0.0      Glycine soja [wild soybean]
ref|XP_007138072.1|  hypothetical protein PHAVU_009G178200g             656   0.0      Phaseolus vulgaris [French bean]
ref|XP_004957459.1|  PREDICTED: pantothenate kinase 2-like              654   0.0      Setaria italica
gb|KHN48232.1|  Pantothenate kinase 2                                   649   0.0      Glycine soja [wild soybean]
ref|XP_009403915.1|  PREDICTED: pantothenate kinase 2                   647   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004501924.1|  PREDICTED: pantothenate kinase 2-like isofor...    647   0.0      Cicer arietinum [garbanzo]
ref|XP_003542534.2|  PREDICTED: pantothenate kinase 2-like isofor...    647   0.0      
ref|XP_006594169.1|  PREDICTED: pantothenate kinase 2-like isofor...    647   0.0      
ref|XP_008782481.1|  PREDICTED: pantothenate kinase 2-like              646   0.0      
ref|XP_003576771.1|  PREDICTED: pantothenate kinase 2                   645   0.0      Brachypodium distachyon [annual false brome]
gb|EEC84941.1|  hypothetical protein OsI_32156                          645   0.0      Oryza sativa Indica Group [Indian rice]
sp|Q0J035.2|PANK2_ORYSJ  RecName: Full=Pantothenate kinase 2; Alt...    645   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_003528148.1|  PREDICTED: pantothenate kinase 2-like              644   0.0      Glycine max [soybeans]
ref|XP_008652990.1|  PREDICTED: pantothenate kinase 2                   644   0.0      
ref|XP_006660887.1|  PREDICTED: pantothenate kinase 2-like              641   0.0      
gb|EPS64631.1|  hypothetical protein M569_10149                         631   0.0      Genlisea aurea
ref|XP_002460569.1|  hypothetical protein SORBIDRAFT_02g030920          641   0.0      Sorghum bicolor [broomcorn]
ref|XP_003601259.1|  Pantothenate kinase                                639   0.0      Medicago truncatula
ref|XP_010447427.1|  PREDICTED: pantothenate kinase 2 isoform X1        639   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010936708.1|  PREDICTED: pantothenate kinase 2-like              638   0.0      Elaeis guineensis
ref|XP_010534230.1|  PREDICTED: pantothenate kinase 2                   638   0.0      Tarenaya hassleriana [spider flower]
ref|NP_001031768.1|  pantothenate kinase 2                              633   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432761.1|  PREDICTED: pantothenate kinase 2-like              637   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010437940.1|  PREDICTED: pantothenate kinase 2-like              637   0.0      Camelina sativa [gold-of-pleasure]
emb|CDX75226.1|  BnaA01g04760D                                          637   0.0      
pir||T05410  hypothetical protein F10M6.180 - Arabidopsis thaliana      634   0.0   
ref|XP_009126332.1|  PREDICTED: pantothenate kinase 2                   636   0.0      Brassica rapa
ref|XP_006840740.2|  PREDICTED: pantothenate kinase 2 isoform X1        635   0.0      
gb|ERN02415.1|  hypothetical protein AMTR_s00096p00130150               635   0.0      Amborella trichopoda
ref|XP_002867254.1|  ATPANK2                                            634   0.0      
emb|CDX68824.1|  BnaC01g06290D                                          634   0.0      
ref|NP_194945.3|  pantothenate kinase 2                                 634   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EEE70109.1|  hypothetical protein OsJ_30119                          632   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_011622021.1|  PREDICTED: pantothenate kinase 2 isoform X2        632   0.0      
gb|AAM20690.1|  putative protein                                        632   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412505.1|  hypothetical protein EUTSA_v10024357mg             632   0.0      Eutrema salsugineum [saltwater cress]
ref|XP_006282554.1|  hypothetical protein CARUB_v10004099mg             632   0.0      Capsella rubella
gb|KFK29830.1|  hypothetical protein AALP_AA7G184400                    630   0.0      Arabis alpina [alpine rockcress]
ref|XP_009108890.1|  PREDICTED: pantothenate kinase 2                   629   0.0      Brassica rapa
gb|EMT07573.1|  Pantothenate kinase 2                                   623   0.0      
gb|KHN18454.1|  Pantothenate kinase 2                                   612   0.0      Glycine soja [wild soybean]
ref|XP_006600639.1|  PREDICTED: pantothenate kinase 2-like isofor...    615   0.0      Glycine max [soybeans]
ref|XP_006600640.1|  PREDICTED: pantothenate kinase 2-like isofor...    614   0.0      Glycine max [soybeans]
gb|EMS60500.1|  Pantothenate kinase 2                                   611   0.0      Triticum urartu
gb|KDO69623.1|  hypothetical protein CISIN_1g042742mg                   602   0.0      Citrus sinensis [apfelsine]
ref|XP_007155432.1|  hypothetical protein PHAVU_003G200700g             599   0.0      Phaseolus vulgaris [French bean]
gb|ACN39905.1|  unknown                                                 588   0.0      Picea sitchensis
gb|ERN02412.1|  hypothetical protein AMTR_s00096p00126400               568   0.0      Amborella trichopoda
ref|XP_006840737.2|  PREDICTED: pantothenate kinase 2 isoform X1        568   0.0      Amborella trichopoda
ref|XP_011622019.1|  PREDICTED: pantothenate kinase 2 isoform X2        568   0.0      Amborella trichopoda
ref|XP_001757682.1|  predicted protein                                  540   2e-180   
ref|XP_010651426.1|  PREDICTED: pantothenate kinase 1                   520   9e-179   Vitis vinifera
gb|KHN34316.1|  Pantothenate kinase 2                                   513   8e-178   Glycine soja [wild soybean]
ref|XP_007044671.1|  Pantothenate kinase 2                              511   2e-175   
ref|XP_012085397.1|  PREDICTED: pantothenate kinase 1                   510   3e-175   Jatropha curcas
gb|KJB50223.1|  hypothetical protein B456_008G159500                    509   1e-174   Gossypium raimondii
gb|KHG03138.1|  hypothetical protein F383_26744                         508   2e-174   Gossypium arboreum [tree cotton]
ref|XP_010100448.1|  Pantothenate kinase 2                              496   1e-169   Morus notabilis
ref|XP_007222331.1|  hypothetical protein PRUPE_ppa005996mg             496   2e-169   Prunus persica
ref|XP_006438369.1|  hypothetical protein CICLE_v10031717mg             495   3e-169   Citrus clementina [clementine]
ref|XP_002314614.1|  pantothenate kinase 2 family protein               494   5e-169   Populus trichocarpa [western balsam poplar]
ref|XP_010044613.1|  PREDICTED: pantothenate kinase 1                   494   6e-169   Eucalyptus grandis [rose gum]
gb|KCW86704.1|  hypothetical protein EUGRSUZ_B03313                     493   1e-168   Eucalyptus grandis [rose gum]
ref|XP_008221833.1|  PREDICTED: pantothenate kinase 1                   494   2e-168   Prunus mume [ume]
ref|XP_002525366.1|  Pantothenate kinase, putative                      492   4e-168   Ricinus communis
ref|XP_011071090.1|  PREDICTED: pantothenate kinase 1                   491   5e-168   Sesamum indicum [beniseed]
ref|XP_011011123.1|  PREDICTED: pantothenate kinase 1-like isofor...    490   2e-167   Populus euphratica
ref|NP_001063766.1|  Os09g0533100                                       502   5e-167   
ref|XP_004297480.1|  PREDICTED: pantothenate kinase 1                   487   3e-166   Fragaria vesca subsp. vesca
ref|XP_003552023.1|  PREDICTED: pantothenate kinase 2-like              487   4e-166   Glycine max [soybeans]
ref|XP_008353021.1|  PREDICTED: pantothenate kinase 1-like              486   6e-166   Malus domestica [apple tree]
ref|XP_002312701.2|  hypothetical protein POPTR_0008s19380g             482   3e-164   Populus trichocarpa [western balsam poplar]
ref|XP_010682543.1|  PREDICTED: pantothenate kinase 1                   483   3e-164   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007153743.1|  hypothetical protein PHAVU_003G061300g             480   2e-163   Phaseolus vulgaris [French bean]
emb|CDP13172.1|  unnamed protein product                                480   4e-163   Coffea canephora [robusta coffee]
ref|XP_011034129.1|  PREDICTED: pantothenate kinase 1-like isofor...    478   8e-163   Populus euphratica
ref|XP_009621068.1|  PREDICTED: pantothenate kinase 1                   479   1e-162   Nicotiana tomentosiformis
ref|XP_003532004.1|  PREDICTED: pantothenate kinase 2-like              475   3e-161   Glycine max [soybeans]
ref|XP_004509755.1|  PREDICTED: pantothenate kinase 2-like              473   1e-160   Cicer arietinum [garbanzo]
ref|XP_009792509.1|  PREDICTED: pantothenate kinase 1                   473   2e-160   Nicotiana sylvestris
gb|KEH20031.1|  pantothenate kinase                                     469   5e-159   Medicago truncatula
ref|XP_011086577.1|  PREDICTED: pantothenate kinase 1-like isofor...    468   2e-158   Sesamum indicum [beniseed]
ref|XP_008389660.1|  PREDICTED: LOW QUALITY PROTEIN: pantothenate...    467   2e-158   Malus domestica [apple tree]
ref|XP_006477543.1|  PREDICTED: pantothenate kinase 2-like              483   2e-158   
ref|NP_001234124.1|  partially similar to pantothenate kinase fam...    468   2e-158   Solanum lycopersicum
ref|XP_006356432.1|  PREDICTED: pantothenate kinase 1-like              466   1e-157   Solanum tuberosum [potatoes]
gb|EYU28448.1|  hypothetical protein MIMGU_mgv1a008312mg                457   1e-154   Erythranthe guttata [common monkey flower]
ref|XP_002311775.2|  pantothenate kinase 2 family protein               455   5e-154   
gb|KJB50225.1|  hypothetical protein B456_008G159500                    452   2e-153   Gossypium raimondii
ref|XP_010447428.1|  PREDICTED: pantothenate kinase 2 isoform X2        461   3e-151   Camelina sativa [gold-of-pleasure]
ref|XP_008446201.1|  PREDICTED: pantothenate kinase 1                   448   6e-151   Cucumis melo [Oriental melon]
ref|XP_004135249.1|  PREDICTED: pantothenate kinase 1                   444   2e-149   Cucumis sativus [cucumbers]
gb|KJB50224.1|  hypothetical protein B456_008G159500                    438   1e-147   Gossypium raimondii
gb|KJB50222.1|  hypothetical protein B456_008G159500                    433   2e-146   Gossypium raimondii
gb|KHG02710.1|  hypothetical protein F383_25888                         449   9e-146   Gossypium arboreum [tree cotton]
ref|XP_011011124.1|  PREDICTED: pantothenate kinase 1-like isofor...    431   4e-145   Populus euphratica
ref|XP_010554952.1|  PREDICTED: LOW QUALITY PROTEIN: pantothenate...    431   4e-144   
gb|KEH20032.1|  pantothenate kinase                                     415   9e-139   Medicago truncatula
ref|XP_006300508.1|  hypothetical protein CARUB_v10020467mg             410   3e-136   Capsella rubella
ref|XP_002886619.1|  ATCOAA/ATPANK1                                     408   2e-135   Arabidopsis lyrata subsp. lyrata
ref|XP_009113211.1|  PREDICTED: pantothenate kinase 1                   407   5e-135   Brassica rapa
ref|NP_176247.2|  Pantothenate kinase 1                                 405   1e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417978.1|  PREDICTED: pantothenate kinase 1-like              405   3e-134   Camelina sativa [gold-of-pleasure]
gb|KFK40789.1|  hypothetical protein AALP_AA2G041200                    405   4e-134   Arabis alpina [alpine rockcress]
emb|CDY53055.1|  BnaA09g14200D                                          407   1e-132   Brassica napus [oilseed rape]
dbj|BAD33319.1|  putative pantothenate kinase 4                         411   1e-132   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010510949.1|  PREDICTED: pantothenate kinase 1-like              400   1e-132   Camelina sativa [gold-of-pleasure]
ref|XP_005649526.1|  fumble-domain-containing protein                   415   8e-132   Coccomyxa subellipsoidea C-169
ref|XP_011034131.1|  PREDICTED: pantothenate kinase 1-like isofor...    397   1e-131   Populus euphratica
emb|CDY47225.1|  BnaC09g14740D                                          405   2e-131   Brassica napus [oilseed rape]
pir||T02294  hypothetical protein T13D8.31 - Arabidopsis thaliana       395   3e-130
ref|XP_002991207.1|  hypothetical protein SELMODRAFT_161467             405   5e-130   
ref|XP_006579568.1|  PREDICTED: pantothenate kinase 2-like              388   7e-130   
emb|CCD74517.1|  Pantothenate kinase 1                                  396   3e-128   Arabidopsis halleri subsp. halleri
ref|XP_005849803.1|  hypothetical protein CHLNCDRAFT_34679              401   3e-127   Chlorella variabilis
ref|XP_006374524.1|  hypothetical protein POPTR_0015s08830g             397   4e-127   
ref|XP_002951581.1|  hypothetical protein VOLCADRAFT_61514              400   7e-127   Volvox carteri f. nagariensis
ref|XP_011395801.1|  Pantothenate kinase 2                              400   8e-126   Auxenochlorella protothecoides
ref|XP_011086582.1|  PREDICTED: pantothenate kinase 1-like isofor...    379   2e-125   
ref|XP_011086580.1|  PREDICTED: pantothenate kinase 1-like isofor...    379   1e-124   
ref|XP_011086579.1|  PREDICTED: pantothenate kinase 1-like isofor...    378   2e-124   
ref|XP_008789287.1|  PREDICTED: pantothenate kinase 1-like              387   3e-124   Phoenix dactylifera
ref|XP_011086581.1|  PREDICTED: pantothenate kinase 1-like isofor...    376   4e-124   
ref|XP_010932472.1|  PREDICTED: pantothenate kinase 1 isoform X2        382   1e-123   
ref|XP_010932471.1|  PREDICTED: pantothenate kinase 1 isoform X1        382   8e-122   Elaeis guineensis
ref|XP_002991270.1|  hypothetical protein SELMODRAFT_269774             380   8e-121   
ref|XP_001768632.1|  predicted protein                                  380   2e-120   
gb|EPS71980.1|  hypothetical protein M569_02777                         369   2e-118   Genlisea aurea
gb|ADN33844.1|  pantotenate kinase family protein                       359   1e-117   Cucumis melo subsp. melo
ref|XP_009419129.1|  PREDICTED: pantothenate kinase 1-like              371   2e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002507494.1|  pantothenate kinase                                377   8e-117   Micromonas commoda
ref|XP_001417152.1|  predicted protein                                  369   2e-115   Ostreococcus lucimarinus CCE9901
ref|XP_003078604.1|  eukaryotic pantothenate kinase family protei...    367   1e-113   Ostreococcus tauri
ref|XP_003056202.1|  pantothenate kinase                                357   1e-109   Micromonas pusilla CCMP1545
gb|AFW85383.1|  hypothetical protein ZEAMMB73_434998                    340   5e-108   
ref|XP_004964926.1|  PREDICTED: pantothenate kinase 2-like isofor...    344   4e-107   Setaria italica
gb|KDD75300.1|  fumble                                                  331   1e-106   Helicosporidium sp. ATCC 50920
gb|KDO82397.1|  hypothetical protein CISIN_1g025826mg                   327   5e-106   Citrus sinensis [apfelsine]
ref|NP_001147318.1|  LOC100280926                                       339   2e-105   Zea mays [maize]
emb|CEG69228.1|  Putative Pantothenate kinase                           328   9e-105   Rhizopus microsporus
ref|XP_006392166.1|  hypothetical protein EUTSA_v10023550mg             326   5e-104   
gb|EMT19063.1|  Pantothenate kinase 2                                   336   8e-104   
ref|XP_635721.1|  pantothenate kinase                                   336   1e-103   Dictyostelium discoideum AX4
ref|XP_003287654.1|  hypothetical protein DICPUDRAFT_54979              331   2e-103   Dictyostelium purpureum
ref|XP_003564125.1|  PREDICTED: pantothenate kinase 1 isoform X2        334   2e-103   Brachypodium distachyon [annual false brome]
ref|XP_010227876.1|  PREDICTED: pantothenate kinase 1 isoform X1        334   3e-103   Brachypodium distachyon [annual false brome]
dbj|BAK03535.1|  predicted protein                                      334   3e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPB91645.1|  pantothenate kinase                                     324   1e-102   Mucor circinelloides f. circinelloides 1006PhL
gb|EIE83745.1|  pantothenate kinase                                     323   3e-102   Rhizopus delemar RA 99-880
emb|CDY40427.1|  BnaA04g20900D                                          320   3e-102   Brassica napus [oilseed rape]
emb|CEP10507.1|  hypothetical protein                                   320   6e-101   Parasitella parasitica
ref|XP_010473224.1|  PREDICTED: pantothenate kinase 1                   315   7e-101   Camelina sativa [gold-of-pleasure]
ref|XP_007512793.1|  predicted protein                                  336   1e-100   Bathycoccus prasinos
ref|NP_001057098.1|  Os06g0207000                                       325   7e-100   
gb|EEE65295.1|  hypothetical protein OsJ_20527                          325   8e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002485965.1|  pantothenate kinase, putative                      318   1e-99    Talaromyces stipitatus ATCC 10500
gb|KKA22937.1|  Pantothenate kinase                                     315   2e-98    Rasamsonia emersonii CBS 393.64
gb|KDO82398.1|  hypothetical protein CISIN_1g025826mg                   306   3e-98    Citrus sinensis [apfelsine]
ref|XP_006656748.1|  PREDICTED: pantothenate kinase 2-like              314   8e-96    
gb|EPS71982.1|  pantothenate kinase family protein-like protein         300   2e-95    Genlisea aurea
dbj|GAM43950.1|  fumble family pantothenate kinase                      306   7e-95    Talaromyces cellulolyticus
gb|KIX01921.1|  pantothenate kinase                                     303   4e-94    Rhinocladiella mackenziei CBS 650.93
ref|XP_754888.1|  pantothenate kinase                                   303   1e-93    Aspergillus fumigatus Af293
gb|EFA83432.1|  pantothenate kinase                                     308   2e-93    Heterostelium album PN500
gb|KFX49665.1|  Pantothenate kinase                                     302   2e-93    Talaromyces marneffei PM1
ref|XP_002152387.1|  pantothenate kinase, putative                      302   2e-93    Talaromyces marneffei ATCC 18224
ref|XP_001400486.2|  pantothenate kinase                                301   2e-93    Aspergillus niger CBS 513.88
gb|KFH68550.1|  pantothenate kinase                                     300   3e-93    Mortierella verticillata NRRL 6337
ref|XP_001270736.1|  pantothenate kinase, putative                      301   4e-93    Aspergillus clavatus NRRL 1
ref|XP_003172870.1|  pantothenate kinase                                301   4e-93    Nannizzia gypsea CBS 118893
ref|XP_001263732.1|  pantothenate kinase, putative                      301   5e-93    Aspergillus fischeri NRRL 181
ref|XP_868828.1|  hypothetical protein AN9446.2                         300   8e-93    Aspergillus nidulans FGSC A4
ref|XP_001246572.1|  hypothetical protein CIMG_00343                    301   1e-92    
dbj|GAD92341.1|  pantothenate kinase, putative                          300   1e-92    Byssochlamys spectabilis No. 5
gb|KIW79137.1|  pantothenate kinase                                     300   1e-92    Fonsecaea pedrosoi CBS 271.37
gb|ESA02283.1|  hypothetical protein GLOINDRAFT_337485                  308   2e-92    
gb|EXX62049.1|  pantothenate kinase                                     308   2e-92    Rhizophagus irregularis DAOM 197198w
gb|EZF35858.1|  pantothenate kinase                                     299   3e-92    Trichophyton interdigitale H6
ref|XP_009152742.1|  type II pantothenate kinase                        299   3e-92    Exophiala dermatitidis NIH/UT8656
gb|KIY00074.1|  hypothetical protein Z520_03759                         299   3e-92    Fonsecaea multimorphosa CBS 102226
gb|EGD95495.1|  pantothenate kinase                                     299   3e-92    Trichophyton tonsurans CBS 112818
gb|KIW48966.1|  pantothenate kinase                                     298   4e-92    Exophiala xenobiotica
gb|EGE05796.1|  pantothenate kinase                                     298   5e-92    Trichophyton equinum CBS 127.97
ref|XP_003237627.1|  pantothenate kinase                                298   6e-92    Trichophyton rubrum CBS 118892
ref|XP_008721632.1|  pantothenate kinase                                298   6e-92    Cladophialophora carrionii CBS 160.54
gb|KIA75919.1|  Pantothenate kinase                                     297   7e-92    Aspergillus ustus
gb|KIV81221.1|  pantothenate kinase                                     298   7e-92    Exophiala sideris
gb|KIW16496.1|  pantothenate kinase                                     298   8e-92    Exophiala spinifera
gb|KIV89403.1|  pantothenate kinase                                     297   9e-92    Exophiala mesophila
gb|KIW25168.1|  pantothenate kinase                                     297   1e-91    Cladophialophora immunda
ref|XP_007737256.1|  type II pantothenate kinase                        297   1e-91    Capronia epimyces CBS 606.96
gb|KGO55503.1|  Type II pantothenate kinase                             297   2e-91    Penicillium expansum
gb|KGO77372.1|  Type II pantothenate kinase                             297   2e-91    Penicillium italicum
gb|KIW45725.1|  pantothenate kinase                                     296   2e-91    Exophiala oligosperma
dbj|GAA84286.1|  pantothenate kinase                                    296   3e-91    Aspergillus kawachii IFO 4308
dbj|GAM27496.1|  hypothetical protein SAMD00019534_106720               295   3e-91    Acytostelium subglobosum LB1
gb|EAS34989.2|  pantothenate kinase                                     302   3e-91    Coccidioides immitis RS
gb|EKV19005.1|  Pantothenate kinase, putative                           296   4e-91    Penicillium digitatum PHI26
gb|KIW74037.1|  pantothenate kinase                                     295   6e-91    Phialophora americana
gb|EYE96107.1|  putative pantothenate kinase                            295   7e-91    Aspergillus ruber CBS 135680
emb|CAK47768.1|  unnamed protein product                                295   8e-91    Aspergillus niger
gb|KGO48561.1|  Type II pantothenate kinase                             295   1e-90    Penicillium expansum
emb|CDM31843.1|  Pantothenate kinase                                    295   1e-90    Penicillium roqueforti FM164
ref|XP_007743113.1|  type II pantothenate kinase                        294   2e-90    Cladophialophora psammophila CBS 110553
gb|KJK67803.1|  Fumble                                                  293   2e-90    Aspergillus parasiticus SU-1
gb|KIW96525.1|  pantothenate kinase                                     294   2e-90    Cladophialophora bantiana CBS 173.52
ref|XP_007752237.1|  type II pantothenate kinase                        294   2e-90    Cladophialophora yegresii CBS 114405
gb|EGE82733.1|  pantothenate kinase                                     295   2e-90    Blastomyces dermatitidis ATCC 18188
ref|XP_001824557.1|  pantothenate kinase                                293   2e-90    Aspergillus oryzae RIB40
ref|XP_002562780.1|  Pc20g02220                                         294   3e-90    Penicillium rubens Wisconsin 54-1255
ref|XP_002673339.1|  predicted protein                                  297   3e-90    Naegleria gruberi strain NEG-M
ref|XP_003025585.1|  hypothetical protein TRV_00225                     293   3e-90    Trichophyton verrucosum HKI 0517
ref|XP_002842925.1|  pantothenate kinase                                293   8e-90    Microsporum canis CBS 113480
gb|EPS26838.1|  hypothetical protein PDE_01777                          292   9e-90    Penicillium oxalicum 114-2
gb|KEF58478.1|  type II pantothenate kinase                             292   1e-89    Exophiala aquamarina CBS 119918
gb|EER45749.1|  pantothenate kinase                                     290   1e-89    Histoplasma capsulatum H143
emb|CDS06976.1|  hypothetical protein LRAMOSA09499                      290   2e-89    Lichtheimia ramosa
emb|CDH50209.1|  pantothenate kinase                                    290   2e-89    Lichtheimia corymbifera JMRC:FSU:9682
gb|EGC41695.1|  pantothenate kinase                                     292   3e-89    Histoplasma capsulatum H88
ref|XP_005102785.1|  PREDICTED: pantothenate kinase 4-like              300   3e-89    Aplysia californica
ref|XP_002794259.1|  pantothenate kinase                                292   3e-89    Paracoccidioides lutzii Pb01
ref|XP_007720232.1|  type II pantothenate kinase                        291   4e-89    Capronia coronata CBS 617.96
gb|EEH07598.1|  pantothenate kinase                                     291   5e-89    Histoplasma capsulatum G186AR
ref|XP_002540896.1|  hypothetical protein UREG_00409                    291   1e-88    Uncinocarpus reesii 1704
ref|XP_006680154.1|  hypothetical protein BATDEDRAFT_89522              298   1e-88    Batrachochytrium dendrobatidis JAM81
ref|XP_010758833.1|  pantothenate kinase                                290   1e-88    Paracoccidioides brasiliensis Pb18
ref|XP_008720281.1|  pantothenate kinase                                289   2e-88    Cyphellophora europaea CBS 101466
dbj|GAN04443.1|  pantothenate kinase                                    287   2e-88    Mucor ambiguus
ref|XP_001537842.1|  hypothetical protein HCAG_07264                    289   3e-88    Histoplasma capsulatum NAm1
gb|EPB92480.1|  pantothenate kinase                                     285   2e-87    Mucor circinelloides f. circinelloides 1006PhL
gb|KFM61168.1|  Pantothenate kinase 4                                   285   2e-87    Stegodyphus mimosarum
gb|EXX73217.1|  pantothenate kinase                                     294   3e-87    Rhizophagus irregularis DAOM 197198w
tpg|DAA00007.1|  TPA: pantothenate kinase 4 putative variant; PANK4p    282   1e-86    Homo sapiens [man]
dbj|GAN09710.1|  pantothenate kinase                                    282   1e-86    Mucor ambiguus
ref|XP_001209118.1|  hypothetical protein ATEG_01753                    283   2e-86    Aspergillus terreus NIH2624
ref|XP_002629570.1|  pantothenate kinase                                284   3e-86    
gb|EEQ91092.1|  pantothenate kinase                                     284   4e-86    
ref|XP_010243065.1|  PREDICTED: pantothenate kinase 2 isoform X2        292   4e-86    
ref|XP_007932136.1|  hypothetical protein MYCFIDRAFT_146300             282   4e-86    
ref|XP_010227877.1|  PREDICTED: pantothenate kinase 1 isoform X3        286   4e-86    
ref|XP_011540010.1|  PREDICTED: pantothenate kinase 4 isoform X2        282   4e-86    
ref|XP_011431671.1|  PREDICTED: pantothenate kinase 4-like              291   5e-86    
ref|XP_005996661.1|  PREDICTED: pantothenate kinase 4                   291   5e-86    
emb|CEP12564.1|  hypothetical protein                                   285   8e-86    
gb|EIE75572.1|  pantothenate kinase                                     279   2e-85    
ref|XP_009053272.1|  hypothetical protein LOTGIDRAFT_116077             289   3e-85    
ref|XP_011540009.1|  PREDICTED: pantothenate kinase 4 isoform X1        283   4e-85    
ref|XP_007680221.1|  hypothetical protein BAUCODRAFT_268808             281   4e-85    
ref|XP_010880005.1|  PREDICTED: pantothenate kinase 4 isoform X6        286   4e-85    
ref|XP_003014814.1|  hypothetical protein ARB_07375                     281   5e-85    
gb|EMF11407.1|  fumble                                                  277   6e-84    
ref|XP_010880001.1|  PREDICTED: pantothenate kinase 4 isoform X2        286   7e-84    
ref|XP_010880002.1|  PREDICTED: pantothenate kinase 4 isoform X3        286   7e-84    
ref|XP_010880003.1|  PREDICTED: pantothenate kinase 4 isoform X4        286   7e-84    
ref|XP_010880000.1|  PREDICTED: pantothenate kinase 4 isoform X1        286   8e-84    
ref|XP_009304207.1|  PREDICTED: pantothenate kinase 4 isoform X7        279   8e-84    
gb|KEQ64276.1|  pantothenate kinase 4                                   276   1e-83    
ref|XP_007780661.1|  pantothenate kinase                                276   2e-83    
ref|XP_004768800.1|  PREDICTED: pantothenate kinase 4                   285   2e-83    
gb|KEQ82420.1|  pantothenate kinase pank                                276   2e-83    
gb|ELT88727.1|  hypothetical protein CAPTEDRAFT_118737                  285   2e-83    
gb|EPY50464.1|  fumble family pantothenate kinase                       274   2e-83    
gb|EME41347.1|  hypothetical protein DOTSEDRAFT_26525                   276   2e-83    
gb|KEQ97437.1|  hypothetical protein AUEXF2481DRAFT_37956               275   4e-83    
ref|XP_008998534.1|  PREDICTED: pantothenate kinase 4                   284   4e-83    
sp|Q4R4U1.2|PANK4_MACFA  RecName: Full=Pantothenate kinase 4; Alt...    283   4e-83    
sp|Q9NVE7.1|PANK4_HUMAN  RecName: Full=Pantothenate kinase 4; Sho...    283   5e-83    
ref|XP_009212778.1|  PREDICTED: pantothenate kinase 4 isoform X1        284   5e-83    
ref|XP_003891046.1|  PREDICTED: pantothenate kinase 4 isoform X2        283   6e-83    
dbj|BAD97266.1|  pantothenate kinase 4 variant                          283   6e-83    
ref|XP_011786373.1|  PREDICTED: pantothenate kinase 4 isoform X1        283   6e-83    
ref|NP_956809.1|  pantothenate kinase 4                                 276   7e-83    
emb|CAC09438.1|  hypothetical protein                                   283   7e-83    
ref|XP_007979100.1|  PREDICTED: pantothenate kinase 4 isoform X2        283   7e-83    
ref|XP_001086116.2|  PREDICTED: pantothenate kinase 4 isoform 2         283   7e-83    
gb|ESZ94475.1|  pantothenate kinase                                     275   8e-83    
ref|XP_524846.3|  PREDICTED: pantothenate kinase 4 isoform X1           283   8e-83    
ref|XP_009445038.1|  PREDICTED: pantothenate kinase 4 isoform X2        282   9e-83    
ref|XP_007979099.1|  PREDICTED: pantothenate kinase 4 isoform X1        283   9e-83    
ref|NP_060686.2|  pantothenate kinase 4                                 283   9e-83    
dbj|BAG58281.1|  unnamed protein product                                283   1e-82    
ref|XP_006642013.1|  PREDICTED: pantothenate kinase 4-like              282   1e-82    
ref|XP_004880439.1|  PREDICTED: pantothenate kinase 4                   282   1e-82    
ref|XP_004863847.1|  PREDICTED: pantothenate kinase 4 isoform X2        281   2e-82    
ref|XP_010784125.1|  PREDICTED: pantothenate kinase 4 isoform X2        282   2e-82    
ref|XP_007583895.1|  putative pantothenate kinase protein               273   2e-82    
gb|KEQ70381.1|  pantothenate kinase 4                                   273   2e-82    
ref|XP_004863846.1|  PREDICTED: pantothenate kinase 4 isoform X1        282   2e-82    
ref|XP_010784124.1|  PREDICTED: pantothenate kinase 4 isoform X1        282   2e-82    
ref|XP_004607250.1|  PREDICTED: pantothenate kinase 4                   282   2e-82    
tpg|DAA00010.1|  TPA: pantothenate kinase 4                             271   3e-82    
gb|AAI61366.1|  LOC100145609 protein                                    281   3e-82    
ref|NP_001120490.2|  pantothenate kinase 4                              281   4e-82    
ref|XP_005339283.1|  PREDICTED: pantothenate kinase 4                   280   8e-82    
ref|XP_003793255.1|  PREDICTED: pantothenate kinase 4 isoform 1         280   9e-82    
ref|NP_001127619.1|  pantothenate kinase 4                              280   1e-81    
gb|KJX94418.1|  pantothenate kinase like protein                        271   1e-81    
ref|XP_006903979.1|  PREDICTED: pantothenate kinase 4                   279   2e-81    
ref|XP_005155852.1|  PREDICTED: pantothenate kinase 4 isoform X2        279   2e-81    
ref|XP_009304203.1|  PREDICTED: pantothenate kinase 4 isoform X1        279   2e-81    
emb|CCD49080.1|  similar to pantothenate kinase                         271   4e-81    
ref|XP_011583743.1|  PREDICTED: pantothenate kinase 4 isoform X2        275   4e-81    
ref|XP_004473587.1|  PREDICTED: pantothenate kinase 4                   278   4e-81    
ref|XP_008407352.1|  PREDICTED: pantothenate kinase 4 isoform X1        278   4e-81    
ref|XP_008407353.1|  PREDICTED: pantothenate kinase 4 isoform X2        278   5e-81    
ref|NP_001270249.1|  pantothenate kinase 4                              278   5e-81    
ref|XP_010880004.1|  PREDICTED: pantothenate kinase 4 isoform X5        278   5e-81    
ref|XP_007427173.1|  PREDICTED: pantothenate kinase 4 isoform X2        274   9e-81    
ref|XP_007228567.1|  PREDICTED: pantothenate kinase 4-like isofor...    277   1e-80    
ref|XP_002171707.1|  fumble family pantothenate kinase                  268   1e-80    
ref|XP_005155853.1|  PREDICTED: pantothenate kinase 4 isoform X4        277   1e-80    
ref|XP_003854608.1|  hypothetical protein MYCGRDRAFT_69324              270   1e-80    
ref|XP_009304204.1|  PREDICTED: pantothenate kinase 4 isoform X3        277   1e-80    
ref|XP_010575776.1|  PREDICTED: pantothenate kinase 4 isoform X5        275   1e-80    
ref|XP_005057671.1|  PREDICTED: pantothenate kinase 4 isoform X3        275   2e-80    
ref|XP_011282738.1|  PREDICTED: pantothenate kinase 4                   278   2e-80    
gb|KJE93934.1|  pantothenate kinase 4, variant                          277   2e-80    
ref|XP_005528416.1|  PREDICTED: pantothenate kinase 4 isoform X3        275   2e-80    
ref|XP_007547099.1|  PREDICTED: pantothenate kinase 4                   276   2e-80    
gb|EPX71610.1|  fumble family pantothenate kinase                       267   2e-80    
ref|XP_003939688.1|  PREDICTED: pantothenate kinase 4                   276   2e-80    
ref|XP_004347393.1|  pantothenate kinase 4                              277   2e-80    
ref|XP_007228566.1|  PREDICTED: pantothenate kinase 4-like isofor...    276   2e-80    
ref|XP_005811885.1|  PREDICTED: pantothenate kinase 4-like              276   2e-80    
ref|XP_007228565.1|  PREDICTED: pantothenate kinase 4-like isofor...    276   2e-80    
ref|XP_008305150.1|  PREDICTED: pantothenate kinase 4 isoform X1        276   3e-80    
ref|XP_008305151.1|  PREDICTED: pantothenate kinase 4 isoform X2        276   4e-80    
gb|EHH14245.1|  hypothetical protein EGK_00136                          275   4e-80    
ref|XP_010727835.1|  PREDICTED: pantothenate kinase 4 isoform X1        276   4e-80    
gb|EHH49476.1|  hypothetical protein EGM_00139                          275   4e-80    
ref|XP_010727836.1|  PREDICTED: pantothenate kinase 4 isoform X2        276   4e-80    
gb|ELK19609.1|  Pantothenate kinase 4                                   275   4e-80    
ref|XP_009909570.1|  PREDICTED: pantothenate kinase 4 isoform X2        273   5e-80    
ref|XP_007874276.1|  pantothenate kinase                                265   6e-80    
ref|XP_011583742.1|  PREDICTED: pantothenate kinase 4 isoform X1        275   6e-80    
ref|XP_010575772.1|  PREDICTED: pantothenate kinase 4 isoform X2        275   7e-80    
ref|XP_005917899.1|  PREDICTED: LOW QUALITY PROTEIN: pantothenate...    275   7e-80    
ref|XP_010575773.1|  PREDICTED: pantothenate kinase 4 isoform X3        275   8e-80    
ref|XP_005057670.1|  PREDICTED: pantothenate kinase 4 isoform X2        275   8e-80    
ref|NP_001231842.1|  pantothenate kinase 4                              275   1e-79    
gb|EFX71404.1|  hypothetical protein DAPPUDRAFT_327249                  275   1e-79    
ref|XP_005729718.1|  PREDICTED: pantothenate kinase 4-like              275   1e-79    
ref|XP_008319266.1|  PREDICTED: pantothenate kinase 4 isoform X3        275   1e-79    
ref|XP_005528414.1|  PREDICTED: pantothenate kinase 4 isoform X1        274   1e-79    
ref|XP_008319265.1|  PREDICTED: pantothenate kinase 4 isoform X2        275   1e-79    
ref|XP_005528415.1|  PREDICTED: pantothenate kinase 4 isoform X2        274   1e-79    
ref|XP_008319264.1|  PREDICTED: pantothenate kinase 4 isoform X1        275   1e-79    
ref|XP_004547490.1|  PREDICTED: pantothenate kinase 4-like isofor...    274   1e-79    
ref|XP_003279784.1|  PREDICTED: pantothenate kinase 4                   276   1e-79    
ref|XP_007427172.1|  PREDICTED: pantothenate kinase 4 isoform X1        274   2e-79    
ref|XP_003659949.1|  hypothetical protein MYCTH_2297559                 268   2e-79    
ref|XP_007115403.1|  PREDICTED: pantothenate kinase 4-like              267   2e-79    
ref|XP_004547489.1|  PREDICTED: pantothenate kinase 4-like isofor...    274   2e-79    
ref|XP_003447770.1|  PREDICTED: pantothenate kinase 4-like isofor...    274   2e-79    
emb|CEI87617.1|  Putative Pantothenate kinase                           266   2e-79    
ref|XP_006782994.1|  PREDICTED: pantothenate kinase 4-like isofor...    274   2e-79    
ref|XP_005057669.1|  PREDICTED: pantothenate kinase 4 isoform X1        274   2e-79    
ref|XP_005469709.1|  PREDICTED: pantothenate kinase 4-like isofor...    274   2e-79    
ref|XP_006782993.1|  PREDICTED: pantothenate kinase 4-like isofor...    274   2e-79    
ref|XP_007900305.1|  PREDICTED: pantothenate kinase 4 isoform X2        274   2e-79    
ref|XP_004350440.1|  pantothenate kinase                                271   3e-79    
gb|KFV63523.1|  Pantothenate kinase 4                                   273   3e-79    
ref|XP_011611908.1|  PREDICTED: pantothenate kinase 4 isoform X1        274   3e-79    
ref|XP_009909569.1|  PREDICTED: pantothenate kinase 4 isoform X1        273   3e-79    
ref|XP_007900304.1|  PREDICTED: pantothenate kinase 4 isoform X1        273   3e-79    
ref|XP_010223585.1|  PREDICTED: pantothenate kinase 4                   273   4e-79    
ref|XP_008501814.1|  PREDICTED: pantothenate kinase 4                   273   4e-79    
gb|KIM88961.1|  hypothetical protein PILCRDRAFT_813960                  265   5e-79    
ref|XP_011375648.1|  PREDICTED: pantothenate kinase 4                   271   6e-79    
gb|EDL14988.1|  pantothenate kinase 4, isoform CRA_b                    273   6e-79    
gb|ERE82712.1|  pantothenate kinase 4-like protein                      272   7e-79    
ref|NP_766578.2|  pantothenate kinase 4 isoform 2                       272   7e-79    
ref|XP_003513896.1|  PREDICTED: pantothenate kinase 4                   272   7e-79    
dbj|BAC34450.1|  unnamed protein product                                272   8e-79    
ref|XP_012042808.1|  PREDICTED: pantothenate kinase 4 isoform X2        269   9e-79    
ref|NP_001231841.1|  pantothenate kinase 4                              272   9e-79    
dbj|GAM90946.1|  hypothetical protein ANO11243_089930                   265   1e-78    
ref|XP_007606831.1|  PREDICTED: LOW QUALITY PROTEIN: pantothenate...    272   1e-78    
ref|NP_001292733.1|  pantothenate kinase 4 isoform 1                    272   1e-78    
ref|XP_001366436.1|  PREDICTED: pantothenate kinase 4                   271   1e-78    
gb|EDL14987.1|  pantothenate kinase 4, isoform CRA_a                    273   1e-78    
ref|XP_003461550.1|  PREDICTED: pantothenate kinase 4                   271   1e-78    
ref|XP_005368706.1|  PREDICTED: pantothenate kinase 4                   271   2e-78    
ref|XP_003765136.1|  PREDICTED: pantothenate kinase 4                   272   2e-78    
ref|XP_006016264.1|  PREDICTED: pantothenate kinase 4                   271   2e-78    
emb|CCJ30854.1|  unnamed protein product                                261   2e-78    
ref|XP_005079304.1|  PREDICTED: pantothenate kinase 4                   271   2e-78    
ref|XP_007070231.1|  PREDICTED: pantothenate kinase 4-like              271   2e-78    
ref|XP_005706891.1|  pantothenate kinase isoform 1                      263   2e-78    
ref|XP_006992456.1|  PREDICTED: pantothenate kinase 4                   271   2e-78    
ref|XP_005427701.1|  PREDICTED: LOW QUALITY PROTEIN: pantothenate...    271   3e-78    
ref|XP_005888905.1|  PREDICTED: pantothenate kinase 4                   271   3e-78    
tpg|DAA21103.1|  TPA: pantothenate kinase 4                             271   3e-78    
ref|NP_001076898.1|  pantothenate kinase 4                              271   3e-78    
ref|XP_006044709.1|  PREDICTED: pantothenate kinase 4 isoform X1        271   3e-78    
ref|XP_008393114.1|  PREDICTED: pantothenate kinase 2-like              256   3e-78    
gb|KFY16888.1|  hypothetical protein V491_05185                         263   3e-78    
gb|ELR61337.1|  Pantothenate kinase 4                                   271   3e-78    
gb|EDL81281.1|  pantothenate kinase 4                                   270   3e-78    
ref|XP_012042807.1|  PREDICTED: pantothenate kinase 4 isoform X4        270   4e-78    
ref|XP_005404224.1|  PREDICTED: pantothenate kinase 4 isoform X3        269   4e-78    
ref|NP_598215.1|  pantothenate kinase 4                                 270   4e-78    
ref|XP_006196654.1|  PREDICTED: pantothenate kinase 4 isoform X2        270   6e-78    
ref|XP_005292819.1|  PREDICTED: pantothenate kinase 4                   270   6e-78    
ref|XP_010955938.1|  PREDICTED: LOW QUALITY PROTEIN: pantothenate...    270   7e-78    
ref|XP_012042806.1|  PREDICTED: pantothenate kinase 4 isoform X1        270   7e-78    
ref|XP_009093945.1|  PREDICTED: pantothenate kinase 4                   270   7e-78    
ref|XP_004657776.1|  PREDICTED: pantothenate kinase 4 isoform X1        270   7e-78    
ref|XP_009318835.1|  PREDICTED: pantothenate kinase 4                   269   8e-78    
ref|XP_005969935.1|  PREDICTED: pantothenate kinase 4                   270   8e-78    
ref|XP_004596209.1|  PREDICTED: pantothenate kinase 4                   268   1e-77    
ref|XP_009304205.1|  PREDICTED: pantothenate kinase 4 isoform X5        269   1e-77    
ref|XP_009887980.1|  PREDICTED: pantothenate kinase 4                   268   1e-77    
ref|XP_004639656.1|  PREDICTED: pantothenate kinase 4                   269   1e-77    
gb|KFW02749.1|  Pantothenate kinase 4                                   266   1e-77    
gb|KFY07079.1|  hypothetical protein V492_07466                         262   1e-77    
ref|XP_005404222.1|  PREDICTED: pantothenate kinase 4 isoform X1        269   1e-77    
ref|XP_007529565.1|  PREDICTED: pantothenate kinase 4 isoform X1        269   1e-77    
gb|KFP08332.1|  Pantothenate kinase 4                                   269   2e-77    
ref|XP_003356172.1|  PREDICTED: pantothenate kinase 4                   269   2e-77    
ref|XP_008067465.1|  PREDICTED: pantothenate kinase 4                   269   2e-77    
ref|XP_004272348.1|  PREDICTED: pantothenate kinase 4                   269   2e-77    
gb|KFP28712.1|  Pantothenate kinase 4                                   268   2e-77    
ref|XP_007166367.1|  PREDICTED: pantothenate kinase 4                   268   2e-77    
ref|XP_004705533.1|  PREDICTED: pantothenate kinase 4                   268   3e-77    
emb|CDR47192.1|  CYFA0S30e00188g1_1                                     260   3e-77    
gb|KFQ39396.1|  Pantothenate kinase 4                                   267   3e-77    
emb|CBN80684.1|  Pantothenate kinase 4                                  268   3e-77    
ref|XP_009559871.1|  PREDICTED: pantothenate kinase 4                   267   3e-77    
gb|KFQ10871.1|  Pantothenate kinase 4                                   267   3e-77    
ref|XP_006124732.1|  PREDICTED: pantothenate kinase 4 isoform X1        267   3e-77    
ref|XP_006885880.1|  PREDICTED: pantothenate kinase 4 isoform X1        268   3e-77    
ref|XP_009816817.1|  PREDICTED: pantothenate kinase 4                   267   3e-77    
gb|KFP60469.1|  Pantothenate kinase 4                                   267   4e-77    
gb|KFY18656.1|  hypothetical protein V493_08441                         260   4e-77    
gb|KFZ55737.1|  Pantothenate kinase 4                                   267   4e-77    
ref|XP_006124733.1|  PREDICTED: pantothenate kinase 4 isoform X2        267   4e-77    
ref|XP_009704664.1|  PREDICTED: pantothenate kinase 4                   267   4e-77    
ref|XP_004425561.1|  PREDICTED: pantothenate kinase 4                   268   4e-77    
ref|XP_009304206.1|  PREDICTED: pantothenate kinase 4 isoform X6        267   4e-77    
ref|XP_006871793.1|  PREDICTED: pantothenate kinase 4                   268   4e-77    
ref|XP_010127500.1|  PREDICTED: pantothenate kinase 4                   267   5e-77    
gb|KFQ45402.1|  Pantothenate kinase 4                                   266   5e-77    
gb|KFQ93749.1|  Pantothenate kinase 4                                   266   5e-77    
ref|XP_006746516.1|  PREDICTED: pantothenate kinase 4                   267   6e-77    
gb|KGK40149.1|  hypothetical protein JL09_g816                          259   6e-77    
ref|XP_007288567.1|  pantothenate kinase                                259   6e-77    
gb|KGL84572.1|  Pantothenate kinase 4                                   267   6e-77    
ref|XP_010022564.1|  PREDICTED: pantothenate kinase 4                   266   6e-77    
gb|KFZ02001.1|  hypothetical protein V500_00511                         260   6e-77    
ref|XP_004407420.1|  PREDICTED: pantothenate kinase 4                   267   6e-77    
gb|KFY37227.1|  hypothetical protein V495_07275                         259   6e-77    
ref|XP_008850873.1|  PREDICTED: pantothenate kinase 4                   267   6e-77    
ref|XP_009981936.1|  PREDICTED: pantothenate kinase 4                   266   7e-77    
ref|XP_005143769.1|  PREDICTED: pantothenate kinase 4                   266   7e-77    
gb|KFY04710.1|  hypothetical protein O988_00590                         259   7e-77    



>ref|XP_006344398.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Solanum tuberosum]
 ref|XP_006344399.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Solanum tuberosum]
 ref|XP_006344400.1| PREDICTED: pantothenate kinase 2-like isoform X3 [Solanum tuberosum]
Length=901

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/433 (85%), Positives = 396/433 (91%), Gaps = 4/433 (1%)
 Frame = +3

Query  120   MAGVTTGDLPDLGIDDKNEKDNIAVLERGGVEKEKEISP---MHRSTSRPQLDLSGAAIQ  290
             MA  TT +   + IDD NE+    + E+  VEK+    P   +HRS+SRPQLD+SGAAIQ
Sbjct  1     MASPTTKNHSHIEIDDINEESQ-QITEKDIVEKDMAPLPGSSIHRSSSRPQLDVSGAAIQ  59

Query  291   GNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSN  470
             GNFEEKDP ILLPNQ+DDISHLALDIGGSLIKL+YFSRH  RQV+D RKRKVKER GV+N
Sbjct  60    GNFEEKDPAILLPNQTDDISHLALDIGGSLIKLIYFSRHADRQVDDGRKRKVKERLGVTN  119

Query  471   GNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKAT  650
             G+RRSYPILGGRLHFVKFET+K+NECLDFI SKQLHCGG+D   W S+AP +EN +IKAT
Sbjct  120   GSRRSYPILGGRLHFVKFETSKINECLDFIHSKQLHCGGMDPRCWPSDAPPSENAVIKAT  179

Query  651   GGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQND  830
             GGGAYKFADLFKERLGVSIEKEDEMNCLV+GANFLLKAIRHEAFTH+EGHKEFVQIDQND
Sbjct  180   GGGAYKFADLFKERLGVSIEKEDEMNCLVSGANFLLKAIRHEAFTHMEGHKEFVQIDQND  239

Query  831   LFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRG  1010
             LFPYLLVNIGSGVSMIKVDGDG+FQRVSGTNVGGGTYWGLGRLLTKCKSFD+LLELSQRG
Sbjct  240   LFPYLLVNIGSGVSMIKVDGDGQFQRVSGTNVGGGTYWGLGRLLTKCKSFDELLELSQRG  299

Query  1011  DNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISY  1190
             DN TIDMLVGDIYGGMDYSKIGLSASTIASSFGK ISENK+LEDY+PEDISLSLLRMISY
Sbjct  300   DNSTIDMLVGDIYGGMDYSKIGLSASTIASSFGKTISENKDLEDYKPEDISLSLLRMISY  359

Query  1191  NIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGA  1370
             NIGQI+YLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV FWSKG+A+AMFLRHEGFLGA
Sbjct  360   NIGQIAYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVQFWSKGDAQAMFLRHEGFLGA  419

Query  1371  LGAFMSYEKHGLD  1409
             LGAFMSYEKHGLD
Sbjct  420   LGAFMSYEKHGLD  432



>ref|XP_009793996.1| PREDICTED: pantothenate kinase 2 isoform X1 [Nicotiana sylvestris]
Length=932

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/457 (83%), Positives = 412/457 (90%), Gaps = 20/457 (4%)
 Frame = +3

Query  90    EECKRGIGR-----VMAGVTTGD-LPDLGIDDKNEK-----DNIAVLERGGVEKEKEISP  236
             E  ++GI R     +MA  TT D  P +GID  NE+     +   VLE+GG   EK+++P
Sbjct  10    EAGRKGIQREREREIMASPTTEDHSPHIGIDCINEETQQISEKDIVLEKGG---EKDMAP  66

Query  237   M------HRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYF  398
             +      HRS+SRPQLD+SGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYF
Sbjct  67    LPGSSSIHRSSSRPQLDVSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYF  126

Query  399   SRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLH  578
             SRH  RQV+D+RKRKVKER GVSNG+RRSYPILGGRLHFVKFET+K+NECLDFI SKQLH
Sbjct  127   SRHADRQVDDRRKRKVKERLGVSNGSRRSYPILGGRLHFVKFETSKLNECLDFIYSKQLH  186

Query  579   CGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLL  758
             CGG+D+  W S+APQ+EN +IKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLL
Sbjct  187   CGGMDSRCWPSDAPQSENAVIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLL  246

Query  759   KAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGT  938
             KAIRHEAFTH+EGHKEFVQID NDLFPYLLVNIGSGVSMIKVDGDG+FQRVSGTNVGGGT
Sbjct  247   KAIRHEAFTHMEGHKEFVQIDHNDLFPYLLVNIGSGVSMIKVDGDGEFQRVSGTNVGGGT  306

Query  939   YWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI  1118
             YWGLG+LLTKCKSFD+LLELSQRGDN TIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI
Sbjct  307   YWGLGKLLTKCKSFDELLELSQRGDNSTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI  366

Query  1119  SENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTIS  1298
             SENKELEDY PEDISLSLLRMISYNIGQI+YLNALR+GLKRIFFGGFFIRGHAYTMDTIS
Sbjct  367   SENKELEDYNPEDISLSLLRMISYNIGQIAYLNALRFGLKRIFFGGFFIRGHAYTMDTIS  426

Query  1299  FAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             FAV FWSKG+A+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  427   FAVQFWSKGDAQAMFLRHEGFLGALGAFMSYEKHGLD  463



>ref|XP_004236210.1| PREDICTED: pantothenate kinase 2 [Solanum lycopersicum]
 ref|XP_010318982.1| PREDICTED: pantothenate kinase 2 [Solanum lycopersicum]
Length=901

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/433 (84%), Positives = 395/433 (91%), Gaps = 4/433 (1%)
 Frame = +3

Query  120   MAGVTTGDLPDLGIDDKNEKDNIAVLERGGVEKEKEISP---MHRSTSRPQLDLSGAAIQ  290
             MA  TT D   + ID  NE+    + E+  VEK+    P   +HRS+SRPQLD+SGAAIQ
Sbjct  1     MASSTTKDHSHIEIDGINEESQ-QMTEKDIVEKDMAPLPGSSIHRSSSRPQLDVSGAAIQ  59

Query  291   GNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSN  470
             GNFEEKDP ILLPNQ+DDISHLALDIGGSLIKL+YFSRH  RQV+D RKRKVKER GV+N
Sbjct  60    GNFEEKDPAILLPNQTDDISHLALDIGGSLIKLIYFSRHADRQVDDGRKRKVKERLGVTN  119

Query  471   GNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKAT  650
             G+RRSYPILGGRLHFVKFET+K+NECLDFI SKQLHCGG+D   W S+AP +EN +IKAT
Sbjct  120   GSRRSYPILGGRLHFVKFETSKINECLDFIHSKQLHCGGMDPRCWPSDAPPSENAVIKAT  179

Query  651   GGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQND  830
             GGGAYKFADLFKERLGVSIEKEDEMNCLV+GANFLLKAIRHEAFTH+EGHKEFVQIDQND
Sbjct  180   GGGAYKFADLFKERLGVSIEKEDEMNCLVSGANFLLKAIRHEAFTHMEGHKEFVQIDQND  239

Query  831   LFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRG  1010
             LFPYLLVNIGSGVSMIKVDGDG+FQRVSGTNVGGGTYWGLGRLLTKCKSFD+LLELSQRG
Sbjct  240   LFPYLLVNIGSGVSMIKVDGDGQFQRVSGTNVGGGTYWGLGRLLTKCKSFDELLELSQRG  299

Query  1011  DNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISY  1190
             DN TIDMLVGDIYGGMDYSKIGLSASTIASSFGK ISENK+L+DY+PEDISLSLLRMISY
Sbjct  300   DNSTIDMLVGDIYGGMDYSKIGLSASTIASSFGKTISENKDLKDYKPEDISLSLLRMISY  359

Query  1191  NIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGA  1370
             NIGQI+YLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV FWSKG+A+AMFLRHEGFLGA
Sbjct  360   NIGQIAYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVQFWSKGDAQAMFLRHEGFLGA  419

Query  1371  LGAFMSYEKHGLD  1409
             LGAFMSYEKHGLD
Sbjct  420   LGAFMSYEKHGLD  432



>ref|XP_009793998.1| PREDICTED: pantothenate kinase 2 isoform X2 [Nicotiana sylvestris]
Length=908

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/442 (85%), Positives = 405/442 (92%), Gaps = 15/442 (3%)
 Frame = +3

Query  120   MAGVTTGD-LPDLGIDDKNEK-----DNIAVLERGGVEKEKEISPM------HRSTSRPQ  263
             MA  TT D  P +GID  NE+     +   VLE+GG   EK+++P+      HRS+SRPQ
Sbjct  1     MASPTTEDHSPHIGIDCINEETQQISEKDIVLEKGG---EKDMAPLPGSSSIHRSSSRPQ  57

Query  264   LDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrk  443
             LD+SGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRH  RQV+D+RKRK
Sbjct  58    LDVSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHADRQVDDRRKRK  117

Query  444   vkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQ  623
             VKER GVSNG+RRSYPILGGRLHFVKFET+K+NECLDFI SKQLHCGG+D+  W S+APQ
Sbjct  118   VKERLGVSNGSRRSYPILGGRLHFVKFETSKLNECLDFIYSKQLHCGGMDSRCWPSDAPQ  177

Query  624   NENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHK  803
             +EN +IKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTH+EGHK
Sbjct  178   SENAVIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHMEGHK  237

Query  804   EFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFD  983
             EFVQID NDLFPYLLVNIGSGVSMIKVDGDG+FQRVSGTNVGGGTYWGLG+LLTKCKSFD
Sbjct  238   EFVQIDHNDLFPYLLVNIGSGVSMIKVDGDGEFQRVSGTNVGGGTYWGLGKLLTKCKSFD  297

Query  984   DLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDIS  1163
             +LLELSQRGDN TIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDY PEDIS
Sbjct  298   ELLELSQRGDNSTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYNPEDIS  357

Query  1164  LSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMF  1343
             LSLLRMISYNIGQI+YLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV FWSKG+A+AMF
Sbjct  358   LSLLRMISYNIGQIAYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVQFWSKGDAQAMF  417

Query  1344  LRHEGFLGALGAFMSYEKHGLD  1409
             LRHEGFLGALGAFMSYEKHGLD
Sbjct  418   LRHEGFLGALGAFMSYEKHGLD  439



>ref|XP_007210380.1| hypothetical protein PRUPE_ppa001094mg [Prunus persica]
 gb|EMJ11579.1| hypothetical protein PRUPE_ppa001094mg [Prunus persica]
Length=910

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/442 (83%), Positives = 398/442 (90%), Gaps = 14/442 (3%)
 Frame = +3

Query  120   MAGVTTGDLPDLGIDD------KNEKDNIAVLERGGV-EKEKEI-----SPMHRSTSRPQ  263
             MA +T    P LGI+D      +NEK N  V++   V + E+++     S +HRS SRPQ
Sbjct  1     MASLTED--PVLGINDIKEREEENEKGNTQVVKTEEVGQSERDMASATGSSIHRSGSRPQ  58

Query  264   LDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrk  443
             LDLS AAIQGNFEE+DPTILLPNQSDD+SHLALDIGGSLIKLVYFSRHE + ++DKRK+ 
Sbjct  59    LDLSKAAIQGNFEERDPTILLPNQSDDLSHLALDIGGSLIKLVYFSRHEDQSIDDKRKKT  118

Query  444   vkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQ  623
             +KER G+SNGNRRSYPILGGRLHFVKFET K+NECLDFI SKQLH GG+D   W+ +AP 
Sbjct  119   LKERLGISNGNRRSYPILGGRLHFVKFETNKINECLDFIYSKQLHRGGMDARIWNPDAPT  178

Query  624   NENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHK  803
             NEN +IKATGGGAYKFADLFKERLGVS++KEDEMNCLV+GANFLLKAIRHEAFTH+EGHK
Sbjct  179   NENAVIKATGGGAYKFADLFKERLGVSLDKEDEMNCLVSGANFLLKAIRHEAFTHMEGHK  238

Query  804   EFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFD  983
             EFVQIDQN+LFPYLLVNIGSGVSMIKVDGDGKFQR+SGTNVGGGTYWGLGRLLTKCKSFD
Sbjct  239   EFVQIDQNELFPYLLVNIGSGVSMIKVDGDGKFQRISGTNVGGGTYWGLGRLLTKCKSFD  298

Query  984   DLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDIS  1163
             +LLELSQ GDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDY PEDIS
Sbjct  299   ELLELSQLGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYSPEDIS  358

Query  1164  LSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMF  1343
             LSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV FWSKG+A+AMF
Sbjct  359   LSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVQFWSKGDAQAMF  418

Query  1344  LRHEGFLGALGAFMSYEKHGLD  1409
             LRHEGFLGALGAFMSYEKHGLD
Sbjct  419   LRHEGFLGALGAFMSYEKHGLD  440



>ref|XP_009600890.1| PREDICTED: pantothenate kinase 2 [Nicotiana tomentosiformis]
 ref|XP_009600891.1| PREDICTED: pantothenate kinase 2 [Nicotiana tomentosiformis]
Length=908

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/442 (85%), Positives = 406/442 (92%), Gaps = 15/442 (3%)
 Frame = +3

Query  120   MAGVTTGD-LPDLGIDDKNEK-----DNIAVLERGGVEKEKEISPM------HRSTSRPQ  263
             MA  TT D  P +GID  NE+     +   VLE+GG   EK+++P+      HRS+SRPQ
Sbjct  1     MASPTTEDHPPHIGIDGINEETQQISEKDIVLEKGG---EKDMAPLPGSSSIHRSSSRPQ  57

Query  264   LDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrk  443
             LD+SGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRH  RQV+D+RKRK
Sbjct  58    LDVSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHADRQVDDRRKRK  117

Query  444   vkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQ  623
             VKER GVSNG+RRSYPILGGRLHFVKFET+K+NECLDFI SKQLH GG+D+  W S+APQ
Sbjct  118   VKERLGVSNGSRRSYPILGGRLHFVKFETSKLNECLDFIYSKQLHRGGMDSRCWPSDAPQ  177

Query  624   NENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHK  803
             +EN +IKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTH+EGHK
Sbjct  178   SENAVIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHMEGHK  237

Query  804   EFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFD  983
             EFVQIDQN+LFPYLLVNIGSGVSMIKVDGDG+FQRVSGTNVGGGTYWGLGRLLTKCKSFD
Sbjct  238   EFVQIDQNELFPYLLVNIGSGVSMIKVDGDGEFQRVSGTNVGGGTYWGLGRLLTKCKSFD  297

Query  984   DLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDIS  1163
             +LLELSQRGDN TIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDY+PEDIS
Sbjct  298   ELLELSQRGDNSTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYKPEDIS  357

Query  1164  LSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMF  1343
             LSLLRMISYNIGQI+YLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV FWSKG+A+AMF
Sbjct  358   LSLLRMISYNIGQIAYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVQFWSKGDAQAMF  417

Query  1344  LRHEGFLGALGAFMSYEKHGLD  1409
             LRHEGFLGALGAFMSYEKHGLD
Sbjct  418   LRHEGFLGALGAFMSYEKHGLD  439



>ref|XP_010243061.1| PREDICTED: pantothenate kinase 2 isoform X1 [Nelumbo nucifera]
 ref|XP_010243063.1| PREDICTED: pantothenate kinase 2 isoform X1 [Nelumbo nucifera]
 ref|XP_010243064.1| PREDICTED: pantothenate kinase 2 isoform X1 [Nelumbo nucifera]
Length=908

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/417 (87%), Positives = 389/417 (93%), Gaps = 3/417 (1%)
 Frame = +3

Query  162   DDKNEKDNIAVLERGGVEKEKEIS-PMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQS  338
             +DKN++D     ++GG E     + P+HRS+SRPQLDLSGAAIQGNFEE+DPTILLPNQS
Sbjct  23    NDKNKEDEEE--KQGGREMAPPAANPIHRSSSRPQLDLSGAAIQGNFEERDPTILLPNQS  80

Query  339   DDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFV  518
             DDISHL+LDIGGSLIKLVYFSRHE R V+DKRKR +KER GVSNGNRRSYPILGGRLHFV
Sbjct  81    DDISHLSLDIGGSLIKLVYFSRHEDRSVDDKRKRSLKERLGVSNGNRRSYPILGGRLHFV  140

Query  519   KFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLG  698
             KFET+K+NECLDFISSKQLH GG D+  W S A  NE+ IIKATGGGAYKFADLFKERLG
Sbjct  141   KFETSKINECLDFISSKQLHRGGTDSQCWHSGATANEDAIIKATGGGAYKFADLFKERLG  200

Query  699   VSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMI  878
             VSI+KEDEM+CLVAGANFLLKAIRHEAFTH+EGHKEFVQID NDLFPYLLVNIGSGVSMI
Sbjct  201   VSIDKEDEMDCLVAGANFLLKAIRHEAFTHMEGHKEFVQIDHNDLFPYLLVNIGSGVSMI  260

Query  879   KVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGM  1058
             KVDG+GKFQRVSGTNVGGGTYWGLGRLLTKCKSFD+LLELSQRGDNR IDMLVGDIYGGM
Sbjct  261   KVDGEGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDELLELSQRGDNRKIDMLVGDIYGGM  320

Query  1059  DYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLK  1238
             DYSKIGLSASTIASSFGKAI ENKELEDYRPEDISLSLLRMISYNIGQISYLNALR+G+K
Sbjct  321   DYSKIGLSASTIASSFGKAIYENKELEDYRPEDISLSLLRMISYNIGQISYLNALRFGIK  380

Query  1239  riffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             RIFFGGFFIRGHAYTMDTISFAV+FWSKGEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  381   RIFFGGFFIRGHAYTMDTISFAVHFWSKGEAKAMFLRHEGFLGALGAFMSYEKHGLD  437



>ref|XP_007036235.1| Pantothenate kinase 2 isoform 2, partial [Theobroma cacao]
 gb|EOY20736.1| Pantothenate kinase 2 isoform 2, partial [Theobroma cacao]
Length=919

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/402 (89%), Positives = 383/402 (95%), Gaps = 5/402 (1%)
 Frame = +3

Query  219   EKEISP-----MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLI  383
             E++++P     +HRS SRPQLDLS AAIQG+ EE+DPTILLPNQSDDISHLALDIGGSLI
Sbjct  60    ERDMAPPASNSIHRSGSRPQLDLSKAAIQGSSEERDPTILLPNQSDDISHLALDIGGSLI  119

Query  384   KLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFIS  563
             KLVYFSRHE R ++DKRK+ VKER G+SNGNRRSYPILGGRLHFVKFET+K+NECLDFIS
Sbjct  120   KLVYFSRHEDRSIDDKRKKTVKERLGISNGNRRSYPILGGRLHFVKFETSKLNECLDFIS  179

Query  564   SKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAG  743
             SKQLH GG+D+  W+SEAP NEN +IKATGGGAYKFADLFKERLGVSI+KEDEM+CLVAG
Sbjct  180   SKQLHRGGIDSHHWNSEAPANENAVIKATGGGAYKFADLFKERLGVSIDKEDEMDCLVAG  239

Query  744   ANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTN  923
             ANFLLKAIRHEAFTH+EGHKEFVQ+D NDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTN
Sbjct  240   ANFLLKAIRHEAFTHMEGHKEFVQLDHNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTN  299

Query  924   VGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASS  1103
             VGGGTYWGLGRLLTKCKSFD+LLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASS
Sbjct  300   VGGGTYWGLGRLLTKCKSFDELLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASS  359

Query  1104  FGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYT  1283
             FGKAIS+ KELEDYRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYT
Sbjct  360   FGKAISDKKELEDYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYT  419

Query  1284  MDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             MDTISFAV+FWS+GEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  420   MDTISFAVHFWSQGEAQAMFLRHEGFLGALGAFMSYEKHGLD  461



>ref|XP_002511391.1| Pantothenate kinase, putative [Ricinus communis]
 gb|EEF51993.1| Pantothenate kinase, putative [Ricinus communis]
Length=907

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/440 (84%), Positives = 395/440 (90%), Gaps = 13/440 (3%)
 Frame = +3

Query  120   MAGVTTGDLPDLGIDDKNEKDNIA-----VLERGGVEKEKEISP-----MHRSTSRPQLD  269
             MAG+     P LGIDD  E    A     + E GG + ++E+SP     +HRS SRPQLD
Sbjct  1     MAGLKED--PVLGIDDIIETSEDAEVRDKLREEGG-QSDREMSPATGNSIHRSGSRPQLD  57

Query  270   LSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvk  449
             LS AAIQGN EE+DPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE R + DKRK+ VK
Sbjct  58    LSKAAIQGNSEERDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEDRSINDKRKKTVK  117

Query  450   erFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNE  629
             ER G+SNGNRRSYP+LGGRLHFVKFET+K+NECLDFISSKQLH GG+D+  W  EAP N+
Sbjct  118   ERLGISNGNRRSYPVLGGRLHFVKFETSKINECLDFISSKQLHRGGIDSHGWLFEAPVND  177

Query  630   NTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEF  809
             N IIKATGGGAYKFADLFKERLGVS++KEDEM+CLVAGANFLLKAIRHEAFTH+EG KEF
Sbjct  178   NAIIKATGGGAYKFADLFKERLGVSLDKEDEMDCLVAGANFLLKAIRHEAFTHMEGQKEF  237

Query  810   VQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDL  989
             VQID NDLFPYLLVNIGSGVSMIKVDGDGKF+RVSGTNVGGGTYWGLGRLLTKCKSFD+L
Sbjct  238   VQIDHNDLFPYLLVNIGSGVSMIKVDGDGKFERVSGTNVGGGTYWGLGRLLTKCKSFDEL  297

Query  990   LELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLS  1169
             LELSQRGDNRTIDMLVGDIYGGMDY+KIGLSASTIASSFGK ISE KELEDYRPEDISLS
Sbjct  298   LELSQRGDNRTIDMLVGDIYGGMDYNKIGLSASTIASSFGKTISEKKELEDYRPEDISLS  357

Query  1170  LLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLR  1349
             LLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV+FWSKGEA+AMFLR
Sbjct  358   LLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEAQAMFLR  417

Query  1350  HEGFLGALGAFMSYEKHGLD  1409
             HEGFLGALGAFMSYEKHGLD
Sbjct  418   HEGFLGALGAFMSYEKHGLD  437



>ref|XP_004298946.1| PREDICTED: pantothenate kinase 2 [Fragaria vesca subsp. vesca]
 ref|XP_011464015.1| PREDICTED: pantothenate kinase 2 [Fragaria vesca subsp. vesca]
Length=908

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/440 (82%), Positives = 394/440 (90%), Gaps = 12/440 (3%)
 Frame = +3

Query  120   MAGVTTGDLPDLGIDDKNEKDNIA-----VLERGGVEKEKEISP-----MHRSTSRPQLD  269
             MAG+T    P LG +D  ++  ++     V+E GG + EK+++P     +HRS SRPQLD
Sbjct  1     MAGLTQH--PILGSNDAIKEKPLSSLEDKVVESGGGQTEKDMAPVTGSSIHRSGSRPQLD  58

Query  270   LSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvk  449
             LS AAIQG FEE+DPTILLPNQSD +SHLALDIGGSLIKLVYFSR E + ++DKRK+ +K
Sbjct  59    LSKAAIQGTFEERDPTILLPNQSDHLSHLALDIGGSLIKLVYFSRREDQAIDDKRKKTLK  118

Query  450   erFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNE  629
             ER G+SNG RRSYP+LGGRLHFVKFET K+NECLDFI SKQLHCGG+D   W+ +AP NE
Sbjct  119   ERLGISNGCRRSYPVLGGRLHFVKFETIKINECLDFIYSKQLHCGGMDARIWNPDAPINE  178

Query  630   NTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEF  809
             N +IKATGGGAYK+ADLFKERLGV ++KEDEMNCLVAGANFLLKAIRHEAFTH+EG KEF
Sbjct  179   NAVIKATGGGAYKYADLFKERLGVGLDKEDEMNCLVAGANFLLKAIRHEAFTHMEGQKEF  238

Query  810   VQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDL  989
             VQIDQNDL+PYLLVNIGSGVSMIKVDG+GKFQRVSGTNVGGGTYWGLGRLLTKC SFD+L
Sbjct  239   VQIDQNDLYPYLLVNIGSGVSMIKVDGEGKFQRVSGTNVGGGTYWGLGRLLTKCNSFDEL  298

Query  990   LELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLS  1169
             LELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGK ISENKELEDYRPEDISLS
Sbjct  299   LELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKTISENKELEDYRPEDISLS  358

Query  1170  LLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLR  1349
             LLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV FWSKGEA+AMFLR
Sbjct  359   LLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVQFWSKGEAQAMFLR  418

Query  1350  HEGFLGALGAFMSYEKHGLD  1409
             HEGFLGALGAFMSYEKHGLD
Sbjct  419   HEGFLGALGAFMSYEKHGLD  438



>ref|XP_011071870.1| PREDICTED: pantothenate kinase 2 [Sesamum indicum]
 ref|XP_011071871.1| PREDICTED: pantothenate kinase 2 [Sesamum indicum]
Length=922

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/402 (88%), Positives = 374/402 (93%), Gaps = 5/402 (1%)
 Frame = +3

Query  219   EKEISP-----MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLI  383
             EK++SP     MHRS+SRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLI
Sbjct  50    EKDMSPVAGNSMHRSSSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLI  109

Query  384   KLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFIS  563
             KLVYFSRHE + V D+R++ +K R G++N NR SYPILGGRLHFVKFET K+NECLDFI 
Sbjct  110   KLVYFSRHENQPVNDRRRKIIKARLGITNSNRMSYPILGGRLHFVKFETAKINECLDFIY  169

Query  564   SKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAG  743
             SKQLH  G+D+  W SE+P   NTIIKATGGGAYKFADLFKERLG+SIEKEDEMNCLVAG
Sbjct  170   SKQLHHSGMDSRHWQSESPNTGNTIIKATGGGAYKFADLFKERLGISIEKEDEMNCLVAG  229

Query  744   ANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTN  923
             ANFLLKAIRHEAFTH EG KEFVQID NDLFPYLLVNIGSGVSMIKVDGDG +QRVSGTN
Sbjct  230   ANFLLKAIRHEAFTHKEGQKEFVQIDSNDLFPYLLVNIGSGVSMIKVDGDGIYQRVSGTN  289

Query  924   VGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASS  1103
             VGGGTYWGLG+LLTKCKSFD+LLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASS
Sbjct  290   VGGGTYWGLGKLLTKCKSFDELLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASS  349

Query  1104  FGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYT  1283
             FGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYT
Sbjct  350   FGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYT  409

Query  1284  MDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             MDTISFAV FWSKG+A+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  410   MDTISFAVQFWSKGQAQAMFLRHEGFLGALGAFMSYEKHGLD  451



>gb|KJB53155.1| hypothetical protein B456_008G295400 [Gossypium raimondii]
Length=730

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/419 (85%), Positives = 388/419 (93%), Gaps = 5/419 (1%)
 Frame = +3

Query  153   LGIDDKNEKDNIAVLERGGVEKEKEISPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPN  332
             +G D  N K+N     +GG EK+   + +HRS SRPQLDLS A IQGN EE+DPTILLPN
Sbjct  38    IGEDSSNNKNN----NQGG-EKDMAGNSIHRSGSRPQLDLSKAEIQGNSEERDPTILLPN  92

Query  333   QSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLH  512
             Q+DDISHLALDIGGSLIKLVYFSRHE + V+DKRK+ VKER G+SNGNRR++P+LGGRLH
Sbjct  93    QTDDISHLALDIGGSLIKLVYFSRHEDQSVDDKRKKTVKERLGISNGNRRNFPVLGGRLH  152

Query  513   FVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKER  692
             FVKFET+K+NECLDFISSKQLH GG+D+  W+SEA  NEN +IKATGGGAYKFADLFKER
Sbjct  153   FVKFETSKLNECLDFISSKQLHRGGIDSHHWNSEASANENAVIKATGGGAYKFADLFKER  212

Query  693   LGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVS  872
             LGVSI+KEDEM+CLVAGANFLLKAIRHEAFTH+EGHKEFVQID NDLFPYLLVNIGSGVS
Sbjct  213   LGVSIDKEDEMDCLVAGANFLLKAIRHEAFTHMEGHKEFVQIDHNDLFPYLLVNIGSGVS  272

Query  873   MIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYG  1052
             +IKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKC SFD+LLELSQRGDNRTIDMLVGDIYG
Sbjct  273   IIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCNSFDELLELSQRGDNRTIDMLVGDIYG  332

Query  1053  GMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYG  1232
             GMDYSKIGLSASTIASSFGKAIS+ KEL+DYRPEDISLSLLRMISYNIGQISYLNALR+G
Sbjct  333   GMDYSKIGLSASTIASSFGKAISDKKELQDYRPEDISLSLLRMISYNIGQISYLNALRFG  392

Query  1233  LKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             LKRIFFGGFFIRGHAYTMDTISFAV+FWSKGEA+AMFLRHEGFLGA+GAFMSY+KHGLD
Sbjct  393   LKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEAQAMFLRHEGFLGAVGAFMSYQKHGLD  451



>ref|XP_008239770.1| PREDICTED: pantothenate kinase 2 [Prunus mume]
Length=910

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/442 (81%), Positives = 397/442 (90%), Gaps = 14/442 (3%)
 Frame = +3

Query  120   MAGVTTGDLPDLGI------DDKNEKDNIAVLERGGV-EKEKEISP-----MHRSTSRPQ  263
             MA +T    P LGI      +++NEK    V++   V + E++++      +HRS SRPQ
Sbjct  1     MASLTED--PVLGISYIKEREEENEKGKTQVVKTEEVGQSERDMASATGNSIHRSGSRPQ  58

Query  264   LDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrk  443
             LDLS AAIQGNFEE+DPTILLPNQSDD+SHLALDIGGSLIKLVYFSRHE + ++DKRK+ 
Sbjct  59    LDLSKAAIQGNFEERDPTILLPNQSDDLSHLALDIGGSLIKLVYFSRHEDQSIDDKRKKT  118

Query  444   vkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQ  623
             +KER G+SNGNRRSYPILGGRLHFVKFET K+NECLDFI SKQLH GG+D   W+ +AP 
Sbjct  119   LKERLGISNGNRRSYPILGGRLHFVKFETNKINECLDFIYSKQLHRGGMDARIWNPDAPT  178

Query  624   NENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHK  803
             NEN +IKATGGGAYKFADLFKERLGVS++KEDEMNCLV+GANFLLKAIRHEAFTH+EGHK
Sbjct  179   NENAVIKATGGGAYKFADLFKERLGVSLDKEDEMNCLVSGANFLLKAIRHEAFTHMEGHK  238

Query  804   EFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFD  983
             EFVQIDQN+LFPYLLVNIGSGVSMIKVDGDGKFQR+SGTNVGGGTYWGLGRLLTKCKSFD
Sbjct  239   EFVQIDQNELFPYLLVNIGSGVSMIKVDGDGKFQRISGTNVGGGTYWGLGRLLTKCKSFD  298

Query  984   DLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDIS  1163
             +LLELSQ GDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDY PEDIS
Sbjct  299   ELLELSQLGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYSPEDIS  358

Query  1164  LSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMF  1343
             LSLLRMISYNIGQI++LNALR+GLKRIFFGGFFIRGHAYTMDTISFAV FWSKG+A+AMF
Sbjct  359   LSLLRMISYNIGQINHLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVQFWSKGDAQAMF  418

Query  1344  LRHEGFLGALGAFMSYEKHGLD  1409
             LRHEGFLGALGAFMSYEKHGLD
Sbjct  419   LRHEGFLGALGAFMSYEKHGLD  440



>emb|CDP12422.1| unnamed protein product [Coffea canephora]
Length=804

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/393 (88%), Positives = 373/393 (95%), Gaps = 1/393 (0%)
 Frame = +3

Query  231   SPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  410
             +P+HRS+SRPQLD+SGAAIQGNFEE+DPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE
Sbjct  7     NPIHRSSSRPQLDVSGAAIQGNFEERDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  66

Query  411   GrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGL  590
              R V D+ K+ +KER G+SNGNRRSYP+LGGRLHFVKFET K+N+CLDFISSKQLHCGG+
Sbjct  67    DRPVNDRIKKTIKERLGISNGNRRSYPVLGGRLHFVKFETNKINQCLDFISSKQLHCGGM  126

Query  591   DTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIR  770
             D   W S    NEN +IKATGGGAYK+ADLFKERLGVSIEKEDEMNCLVAGANFLLKAIR
Sbjct  127   DAHLWHSGV-SNENAVIKATGGGAYKYADLFKERLGVSIEKEDEMNCLVAGANFLLKAIR  185

Query  771   HEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGL  950
             HEAFTH+EGHK FVQIDQNDLFPYLLVN+GSGVS+IKVDGDGKF+RVSGTNVGGGTYWGL
Sbjct  186   HEAFTHMEGHKAFVQIDQNDLFPYLLVNVGSGVSIIKVDGDGKFERVSGTNVGGGTYWGL  245

Query  951   GRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENK  1130
             G+LLTKC SFD+LLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAIS+NK
Sbjct  246   GKLLTKCNSFDELLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISDNK  305

Query  1131  ELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVN  1310
             +LEDYRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV 
Sbjct  306   DLEDYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVQ  365

Query  1311  FWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             FWSKG ++AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  366   FWSKGTSQAMFLRHEGFLGALGAFMSYEKHGLD  398



>ref|XP_002279079.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663163.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663164.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663165.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663166.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663167.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663168.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
Length=906

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/425 (85%), Positives = 388/425 (91%), Gaps = 7/425 (2%)
 Frame = +3

Query  150   DLGIDDKNEKDNIAVLERGGVEKEKEISP----MHRSTSRPQLDLSGAAIQGN-FEEKDP  314
             D+  D +  +    V E GGV +   + P    +HRS SRPQLDLSGAAIQGN FEE+ P
Sbjct  14    DIKEDSEETEPKDKVREEGGVREM--VLPAGNSIHRSGSRPQLDLSGAAIQGNNFEERHP  71

Query  315   TILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPI  494
             TILLPNQSDDISHLALDIGGSLIKLVYFSRHE R ++DKRKR +KER GV+NGNRRSYPI
Sbjct  72    TILLPNQSDDISHLALDIGGSLIKLVYFSRHEDRSIDDKRKRSIKERLGVTNGNRRSYPI  131

Query  495   LGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFA  674
             LGGRLHFVKFET+K+NECLDFI+SKQLH GG+D+  W SEAP +++ IIKATGGGA+KFA
Sbjct  132   LGGRLHFVKFETSKINECLDFINSKQLHRGGMDSRLWLSEAPPSDDVIIKATGGGAHKFA  191

Query  675   DLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVN  854
             DLFKERLGVSI+KEDEM+CLVAGANFLLKAIRHEAFTH+EGHKEFVQID NDLFPYLLVN
Sbjct  192   DLFKERLGVSIDKEDEMDCLVAGANFLLKAIRHEAFTHMEGHKEFVQIDHNDLFPYLLVN  251

Query  855   IGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDML  1034
             IGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDML
Sbjct  252   IGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDML  311

Query  1035  VGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYL  1214
             VGDIYGGMDYSKIGLSASTIASSFGK ISENKELEDYRPEDISLSLLRMISYNIGQISYL
Sbjct  312   VGDIYGGMDYSKIGLSASTIASSFGKTISENKELEDYRPEDISLSLLRMISYNIGQISYL  371

Query  1215  NALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYE  1394
             NALR+GLKRIFFGGFFIRGHAYTMDTISFAV FWS G+A+AMFLRHEGFLGALGAFMSYE
Sbjct  372   NALRFGLKRIFFGGFFIRGHAYTMDTISFAVQFWSNGDAQAMFLRHEGFLGALGAFMSYE  431

Query  1395  KHGLD  1409
             KHGLD
Sbjct  432   KHGLD  436



>gb|KCW49280.1| hypothetical protein EUGRSUZ_K02840 [Eucalyptus grandis]
Length=906

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/397 (88%), Positives = 372/397 (94%), Gaps = 6/397 (2%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             +HRS+SRPQLDLS AAIQGNFEE+DPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE +
Sbjct  49    IHRSSSRPQLDLSKAAIQGNFEERDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEDQ  108

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
                DKRK+ VK R G+SNGNRRSYPILGGRLHFVKFET K+NECL+FI SKQLHC G+D+
Sbjct  109   STIDKRKKTVKLRLGISNGNRRSYPILGGRLHFVKFETHKINECLEFIDSKQLHCSGVDS  168

Query  597   PRWSSEAPQNE------NTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLL  758
               W SE+P ++      N +IKATGGGA+KFADLF+ERLGVSIEKEDEM+CLVAGANFLL
Sbjct  169   RHWGSESPNSQPINNANNAVIKATGGGAFKFADLFRERLGVSIEKEDEMDCLVAGANFLL  228

Query  759   KAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGT  938
             KAIRHEAFTHIEG KEFVQID N+LFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGT
Sbjct  229   KAIRHEAFTHIEGQKEFVQIDHNELFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGT  288

Query  939   YWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI  1118
             YWGLGRLLTKCKSFD+LLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI
Sbjct  289   YWGLGRLLTKCKSFDELLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI  348

Query  1119  SENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTIS  1298
             SENKELEDYRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTIS
Sbjct  349   SENKELEDYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTIS  408

Query  1299  FAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             FAV+FWS+GE +AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  409   FAVHFWSRGEMQAMFLRHEGFLGALGAFMSYEKHGLD  445



>ref|XP_012080051.1| PREDICTED: pantothenate kinase 2 [Jatropha curcas]
 ref|XP_012080052.1| PREDICTED: pantothenate kinase 2 [Jatropha curcas]
 ref|XP_012080053.1| PREDICTED: pantothenate kinase 2 [Jatropha curcas]
 gb|KDP31092.1| hypothetical protein JCGZ_11468 [Jatropha curcas]
Length=911

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/443 (82%), Positives = 392/443 (88%), Gaps = 15/443 (3%)
 Frame = +3

Query  120   MAGVTTGDLPDLGIDDKNEKDNIAVLERGGVEK--------EKEISP-----MHRSTSRP  260
             MAG+     P LGI+D  E +  A +  G + K        EK+++P     +HRS SRP
Sbjct  1     MAGLKED--PVLGINDIMETNEEAEIRDGVIGKVREEAGQSEKDMAPPTGNSIHRSGSRP  58

Query  261   QLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkr  440
             QLDLS AAIQGN EE+DPTILLPNQSDD+SHLALDIGGSLIKLVYFSRHE R + DKRK+
Sbjct  59    QLDLSKAAIQGNSEERDPTILLPNQSDDLSHLALDIGGSLIKLVYFSRHEDRSINDKRKK  118

Query  441   kvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAP  620
              VKER G+SNGNRRSYPILGGRLHFVKFET K+NECLDFISSKQLH GG+D+  W SE P
Sbjct  119   TVKERLGISNGNRRSYPILGGRLHFVKFETRKINECLDFISSKQLHRGGIDSHGWLSETP  178

Query  621   QNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGH  800
              N N +IKATGGGAYKF DLFKERLGVS++KEDEM+CLVAGANFLLKAIRHEAFTH+EG 
Sbjct  179   SNCNAVIKATGGGAYKFTDLFKERLGVSLDKEDEMDCLVAGANFLLKAIRHEAFTHMEGR  238

Query  801   KEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSF  980
             KEFVQID NDLFPYLLVNIGSGVSMIKVDGDGKF+RVSGTNVGGGTYWGLGRLLTKCKSF
Sbjct  239   KEFVQIDHNDLFPYLLVNIGSGVSMIKVDGDGKFERVSGTNVGGGTYWGLGRLLTKCKSF  298

Query  981   DDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDI  1160
             D+LLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGK IS+ KELEDYRPEDI
Sbjct  299   DELLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKTISDKKELEDYRPEDI  358

Query  1161  SLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAM  1340
             SLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV+FWSKGEA+AM
Sbjct  359   SLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEAQAM  418

Query  1341  FLRHEGFLGALGAFMSYEKHGLD  1409
             FLRHEGFLGALGAFMSYEKHGLD
Sbjct  419   FLRHEGFLGALGAFMSYEKHGLD  441



>gb|EYU42581.1| hypothetical protein MIMGU_mgv1a001050mg [Erythranthe guttata]
Length=904

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/402 (87%), Positives = 374/402 (93%), Gaps = 5/402 (1%)
 Frame = +3

Query  219   EKEISPM-----HRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLI  383
             EKE++P+     HRS+SRPQLDLSGAAIQGNFEE+DPTILLPNQSDDISHLALDIGGSLI
Sbjct  33    EKEMAPIAGNSIHRSSSRPQLDLSGAAIQGNFEERDPTILLPNQSDDISHLALDIGGSLI  92

Query  384   KLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFIS  563
             KLVYFSRHE + V D+R++ +  R G++N NRRSYPILGGRLHFVKFET K+NECLDFI 
Sbjct  93    KLVYFSRHENQTVTDRRRKIINARLGITNVNRRSYPILGGRLHFVKFETNKINECLDFIY  152

Query  564   SKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAG  743
             SKQLH GG+D+  W SE    ENTIIKATGGGAYKFADLFK+RLG+SIEKEDEMNCLVAG
Sbjct  153   SKQLHRGGMDSRHWQSEGSVTENTIIKATGGGAYKFADLFKDRLGISIEKEDEMNCLVAG  212

Query  744   ANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTN  923
             ANFLLKAIRHEAFTH+EG KEFVQID NDLFPYLLVNIGSGVSMIKVDGDG FQRVSGTN
Sbjct  213   ANFLLKAIRHEAFTHMEGQKEFVQIDSNDLFPYLLVNIGSGVSMIKVDGDGIFQRVSGTN  272

Query  924   VGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASS  1103
             VGGGTYWGLG+LLTKCKSFD+LLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASS
Sbjct  273   VGGGTYWGLGKLLTKCKSFDELLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASS  332

Query  1104  FGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYT  1283
             FGKAISENK+LEDY PEDISLSLLRMISYNIGQI+YLNALR+GLKRIFFGGFFIRGHAYT
Sbjct  333   FGKAISENKDLEDYSPEDISLSLLRMISYNIGQIAYLNALRFGLKRIFFGGFFIRGHAYT  392

Query  1284  MDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             MDTISFAV FWSKG+A+AMFLRHEGFLGA+GAFMSYEKHGLD
Sbjct  393   MDTISFAVQFWSKGQAQAMFLRHEGFLGAIGAFMSYEKHGLD  434



>ref|XP_010037560.1| PREDICTED: pantothenate kinase 2 [Eucalyptus grandis]
 gb|KCW49279.1| hypothetical protein EUGRSUZ_K02840 [Eucalyptus grandis]
Length=915

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/397 (88%), Positives = 372/397 (94%), Gaps = 6/397 (2%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             +HRS+SRPQLDLS AAIQGNFEE+DPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE +
Sbjct  49    IHRSSSRPQLDLSKAAIQGNFEERDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEDQ  108

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
                DKRK+ VK R G+SNGNRRSYPILGGRLHFVKFET K+NECL+FI SKQLHC G+D+
Sbjct  109   STIDKRKKTVKLRLGISNGNRRSYPILGGRLHFVKFETHKINECLEFIDSKQLHCSGVDS  168

Query  597   PRWSSEAPQNE------NTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLL  758
               W SE+P ++      N +IKATGGGA+KFADLF+ERLGVSIEKEDEM+CLVAGANFLL
Sbjct  169   RHWGSESPNSQPINNANNAVIKATGGGAFKFADLFRERLGVSIEKEDEMDCLVAGANFLL  228

Query  759   KAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGT  938
             KAIRHEAFTHIEG KEFVQID N+LFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGT
Sbjct  229   KAIRHEAFTHIEGQKEFVQIDHNELFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGT  288

Query  939   YWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI  1118
             YWGLGRLLTKCKSFD+LLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI
Sbjct  289   YWGLGRLLTKCKSFDELLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI  348

Query  1119  SENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTIS  1298
             SENKELEDYRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTIS
Sbjct  349   SENKELEDYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTIS  408

Query  1299  FAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             FAV+FWS+GE +AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  409   FAVHFWSRGEMQAMFLRHEGFLGALGAFMSYEKHGLD  445



>gb|KJB53156.1| hypothetical protein B456_008G295400 [Gossypium raimondii]
 gb|KJB53158.1| hypothetical protein B456_008G295400 [Gossypium raimondii]
Length=922

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/419 (85%), Positives = 388/419 (93%), Gaps = 5/419 (1%)
 Frame = +3

Query  153   LGIDDKNEKDNIAVLERGGVEKEKEISPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPN  332
             +G D  N K+N     +GG EK+   + +HRS SRPQLDLS A IQGN EE+DPTILLPN
Sbjct  38    IGEDSSNNKNN----NQGG-EKDMAGNSIHRSGSRPQLDLSKAEIQGNSEERDPTILLPN  92

Query  333   QSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLH  512
             Q+DDISHLALDIGGSLIKLVYFSRHE + V+DKRK+ VKER G+SNGNRR++P+LGGRLH
Sbjct  93    QTDDISHLALDIGGSLIKLVYFSRHEDQSVDDKRKKTVKERLGISNGNRRNFPVLGGRLH  152

Query  513   FVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKER  692
             FVKFET+K+NECLDFISSKQLH GG+D+  W+SEA  NEN +IKATGGGAYKFADLFKER
Sbjct  153   FVKFETSKLNECLDFISSKQLHRGGIDSHHWNSEASANENAVIKATGGGAYKFADLFKER  212

Query  693   LGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVS  872
             LGVSI+KEDEM+CLVAGANFLLKAIRHEAFTH+EGHKEFVQID NDLFPYLLVNIGSGVS
Sbjct  213   LGVSIDKEDEMDCLVAGANFLLKAIRHEAFTHMEGHKEFVQIDHNDLFPYLLVNIGSGVS  272

Query  873   MIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYG  1052
             +IKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKC SFD+LLELSQRGDNRTIDMLVGDIYG
Sbjct  273   IIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCNSFDELLELSQRGDNRTIDMLVGDIYG  332

Query  1053  GMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYG  1232
             GMDYSKIGLSASTIASSFGKAIS+ KEL+DYRPEDISLSLLRMISYNIGQISYLNALR+G
Sbjct  333   GMDYSKIGLSASTIASSFGKAISDKKELQDYRPEDISLSLLRMISYNIGQISYLNALRFG  392

Query  1233  LKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             LKRIFFGGFFIRGHAYTMDTISFAV+FWSKGEA+AMFLRHEGFLGA+GAFMSY+KHGLD
Sbjct  393   LKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEAQAMFLRHEGFLGAVGAFMSYQKHGLD  451



>ref|XP_008356598.1| PREDICTED: pantothenate kinase 2-like [Malus domestica]
Length=916

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/439 (82%), Positives = 391/439 (89%), Gaps = 18/439 (4%)
 Frame = +3

Query  147   PDLGIDD------KNEKDNIA-------VLERGGVEKEKEI-----SPMHRSTSRPQLDL  272
             P LG +D      + E D I+       V+   G E E+++     S +HRS SRPQLDL
Sbjct  8     PVLGXNDIKEREGEEEADKISYTLESHVVIRTEGGEVERDMAQATGSSIHRSGSRPQLDL  67

Query  273   SGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvke  452
             S AAIQGNFEE+DPTILLPNQSDD+SHLALDIGGSLIKLVYFSRHEG+ ++DKRK+ +KE
Sbjct  68    SKAAIQGNFEERDPTILLPNQSDDLSHLALDIGGSLIKLVYFSRHEGQSIDDKRKKTLKE  127

Query  453   rFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNEN  632
             R  +SNG+RRSYPILGGRLHFVKFET K+NECLDFI SKQLH GG+D   W+ +AP NE+
Sbjct  128   RLEISNGSRRSYPILGGRLHFVKFETNKINECLDFIYSKQLHRGGMDARIWNPDAPTNES  187

Query  633   TIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFV  812
             ++IKATGGGAYKFADLFKERLGVS++KEDEMNCLVAGANFLLKAIRHEAFTH EG KEFV
Sbjct  188   SVIKATGGGAYKFADLFKERLGVSLDKEDEMNCLVAGANFLLKAIRHEAFTHKEGQKEFV  247

Query  813   QIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLL  992
             QIDQN+LFPYLLVNIGSGVSMIKVDGDGKFQR+SGTNVGGGTYWGLG+LLTKCKSFD+LL
Sbjct  248   QIDQNELFPYLLVNIGSGVSMIKVDGDGKFQRISGTNVGGGTYWGLGKLLTKCKSFDELL  307

Query  993   ELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSL  1172
             ELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISE KELEDY PEDISLSL
Sbjct  308   ELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISEKKELEDYSPEDISLSL  367

Query  1173  LRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRH  1352
             LRMISYNIGQI+YLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV FWSKGEA+AMFLRH
Sbjct  368   LRMISYNIGQIAYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVQFWSKGEAQAMFLRH  427

Query  1353  EGFLGALGAFMSYEKHGLD  1409
             EGFLGALGAFMSYEKHGLD
Sbjct  428   EGFLGALGAFMSYEKHGLD  446



>emb|CBI15019.3| unnamed protein product [Vitis vinifera]
Length=988

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/392 (90%), Positives = 375/392 (96%), Gaps = 1/392 (0%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGN-FEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEG  413
             +HRS SRPQLDLSGAAIQGN FEE+ PTILLPNQSDDISHLALDIGGSLIKLVYFSRHE 
Sbjct  9     IHRSGSRPQLDLSGAAIQGNNFEERHPTILLPNQSDDISHLALDIGGSLIKLVYFSRHED  68

Query  414   rqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLD  593
             R ++DKRKR +KER GV+NGNRRSYPILGGRLHFVKFET+K+NECLDFI+SKQLH GG+D
Sbjct  69    RSIDDKRKRSIKERLGVTNGNRRSYPILGGRLHFVKFETSKINECLDFINSKQLHRGGMD  128

Query  594   TPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRH  773
             +  W SEAP +++ IIKATGGGA+KFADLFKERLGVSI+KEDEM+CLVAGANFLLKAIRH
Sbjct  129   SRLWLSEAPPSDDVIIKATGGGAHKFADLFKERLGVSIDKEDEMDCLVAGANFLLKAIRH  188

Query  774   EAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLG  953
             EAFTH+EGHKEFVQID NDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLG
Sbjct  189   EAFTHMEGHKEFVQIDHNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLG  248

Query  954   RLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKE  1133
             RLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGK ISENKE
Sbjct  249   RLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKTISENKE  308

Query  1134  LEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNF  1313
             LEDYRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV F
Sbjct  309   LEDYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVQF  368

Query  1314  WSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             WS G+A+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  369   WSNGDAQAMFLRHEGFLGALGAFMSYEKHGLD  400



>ref|XP_006439829.1| hypothetical protein CICLE_v10018751mg [Citrus clementina]
 gb|ESR53069.1| hypothetical protein CICLE_v10018751mg [Citrus clementina]
Length=828

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/397 (87%), Positives = 370/397 (93%), Gaps = 0/397 (0%)
 Frame = +3

Query  219   EKEISPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYF  398
             E+E+  MHRS SRPQLDLS AAIQGNFE K+PTILLPNQSDDISHLALDIGGSLIKLVYF
Sbjct  61    EREMPSMHRSGSRPQLDLSKAAIQGNFEVKNPTILLPNQSDDISHLALDIGGSLIKLVYF  120

Query  399   SRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLH  578
             SRHE + ++DKRK+ + ER G+SNGNRRSYPILGGRLHFVKFETTK+NECLDFI SKQLH
Sbjct  121   SRHEDQSIDDKRKKTINERLGISNGNRRSYPILGGRLHFVKFETTKINECLDFIHSKQLH  180

Query  579   CGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLL  758
              GG+D+  W+     N+N +IKATGGGAYKFADLFKERLGVS++KEDEM+CLVAGANFLL
Sbjct  181   RGGVDSRHWNPGVQVNDNAVIKATGGGAYKFADLFKERLGVSLDKEDEMDCLVAGANFLL  240

Query  759   KAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGT  938
             KAIRHEAFTH+EG KEFVQID NDLFPYLLVNIGSGVSMIKVDGDGKF+RVSGTNVGGGT
Sbjct  241   KAIRHEAFTHMEGQKEFVQIDTNDLFPYLLVNIGSGVSMIKVDGDGKFERVSGTNVGGGT  300

Query  939   YWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI  1118
             YWGLGRLLTKCKSFD+LLELSQRGDN TIDMLVGDIYGGMDYSKIGLSASTIASSFGK I
Sbjct  301   YWGLGRLLTKCKSFDELLELSQRGDNSTIDMLVGDIYGGMDYSKIGLSASTIASSFGKTI  360

Query  1119  SENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTIS  1298
             S+ KEL DYRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTIS
Sbjct  361   SDKKELADYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTIS  420

Query  1299  FAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             FAV FWSKGEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  421   FAVQFWSKGEAQAMFLRHEGFLGALGAFMSYEKHGLD  457



>gb|KCW49278.1| hypothetical protein EUGRSUZ_K02840 [Eucalyptus grandis]
Length=916

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/398 (88%), Positives = 369/398 (93%), Gaps = 7/398 (2%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             +HRS+SRPQLDLS AAIQGNFEE+DPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE +
Sbjct  49    IHRSSSRPQLDLSKAAIQGNFEERDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEDQ  108

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
                DKRK+ VK R G+SNGNRRSYPILGGRLHFVKFET K+NECL+FI SKQLHC G+D+
Sbjct  109   STIDKRKKTVKLRLGISNGNRRSYPILGGRLHFVKFETHKINECLEFIDSKQLHCSGVDS  168

Query  597   PRWSSEAPQ-------NENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFL  755
               W SE+P        N   I KATGGGA+KFADLF+ERLGVSIEKEDEM+CLVAGANFL
Sbjct  169   RHWGSESPNSQPINNANNAVIKKATGGGAFKFADLFRERLGVSIEKEDEMDCLVAGANFL  228

Query  756   LKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGG  935
             LKAIRHEAFTHIEG KEFVQID N+LFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGG
Sbjct  229   LKAIRHEAFTHIEGQKEFVQIDHNELFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGG  288

Query  936   TYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKA  1115
             TYWGLGRLLTKCKSFD+LLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKA
Sbjct  289   TYWGLGRLLTKCKSFDELLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKA  348

Query  1116  ISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTI  1295
             ISENKELEDYRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTI
Sbjct  349   ISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTI  408

Query  1296  SFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             SFAV+FWS+GE +AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  409   SFAVHFWSRGEMQAMFLRHEGFLGALGAFMSYEKHGLD  446



>gb|KJB53157.1| hypothetical protein B456_008G295400 [Gossypium raimondii]
Length=867

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/391 (88%), Positives = 374/391 (96%), Gaps = 0/391 (0%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             +HRS SRPQLDLS A IQGN EE+DPTILLPNQ+DDISHLALDIGGSLIKLVYFSRHE +
Sbjct  6     IHRSGSRPQLDLSKAEIQGNSEERDPTILLPNQTDDISHLALDIGGSLIKLVYFSRHEDQ  65

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
              V+DKRK+ VKER G+SNGNRR++P+LGGRLHFVKFET+K+NECLDFISSKQLH GG+D+
Sbjct  66    SVDDKRKKTVKERLGISNGNRRNFPVLGGRLHFVKFETSKLNECLDFISSKQLHRGGIDS  125

Query  597   PRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHE  776
               W+SEA  NEN +IKATGGGAYKFADLFKERLGVSI+KEDEM+CLVAGANFLLKAIRHE
Sbjct  126   HHWNSEASANENAVIKATGGGAYKFADLFKERLGVSIDKEDEMDCLVAGANFLLKAIRHE  185

Query  777   AFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             AFTH+EGHKEFVQID NDLFPYLLVNIGSGVS+IKVDGDGKFQRVSGTNVGGGTYWGLGR
Sbjct  186   AFTHMEGHKEFVQIDHNDLFPYLLVNIGSGVSIIKVDGDGKFQRVSGTNVGGGTYWGLGR  245

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL  1136
             LLTKC SFD+LLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAIS+ KEL
Sbjct  246   LLTKCNSFDELLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISDKKEL  305

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
             +DYRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV+FW
Sbjct  306   QDYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVHFW  365

Query  1317  SKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             SKGEA+AMFLRHEGFLGA+GAFMSY+KHGLD
Sbjct  366   SKGEAQAMFLRHEGFLGAVGAFMSYQKHGLD  396



>ref|XP_009363012.1| PREDICTED: pantothenate kinase 2 [Pyrus x bretschneideri]
 ref|XP_009363013.1| PREDICTED: pantothenate kinase 2 [Pyrus x bretschneideri]
 ref|XP_009363015.1| PREDICTED: pantothenate kinase 2 [Pyrus x bretschneideri]
Length=915

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/446 (79%), Positives = 394/446 (88%), Gaps = 17/446 (4%)
 Frame = +3

Query  120   MAGVTTGDLPDLGIDDKNEKDNIAVLERGGV-----------EKEKEISP-----MHRST  251
             MAG  T D+ +   ++  +K NI  LE   V             E++++P     +HRS 
Sbjct  1     MAGFGTSDIKEREKEEGGDK-NINTLESHAVIRTEGGEVGQSSSERDMAPATGNSIHRSG  59

Query  252   SRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedk  431
             SRPQLDLS AAIQGNFEE+DPTILLPNQSDD+SHLALDIGGSLIKLVYFSRHEG+ ++DK
Sbjct  60    SRPQLDLSKAAIQGNFEERDPTILLPNQSDDLSHLALDIGGSLIKLVYFSRHEGQSIDDK  119

Query  432   rkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSS  611
             RK+ +KER G+SNG+RRSYP+LGGRLHFVKFET K+NECLDFI SKQLH GG+D   W+ 
Sbjct  120   RKKTLKERLGISNGSRRSYPVLGGRLHFVKFETNKINECLDFIYSKQLHRGGMDARIWNP  179

Query  612   EAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHI  791
             +AP NE+++IKATGGGAYKFADLFKERLGVS++KEDEMNCLV+GANFLLKAIRHEAFTH+
Sbjct  180   DAPTNESSVIKATGGGAYKFADLFKERLGVSLDKEDEMNCLVSGANFLLKAIRHEAFTHM  239

Query  792   EGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKC  971
             EG KEFVQIDQN+LFPYLLVNIGSGVS+IKVDGDGKFQRVSGTNVGGGTYWGLG+LLTKC
Sbjct  240   EGQKEFVQIDQNELFPYLLVNIGSGVSIIKVDGDGKFQRVSGTNVGGGTYWGLGKLLTKC  299

Query  972   KSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRP  1151
             KSFD+LLELSQRGDN  IDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDY P
Sbjct  300   KSFDELLELSQRGDNGAIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYSP  359

Query  1152  EDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEA  1331
             EDISLSLLRMISYNIGQI+YLNALR+GLKRI+FGGFFIRGHAYTMDTISFAV FWS G+A
Sbjct  360   EDISLSLLRMISYNIGQIAYLNALRFGLKRIYFGGFFIRGHAYTMDTISFAVQFWSNGDA  419

Query  1332  EAMFLRHEGFLGALGAFMSYEKHGLD  1409
             +AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  420   QAMFLRHEGFLGALGAFMSYEKHGLD  445



>ref|XP_011028555.1| PREDICTED: pantothenate kinase 2-like [Populus euphratica]
 ref|XP_011028556.1| PREDICTED: pantothenate kinase 2-like [Populus euphratica]
Length=936

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/402 (87%), Positives = 374/402 (93%), Gaps = 5/402 (1%)
 Frame = +3

Query  219   EKEISP-----MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLI  383
             E+++ P     +HRS SRPQLDLS AAI+G FEE+DPTILLPNQSDDISHLALDIGGSLI
Sbjct  65    ERDMVPPTSNSIHRSGSRPQLDLSKAAIEGTFEERDPTILLPNQSDDISHLALDIGGSLI  124

Query  384   KLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFIS  563
             KLVYFSRH+ R   DKRK+ VKER G+SNGNRRSYPILGGRLHFVKFET+K+NECLDFIS
Sbjct  125   KLVYFSRHQDRPTNDKRKKTVKERLGISNGNRRSYPILGGRLHFVKFETSKINECLDFIS  184

Query  564   SKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAG  743
             SKQLHCGG+D+  W SE   N N +IKATGGGAYKFADLFKERLGVS++KEDEM+CLVAG
Sbjct  185   SKQLHCGGMDSHSWHSETSPNGNAVIKATGGGAYKFADLFKERLGVSLDKEDEMDCLVAG  244

Query  744   ANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTN  923
             ANFLLKAIRHEAFTH+EG KEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKF+RVSGTN
Sbjct  245   ANFLLKAIRHEAFTHMEGQKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFERVSGTN  304

Query  924   VGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASS  1103
             VGGGTYWGLGRLLTKCKSFD+LLELSQ+GDNRTIDMLVGDIYGGMDY+KIGLSASTIASS
Sbjct  305   VGGGTYWGLGRLLTKCKSFDELLELSQKGDNRTIDMLVGDIYGGMDYNKIGLSASTIASS  364

Query  1104  FGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYT  1283
             FGK ISE KEL  YRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYT
Sbjct  365   FGKTISEKKELTGYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYT  424

Query  1284  MDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             MDTISFAV+FWSKGEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  425   MDTISFAVHFWSKGEAQAMFLRHEGFLGALGAFMSYEKHGLD  466



>ref|XP_006439830.1| hypothetical protein CICLE_v10018751mg [Citrus clementina]
 gb|ESR53070.1| hypothetical protein CICLE_v10018751mg [Citrus clementina]
Length=927

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/397 (87%), Positives = 370/397 (93%), Gaps = 0/397 (0%)
 Frame = +3

Query  219   EKEISPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYF  398
             E+E+  MHRS SRPQLDLS AAIQGNFE K+PTILLPNQSDDISHLALDIGGSLIKLVYF
Sbjct  61    EREMPSMHRSGSRPQLDLSKAAIQGNFEVKNPTILLPNQSDDISHLALDIGGSLIKLVYF  120

Query  399   SRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLH  578
             SRHE + ++DKRK+ + ER G+SNGNRRSYPILGGRLHFVKFETTK+NECLDFI SKQLH
Sbjct  121   SRHEDQSIDDKRKKTINERLGISNGNRRSYPILGGRLHFVKFETTKINECLDFIHSKQLH  180

Query  579   CGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLL  758
              GG+D+  W+     N+N +IKATGGGAYKFADLFKERLGVS++KEDEM+CLVAGANFLL
Sbjct  181   RGGVDSRHWNPGVQVNDNAVIKATGGGAYKFADLFKERLGVSLDKEDEMDCLVAGANFLL  240

Query  759   KAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGT  938
             KAIRHEAFTH+EG KEFVQID NDLFPYLLVNIGSGVSMIKVDGDGKF+RVSGTNVGGGT
Sbjct  241   KAIRHEAFTHMEGQKEFVQIDTNDLFPYLLVNIGSGVSMIKVDGDGKFERVSGTNVGGGT  300

Query  939   YWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI  1118
             YWGLGRLLTKCKSFD+LLELSQRGDN TIDMLVGDIYGGMDYSKIGLSASTIASSFGK I
Sbjct  301   YWGLGRLLTKCKSFDELLELSQRGDNSTIDMLVGDIYGGMDYSKIGLSASTIASSFGKTI  360

Query  1119  SENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTIS  1298
             S+ KEL DYRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTIS
Sbjct  361   SDKKELADYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTIS  420

Query  1299  FAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             FAV FWSKGEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  421   FAVQFWSKGEAQAMFLRHEGFLGALGAFMSYEKHGLD  457



>ref|XP_007036234.1| Pantothenate kinase 2 isoform 1 [Theobroma cacao]
 gb|EOY20735.1| Pantothenate kinase 2 isoform 1 [Theobroma cacao]
Length=973

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/413 (86%), Positives = 383/413 (93%), Gaps = 16/413 (4%)
 Frame = +3

Query  219   EKEISP-----MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLI  383
             E++++P     +HRS SRPQLDLS AAIQG+ EE+DPTILLPNQSDDISHLALDIGGSLI
Sbjct  60    ERDMAPPASNSIHRSGSRPQLDLSKAAIQGSSEERDPTILLPNQSDDISHLALDIGGSLI  119

Query  384   KLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFIS  563
             KLVYFSRHE R ++DKRK+ VKER G+SNGNRRSYPILGGRLHFVKFET+K+NECLDFIS
Sbjct  120   KLVYFSRHEDRSIDDKRKKTVKERLGISNGNRRSYPILGGRLHFVKFETSKLNECLDFIS  179

Query  564   SKQLHCGGLDTPRWSSEAPQNENTIIK-ATGGGAYKFADLFKERLGVSIEKEDEMNCLVA  740
             SKQLH GG+D+  W+SEAP NEN +IK ATGGGAYKFADLFKERLGVSI+KEDEM+CLVA
Sbjct  180   SKQLHRGGIDSHHWNSEAPANENAVIKKATGGGAYKFADLFKERLGVSIDKEDEMDCLVA  239

Query  741   GANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGT  920
             GANFLLKAIRHEAFTH+EGHKEFVQ+D NDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGT
Sbjct  240   GANFLLKAIRHEAFTHMEGHKEFVQLDHNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGT  299

Query  921   NVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSK----------  1070
             NVGGGTYWGLGRLLTKCKSFD+LLELSQRGDNRTIDMLVGDIYGGMDYSK          
Sbjct  300   NVGGGTYWGLGRLLTKCKSFDELLELSQRGDNRTIDMLVGDIYGGMDYSKLPPSILKSSQ  359

Query  1071  IGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriff  1250
             IGLSASTIASSFGKAIS+ KELEDYRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFF
Sbjct  360   IGLSASTIASSFGKAISDKKELEDYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFF  419

Query  1251  ggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             GGFFIRGHAYTMDTISFAV+FWS+GEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  420   GGFFIRGHAYTMDTISFAVHFWSQGEAQAMFLRHEGFLGALGAFMSYEKHGLD  472



>ref|XP_008438456.1| PREDICTED: pantothenate kinase 2 [Cucumis melo]
Length=911

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/422 (84%), Positives = 382/422 (91%), Gaps = 9/422 (2%)
 Frame = +3

Query  162   DDKNEKDNIAVLERGGVEKEKEISP-----MHRSTSRPQLDLSGAAIQGNFEEKDPTILL  326
             DDKN+   +   E G    E++++P     +HRS SRPQLDLS A IQGNFEE+DPTILL
Sbjct  23    DDKNQ---LVDKEAGLSGGERDMAPVTGNSIHRSGSRPQLDLSKAEIQGNFEERDPTILL  79

Query  327   PNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGR  506
             PNQSDDISHLALDIGGSLIKLVYFSRHE + V+DKRKR +K+R G+SNGNRRSYP+LGGR
Sbjct  80    PNQSDDISHLALDIGGSLIKLVYFSRHEDQSVDDKRKRSIKQRLGLSNGNRRSYPVLGGR  139

Query  507   LHFVKFETTKVNECLDFISSKQLHCGGL-DTPRWSSEAPQNENTIIKATGGGAYKFADLF  683
             LHFVKFET+K+NECLDFI SKQLH G   D P W S+ P NEN IIKATGGGAYKFADLF
Sbjct  140   LHFVKFETSKINECLDFIHSKQLHRGACNDLPHWHSDDPANENAIIKATGGGAYKFADLF  199

Query  684   KERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGS  863
             KERLGVSIEKEDEM+CLVAGANFLLKAIRHEAFTH+EG KEFVQ+D N+LFPYLLVNIGS
Sbjct  200   KERLGVSIEKEDEMDCLVAGANFLLKAIRHEAFTHMEGKKEFVQLDHNELFPYLLVNIGS  259

Query  864   GVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGD  1043
             GVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKC SFD+LLELSQ+GDN TIDMLVGD
Sbjct  260   GVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCNSFDELLELSQKGDNSTIDMLVGD  319

Query  1044  IYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNAL  1223
             IYGGMDYSKIGLSASTIASSFGK IS NKELEDYRPEDISLSLLRMISYNIGQISYLNAL
Sbjct  320   IYGGMDYSKIGLSASTIASSFGKTISVNKELEDYRPEDISLSLLRMISYNIGQISYLNAL  379

Query  1224  RYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHG  1403
             R+GLKRIFFGGFFIRGHAYTMDTISFAV+FWSKGEA+AMFLRHEGFLGALGAFMSYEKHG
Sbjct  380   RFGLKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEAQAMFLRHEGFLGALGAFMSYEKHG  439

Query  1404  LD  1409
             LD
Sbjct  440   LD  441



>ref|XP_004152477.1| PREDICTED: pantothenate kinase 2 [Cucumis sativus]
 ref|XP_011651576.1| PREDICTED: pantothenate kinase 2 [Cucumis sativus]
 gb|KGN64313.1| hypothetical protein Csa_1G046095 [Cucumis sativus]
Length=911

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/422 (84%), Positives = 383/422 (91%), Gaps = 9/422 (2%)
 Frame = +3

Query  162   DDKNEKDNIAVLERGGVEKEKEISP-----MHRSTSRPQLDLSGAAIQGNFEEKDPTILL  326
             DDKN+   +   E G    E++++P     +HRS SRPQLDLS A IQGNFEE+DPTILL
Sbjct  23    DDKNQ---LVDKEAGLSGGERDMAPVTGNSIHRSGSRPQLDLSKAEIQGNFEERDPTILL  79

Query  327   PNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGR  506
             PNQSDDISHLALDIGGSLIKLVYFSRHE + V+DKRKR VK+R G+SNGNRRSYP+LGGR
Sbjct  80    PNQSDDISHLALDIGGSLIKLVYFSRHEDQSVDDKRKRSVKQRLGLSNGNRRSYPVLGGR  139

Query  507   LHFVKFETTKVNECLDFISSKQLHCGGL-DTPRWSSEAPQNENTIIKATGGGAYKFADLF  683
             LHFVKFET+K+NECLDFI SKQLH G   D P W S+ P+NEN IIKATGGGAYKFADLF
Sbjct  140   LHFVKFETSKINECLDFIHSKQLHRGAYKDLPHWHSDGPENENAIIKATGGGAYKFADLF  199

Query  684   KERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGS  863
             KERLGVSI+KEDEM+CLVAGANFLLKAIRHEAFTH+EG KEFVQ+D N+LFPYLLVNIGS
Sbjct  200   KERLGVSIDKEDEMDCLVAGANFLLKAIRHEAFTHMEGKKEFVQLDHNELFPYLLVNIGS  259

Query  864   GVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGD  1043
             GVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKC SFD+LLELSQ+GDN TIDMLVGD
Sbjct  260   GVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCNSFDELLELSQKGDNSTIDMLVGD  319

Query  1044  IYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNAL  1223
             IYGGMDYSKIGLSASTIASSFGK IS NKELEDYRPEDISLSLLRMISYNIGQISYLNAL
Sbjct  320   IYGGMDYSKIGLSASTIASSFGKTISVNKELEDYRPEDISLSLLRMISYNIGQISYLNAL  379

Query  1224  RYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHG  1403
             R+GLKRIFFGGFFIRGHAYTMDTISFAV+FWSKGEA+AMFLRHEGFLGALGAFMSYEKHG
Sbjct  380   RFGLKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEAQAMFLRHEGFLGALGAFMSYEKHG  439

Query  1404  LD  1409
             LD
Sbjct  440   LD  441



>gb|KHG28314.1| hypothetical protein F383_13494 [Gossypium arboreum]
Length=950

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/429 (83%), Positives = 388/429 (90%), Gaps = 15/429 (3%)
 Frame = +3

Query  153   LGIDDKNEKDNIAVLERGGVEKEKEISPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPN  332
             +G D  N K+N     +GG EK+   + +HRS SRPQLDLS A IQGN EE+DPTILLPN
Sbjct  38    IGEDSSNNKNN----NQGG-EKDMAGNSIHRSGSRPQLDLSKAEIQGNSEERDPTILLPN  92

Query  333   QSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLH  512
             Q+DDISHLALDIGGSLIKLVYFSRHE + V+DKRK+ VKER G+SNGNRR++PILGGRLH
Sbjct  93    QTDDISHLALDIGGSLIKLVYFSRHEDQSVDDKRKKTVKERLGISNGNRRNFPILGGRLH  152

Query  513   FVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKER  692
             FVKFET+K+NECLDFISSKQLH G +D+  W+SEAP NEN +IKATGGGAYKFADLFKER
Sbjct  153   FVKFETSKLNECLDFISSKQLHRGRIDSHHWNSEAPANENAVIKATGGGAYKFADLFKER  212

Query  693   LGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVS  872
             LGVSI+KEDEM+CLVAGANFLLKAIRHEAFTH+EGHKEFVQID NDLFPYLLVNIGSGVS
Sbjct  213   LGVSIDKEDEMDCLVAGANFLLKAIRHEAFTHMEGHKEFVQIDHNDLFPYLLVNIGSGVS  272

Query  873   MIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCK----------SFDDLLELSQRGDNRT  1022
             +IKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKC           SFD+LLELSQRGDNRT
Sbjct  273   IIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCNRPYSSVTPLFSFDELLELSQRGDNRT  332

Query  1023  IDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQ  1202
             IDMLVGDIYGGMDYSKIGLSASTIASSFGKAIS+ KEL+DYRPEDISLSLLRMISYNIGQ
Sbjct  333   IDMLVGDIYGGMDYSKIGLSASTIASSFGKAISDKKELQDYRPEDISLSLLRMISYNIGQ  392

Query  1203  ISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAF  1382
             ISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV+FWSKGEA+AMFLRHEGFLGA+GAF
Sbjct  393   ISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEAQAMFLRHEGFLGAVGAF  452

Query  1383  MSYEKHGLD  1409
             MSY+KHGLD
Sbjct  453   MSYQKHGLD  461



>gb|KJB39191.1| hypothetical protein B456_007G001600 [Gossypium raimondii]
Length=678

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/391 (88%), Positives = 370/391 (95%), Gaps = 3/391 (1%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             +HRS SRPQLDLS AAIQGN EE+DPTILLPNQSDDISH ALDIGGSLIKLVYFSRHEG+
Sbjct  67    LHRSGSRPQLDLSKAAIQGNSEERDPTILLPNQSDDISHFALDIGGSLIKLVYFSRHEGQ  126

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
              ++DKRK+ VKE   +SNG+RRSYPILGGRLHFVKFET+K+NECLDFISSKQLH G +D+
Sbjct  127   SIDDKRKKTVKE---ISNGSRRSYPILGGRLHFVKFETSKLNECLDFISSKQLHNGRIDS  183

Query  597   PRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHE  776
               W+SEA   EN +IKATGGGAYKFADLFKERLGVSI+KEDEM+CLVAGANFLLKAIRHE
Sbjct  184   HYWNSEATNKENAVIKATGGGAYKFADLFKERLGVSIDKEDEMDCLVAGANFLLKAIRHE  243

Query  777   AFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             AFTH+EGHKEFVQID NDLFPYLLVN+GSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR
Sbjct  244   AFTHMEGHKEFVQIDHNDLFPYLLVNVGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  303

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL  1136
             LLTKC SFD+LLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAIS+ KEL
Sbjct  304   LLTKCNSFDELLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISDKKEL  363

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
             ED+RPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV+FW
Sbjct  364   EDHRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVHFW  423

Query  1317  SKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             S+G+A+AMFLRHEGFLGALGAFMSYEK GLD
Sbjct  424   SQGQAQAMFLRHEGFLGALGAFMSYEKLGLD  454



>ref|XP_008795923.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Phoenix dactylifera]
 ref|XP_008795924.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Phoenix dactylifera]
Length=909

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/394 (87%), Positives = 375/394 (95%), Gaps = 1/394 (0%)
 Frame = +3

Query  231   SPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  410
             +P+HRS+SRPQLD+SGAAIQGNFEE++PTILLPNQSDDISHLALDIGGSLIKLVYFSRHE
Sbjct  37    APIHRSSSRPQLDVSGAAIQGNFEERNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  96

Query  411   GrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGL  590
              + ++DKR+R +K+RFG+SNG+RRSYPILGGRLHFVKFET K+NECLDFISSKQLH GGL
Sbjct  97    EQSLDDKRRRSIKKRFGISNGSRRSYPILGGRLHFVKFETGKLNECLDFISSKQLHLGGL  156

Query  591   DTPRWSS-EAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAI  767
             D+P W S   P++   IIKATGGGAYKFAD+FKERLGVS++KEDEM+CLVAGANFLLKAI
Sbjct  157   DSPSWRSGTRPEDNAIIIKATGGGAYKFADVFKERLGVSLDKEDEMDCLVAGANFLLKAI  216

Query  768   RHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWG  947
             RHEAFTH+EG KEFVQID NDLFPYLLVN+GSGVS+IKVDGDGKFQRVSGTNVGGGTYWG
Sbjct  217   RHEAFTHMEGQKEFVQIDHNDLFPYLLVNVGSGVSIIKVDGDGKFQRVSGTNVGGGTYWG  276

Query  948   LGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISEN  1127
             LGRLLTKCKSFD+LLELSQ+GDN  +DMLVGDIYGGMDYSKIGLSASTIASSFGK ISE+
Sbjct  277   LGRLLTKCKSFDELLELSQQGDNGNVDMLVGDIYGGMDYSKIGLSASTIASSFGKTISES  336

Query  1128  KELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAV  1307
             KEL DYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAV
Sbjct  337   KELLDYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAV  396

Query  1308  NFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             +FWSKG+A+AMFLRHEGFLGALGAFMSYE+HGLD
Sbjct  397   HFWSKGQAQAMFLRHEGFLGALGAFMSYEEHGLD  430



>ref|XP_008795922.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Phoenix dactylifera]
Length=913

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/394 (87%), Positives = 375/394 (95%), Gaps = 1/394 (0%)
 Frame = +3

Query  231   SPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  410
             +P+HRS+SRPQLD+SGAAIQGNFEE++PTILLPNQSDDISHLALDIGGSLIKLVYFSRHE
Sbjct  37    APIHRSSSRPQLDVSGAAIQGNFEERNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  96

Query  411   GrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGL  590
              + ++DKR+R +K+RFG+SNG+RRSYPILGGRLHFVKFET K+NECLDFISSKQLH GGL
Sbjct  97    EQSLDDKRRRSIKKRFGISNGSRRSYPILGGRLHFVKFETGKLNECLDFISSKQLHLGGL  156

Query  591   DTPRWSS-EAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAI  767
             D+P W S   P++   IIKATGGGAYKFAD+FKERLGVS++KEDEM+CLVAGANFLLKAI
Sbjct  157   DSPSWRSGTRPEDNAIIIKATGGGAYKFADVFKERLGVSLDKEDEMDCLVAGANFLLKAI  216

Query  768   RHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWG  947
             RHEAFTH+EG KEFVQID NDLFPYLLVN+GSGVS+IKVDGDGKFQRVSGTNVGGGTYWG
Sbjct  217   RHEAFTHMEGQKEFVQIDHNDLFPYLLVNVGSGVSIIKVDGDGKFQRVSGTNVGGGTYWG  276

Query  948   LGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISEN  1127
             LGRLLTKCKSFD+LLELSQ+GDN  +DMLVGDIYGGMDYSKIGLSASTIASSFGK ISE+
Sbjct  277   LGRLLTKCKSFDELLELSQQGDNGNVDMLVGDIYGGMDYSKIGLSASTIASSFGKTISES  336

Query  1128  KELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAV  1307
             KEL DYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAV
Sbjct  337   KELLDYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAV  396

Query  1308  NFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             +FWSKG+A+AMFLRHEGFLGALGAFMSYE+HGLD
Sbjct  397   HFWSKGQAQAMFLRHEGFLGALGAFMSYEEHGLD  430



>ref|XP_011001529.1| PREDICTED: pantothenate kinase 2-like [Populus euphratica]
 ref|XP_011001530.1| PREDICTED: pantothenate kinase 2-like [Populus euphratica]
Length=935

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/409 (85%), Positives = 376/409 (92%), Gaps = 5/409 (1%)
 Frame = +3

Query  198   ERGGVEKEKEISP-----MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLAL  362
             E  G + E+++ P     +HRS SRPQLDLS AAI+GNFEE+DPTILLPNQSDDISHLAL
Sbjct  57    EGSGGQGERDMVPPTSNSIHRSGSRPQLDLSKAAIEGNFEERDPTILLPNQSDDISHLAL  116

Query  363   DIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVN  542
             DIGGSLIKLVYFSRH+ R   DKRK+ VKER G+SNGNRRSYPILGGRLHFVKFET+K+N
Sbjct  117   DIGGSLIKLVYFSRHQDRPTNDKRKKTVKERLGISNGNRRSYPILGGRLHFVKFETSKIN  176

Query  543   ECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDE  722
             ECLDFISSKQLH GG+D+  W S+   N N +IKATGGGAYK+ADLFKERLGVS++KEDE
Sbjct  177   ECLDFISSKQLHRGGMDSHSWHSDTSSNGNAVIKATGGGAYKYADLFKERLGVSLDKEDE  236

Query  723   MNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKF  902
             M+CLVAGANFLLKAIRHEAFTH+EG KEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKF
Sbjct  237   MDCLVAGANFLLKAIRHEAFTHMEGQKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKF  296

Query  903   QRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLS  1082
             +RVSGTNVGGGTYWGLGRLL +CKSFD+LLELSQ+GDNRTIDMLVGDIYGGMDY+KIGLS
Sbjct  297   ERVSGTNVGGGTYWGLGRLLNQCKSFDELLELSQKGDNRTIDMLVGDIYGGMDYNKIGLS  356

Query  1083  ASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggff  1262
             ASTIASSFGK ISE KEL  YRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFF
Sbjct  357   ASTIASSFGKTISEKKELTGYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFF  416

Query  1263  irgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             IRGHAYTMDTISFAV+FWSKGEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  417   IRGHAYTMDTISFAVHFWSKGEAQAMFLRHEGFLGALGAFMSYEKHGLD  465



>ref|XP_010678776.1| PREDICTED: pantothenate kinase 2 [Beta vulgaris subsp. vulgaris]
Length=899

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/391 (88%), Positives = 369/391 (94%), Gaps = 0/391 (0%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             +HRS SRPQLD+SGAAIQGNFEE+DPTILLPNQSDDISHLALDIGGSLIKL YFSRHE R
Sbjct  39    IHRSGSRPQLDVSGAAIQGNFEERDPTILLPNQSDDISHLALDIGGSLIKLAYFSRHEDR  98

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
              VEDKRKR +K+RFG+ NGNRRSYPILGGRLHFVKFET K+NECLDFI SKQLH GG+  
Sbjct  99    SVEDKRKRSIKQRFGIPNGNRRSYPILGGRLHFVKFETHKINECLDFIKSKQLHRGGMVA  158

Query  597   PRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHE  776
               W S+A  NEN ++KATGGGAYKFADLFKE+LGVS++KEDEM+CLVAGANFLLKAIRHE
Sbjct  159   RCWPSDALSNENVVVKATGGGAYKFADLFKEKLGVSLDKEDEMDCLVAGANFLLKAIRHE  218

Query  777   AFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             AFTH+EG KEFVQI+QNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLG+
Sbjct  219   AFTHMEGQKEFVQIEQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGK  278

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL  1136
             LLTKCKSFDDLLELSQRGDN  IDMLVGDIYGGMDYSKIGLSASTIASSFGK IS +KEL
Sbjct  279   LLTKCKSFDDLLELSQRGDNGAIDMLVGDIYGGMDYSKIGLSASTIASSFGKTISNDKEL  338

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
             EDYRPEDISLSLLRMISYNIGQISYLNALR+G+KRIFFGGFFIRGHAYTMDTISFAV+FW
Sbjct  339   EDYRPEDISLSLLRMISYNIGQISYLNALRFGIKRIFFGGFFIRGHAYTMDTISFAVHFW  398

Query  1317  SKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             SKG+A+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  399   SKGDAKAMFLRHEGFLGALGAFMSYEKHGLD  429



>ref|XP_010101220.1| Pantothenate kinase 2 [Morus notabilis]
 gb|EXB87894.1| Pantothenate kinase 2 [Morus notabilis]
Length=912

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/394 (88%), Positives = 369/394 (94%), Gaps = 1/394 (0%)
 Frame = +3

Query  231   SPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDIS-HLALDIGGSLIKLVYFSRH  407
             S +HRS+SRPQLDLS AAIQGN EE+DPTILLPNQSDDIS HLALDIGGSLIKLVYFSRH
Sbjct  49    SSIHRSSSRPQLDLSKAAIQGNSEERDPTILLPNQSDDISSHLALDIGGSLIKLVYFSRH  108

Query  408   EGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGG  587
             E    +DKRK+ VKER G+SNGNRRSYPILGGRLHFVKFET K+NECLDFI SK+LH GG
Sbjct  109   EDHSTDDKRKKNVKERLGISNGNRRSYPILGGRLHFVKFETHKINECLDFIYSKRLHHGG  168

Query  588   LDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAI  767
             +D+  W ++AP NEN  IKATGGGAYKFAD F++RLGV+++KEDEM+CLVAGANFLLKAI
Sbjct  169   IDSHSWLTDAPTNENATIKATGGGAYKFADFFRQRLGVTLDKEDEMDCLVAGANFLLKAI  228

Query  768   RHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWG  947
             RHEAFTH EG KEFVQID N+LFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWG
Sbjct  229   RHEAFTHREGQKEFVQIDHNELFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWG  288

Query  948   LGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISEN  1127
             LGRLLTKCKSFD+LLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISEN
Sbjct  289   LGRLLTKCKSFDELLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISEN  348

Query  1128  KELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAV  1307
             KEL DYRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV
Sbjct  349   KELGDYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAV  408

Query  1308  NFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
              FWSKGEA+AMFLRHEGFLGALGAFMS+EKHGLD
Sbjct  409   KFWSKGEAQAMFLRHEGFLGALGAFMSHEKHGLD  442



>ref|XP_010940070.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Elaeis guineensis]
Length=908

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/394 (87%), Positives = 372/394 (94%), Gaps = 1/394 (0%)
 Frame = +3

Query  231   SPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  410
             +P+HRS+SR QLDLSGAAIQGNFEE++PTILLPNQSDDISHLALDIGGSLIKLVYFSRHE
Sbjct  36    APIHRSSSRLQLDLSGAAIQGNFEERNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  95

Query  411   GrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGL  590
              +  +DKRKR +K+RFG+SNG+RRSYPILGGRLHFVKFET K+NECLDFIS+KQLH GGL
Sbjct  96    EQSPDDKRKRSIKKRFGISNGSRRSYPILGGRLHFVKFETGKLNECLDFISAKQLHRGGL  155

Query  591   DTPRW-SSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAI  767
             D+P W S   P++   IIKATGGGAYKFAD+FKERLGVS++KEDEM+CLVAGANFLLKAI
Sbjct  156   DSPSWHSGTRPEDNTIIIKATGGGAYKFADVFKERLGVSLDKEDEMDCLVAGANFLLKAI  215

Query  768   RHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWG  947
             RHEAFTH+EG KEFVQID NDLFPYLLVN+GSGVS+IKVDGDGKFQRVSGTNVGGGTYWG
Sbjct  216   RHEAFTHMEGQKEFVQIDHNDLFPYLLVNVGSGVSIIKVDGDGKFQRVSGTNVGGGTYWG  275

Query  948   LGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISEN  1127
             LGRLLTKC SFD+LLELSQ+GDN  +DMLVGDIYGGMDYSKIGLSASTIASSFGK ISE+
Sbjct  276   LGRLLTKCNSFDELLELSQQGDNSNVDMLVGDIYGGMDYSKIGLSASTIASSFGKTISES  335

Query  1128  KELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAV  1307
             KEL DYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAV
Sbjct  336   KELSDYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAV  395

Query  1308  NFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             +FWSKG+A+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  396   HFWSKGQAQAMFLRHEGFLGALGAFMSYEKHGLD  429



>ref|XP_010940068.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Elaeis guineensis]
 ref|XP_010940069.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Elaeis guineensis]
Length=922

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/394 (87%), Positives = 372/394 (94%), Gaps = 1/394 (0%)
 Frame = +3

Query  231   SPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  410
             +P+HRS+SR QLDLSGAAIQGNFEE++PTILLPNQSDDISHLALDIGGSLIKLVYFSRHE
Sbjct  36    APIHRSSSRLQLDLSGAAIQGNFEERNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  95

Query  411   GrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGL  590
              +  +DKRKR +K+RFG+SNG+RRSYPILGGRLHFVKFET K+NECLDFIS+KQLH GGL
Sbjct  96    EQSPDDKRKRSIKKRFGISNGSRRSYPILGGRLHFVKFETGKLNECLDFISAKQLHRGGL  155

Query  591   DTPRWSS-EAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAI  767
             D+P W S   P++   IIKATGGGAYKFAD+FKERLGVS++KEDEM+CLVAGANFLLKAI
Sbjct  156   DSPSWHSGTRPEDNTIIIKATGGGAYKFADVFKERLGVSLDKEDEMDCLVAGANFLLKAI  215

Query  768   RHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWG  947
             RHEAFTH+EG KEFVQID NDLFPYLLVN+GSGVS+IKVDGDGKFQRVSGTNVGGGTYWG
Sbjct  216   RHEAFTHMEGQKEFVQIDHNDLFPYLLVNVGSGVSIIKVDGDGKFQRVSGTNVGGGTYWG  275

Query  948   LGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISEN  1127
             LGRLLTKC SFD+LLELSQ+GDN  +DMLVGDIYGGMDYSKIGLSASTIASSFGK ISE+
Sbjct  276   LGRLLTKCNSFDELLELSQQGDNSNVDMLVGDIYGGMDYSKIGLSASTIASSFGKTISES  335

Query  1128  KELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAV  1307
             KEL DYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAV
Sbjct  336   KELSDYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAV  395

Query  1308  NFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             +FWSKG+A+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  396   HFWSKGQAQAMFLRHEGFLGALGAFMSYEKHGLD  429



>ref|XP_002318651.1| hypothetical protein POPTR_0012s08310g [Populus trichocarpa]
 gb|EEE96871.1| hypothetical protein POPTR_0012s08310g [Populus trichocarpa]
Length=939

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/413 (85%), Positives = 380/413 (92%), Gaps = 7/413 (2%)
 Frame = +3

Query  192   VLERG-GVEKEKEISP-----MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISH  353
             V+E G G + E+++ P     +HRS SRPQLDLS AAI+GNFEE+DPTILLPNQSDDISH
Sbjct  54    VIEEGSGGQGERDMVPPTSTSIHRSGSRPQLDLSKAAIEGNFEERDPTILLPNQSDDISH  113

Query  354   LALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETT  533
             LALDIGGSLIKLVYFSRH+ R   DKRK+ VKER G+SNGNRRSYPILGGRLHFVKFET+
Sbjct  114   LALDIGGSLIKLVYFSRHQDRPTNDKRKKTVKERLGISNGNRRSYPILGGRLHFVKFETS  173

Query  534   KVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIK-ATGGGAYKFADLFKERLGVSIE  710
             K+NECLDFISSKQLH GG+D+  W S+   N N +IK ATGGGAYK+ADL KERLGVS++
Sbjct  174   KINECLDFISSKQLHRGGVDSHSWHSDTSSNGNAVIKKATGGGAYKYADLLKERLGVSLD  233

Query  711   KEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDG  890
             KEDEM+CLVAGANFLLKAIRHEAFTH+EG KEFVQIDQND+FPYLLVNIGSGVSMIKVDG
Sbjct  234   KEDEMDCLVAGANFLLKAIRHEAFTHMEGQKEFVQIDQNDMFPYLLVNIGSGVSMIKVDG  293

Query  891   DGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSK  1070
             DGKF+RVSGTNVGGGTYWGLGRLLTKCKSFD+LLELSQ+GDN TIDMLVGDIYGGMDY+K
Sbjct  294   DGKFERVSGTNVGGGTYWGLGRLLTKCKSFDELLELSQKGDNGTIDMLVGDIYGGMDYNK  353

Query  1071  IGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriff  1250
             IGLSASTIASSFGKAISE KEL +YRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFF
Sbjct  354   IGLSASTIASSFGKAISEKKELTNYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFF  413

Query  1251  ggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             GGFFIRGHAYTMDTISFAV+FWSKGEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  414   GGFFIRGHAYTMDTISFAVHFWSKGEAQAMFLRHEGFLGALGAFMSYEKHGLD  466



>ref|XP_008393029.1| PREDICTED: pantothenate kinase 2 [Malus domestica]
Length=907

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/437 (79%), Positives = 384/437 (88%), Gaps = 7/437 (2%)
 Frame = +3

Query  120   MAGVTTGDLPDLGIDDKNEKDN-----IAVLERGGV--EKEKEISPMHRSTSRPQLDLSG  278
             MAG  T D+     ++ ++  N     + +   GG   +   E   +H S SRPQLDLS 
Sbjct  1     MAGFGTKDIKGREKEEGDKNSNTLESHVVIRTEGGEVGQSSSERDTIHXSGSRPQLDLSK  60

Query  279   AAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerF  458
             AAIQGNFEE+DP ILLPNQSDD+SHLALDIGGSLIKLVYFSRHEG+ ++DKRK+ +KER 
Sbjct  61    AAIQGNFEERDPXILLPNQSDDLSHLALDIGGSLIKLVYFSRHEGQSIDDKRKKTLKERL  120

Query  459   GVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTI  638
             G+SNG+RRSYPILGGRLHFVKFET K+NECLDFI SKQLH GG D   W+ + P NE+++
Sbjct  121   GISNGSRRSYPILGGRLHFVKFETNKINECLDFIYSKQLHRGGTDARIWNPDXPTNESSV  180

Query  639   IKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQI  818
             IKATGGGAYKFADLFKERLGVS++KEDEMNCLV+GANFLLKAIRHEAFTH+EG KEFVQI
Sbjct  181   IKATGGGAYKFADLFKERLGVSLDKEDEMNCLVSGANFLLKAIRHEAFTHMEGQKEFVQI  240

Query  819   DQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLEL  998
             DQN+LFPYLLVNIGSGVS+IKVDGDGKFQRVSGTNVGGGTYWGLG+LLTKCKSFD+LLEL
Sbjct  241   DQNELFPYLLVNIGSGVSIIKVDGDGKFQRVSGTNVGGGTYWGLGKLLTKCKSFDELLEL  300

Query  999   SQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLR  1178
             SQRGDN  IDMLVGDIYGGMDYSKIGLSAS IASSFGKAISENKELEDY PEDISLSLLR
Sbjct  301   SQRGDNGAIDMLVGDIYGGMDYSKIGLSASXIASSFGKAISENKELEDYSPEDISLSLLR  360

Query  1179  MISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEG  1358
             MISYNIGQI+YLNALR+GLKRI+FGGFFIRGHAYTMDTISFAV FWS G+A+AMFLRHEG
Sbjct  361   MISYNIGQIAYLNALRFGLKRIYFGGFFIRGHAYTMDTISFAVQFWSNGDAQAMFLRHEG  420

Query  1359  FLGALGAFMSYEKHGLD  1409
             FLGALGAFMSYEKHGLD
Sbjct  421   FLGALGAFMSYEKHGLD  437



>gb|KJB39190.1| hypothetical protein B456_007G001600 [Gossypium raimondii]
 gb|KJB39192.1| hypothetical protein B456_007G001600 [Gossypium raimondii]
Length=924

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/391 (88%), Positives = 370/391 (95%), Gaps = 3/391 (1%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             +HRS SRPQLDLS AAIQGN EE+DPTILLPNQSDDISH ALDIGGSLIKLVYFSRHEG+
Sbjct  67    LHRSGSRPQLDLSKAAIQGNSEERDPTILLPNQSDDISHFALDIGGSLIKLVYFSRHEGQ  126

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
              ++DKRK+ VKE   +SNG+RRSYPILGGRLHFVKFET+K+NECLDFISSKQLH G +D+
Sbjct  127   SIDDKRKKTVKE---ISNGSRRSYPILGGRLHFVKFETSKLNECLDFISSKQLHNGRIDS  183

Query  597   PRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHE  776
               W+SEA   EN +IKATGGGAYKFADLFKERLGVSI+KEDEM+CLVAGANFLLKAIRHE
Sbjct  184   HYWNSEATNKENAVIKATGGGAYKFADLFKERLGVSIDKEDEMDCLVAGANFLLKAIRHE  243

Query  777   AFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             AFTH+EGHKEFVQID NDLFPYLLVN+GSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR
Sbjct  244   AFTHMEGHKEFVQIDHNDLFPYLLVNVGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  303

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL  1136
             LLTKC SFD+LLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAIS+ KEL
Sbjct  304   LLTKCNSFDELLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISDKKEL  363

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
             ED+RPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV+FW
Sbjct  364   EDHRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVHFW  423

Query  1317  SKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             S+G+A+AMFLRHEGFLGALGAFMSYEK GLD
Sbjct  424   SQGQAQAMFLRHEGFLGALGAFMSYEKLGLD  454



>tpg|DAA62461.1| TPA: hypothetical protein ZEAMMB73_754388 [Zea mays]
Length=477

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/389 (85%), Positives = 361/389 (93%), Gaps = 1/389 (0%)
 Frame = +3

Query  243   RSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqv  422
             RS+SRPQLDLSGAAI G  E+++PTILLPNQSDDISHLALDIGGSLIKLVYFSRH     
Sbjct  48    RSSSRPQLDLSGAAIHGTLEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHAELST  107

Query  423   edkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPR  602
             EDK K   K R G+ NG RRSYPILGGRLHFVKFET K+NECLDFISSKQLH GG+D+P 
Sbjct  108   EDKHKISTKRRLGMFNGGRRSYPILGGRLHFVKFETGKLNECLDFISSKQLHRGGIDSPS  167

Query  603   WSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAF  782
             W S A Q+++ +IKATGGGA+K+AD+FKERLGVS+EKEDEM+CLVAGANFLLKAIRHEAF
Sbjct  168   WRSGA-QSDDIVIKATGGGAFKYADVFKERLGVSLEKEDEMDCLVAGANFLLKAIRHEAF  226

Query  783   THIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLL  962
             TH++G K++VQIDQNDLFP+LLVN+GSGVS+IKVDG GKFQRVSGTNVGGGTYWGLGRL+
Sbjct  227   THMDGQKQYVQIDQNDLFPFLLVNVGSGVSIIKVDGHGKFQRVSGTNVGGGTYWGLGRLM  286

Query  963   TKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELED  1142
             TKCKSFD+LLELSQRGDN T+DMLVGDIYGG+DYSKIGLSASTIASSFGK ISENKEL D
Sbjct  287   TKCKSFDELLELSQRGDNSTMDMLVGDIYGGLDYSKIGLSASTIASSFGKIISENKELSD  346

Query  1143  YRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSK  1322
             YRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAV+FWSK
Sbjct  347   YRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAVHFWSK  406

Query  1323  GEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             GEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  407   GEAQAMFLRHEGFLGALGAFMSYEKHGLD  435



>gb|KHN19302.1| Pantothenate kinase 2 [Glycine soja]
Length=498

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/391 (86%), Positives = 365/391 (93%), Gaps = 2/391 (1%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             +HRS SRPQLD+S A IQGN EEK PTILLPNQSDD+SHLALDIGGSLIKLVYFSRHE +
Sbjct  53    IHRSGSRPQLDVSKAEIQGNVEEKYPTILLPNQSDDLSHLALDIGGSLIKLVYFSRHEDQ  112

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
               +DKRKR +KE  G+SNGNRRS+PILGGRLHFVKFET K+NECLDFI SKQLHCGGL++
Sbjct  113   SWDDKRKRSMKEPLGLSNGNRRSFPILGGRLHFVKFETRKINECLDFIHSKQLHCGGLES  172

Query  597   PRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHE  776
                 S+   ++N IIKATGGGAYK+ADLFKERLGVS++KEDEM+CLVAGANFLLKAIRHE
Sbjct  173   HY--SDGVTDQNGIIKATGGGAYKYADLFKERLGVSLDKEDEMDCLVAGANFLLKAIRHE  230

Query  777   AFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             AFTH+EGHKEFVQI+ NDLFPYLLVNIGSGVSMIKVDGDGKF+RVSGTNVGGGTYWGLGR
Sbjct  231   AFTHMEGHKEFVQIEPNDLFPYLLVNIGSGVSMIKVDGDGKFERVSGTNVGGGTYWGLGR  290

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL  1136
             LLTKCKSFD+LLELSQ+GDNRT+DMLVGDIYGG+DYSKIGLSASTIASSFGK ISE KEL
Sbjct  291   LLTKCKSFDELLELSQKGDNRTMDMLVGDIYGGLDYSKIGLSASTIASSFGKTISEKKEL  350

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
             E+YRPEDISLSLLRMISYNIGQI+YLNALR+ LKRIFFGGFFIRGHAYTMDTISFAV+FW
Sbjct  351   EEYRPEDISLSLLRMISYNIGQIAYLNALRFRLKRIFFGGFFIRGHAYTMDTISFAVHFW  410

Query  1317  SKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             S GEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  411   SNGEAQAMFLRHEGFLGALGAFMSYEKHGLD  441



>ref|XP_007138072.1| hypothetical protein PHAVU_009G178200g [Phaseolus vulgaris]
 ref|XP_007138073.1| hypothetical protein PHAVU_009G178200g [Phaseolus vulgaris]
 gb|ESW10066.1| hypothetical protein PHAVU_009G178200g [Phaseolus vulgaris]
 gb|ESW10067.1| hypothetical protein PHAVU_009G178200g [Phaseolus vulgaris]
Length=915

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/420 (83%), Positives = 380/420 (90%), Gaps = 7/420 (2%)
 Frame = +3

Query  165   DKNEKDNIAVLERGGVEKEKEISP-----MHRSTSRPQLDLSGAAIQGNFEEKDPTILLP  329
             D     NIA  +    E E+E++P     MHRS SRPQLD+S A IQGN EEK PTILLP
Sbjct  27    DSENNSNIARTQLESGEGEREMAPTPANSMHRSGSRPQLDVSKAEIQGNEEEKYPTILLP  86

Query  330   NQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRL  509
             NQSDD+SHLALDIGGSLIKLVYFSRHE + V+DKRKR VKER G SNGNRRSYPILGGRL
Sbjct  87    NQSDDLSHLALDIGGSLIKLVYFSRHEDQSVDDKRKRSVKERLGFSNGNRRSYPILGGRL  146

Query  510   HFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKE  689
             HFVKFET K+NECLDFI SKQLHCGGL+ PR+S +   ++N IIKATGGGAYK+ADLFKE
Sbjct  147   HFVKFETRKINECLDFIHSKQLHCGGLE-PRYS-DGLTDQNGIIKATGGGAYKYADLFKE  204

Query  690   RLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGV  869
             RLGVS++KEDEM+CLVAGANFLLKAIRHEAFTH+EGHKEFVQI+ NDLFPYLLVNIGSGV
Sbjct  205   RLGVSLDKEDEMDCLVAGANFLLKAIRHEAFTHMEGHKEFVQIEPNDLFPYLLVNIGSGV  264

Query  870   SMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIY  1049
             SMIKVDGDGKF+RVSGTNVGGGTYWGLGRLLTKCKSFD+LLELSQ+GDNR++DMLVGDIY
Sbjct  265   SMIKVDGDGKFERVSGTNVGGGTYWGLGRLLTKCKSFDELLELSQKGDNRSMDMLVGDIY  324

Query  1050  GGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRY  1229
             GG+DYSKIGLSASTIASSFGK ISE KELE+YRPEDISLSLLRMISYNIGQI+YLNALR+
Sbjct  325   GGLDYSKIGLSASTIASSFGKTISEKKELEEYRPEDISLSLLRMISYNIGQIAYLNALRF  384

Query  1230  GLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
              LKRIFFGGFFIRGHAYTMDTISFAV+FWS GEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  385   RLKRIFFGGFFIRGHAYTMDTISFAVHFWSNGEAQAMFLRHEGFLGALGAFMSYEKHGLD  444



>ref|XP_004957459.1| PREDICTED: pantothenate kinase 2-like [Setaria italica]
Length=897

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/391 (86%), Positives = 363/391 (93%), Gaps = 1/391 (0%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             + RS+SRPQLDLSGAAI G  E+++PTILLPNQSDDISHLALDIGGSLIKLVYFSRH   
Sbjct  40    LPRSSSRPQLDLSGAAIHGTLEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHAEL  99

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
               EDKRK   K R G+ NG RRSYPILGGRLHFVKFET K+NECLDFISSKQLH GG+D+
Sbjct  100   STEDKRKISTKRRLGMFNGGRRSYPILGGRLHFVKFETEKLNECLDFISSKQLHRGGVDS  159

Query  597   PRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHE  776
             P W S A Q ++ +IKATGGGAYK+ADLFKERLGVS+EKEDEM+CLVAGANFLLKAIRHE
Sbjct  160   PSWRSGA-QPDDIVIKATGGGAYKYADLFKERLGVSLEKEDEMDCLVAGANFLLKAIRHE  218

Query  777   AFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             AFTH++GHKE+VQIDQNDLFP+LLVN+GSGVS+IKVDG GKFQRVSGTNVGGGTYWGLGR
Sbjct  219   AFTHMDGHKEYVQIDQNDLFPFLLVNVGSGVSIIKVDGHGKFQRVSGTNVGGGTYWGLGR  278

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL  1136
             L+TKCKSFD+LLELSQRGDN TIDMLVGDIYGG+DYSKIGLSASTIASSFGK ISENKEL
Sbjct  279   LMTKCKSFDELLELSQRGDNSTIDMLVGDIYGGLDYSKIGLSASTIASSFGKTISENKEL  338

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
              DYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAVNFW
Sbjct  339   SDYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAVNFW  398

Query  1317  SKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             SKGEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  399   SKGEAQAMFLRHEGFLGALGAFMSYEKHGLD  429



>gb|KHN48232.1| Pantothenate kinase 2 [Glycine soja]
Length=868

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/391 (87%), Positives = 366/391 (94%), Gaps = 2/391 (1%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             +HRS SRPQLD+S A IQGN EEK PTILLPNQSDD+SHLALDIGGSLIKLVYFSRHE +
Sbjct  9     IHRSGSRPQLDVSKAEIQGNVEEKYPTILLPNQSDDLSHLALDIGGSLIKLVYFSRHEDQ  68

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
               +DKRKR VKER G+SNGNRRS+PILGGRLHFVKFET K+NECLDFI SKQLHCGGL++
Sbjct  69    SADDKRKRSVKERLGLSNGNRRSFPILGGRLHFVKFETRKINECLDFIYSKQLHCGGLES  128

Query  597   PRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHE  776
                 S+   ++N IIKATGGGAYK+ADLFKERLGVS++KEDEMNCLVAGANFLLKAIRHE
Sbjct  129   --HYSDGVTDQNGIIKATGGGAYKYADLFKERLGVSLDKEDEMNCLVAGANFLLKAIRHE  186

Query  777   AFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             AFTH+EGHKEFVQID NDLFPYLLVNIGSGVSMIKVDGDGKF+RVSGTNVGGGTYWGLGR
Sbjct  187   AFTHMEGHKEFVQIDPNDLFPYLLVNIGSGVSMIKVDGDGKFERVSGTNVGGGTYWGLGR  246

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL  1136
             LLTKCKSFD+LLELSQ+GDNRT+DMLVGDIYGG+DYSKIGLSASTIASSFGK ISE KEL
Sbjct  247   LLTKCKSFDELLELSQKGDNRTMDMLVGDIYGGLDYSKIGLSASTIASSFGKTISEKKEL  306

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
             E+YRPEDISLSLLRMISYNIGQI+YLNALR+ LKRIFFGGFFIRGHAYTMDTISFAV+FW
Sbjct  307   EEYRPEDISLSLLRMISYNIGQIAYLNALRFRLKRIFFGGFFIRGHAYTMDTISFAVHFW  366

Query  1317  SKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             S GEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  367   SNGEAQAMFLRHEGFLGALGAFMSYEKHGLD  397



>ref|XP_009403915.1| PREDICTED: pantothenate kinase 2 [Musa acuminata subsp. malaccensis]
 ref|XP_009403916.1| PREDICTED: pantothenate kinase 2 [Musa acuminata subsp. malaccensis]
Length=899

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/391 (84%), Positives = 365/391 (93%), Gaps = 1/391 (0%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             MHRS+SRPQLD+S AAIQ + E+++PTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  
Sbjct  35    MHRSSSRPQLDVSRAAIQEDSEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE-E  93

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
             Q  D ++R +K+RFG+SNGNRRSYPILGGRLHFVKFET K+NECLDFISSKQLH GG+D+
Sbjct  94    QSPDDKRRSMKKRFGLSNGNRRSYPILGGRLHFVKFETGKLNECLDFISSKQLHRGGIDS  153

Query  597   PRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHE  776
             P W S    ++N +IKATGGGAYKFAD+ KERLGVS++KEDEM+CLVAGANFLLKAIRHE
Sbjct  154   PSWRSGTQTDDNIVIKATGGGAYKFADVLKERLGVSLDKEDEMSCLVAGANFLLKAIRHE  213

Query  777   AFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             AFTH+EG KEFVQID ND+FPYLLVN+GSGVS+IKVDGDGK+QRVSGTNVGGGT+WGLGR
Sbjct  214   AFTHMEGQKEFVQIDHNDMFPYLLVNVGSGVSIIKVDGDGKYQRVSGTNVGGGTFWGLGR  273

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL  1136
             LLTKCK+FD+LLELSQ+GDN  +DMLVGDIYGG+DYSKIGLSASTIASSFGK ISE KEL
Sbjct  274   LLTKCKNFDELLELSQQGDNSNVDMLVGDIYGGLDYSKIGLSASTIASSFGKTISETKEL  333

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
              DYRPEDISLSLLRMISYNIGQISYLNALRYGLK+IFFGGFFIRGHAYTMDTISFAV+FW
Sbjct  334   SDYRPEDISLSLLRMISYNIGQISYLNALRYGLKKIFFGGFFIRGHAYTMDTISFAVHFW  393

Query  1317  SKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             SKG+A+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  394   SKGQAQAMFLRHEGFLGALGAFMSYEKHGLD  424



>ref|XP_004501924.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Cicer arietinum]
 ref|XP_004501925.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Cicer arietinum]
 ref|XP_004501926.1| PREDICTED: pantothenate kinase 2-like isoform X3 [Cicer arietinum]
 ref|XP_004501927.1| PREDICTED: pantothenate kinase 2-like isoform X4 [Cicer arietinum]
Length=910

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/402 (84%), Positives = 371/402 (92%), Gaps = 7/402 (2%)
 Frame = +3

Query  219   EKEISP-----MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLI  383
             EK++ P     +HRS+SRPQLD+S A IQ N E+K PTILLPNQSDD+SHLALDIGGSLI
Sbjct  41    EKDMPPASGNSIHRSSSRPQLDVSKAEIQSNVEDKYPTILLPNQSDDLSHLALDIGGSLI  100

Query  384   KLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFIS  563
             KLVYFSRHEG   +DKRK+ +KER G+SNGNRRS+PILGGRLHFVKFET K+NECLDFI 
Sbjct  101   KLVYFSRHEGHSDDDKRKKSLKERLGLSNGNRRSFPILGGRLHFVKFETGKINECLDFIH  160

Query  564   SKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAG  743
             SKQLHCGGL++ R+S +A  ++N IIKATGGGAYK+ DLFKERLGVS++KEDEM+CLVAG
Sbjct  161   SKQLHCGGLES-RYS-DAAADQNAIIKATGGGAYKYTDLFKERLGVSLDKEDEMDCLVAG  218

Query  744   ANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTN  923
             ANFLLKAIRHEAFTH+EG KEFVQID ND+FPYLLVN+GSGVSMIKVDGDGKF+RVSGTN
Sbjct  219   ANFLLKAIRHEAFTHMEGQKEFVQIDHNDMFPYLLVNVGSGVSMIKVDGDGKFERVSGTN  278

Query  924   VGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASS  1103
             VGGGTYWGLGRLLTKCKSFD+LLELSQ+GDNRTIDMLVGDIYGG+DYSKIGLSASTIASS
Sbjct  279   VGGGTYWGLGRLLTKCKSFDELLELSQKGDNRTIDMLVGDIYGGLDYSKIGLSASTIASS  338

Query  1104  FGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYT  1283
             FGK ISE KELE+YRPEDISLSLLRMISYNIGQI+YLNALR+ LKRIFFGGFFIRGHAYT
Sbjct  339   FGKTISETKELENYRPEDISLSLLRMISYNIGQIAYLNALRFRLKRIFFGGFFIRGHAYT  398

Query  1284  MDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             MDTISFAV FWS G+A+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  399   MDTISFAVQFWSNGDAQAMFLRHEGFLGALGAFMSYEKHGLD  440



>ref|XP_003542534.2| PREDICTED: pantothenate kinase 2-like isoform X1 [Glycine max]
Length=910

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/391 (86%), Positives = 365/391 (93%), Gaps = 2/391 (1%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             +HRS SRPQLD+S A IQGN EEK PTILLPNQSDD+SHLALDIGGSLIKLVYFSRHE +
Sbjct  57    IHRSGSRPQLDVSKAEIQGNVEEKYPTILLPNQSDDLSHLALDIGGSLIKLVYFSRHEDQ  116

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
               +DKRKR VKER G+SNGNRRS+PILGGRLHFVKFET K+NECLDFI SKQLHCGGL++
Sbjct  117   SADDKRKRSVKERLGLSNGNRRSFPILGGRLHFVKFETRKINECLDFIYSKQLHCGGLES  176

Query  597   PRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHE  776
                 S+   ++N IIKATGGGAYK+ADL KERLGVS++KEDEMNCLVAGANFLLKAIRHE
Sbjct  177   --HYSDGVTDQNGIIKATGGGAYKYADLLKERLGVSLDKEDEMNCLVAGANFLLKAIRHE  234

Query  777   AFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             AFTH+EGHKEFVQID NDLFPYLLVNIGSGVSMIKVDGDGKF+RVSGTNVGGGTYWGLGR
Sbjct  235   AFTHMEGHKEFVQIDPNDLFPYLLVNIGSGVSMIKVDGDGKFERVSGTNVGGGTYWGLGR  294

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL  1136
             LLTKCKSFD+LLELSQ+GDNRT+DMLVGDIYGG+DYSKIGLSASTIASSFGK ISE KEL
Sbjct  295   LLTKCKSFDELLELSQKGDNRTMDMLVGDIYGGLDYSKIGLSASTIASSFGKTISEKKEL  354

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
             E+YRPEDISLSLLRMISYNIGQI+YLNALR+ LKRIFFGGFFIRGHAYTMDTISFAV+FW
Sbjct  355   EEYRPEDISLSLLRMISYNIGQIAYLNALRFRLKRIFFGGFFIRGHAYTMDTISFAVHFW  414

Query  1317  SKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             S GEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  415   SNGEAQAMFLRHEGFLGALGAFMSYEKHGLD  445



>ref|XP_006594169.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Glycine max]
Length=920

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/391 (86%), Positives = 365/391 (93%), Gaps = 2/391 (1%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             +HRS SRPQLD+S A IQGN EEK PTILLPNQSDD+SHLALDIGGSLIKLVYFSRHE +
Sbjct  57    IHRSGSRPQLDVSKAEIQGNVEEKYPTILLPNQSDDLSHLALDIGGSLIKLVYFSRHEDQ  116

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
               +DKRKR VKER G+SNGNRRS+PILGGRLHFVKFET K+NECLDFI SKQLHCGGL++
Sbjct  117   SADDKRKRSVKERLGLSNGNRRSFPILGGRLHFVKFETRKINECLDFIYSKQLHCGGLES  176

Query  597   PRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHE  776
                 S+   ++N IIKATGGGAYK+ADL KERLGVS++KEDEMNCLVAGANFLLKAIRHE
Sbjct  177   --HYSDGVTDQNGIIKATGGGAYKYADLLKERLGVSLDKEDEMNCLVAGANFLLKAIRHE  234

Query  777   AFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             AFTH+EGHKEFVQID NDLFPYLLVNIGSGVSMIKVDGDGKF+RVSGTNVGGGTYWGLGR
Sbjct  235   AFTHMEGHKEFVQIDPNDLFPYLLVNIGSGVSMIKVDGDGKFERVSGTNVGGGTYWGLGR  294

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL  1136
             LLTKCKSFD+LLELSQ+GDNRT+DMLVGDIYGG+DYSKIGLSASTIASSFGK ISE KEL
Sbjct  295   LLTKCKSFDELLELSQKGDNRTMDMLVGDIYGGLDYSKIGLSASTIASSFGKTISEKKEL  354

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
             E+YRPEDISLSLLRMISYNIGQI+YLNALR+ LKRIFFGGFFIRGHAYTMDTISFAV+FW
Sbjct  355   EEYRPEDISLSLLRMISYNIGQIAYLNALRFRLKRIFFGGFFIRGHAYTMDTISFAVHFW  414

Query  1317  SKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             S GEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  415   SNGEAQAMFLRHEGFLGALGAFMSYEKHGLD  445



>ref|XP_008782481.1| PREDICTED: pantothenate kinase 2-like [Phoenix dactylifera]
 ref|XP_008782482.1| PREDICTED: pantothenate kinase 2-like [Phoenix dactylifera]
 ref|XP_008782483.1| PREDICTED: pantothenate kinase 2-like [Phoenix dactylifera]
Length=904

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/405 (83%), Positives = 368/405 (91%), Gaps = 6/405 (1%)
 Frame = +3

Query  213   EKEKEIS-----PMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGS  377
             E+ KEIS     PMH+S+  PQLDL+ AAI+GN+EE++PTILLPNQSDDISHLA+DIGGS
Sbjct  26    EEMKEISLASLNPMHQSSLWPQLDLTRAAIKGNWEERNPTILLPNQSDDISHLAVDIGGS  85

Query  378   LIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDF  557
             LIKLVYFSRHE    +DKRK  +K+RFG+SNG+RRSYPILGGRLHFV FET K++ECLDF
Sbjct  86    LIKLVYFSRHEEHSPDDKRKISIKKRFGISNGSRRSYPILGGRLHFVNFETGKLDECLDF  145

Query  558   ISSKQLHCGGLDTPRW-SSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCL  734
             ISSKQLH GGLD+P W S   P +   IIKATGGGAYKFAD+FKERLGVS++KEDEM CL
Sbjct  146   ISSKQLHLGGLDSPSWHSGTRPHDNPIIIKATGGGAYKFADVFKERLGVSLDKEDEMACL  205

Query  735   VAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVS  914
             VAGANFLLKAIRHEAFTH+EG KEFVQID NDLFPYLLVNIGSGVSMIKV+GDGKFQRVS
Sbjct  206   VAGANFLLKAIRHEAFTHMEGEKEFVQIDHNDLFPYLLVNIGSGVSMIKVEGDGKFQRVS  265

Query  915   GTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTI  1094
             GTNVGGGTYWGLGRLLTKCKSF +LLELSQ+GDN  +DMLVGDIYGGMDYSKIGLSASTI
Sbjct  266   GTNVGGGTYWGLGRLLTKCKSFVELLELSQQGDNSNVDMLVGDIYGGMDYSKIGLSASTI  325

Query  1095  ASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgH  1274
             ASSFG+ I+E KEL DYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFI GH
Sbjct  326   ASSFGRTIAETKELLDYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFICGH  385

Query  1275  AYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             AYTMDTISFAV+FWSKG+A+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  386   AYTMDTISFAVHFWSKGQAQAMFLRHEGFLGALGAFMSYEKHGLD  430



>ref|XP_003576771.1| PREDICTED: pantothenate kinase 2 [Brachypodium distachyon]
Length=912

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/403 (83%), Positives = 364/403 (90%), Gaps = 1/403 (0%)
 Frame = +3

Query  201   RGGVEKEKEISPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSL  380
             +G        + +HRS SRPQLDLSGAAI G  E+++PTILLPNQSDDISHLALDIGGSL
Sbjct  30    KGKAPASASTTMLHRSGSRPQLDLSGAAIHGTLEDRNPTILLPNQSDDISHLALDIGGSL  89

Query  381   IKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFI  560
             IKLVYFSRH  +  EDKRK   K R  +  G RRSYP+LGGRLHFVKFET K+NECLDFI
Sbjct  90    IKLVYFSRHADQPTEDKRKISTKRRLEIFTGARRSYPVLGGRLHFVKFETGKLNECLDFI  149

Query  561   SSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVA  740
             SSKQLH GG+D+P W S A Q +N +IKATGGGAYK+ADLFKERLGVS+EKEDEM+CLV+
Sbjct  150   SSKQLHRGGVDSPSWRSGA-QPDNIVIKATGGGAYKYADLFKERLGVSLEKEDEMDCLVS  208

Query  741   GANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGT  920
             GANFLLKAIRHEAFTH++G KE+VQIDQNDLFPYLLVN+GSGVS+IKVDG GKFQRVSGT
Sbjct  209   GANFLLKAIRHEAFTHMDGQKEYVQIDQNDLFPYLLVNVGSGVSIIKVDGHGKFQRVSGT  268

Query  921   NVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIAS  1100
             NVGGGTYWGLGRL+T+CKSFD+LLELSQRGDN TIDMLVGDIYGG+DYSKIGLSASTIAS
Sbjct  269   NVGGGTYWGLGRLMTECKSFDELLELSQRGDNSTIDMLVGDIYGGLDYSKIGLSASTIAS  328

Query  1101  SFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAY  1280
             SFGK IS+NKEL DYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAY
Sbjct  329   SFGKTISDNKELSDYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAY  388

Query  1281  TMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             TMDTISFAV+FWSKGEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  389   TMDTISFAVHFWSKGEAKAMFLRHEGFLGALGAFMSYEKHGLD  431



>gb|EEC84941.1| hypothetical protein OsI_32156 [Oryza sativa Indica Group]
Length=903

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/391 (85%), Positives = 362/391 (93%), Gaps = 1/391 (0%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             + RS SRPQLDLSGAAI GN E+++PTILLPNQSDDISHLALDIGGSLIKLVYFSRH   
Sbjct  46    LPRSGSRPQLDLSGAAIHGNLEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHAEH  105

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
               EDKRK   K R G+ NG RRSYP+LGGRLHFVKFET K+NECLDFISSKQLH GG+D+
Sbjct  106   SSEDKRKLSTKRRLGMLNGGRRSYPVLGGRLHFVKFETGKLNECLDFISSKQLHRGGVDS  165

Query  597   PRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHE  776
             P W S A Q +N +IKATGGGA+K+ADLFKERLGVS+EKEDEM+CLVAGANFLLK+IRHE
Sbjct  166   PSWRSGA-QPDNIVIKATGGGAFKYADLFKERLGVSLEKEDEMDCLVAGANFLLKSIRHE  224

Query  777   AFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             AFTH++G KE+VQIDQNDLFP+LLVN+GSGVS+IKVDG GKFQRVSGTNVGGGTYWGLGR
Sbjct  225   AFTHMDGQKEYVQIDQNDLFPFLLVNVGSGVSIIKVDGHGKFQRVSGTNVGGGTYWGLGR  284

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL  1136
             L+TKCKSFD+LLELSQRGDN TIDMLVGDIYGG+DYSKIGLSASTIASSFGK IS++KEL
Sbjct  285   LMTKCKSFDELLELSQRGDNSTIDMLVGDIYGGLDYSKIGLSASTIASSFGKTISDDKEL  344

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
              DYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAVNFW
Sbjct  345   SDYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAVNFW  404

Query  1317  SKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             SKGEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  405   SKGEAKAMFLRHEGFLGALGAFMSYEKHGLD  435



>sp|Q0J035.2|PANK2_ORYSJ RecName: Full=Pantothenate kinase 2; AltName: Full=Pantothenic 
acid kinase 2 [Oryza sativa Japonica Group]
Length=904

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/391 (85%), Positives = 362/391 (93%), Gaps = 1/391 (0%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             + RS SRPQLDLSGAAI GN E+++PTILLPNQSDDISHLALDIGGSLIKLVYFSRH   
Sbjct  47    LPRSGSRPQLDLSGAAIHGNLEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHAEH  106

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
               EDKRK   K R G+ NG RRSYP+LGGRLHFVKFET K+NECLDFISSKQLH GG+D+
Sbjct  107   SSEDKRKLSTKRRLGMLNGGRRSYPVLGGRLHFVKFETGKLNECLDFISSKQLHRGGVDS  166

Query  597   PRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHE  776
             P W S A Q +N +IKATGGGA+K+ADLFKERLGVS+EKEDEM+CLVAGANFLLK+IRHE
Sbjct  167   PSWRSGA-QPDNIVIKATGGGAFKYADLFKERLGVSLEKEDEMDCLVAGANFLLKSIRHE  225

Query  777   AFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             AFTH++G KE+VQIDQNDLFP+LLVN+GSGVS+IKVDG GKFQRVSGTNVGGGTYWGLGR
Sbjct  226   AFTHMDGQKEYVQIDQNDLFPFLLVNVGSGVSIIKVDGHGKFQRVSGTNVGGGTYWGLGR  285

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL  1136
             L+TKCKSFD+LLELSQRGDN TIDMLVGDIYGG+DYSKIGLSASTIASSFGK IS++KEL
Sbjct  286   LMTKCKSFDELLELSQRGDNSTIDMLVGDIYGGLDYSKIGLSASTIASSFGKTISDDKEL  345

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
              DYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAVNFW
Sbjct  346   SDYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAVNFW  405

Query  1317  SKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             SKGEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  406   SKGEAKAMFLRHEGFLGALGAFMSYEKHGLD  436



>ref|XP_003528148.1| PREDICTED: pantothenate kinase 2-like [Glycine max]
Length=912

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/391 (86%), Positives = 365/391 (93%), Gaps = 2/391 (1%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             +HRS SRPQLD+S A IQGN EEK PTILLPNQSDD+SHLALDIGGSLIKLVYFSRHE +
Sbjct  53    IHRSGSRPQLDVSKAEIQGNVEEKYPTILLPNQSDDLSHLALDIGGSLIKLVYFSRHEDQ  112

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
               +DKRKR +KE  G+SNGNRRS+PILGGRLHFVKFET K+NECLDFI SKQLHCGGL++
Sbjct  113   SWDDKRKRSMKEPLGLSNGNRRSFPILGGRLHFVKFETRKINECLDFIHSKQLHCGGLES  172

Query  597   PRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHE  776
                 S+   ++N IIKATGGGAYK+ADLFKERLGVS++KEDEM+CLVAGANFLLKAIRHE
Sbjct  173   --HYSDGVTDQNGIIKATGGGAYKYADLFKERLGVSLDKEDEMDCLVAGANFLLKAIRHE  230

Query  777   AFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             AFTH+EGHKEFVQI+ NDLFPYLLVNIGSGVSMIKVDGDGKF+RVSGTNVGGGTYWGLGR
Sbjct  231   AFTHMEGHKEFVQIEPNDLFPYLLVNIGSGVSMIKVDGDGKFERVSGTNVGGGTYWGLGR  290

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL  1136
             LLTKCKSFD+LLELSQ+GDNRT+DMLVGDIYGG+DYSKIGLSASTIASSFGK ISE KEL
Sbjct  291   LLTKCKSFDELLELSQKGDNRTMDMLVGDIYGGLDYSKIGLSASTIASSFGKTISEKKEL  350

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
             E+YRPEDISLSLLRMISYNIGQI+YLNALR+ LKRIFFGGFFIRGHAYTMDTISFAV+FW
Sbjct  351   EEYRPEDISLSLLRMISYNIGQIAYLNALRFRLKRIFFGGFFIRGHAYTMDTISFAVHFW  410

Query  1317  SKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             S GEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  411   SNGEAQAMFLRHEGFLGALGAFMSYEKHGLD  441



>ref|XP_008652990.1| PREDICTED: pantothenate kinase 2 [Zea mays]
 ref|XP_008652991.1| PREDICTED: pantothenate kinase 2 [Zea mays]
 ref|XP_008652992.1| PREDICTED: pantothenate kinase 2 [Zea mays]
 ref|XP_008652993.1| PREDICTED: pantothenate kinase 2 [Zea mays]
Length=903

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/391 (85%), Positives = 362/391 (93%), Gaps = 1/391 (0%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             + RS+SRPQLDLSGAAI G  E+++PTILLPNQSDDISHLALDIGGSLIKLVYFSRH   
Sbjct  46    LPRSSSRPQLDLSGAAIHGTLEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHAEL  105

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
               EDK K   K R G+ NG RRSYPILGGRLHFVKFET K+NECLDFISSKQLH GG+D+
Sbjct  106   STEDKHKISTKRRLGMFNGGRRSYPILGGRLHFVKFETGKLNECLDFISSKQLHRGGIDS  165

Query  597   PRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHE  776
             P W S A Q+++ +IKATGGGA+K+AD+FKERLGVS+EKEDEM+CLVAGANFLLKAIRHE
Sbjct  166   PSWRSGA-QSDDIVIKATGGGAFKYADVFKERLGVSLEKEDEMDCLVAGANFLLKAIRHE  224

Query  777   AFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             AFTH++G K++VQIDQNDLFP+LLVN+GSGVS+IKVDG GKFQRVSGTNVGGGTYWGLGR
Sbjct  225   AFTHMDGQKQYVQIDQNDLFPFLLVNVGSGVSIIKVDGHGKFQRVSGTNVGGGTYWGLGR  284

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL  1136
             L+TKCKSFD+LLELSQRGDN T+DMLVGDIYGG+DYSKIGLSASTIASSFGK ISENKEL
Sbjct  285   LMTKCKSFDELLELSQRGDNSTMDMLVGDIYGGLDYSKIGLSASTIASSFGKIISENKEL  344

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
              DYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAV+FW
Sbjct  345   SDYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAVHFW  404

Query  1317  SKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             SKGEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  405   SKGEAQAMFLRHEGFLGALGAFMSYEKHGLD  435



>ref|XP_006660887.1| PREDICTED: pantothenate kinase 2-like [Oryza brachyantha]
Length=859

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/391 (85%), Positives = 361/391 (92%), Gaps = 1/391 (0%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             + RS SRPQLDLSGAAI G  E+++PTILLPNQSDDISHLALDIGGSLIKLVYFSRH   
Sbjct  2     LPRSGSRPQLDLSGAAIHGTSEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHAEH  61

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
               EDKRK   K R G+ NG RRSYP+LGGRLHFVKFET K++ECLDFISSKQLH GG+D+
Sbjct  62    SNEDKRKMSTKRRLGMLNGGRRSYPVLGGRLHFVKFETGKLSECLDFISSKQLHRGGVDS  121

Query  597   PRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHE  776
             P W S A Q +N +IKATGGGA+K+ADLFKERLGVS+EKEDEM+CLVAGANFLLK+IRHE
Sbjct  122   PSWRSGA-QPDNIVIKATGGGAFKYADLFKERLGVSLEKEDEMDCLVAGANFLLKSIRHE  180

Query  777   AFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             AFTH++G KE+VQIDQNDLFP+LLVN+GSGVS+IKVDG GKFQRVSGTNVGGGTYWGLGR
Sbjct  181   AFTHMDGQKEYVQIDQNDLFPFLLVNVGSGVSIIKVDGHGKFQRVSGTNVGGGTYWGLGR  240

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL  1136
             L+TKCKSFD+LLELSQRGDN TIDMLVGDIYGG+DYSKIGLSASTIASSFGK IS+NKEL
Sbjct  241   LMTKCKSFDELLELSQRGDNSTIDMLVGDIYGGLDYSKIGLSASTIASSFGKTISDNKEL  300

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
              DYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAVNFW
Sbjct  301   SDYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAVNFW  360

Query  1317  SKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             SKGEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  361   SKGEAQAMFLRHEGFLGALGAFMSYEKHGLD  391



>gb|EPS64631.1| hypothetical protein M569_10149, partial [Genlisea aurea]
Length=601

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/407 (81%), Positives = 364/407 (89%), Gaps = 8/407 (2%)
 Frame = +3

Query  210   VEKEKEISPM-----HRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGG  374
             + +EK+++P+      RS+SRPQLDLSGAAIQGNFEE++PTILLPNQSDDISHLALDIGG
Sbjct  34    IPEEKDMAPLSGNSIRRSSSRPQLDLSGAAIQGNFEERNPTILLPNQSDDISHLALDIGG  93

Query  375   SLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLD  554
             SLIKLVYFSRHE + V D R++ +KER  +SN +RRSYPILGGRLHFVKFET K+NECLD
Sbjct  94    SLIKLVYFSRHENQPVNDTRRKVIKERLSISNSSRRSYPILGGRLHFVKFETVKINECLD  153

Query  555   FISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCL  734
             FI SKQLH    D+  W SE    +  +IKATGGGAYKFADLFKERLG+SIEKEDEM+CL
Sbjct  154   FIYSKQLH-RRRDSQDWKSEGSNTQTIVIKATGGGAYKFADLFKERLGISIEKEDEMSCL  212

Query  735   VAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVS  914
             VAGANFLLKAIRHEAFTH EG KEFVQID NDLFPYLLVNIGSGVSMIKVDGDGKFQRVS
Sbjct  213   VAGANFLLKAIRHEAFTHKEGQKEFVQIDSNDLFPYLLVNIGSGVSMIKVDGDGKFQRVS  272

Query  915   GTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTI  1094
             GTNVGGGTYWGLG+LLT CKSFD+LLELSQ+GDN TIDMLVGDIYGGMDYSKIGLSASTI
Sbjct  273   GTNVGGGTYWGLGKLLTTCKSFDELLELSQKGDNSTIDMLVGDIYGGMDYSKIGLSASTI  332

Query  1095  ASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQ--ISYLNALRYGLKriffggffir  1268
             ASSFGKAI ++K+L DYRPEDISLSLLRMISYNIGQ    YLNALR+GL RIFFGGFFIR
Sbjct  333   ASSFGKAIYDDKDLRDYRPEDISLSLLRMISYNIGQARCPYLNALRFGLNRIFFGGFFIR  392

Query  1269  gHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             GH+YTMDTISFA+ FWS+G+A+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  393   GHSYTMDTISFAIQFWSQGQAQAMFLRHEGFLGALGAFMSYEKHGLD  439



>ref|XP_002460569.1| hypothetical protein SORBIDRAFT_02g030920 [Sorghum bicolor]
 gb|EER97090.1| hypothetical protein SORBIDRAFT_02g030920 [Sorghum bicolor]
Length=902

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/391 (84%), Positives = 361/391 (92%), Gaps = 1/391 (0%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             + RS+SRPQLDLSGAAI G  E+++PTILLPNQSDDISHLALDIGGSLIKLVYFSRH   
Sbjct  45    LPRSSSRPQLDLSGAAIHGTLEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHAEL  104

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
               EDKRK   K + G+ NG RRSYPILGGRLHFVKFET K+NECLDFISSKQLH GG+D+
Sbjct  105   STEDKRKISTKRKLGMFNGGRRSYPILGGRLHFVKFETGKLNECLDFISSKQLHRGGIDS  164

Query  597   PRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHE  776
             P W S A Q ++ +IKATGGGAYK+AD+FKERLGVS+EKEDEM+CLVAGANFLLKAIRHE
Sbjct  165   PSWRSGA-QPDDIVIKATGGGAYKYADVFKERLGVSLEKEDEMDCLVAGANFLLKAIRHE  223

Query  777   AFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             AFTH++G K +VQIDQNDLFP+LLVNIGSGVS+IKVDG G+FQRVSGTNVGGGTYWGLG+
Sbjct  224   AFTHMDGQKRYVQIDQNDLFPFLLVNIGSGVSIIKVDGHGEFQRVSGTNVGGGTYWGLGK  283

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL  1136
             L+TKCKSFD+LLELSQRGDN T+DML+GDIYGG+DYSKIGLSASTIASSFGK ISENKEL
Sbjct  284   LMTKCKSFDELLELSQRGDNSTMDMLIGDIYGGLDYSKIGLSASTIASSFGKIISENKEL  343

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
              DYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAV+FW
Sbjct  344   SDYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAVHFW  403

Query  1317  SKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             SKGEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  404   SKGEAQAMFLRHEGFLGALGAFMSYEKHGLD  434



>ref|XP_003601259.1| Pantothenate kinase [Medicago truncatula]
 gb|AES71510.1| pantothenate kinase [Medicago truncatula]
Length=893

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/419 (81%), Positives = 373/419 (89%), Gaps = 10/419 (2%)
 Frame = +3

Query  153   LGIDDKNEKDNIAVLERGGVEKEKEISPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPN  332
             LGID+    +N   +   G       +P+HRS+SRPQLD+S A IQ N E+K PTILLPN
Sbjct  15    LGIDESEGHNNTNNMAPTG-------NPIHRSSSRPQLDVSKAEIQSNVEDKYPTILLPN  67

Query  333   QSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLH  512
             QSDD+SHLALDIGGSLIKLVYFSRHEG+  +DKRK+ +KER G+SNGNRRS+PILGGRLH
Sbjct  68    QSDDLSHLALDIGGSLIKLVYFSRHEGQSDDDKRKKTLKERLGLSNGNRRSFPILGGRLH  127

Query  513   FVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKER  692
             FVKFET K+NECLDFI SKQLH  GL++    +EA  + N IIKATGGGAYKF DLFKE+
Sbjct  128   FVKFETGKINECLDFIHSKQLH-RGLESRYSDTEA--DRNAIIKATGGGAYKFTDLFKEK  184

Query  693   LGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVS  872
             LGVS++KEDEMNCLVAGANFLLKAIRHEAFTH+EG KEFVQIDQNDLFPYLLVN+GSGVS
Sbjct  185   LGVSLDKEDEMNCLVAGANFLLKAIRHEAFTHMEGQKEFVQIDQNDLFPYLLVNVGSGVS  244

Query  873   MIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYG  1052
             MIKVDGDGKF+RVSGTNVGGGTYWGLGRLLTKCKSFD+LLELSQ+GDNR IDMLVGDIYG
Sbjct  245   MIKVDGDGKFERVSGTNVGGGTYWGLGRLLTKCKSFDELLELSQKGDNRAIDMLVGDIYG  304

Query  1053  GMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYG  1232
             G+DYSKIGLSASTIASSFGK ISE KEL+DYRPEDISLSLLRMISYNIGQI+YLNALR+ 
Sbjct  305   GLDYSKIGLSASTIASSFGKTISEKKELQDYRPEDISLSLLRMISYNIGQIAYLNALRFK  364

Query  1233  LKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             LKRIFFGGFFIRGHAYTMDT+SFAV +WS GEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  365   LKRIFFGGFFIRGHAYTMDTLSFAVQYWSNGEAQAMFLRHEGFLGALGAFMSYEKHGLD  423



>ref|XP_010447427.1| PREDICTED: pantothenate kinase 2 isoform X1 [Camelina sativa]
Length=905

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/438 (79%), Positives = 377/438 (86%), Gaps = 12/438 (3%)
 Frame = +3

Query  120   MAGVTTGDLPDLGIDDKNEKDNIAVLERGGVEKEKE-------ISPMHRSTSRPQLDLSG  278
             MAG   GD  D  +DDK E +  + +  G  EK+          SP+HRS SRPQLDLS 
Sbjct  1     MAG--PGDEHDPSLDDKKEAEAKSQVCVGVGEKDMSPSSSVPGTSPIHRSGSRPQLDLSK  58

Query  279   AAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqved-krkrkvker  455
             A IQGN EE+DPTILLPNQSDDISHLALDIGGSLIKL+YFSRHE    +D KRKR +KER
Sbjct  59    AEIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLLYFSRHEDYSNDDDKRKRTIKER  118

Query  456   FGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENT  635
              G++NGN RSYP+LGGRLHFVKFET K+NECLDFI SKQLH    D   WSS        
Sbjct  119   LGITNGNLRSYPVLGGRLHFVKFETNKINECLDFIHSKQLH--RRDPYPWSSRTLPLGTG  176

Query  636   IIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQ  815
             +IK TGGGAYKFADLFKERLGVSIEKEDEM+CLV+GANFLLKAIRHEAFTH+EG KEFVQ
Sbjct  177   VIKVTGGGAYKFADLFKERLGVSIEKEDEMHCLVSGANFLLKAIRHEAFTHMEGEKEFVQ  236

Query  816   IDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLE  995
             ID NDL+PYLLVN+GSGVS+IKVDG+GKF+RVSGTNVGGGTYWGLGRLLTKCKSFD+LLE
Sbjct  237   IDPNDLYPYLLVNVGSGVSIIKVDGEGKFERVSGTNVGGGTYWGLGRLLTKCKSFDELLE  296

Query  996   LSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLL  1175
             LSQ+GDN  IDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL+DYRPEDISLSLL
Sbjct  297   LSQKGDNSAIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELDDYRPEDISLSLL  356

Query  1176  RMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHE  1355
             RMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV+FWSKGE +AMFLRHE
Sbjct  357   RMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEMQAMFLRHE  416

Query  1356  GFLGALGAFMSYEKHGLD  1409
             GFLGALGAFMSYEKHGLD
Sbjct  417   GFLGALGAFMSYEKHGLD  434



>ref|XP_010936708.1| PREDICTED: pantothenate kinase 2-like [Elaeis guineensis]
Length=903

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/405 (83%), Positives = 365/405 (90%), Gaps = 6/405 (1%)
 Frame = +3

Query  213   EKEKEISPM-----HRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGS  377
             E+ KEISPM     H+S+ RPQLDL+ A I+  +EE++PTILLPNQSDDISHLALDIGGS
Sbjct  26    EETKEISPMSLNPMHQSSLRPQLDLTRATIEDKWEERNPTILLPNQSDDISHLALDIGGS  85

Query  378   LIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDF  557
             LIKLVYFSRHE    +DKRKR +K+RFG+  G+RRSYP+LGGRLHFVKFET K+NECLDF
Sbjct  86    LIKLVYFSRHEEHSPDDKRKRSIKKRFGIPKGSRRSYPVLGGRLHFVKFETGKLNECLDF  145

Query  558   ISSKQLHCGGLDTPRWSS-EAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCL  734
             ISSKQLH GGLD+P W S   P +   IIKATGGGAYKFAD+FKERLGVS++KEDEM CL
Sbjct  146   ISSKQLHRGGLDSPSWQSGTRPHDNPIIIKATGGGAYKFADVFKERLGVSLDKEDEMACL  205

Query  735   VAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVS  914
             VAGANFLLKAIRHEAFTH+EG KEFVQID NDLFPYLLVNIGSGVSMIKV+GDGKFQRVS
Sbjct  206   VAGANFLLKAIRHEAFTHMEGQKEFVQIDHNDLFPYLLVNIGSGVSMIKVEGDGKFQRVS  265

Query  915   GTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTI  1094
             GTNVGGGTYWGLGRLLTKCKSFD+LLELSQ+GD+  +DM VGDIYGGMDYSKIGLSASTI
Sbjct  266   GTNVGGGTYWGLGRLLTKCKSFDELLELSQQGDSSNVDMHVGDIYGGMDYSKIGLSASTI  325

Query  1095  ASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgH  1274
             ASSFGKAI+E KEL DYRPEDISLSLLRMISYNIGQISYL ALRYGLKRIFFGGFFIRGH
Sbjct  326   ASSFGKAIAETKELLDYRPEDISLSLLRMISYNIGQISYLIALRYGLKRIFFGGFFIRGH  385

Query  1275  AYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             AYTMD ISFAV+FWS G+A+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  386   AYTMDAISFAVHFWSNGQAQAMFLRHEGFLGALGAFMSYEKHGLD  430



>ref|XP_010534230.1| PREDICTED: pantothenate kinase 2 [Tarenaya hassleriana]
 ref|XP_010534231.1| PREDICTED: pantothenate kinase 2 [Tarenaya hassleriana]
 ref|XP_010534232.1| PREDICTED: pantothenate kinase 2 [Tarenaya hassleriana]
Length=923

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/391 (86%), Positives = 360/391 (92%), Gaps = 2/391 (1%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             +HRS SRPQLDLS AAIQG+ EE+DPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  
Sbjct  63    IHRSGSRPQLDLSKAAIQGSSEERDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEDY  122

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
               +DKRK+ +KER G+SNGNR SYP+LGGRLHFVKFET K+NECLDFI SKQLH    + 
Sbjct  123   SNDDKRKKTIKERLGISNGNRISYPVLGGRLHFVKFETNKINECLDFIHSKQLH--RREC  180

Query  597   PRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHE  776
               W+ +     + IIKATGGGAYKFADLFKERLGVSIEKEDEM+CLVAGANFLLKAIRHE
Sbjct  181   YPWNPKNLPLGSGIIKATGGGAYKFADLFKERLGVSIEKEDEMDCLVAGANFLLKAIRHE  240

Query  777   AFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             AFTH+EG KEFVQID NDL+PYLLVN+GSGVS+IKVDG+GKFQRVSGTNVGGGTYWGLGR
Sbjct  241   AFTHMEGEKEFVQIDPNDLYPYLLVNVGSGVSIIKVDGEGKFQRVSGTNVGGGTYWGLGR  300

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL  1136
             LLTKCK+FD+LLELSQ+GDNRTIDMLVGDIYGG DYSKIGLSASTIASSFGKAISENKEL
Sbjct  301   LLTKCKTFDELLELSQKGDNRTIDMLVGDIYGGTDYSKIGLSASTIASSFGKAISENKEL  360

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
             EDYRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV FW
Sbjct  361   EDYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVQFW  420

Query  1317  SKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             SKGE +AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  421   SKGEMQAMFLRHEGFLGALGAFMSYEKHGLD  451



>ref|NP_001031768.1| pantothenate kinase 2 [Arabidopsis thaliana]
 ref|NP_001119092.1| pantothenate kinase 2 [Arabidopsis thaliana]
 gb|AEE86016.1| pantothenate kinase 2 [Arabidopsis thaliana]
 gb|AEE86017.1| pantothenate kinase 2 [Arabidopsis thaliana]
Length=783

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/421 (80%), Positives = 370/421 (88%), Gaps = 6/421 (1%)
 Frame = +3

Query  159   IDDKNE---KDNIAVLERGGVEKEKEISPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLP  329
             +D+K E   K  ++V     +      +P+HRS SRPQLDLS A IQGN EE+DPTILLP
Sbjct  12    LDNKREAEAKSQVSVAADKNMAPSTSGTPIHRSGSRPQLDLSKAEIQGNLEERDPTILLP  71

Query  330   NQSDDISHLALDIGGSLIKLVYFSRHEGrqved-krkrkvkerFGVSNGNRRSYPILGGR  506
             NQSDDISHLALDIGGSLIKL+YFSRHE    +D KRKR +KER G++NGN RSYP+LGGR
Sbjct  72    NQSDDISHLALDIGGSLIKLLYFSRHEDYSNDDDKRKRTIKERLGITNGNLRSYPVLGGR  131

Query  507   LHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFK  686
             LHFVKFET K+NECLDFI SKQLH    D   WSS+       +IK TGGGA+KFADLFK
Sbjct  132   LHFVKFETHKINECLDFIHSKQLHR--RDPYPWSSKTLPLGTGVIKVTGGGAFKFADLFK  189

Query  687   ERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSG  866
             ERLGVSIEKEDEM+CLV+GANFLLKAIRHEAFTH+EG KEFVQID NDL+PYLLVN+GSG
Sbjct  190   ERLGVSIEKEDEMHCLVSGANFLLKAIRHEAFTHMEGEKEFVQIDPNDLYPYLLVNVGSG  249

Query  867   VSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDI  1046
             VS+IKVDG+GKF+RVSGTNVGGGTYWGLGRLLTKCKSFD+LLELSQ+GDN  IDMLVGDI
Sbjct  250   VSIIKVDGEGKFERVSGTNVGGGTYWGLGRLLTKCKSFDELLELSQKGDNSAIDMLVGDI  309

Query  1047  YGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALR  1226
             YGGMDYSKIGLSASTIASSFGKAISENKEL+DYRPEDISLSLLRMISYNIGQISYLNALR
Sbjct  310   YGGMDYSKIGLSASTIASSFGKAISENKELDDYRPEDISLSLLRMISYNIGQISYLNALR  369

Query  1227  YGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGL  1406
             +GLKRIFFGGFFIRGHAYTMDTISFAV+FWSKGE +AMFLRHEGFLGALGAFMSYEKHGL
Sbjct  370   FGLKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEMQAMFLRHEGFLGALGAFMSYEKHGL  429

Query  1407  D  1409
             D
Sbjct  430   D  430



>ref|XP_010432761.1| PREDICTED: pantothenate kinase 2-like [Camelina sativa]
Length=902

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/439 (79%), Positives = 378/439 (86%), Gaps = 17/439 (4%)
 Frame = +3

Query  120   MAGVTTGDLPDLGIDDKNEKDNIAVLERGGVEKEKEISP--------MHRSTSRPQLDLS  275
             MAG   GD  D  +DDK E +  + +  G    EK++SP        +HRS SRPQLDLS
Sbjct  1     MAG--PGDEHDPSLDDKKEAEAKSQVCVG----EKDMSPSSVPGTSSIHRSGSRPQLDLS  54

Query  276   GAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqved-krkrkvke  452
              A IQGN EE+DPTILLPNQSDDISHLALDIGGSLIKL+YFSRHE    +D KRKR +KE
Sbjct  55    KAEIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLLYFSRHEDYSNDDDKRKRTIKE  114

Query  453   rFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNEN  632
             R G++NGN RSYP+LGGRLHFVKFET K+NECLDFI SKQLH    D   WSS       
Sbjct  115   RLGITNGNLRSYPVLGGRLHFVKFETNKINECLDFIHSKQLH--RRDPYPWSSRTLPLGT  172

Query  633   TIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFV  812
              +IK TGGGAYKFADLFKERLGVSIEKEDEM+CLV+GANFLLKAIRHEAFTH+EG KEFV
Sbjct  173   GVIKVTGGGAYKFADLFKERLGVSIEKEDEMHCLVSGANFLLKAIRHEAFTHMEGEKEFV  232

Query  813   QIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLL  992
             QID NDL+PYLLVN+GSGVS+IKVDG+GKF+RVSGTNVGGGTYWGLGRLLTKCKSFD+LL
Sbjct  233   QIDPNDLYPYLLVNVGSGVSIIKVDGEGKFERVSGTNVGGGTYWGLGRLLTKCKSFDELL  292

Query  993   ELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSL  1172
             ELSQ+GDN  IDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL+DYRPEDISLSL
Sbjct  293   ELSQKGDNSAIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELDDYRPEDISLSL  352

Query  1173  LRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRH  1352
             LRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV+FWSKGE +AMFLRH
Sbjct  353   LRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEMQAMFLRH  412

Query  1353  EGFLGALGAFMSYEKHGLD  1409
             EGFLGALGAFMSYEKHGLD
Sbjct  413   EGFLGALGAFMSYEKHGLD  431



>ref|XP_010437940.1| PREDICTED: pantothenate kinase 2-like [Camelina sativa]
Length=902

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/439 (79%), Positives = 378/439 (86%), Gaps = 17/439 (4%)
 Frame = +3

Query  120   MAGVTTGDLPDLGIDDKNEKDNIAVLERGGVEKEKEISP--------MHRSTSRPQLDLS  275
             MAG   GD  D  +DDK E +  + +  G    EK++SP        +HRS SRPQLDLS
Sbjct  1     MAG--PGDEHDPSLDDKKEAEAKSQVGVG----EKDMSPSSVPGTSSIHRSGSRPQLDLS  54

Query  276   GAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqved-krkrkvke  452
              A IQGN EE+DPTILLPNQSDDISHLALDIGGSLIKL+YFSRHE    +D KRKR +KE
Sbjct  55    KAEIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLLYFSRHEDYSNDDDKRKRTIKE  114

Query  453   rFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNEN  632
             R G++NGN RSYP+LGGRLHFVKFET K+NECLDFI SKQLH    D   WSS       
Sbjct  115   RLGITNGNLRSYPVLGGRLHFVKFETNKINECLDFIHSKQLH--RRDPYPWSSRTLPLGT  172

Query  633   TIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFV  812
              +IK TGGGAYKFADLFKERLGVSIEKEDEM+CLV+GANFLLKAIRHEAFTH+EG KEFV
Sbjct  173   GVIKVTGGGAYKFADLFKERLGVSIEKEDEMHCLVSGANFLLKAIRHEAFTHMEGEKEFV  232

Query  813   QIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLL  992
             QID NDL+PYLLVN+GSGVS+IKVDG+GKF+RVSGTNVGGGTYWGLGRLLTKCKSFD+LL
Sbjct  233   QIDPNDLYPYLLVNVGSGVSIIKVDGEGKFERVSGTNVGGGTYWGLGRLLTKCKSFDELL  292

Query  993   ELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSL  1172
             ELSQ+GDN  IDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL+DYRPEDISLSL
Sbjct  293   ELSQKGDNSAIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELDDYRPEDISLSL  352

Query  1173  LRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRH  1352
             LRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV+FWSKGE +AMFLRH
Sbjct  353   LRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEMQAMFLRH  412

Query  1353  EGFLGALGAFMSYEKHGLD  1409
             EGFLGALGAFMSYEKHGLD
Sbjct  413   EGFLGALGAFMSYEKHGLD  431



>emb|CDX75226.1| BnaA01g04760D [Brassica napus]
Length=910

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/438 (79%), Positives = 376/438 (86%), Gaps = 10/438 (2%)
 Frame = +3

Query  120   MAGVTTGDLPDLGIDDKNEKDNIAVLERGGVEKEKEISP------MHRSTSRPQLDLSGA  281
             MAG    D  D  +DD  E +       GG   E++++P      +HRS SRPQLDLS A
Sbjct  1     MAGPGDDDEHDPILDDSIEAEAKTQTCVGGGSGERDMAPSAPGPSIHRSGSRPQLDLSKA  60

Query  282   AIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqved--krkrkvker  455
              IQGNFEE+DPTILLPNQSDDISHLALDIGGSLIKL+YFSRHE     D  KRKR +KER
Sbjct  61    EIQGNFEERDPTILLPNQSDDISHLALDIGGSLIKLLYFSRHEEDYSNDDDKRKRTIKER  120

Query  456   FGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENT  635
              G++NGN RSYP+LGGRLHFVKFET K+NECLDFI SKQLH    D   WSS+       
Sbjct  121   LGITNGNLRSYPVLGGRLHFVKFETHKINECLDFIHSKQLH--RRDPYPWSSKTLPLGTG  178

Query  636   IIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQ  815
             +IK TGGGAYKFADLFKERLGVSIEKEDEM+CLV+GANFLLKAIRHEAFTH+E  KEFVQ
Sbjct  179   VIKVTGGGAYKFADLFKERLGVSIEKEDEMHCLVSGANFLLKAIRHEAFTHMEAEKEFVQ  238

Query  816   IDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLE  995
             ID NDL+PYLLVN+GSGVS+IKVDG+GKF+RVSGTNVGGGTYWGLG+LLTKCKSFD+LLE
Sbjct  239   IDPNDLYPYLLVNVGSGVSIIKVDGEGKFERVSGTNVGGGTYWGLGKLLTKCKSFDELLE  298

Query  996   LSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLL  1175
             LSQ+GDN TIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLL
Sbjct  299   LSQKGDNSTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLL  358

Query  1176  RMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHE  1355
             RMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV+FWSKGE +AMFLRHE
Sbjct  359   RMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEMQAMFLRHE  418

Query  1356  GFLGALGAFMSYEKHGLD  1409
             GFLGALGAFMSYEKHGLD
Sbjct  419   GFLGALGAFMSYEKHGLD  436



>pir||T05410 hypothetical protein F10M6.180 - Arabidopsis thaliana
 emb|CAA16972.1| putative protein [Arabidopsis thaliana]
 emb|CAB79936.1| putative protein [Arabidopsis thaliana]
Length=838

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/421 (80%), Positives = 370/421 (88%), Gaps = 6/421 (1%)
 Frame = +3

Query  159   IDDKNE---KDNIAVLERGGVEKEKEISPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLP  329
             +D+K E   K  ++V     +      +P+HRS SRPQLDLS A IQGN EE+DPTILLP
Sbjct  12    LDNKREAEAKSQVSVAADKNMAPSTSGTPIHRSGSRPQLDLSKAEIQGNLEERDPTILLP  71

Query  330   NQSDDISHLALDIGGSLIKLVYFSRHEGrqved-krkrkvkerFGVSNGNRRSYPILGGR  506
             NQSDDISHLALDIGGSLIKL+YFSRHE    +D KRKR +KER G++NGN RSYP+LGGR
Sbjct  72    NQSDDISHLALDIGGSLIKLLYFSRHEDYSNDDDKRKRTIKERLGITNGNLRSYPVLGGR  131

Query  507   LHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFK  686
             LHFVKFET K+NECLDFI SKQLH    D   WSS+       +IK TGGGA+KFADLFK
Sbjct  132   LHFVKFETHKINECLDFIHSKQLH--RRDPYPWSSKTLPLGTGVIKVTGGGAFKFADLFK  189

Query  687   ERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSG  866
             ERLGVSIEKEDEM+CLV+GANFLLKAIRHEAFTH+EG KEFVQID NDL+PYLLVN+GSG
Sbjct  190   ERLGVSIEKEDEMHCLVSGANFLLKAIRHEAFTHMEGEKEFVQIDPNDLYPYLLVNVGSG  249

Query  867   VSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDI  1046
             VS+IKVDG+GKF+RVSGTNVGGGTYWGLGRLLTKCKSFD+LLELSQ+GDN  IDMLVGDI
Sbjct  250   VSIIKVDGEGKFERVSGTNVGGGTYWGLGRLLTKCKSFDELLELSQKGDNSAIDMLVGDI  309

Query  1047  YGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALR  1226
             YGGMDYSKIGLSASTIASSFGKAISENKEL+DYRPEDISLSLLRMISYNIGQISYLNALR
Sbjct  310   YGGMDYSKIGLSASTIASSFGKAISENKELDDYRPEDISLSLLRMISYNIGQISYLNALR  369

Query  1227  YGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGL  1406
             +GLKRIFFGGFFIRGHAYTMDTISFAV+FWSKGE +AMFLRHEGFLGALGAFMSYEKHGL
Sbjct  370   FGLKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEMQAMFLRHEGFLGALGAFMSYEKHGL  429

Query  1407  D  1409
             D
Sbjct  430   D  430



>ref|XP_009126332.1| PREDICTED: pantothenate kinase 2 [Brassica rapa]
Length=910

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/438 (79%), Positives = 377/438 (86%), Gaps = 10/438 (2%)
 Frame = +3

Query  120   MAGVTTGDLPDLGIDDKNEKDNIAVLERGGVEKEKEISP------MHRSTSRPQLDLSGA  281
             MAG    D  D  +DD  E +  +    GG   E++++P      +HRS SRPQLDLS A
Sbjct  1     MAGPGDDDEHDPILDDSIEAEVKSHAFVGGGSGERDMAPSAPGPSIHRSGSRPQLDLSKA  60

Query  282   AIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqved--krkrkvker  455
              IQGNFEE+DPTILLPNQSDDISHLALDIGGSLIKL+YFSRHE     D  KRKR +KER
Sbjct  61    EIQGNFEERDPTILLPNQSDDISHLALDIGGSLIKLLYFSRHEEDYSNDDDKRKRTIKER  120

Query  456   FGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENT  635
              G++NGN RSYP+LGGRLHFVKFET K+NECLDFI SKQLH    D   WSS+       
Sbjct  121   LGITNGNLRSYPVLGGRLHFVKFETHKINECLDFIHSKQLH--RRDPYPWSSKTLPLGTG  178

Query  636   IIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQ  815
             +IK TGGGAYKFADLFKERLGVSIEKEDEM+CLV+GANFLLKAIRHEAFTH+E  KEFVQ
Sbjct  179   VIKVTGGGAYKFADLFKERLGVSIEKEDEMHCLVSGANFLLKAIRHEAFTHMEAEKEFVQ  238

Query  816   IDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLE  995
             ID NDL+PYLLVN+GSGVS+IKVDG+GKF+RVSGTNVGGGTYWGLG+LLTKCKSFD+LLE
Sbjct  239   IDPNDLYPYLLVNVGSGVSIIKVDGEGKFERVSGTNVGGGTYWGLGKLLTKCKSFDELLE  298

Query  996   LSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLL  1175
             LSQ+GDN TIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLL
Sbjct  299   LSQKGDNSTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLL  358

Query  1176  RMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHE  1355
             RMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV+FWSKGE +AMFLRHE
Sbjct  359   RMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEMQAMFLRHE  418

Query  1356  GFLGALGAFMSYEKHGLD  1409
             GFLGALGAFMSYEKHGLD
Sbjct  419   GFLGALGAFMSYEKHGLD  436



>ref|XP_006840740.2| PREDICTED: pantothenate kinase 2 isoform X1 [Amborella trichopoda]
Length=873

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/393 (84%), Positives = 360/393 (92%), Gaps = 1/393 (0%)
 Frame = +3

Query  231   SPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  410
             + MHRS SRPQLDLSGAAIQGNFEE++P ILLPNQSDDIS +ALDIGGSLIKLVYFSRHE
Sbjct  6     ASMHRSGSRPQLDLSGAAIQGNFEERNPIILLPNQSDDISCMALDIGGSLIKLVYFSRHE  65

Query  411   GrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGL  590
                 +DKRK+ +K+R  V NG RRSYPILGGRLHFVKFET K+NEC+DFI  KQLH GG 
Sbjct  66    DNPHKDKRKKYMKQRLEVPNGGRRSYPILGGRLHFVKFETRKLNECVDFIKCKQLHRGGE  125

Query  591   DTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIR  770
             +   W+S A QNEN +IKATGGGAYKF D+FKE LGV+++KEDEM+CLVAGANFLLKAIR
Sbjct  126   ENA-WNSGALQNENVVIKATGGGAYKFTDVFKEGLGVTLDKEDEMDCLVAGANFLLKAIR  184

Query  771   HEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGL  950
             HEAFTH+EGHKEFVQID NDLFPYLLVN+GSGVSMIKVDG GKFQRVSGTNVGGGT+WGL
Sbjct  185   HEAFTHMEGHKEFVQIDHNDLFPYLLVNVGSGVSMIKVDGYGKFQRVSGTNVGGGTFWGL  244

Query  951   GRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENK  1130
             GRLLTKCKSFD++LELSQRGDN  +DMLVGDIYGGMDYSKIGLSASTIASSFGK ISE+K
Sbjct  245   GRLLTKCKSFDEILELSQRGDNSAVDMLVGDIYGGMDYSKIGLSASTIASSFGKVISESK  304

Query  1131  ELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVN  1310
             +L +YRPEDISLSLLRMISYNIGQISYLNALRYGL RIFFGGFFIRGHAYTMDTISFAV+
Sbjct  305   DLSEYRPEDISLSLLRMISYNIGQISYLNALRYGLNRIFFGGFFIRGHAYTMDTISFAVH  364

Query  1311  FWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             FWSKGEA+AMFLRHEGFLGALGAFMSY+KHGL+
Sbjct  365   FWSKGEAQAMFLRHEGFLGALGAFMSYDKHGLE  397



>gb|ERN02415.1| hypothetical protein AMTR_s00096p00130150 [Amborella trichopoda]
Length=919

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/393 (84%), Positives = 360/393 (92%), Gaps = 1/393 (0%)
 Frame = +3

Query  231   SPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  410
             + MHRS SRPQLDLSGAAIQGNFEE++P ILLPNQSDDIS +ALDIGGSLIKLVYFSRHE
Sbjct  52    ASMHRSGSRPQLDLSGAAIQGNFEERNPIILLPNQSDDISCMALDIGGSLIKLVYFSRHE  111

Query  411   GrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGL  590
                 +DKRK+ +K+R  V NG RRSYPILGGRLHFVKFET K+NEC+DFI  KQLH GG 
Sbjct  112   DNPHKDKRKKYMKQRLEVPNGGRRSYPILGGRLHFVKFETRKLNECVDFIKCKQLHRGGE  171

Query  591   DTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIR  770
             +   W+S A QNEN +IKATGGGAYKF D+FKE LGV+++KEDEM+CLVAGANFLLKAIR
Sbjct  172   ENA-WNSGALQNENVVIKATGGGAYKFTDVFKEGLGVTLDKEDEMDCLVAGANFLLKAIR  230

Query  771   HEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGL  950
             HEAFTH+EGHKEFVQID NDLFPYLLVN+GSGVSMIKVDG GKFQRVSGTNVGGGT+WGL
Sbjct  231   HEAFTHMEGHKEFVQIDHNDLFPYLLVNVGSGVSMIKVDGYGKFQRVSGTNVGGGTFWGL  290

Query  951   GRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENK  1130
             GRLLTKCKSFD++LELSQRGDN  +DMLVGDIYGGMDYSKIGLSASTIASSFGK ISE+K
Sbjct  291   GRLLTKCKSFDEILELSQRGDNSAVDMLVGDIYGGMDYSKIGLSASTIASSFGKVISESK  350

Query  1131  ELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVN  1310
             +L +YRPEDISLSLLRMISYNIGQISYLNALRYGL RIFFGGFFIRGHAYTMDTISFAV+
Sbjct  351   DLSEYRPEDISLSLLRMISYNIGQISYLNALRYGLNRIFFGGFFIRGHAYTMDTISFAVH  410

Query  1311  FWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             FWSKGEA+AMFLRHEGFLGALGAFMSY+KHGL+
Sbjct  411   FWSKGEAQAMFLRHEGFLGALGAFMSYDKHGLE  443



>ref|XP_002867254.1| ATPANK2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43513.1| ATPANK2 [Arabidopsis lyrata subsp. lyrata]
Length=902

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/422 (81%), Positives = 372/422 (88%), Gaps = 7/422 (2%)
 Frame = +3

Query  159   IDDKNEKDNIAVLERGGVEKEKEIS----PMHRSTSRPQLDLSGAAIQGNFEEKDPTILL  326
             +DDK E +  + +  GG E++   S     +HRS SRPQLDLS A IQGN EE+DPTILL
Sbjct  12    LDDKKEAEAKSEVCVGGGERDMAPSTSGTSIHRSGSRPQLDLSKAEIQGNLEERDPTILL  71

Query  327   PNQSDDISHLALDIGGSLIKLVYFSRHEGrqve-dkrkrkvkerFGVSNGNRRSYPILGG  503
             PNQSDDISHLALDIGGSLIKL+YFSRHE    + DKRKR +KER G++NGN RSYP+LGG
Sbjct  72    PNQSDDISHLALDIGGSLIKLLYFSRHEDYSNDGDKRKRTIKERLGITNGNLRSYPVLGG  131

Query  504   RLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLF  683
             RLHFVKFET K+NECLDFI SKQLH    D   WSS+       +IK TGGGAYKFADLF
Sbjct  132   RLHFVKFETHKINECLDFIHSKQLH--RRDPYPWSSKTLPLGTGVIKVTGGGAYKFADLF  189

Query  684   KERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGS  863
             KERLGVSIEKEDEM+CLV+GANFLLKAIRHEAFTH+EG KEFVQID NDL+PYLLVN+GS
Sbjct  190   KERLGVSIEKEDEMHCLVSGANFLLKAIRHEAFTHMEGEKEFVQIDPNDLYPYLLVNVGS  249

Query  864   GVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGD  1043
             GVS+IKVDG+GKF+RVSGTNVGGGTYWGLGRLLTKCKSFD+LLELSQ+GDN  IDMLVGD
Sbjct  250   GVSIIKVDGEGKFERVSGTNVGGGTYWGLGRLLTKCKSFDELLELSQKGDNSAIDMLVGD  309

Query  1044  IYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNAL  1223
             IYGGMDYSKIGLSASTIASSFGKAISENKEL+DYRPEDISLSLLRMISYNIGQISYLNAL
Sbjct  310   IYGGMDYSKIGLSASTIASSFGKAISENKELDDYRPEDISLSLLRMISYNIGQISYLNAL  369

Query  1224  RYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHG  1403
             R+GLKRIFFGGFFIRGHAYTMDTISFAV+FWSKGE +AMFLRHEGFLGALGAFMSYEKHG
Sbjct  370   RFGLKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEMQAMFLRHEGFLGALGAFMSYEKHG  429

Query  1404  LD  1409
             LD
Sbjct  430   LD  431



>emb|CDX68824.1| BnaC01g06290D [Brassica napus]
Length=906

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/425 (80%), Positives = 372/425 (88%), Gaps = 13/425 (3%)
 Frame = +3

Query  159   IDDKNEKDNIAVLERGGVEKEKEISP------MHRSTSRPQLDLSGAAIQGNFEEKDPTI  320
             +DD  E + I+    GG   E++++P      +HRS SRPQLDLS A IQGN EE+DPTI
Sbjct  13    LDDNREAEAISQACVGG---ERDMAPSAPGPSIHRSGSRPQLDLSKAEIQGNLEERDPTI  69

Query  321   LLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqved--krkrkvkerFGVSNGNRRSYPI  494
             LLPNQSDDISHLALDIGGSLIKL+YFSRHE     D  KRKR +KER G++NGN RSYP+
Sbjct  70    LLPNQSDDISHLALDIGGSLIKLLYFSRHEEDYSNDDDKRKRTIKERLGITNGNLRSYPV  129

Query  495   LGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFA  674
             LGGRLHFVKFET K+NECLDFI SKQLH    D   WSS+       +IK TGGGAYKFA
Sbjct  130   LGGRLHFVKFETHKINECLDFIHSKQLH--RRDPYPWSSKTLPLGTGVIKVTGGGAYKFA  187

Query  675   DLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVN  854
             DLFKERLGVSIEKEDEM+CLV+GANFLLKAIRHEAFTH+E  KEFVQID NDL+PYLLVN
Sbjct  188   DLFKERLGVSIEKEDEMHCLVSGANFLLKAIRHEAFTHMEAEKEFVQIDPNDLYPYLLVN  247

Query  855   IGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDML  1034
             +GSGVS+IKVDG+GKF+RVSGTNVGGGTYWGLG+LLTKCKSFD+LLELSQ+GDN TIDML
Sbjct  248   VGSGVSIIKVDGEGKFERVSGTNVGGGTYWGLGKLLTKCKSFDELLELSQKGDNSTIDML  307

Query  1035  VGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYL  1214
             VGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYL
Sbjct  308   VGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYL  367

Query  1215  NALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYE  1394
             NALR+GLKRIFFGGFFIRGHAYTMDTISFAV+FWSKGE +AMFLRHEGFLGALGAFMSYE
Sbjct  368   NALRFGLKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEMQAMFLRHEGFLGALGAFMSYE  427

Query  1395  KHGLD  1409
             KHGLD
Sbjct  428   KHGLD  432



>ref|NP_194945.3| pantothenate kinase 2 [Arabidopsis thaliana]
 sp|Q8L5Y9.2|PANK2_ARATH RecName: Full=Pantothenate kinase 2; Short=AtPANK2; AltName: 
Full=Pantothenic acid kinase 2 [Arabidopsis thaliana]
 gb|AEE86015.1| pantothenate kinase 2 [Arabidopsis thaliana]
Length=901

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/421 (80%), Positives = 370/421 (88%), Gaps = 6/421 (1%)
 Frame = +3

Query  159   IDDKNE---KDNIAVLERGGVEKEKEISPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLP  329
             +D+K E   K  ++V     +      +P+HRS SRPQLDLS A IQGN EE+DPTILLP
Sbjct  12    LDNKREAEAKSQVSVAADKNMAPSTSGTPIHRSGSRPQLDLSKAEIQGNLEERDPTILLP  71

Query  330   NQSDDISHLALDIGGSLIKLVYFSRHEGrqved-krkrkvkerFGVSNGNRRSYPILGGR  506
             NQSDDISHLALDIGGSLIKL+YFSRHE    +D KRKR +KER G++NGN RSYP+LGGR
Sbjct  72    NQSDDISHLALDIGGSLIKLLYFSRHEDYSNDDDKRKRTIKERLGITNGNLRSYPVLGGR  131

Query  507   LHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFK  686
             LHFVKFET K+NECLDFI SKQLH    D   WSS+       +IK TGGGA+KFADLFK
Sbjct  132   LHFVKFETHKINECLDFIHSKQLH--RRDPYPWSSKTLPLGTGVIKVTGGGAFKFADLFK  189

Query  687   ERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSG  866
             ERLGVSIEKEDEM+CLV+GANFLLKAIRHEAFTH+EG KEFVQID NDL+PYLLVN+GSG
Sbjct  190   ERLGVSIEKEDEMHCLVSGANFLLKAIRHEAFTHMEGEKEFVQIDPNDLYPYLLVNVGSG  249

Query  867   VSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDI  1046
             VS+IKVDG+GKF+RVSGTNVGGGTYWGLGRLLTKCKSFD+LLELSQ+GDN  IDMLVGDI
Sbjct  250   VSIIKVDGEGKFERVSGTNVGGGTYWGLGRLLTKCKSFDELLELSQKGDNSAIDMLVGDI  309

Query  1047  YGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALR  1226
             YGGMDYSKIGLSASTIASSFGKAISENKEL+DYRPEDISLSLLRMISYNIGQISYLNALR
Sbjct  310   YGGMDYSKIGLSASTIASSFGKAISENKELDDYRPEDISLSLLRMISYNIGQISYLNALR  369

Query  1227  YGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGL  1406
             +GLKRIFFGGFFIRGHAYTMDTISFAV+FWSKGE +AMFLRHEGFLGALGAFMSYEKHGL
Sbjct  370   FGLKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEMQAMFLRHEGFLGALGAFMSYEKHGL  429

Query  1407  D  1409
             D
Sbjct  430   D  430



>gb|EEE70109.1| hypothetical protein OsJ_30119 [Oryza sativa Japonica Group]
Length=872

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/382 (86%), Positives = 355/382 (93%), Gaps = 1/382 (0%)
 Frame = +3

Query  264   LDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrk  443
             LDLSGAAI GN E+++PTILLPNQSDDISHLALDIGGSLIKLVYFSRH     EDKRK  
Sbjct  24    LDLSGAAIHGNLEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHAEHSSEDKRKLS  83

Query  444   vkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQ  623
              K R G+ NG RRSYP+LGGRLHFVKFET K+NECLDFISSKQLH GG+D+P W S A Q
Sbjct  84    TKRRLGMLNGGRRSYPVLGGRLHFVKFETGKLNECLDFISSKQLHRGGVDSPSWRSGA-Q  142

Query  624   NENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHK  803
              +N +IKATGGGA+K+ADLFKERLGVS+EKEDEM+CLVAGANFLLK+IRHEAFTH++G K
Sbjct  143   PDNIVIKATGGGAFKYADLFKERLGVSLEKEDEMDCLVAGANFLLKSIRHEAFTHMDGQK  202

Query  804   EFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFD  983
             E+VQIDQNDLFP+LLVN+GSGVS+IKVDG GKFQRVSGTNVGGGTYWGLGRL+TKCKSFD
Sbjct  203   EYVQIDQNDLFPFLLVNVGSGVSIIKVDGHGKFQRVSGTNVGGGTYWGLGRLMTKCKSFD  262

Query  984   DLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDIS  1163
             +LLELSQRGDN TIDMLVGDIYGG+DYSKIGLSASTIASSFGK IS++KEL DYRPEDIS
Sbjct  263   ELLELSQRGDNSTIDMLVGDIYGGLDYSKIGLSASTIASSFGKTISDDKELSDYRPEDIS  322

Query  1164  LSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMF  1343
             LSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAVNFWSKGEA+AMF
Sbjct  323   LSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAVNFWSKGEAKAMF  382

Query  1344  LRHEGFLGALGAFMSYEKHGLD  1409
             LRHEGFLGALGAFMSYEKHGLD
Sbjct  383   LRHEGFLGALGAFMSYEKHGLD  404



>ref|XP_011622021.1| PREDICTED: pantothenate kinase 2 isoform X2 [Amborella trichopoda]
Length=872

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/393 (83%), Positives = 359/393 (91%), Gaps = 2/393 (1%)
 Frame = +3

Query  231   SPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  410
             + MHRS SRPQLDLSGAAIQGNFEE++P ILLPNQSDDIS +ALDIGGSLIKLVYFSRHE
Sbjct  6     ASMHRSGSRPQLDLSGAAIQGNFEERNPIILLPNQSDDISCMALDIGGSLIKLVYFSRHE  65

Query  411   GrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGL  590
                 +DKRK+ +K+R  V NG RRSYPILGGRLHFVKFET K+NEC+DFI  KQLH G  
Sbjct  66    DNPHKDKRKKYMKQRLEVPNGGRRSYPILGGRLHFVKFETRKLNECVDFIKCKQLHRG--  123

Query  591   DTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIR  770
             +   W+S A QNEN +IKATGGGAYKF D+FKE LGV+++KEDEM+CLVAGANFLLKAIR
Sbjct  124   EENAWNSGALQNENVVIKATGGGAYKFTDVFKEGLGVTLDKEDEMDCLVAGANFLLKAIR  183

Query  771   HEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGL  950
             HEAFTH+EGHKEFVQID NDLFPYLLVN+GSGVSMIKVDG GKFQRVSGTNVGGGT+WGL
Sbjct  184   HEAFTHMEGHKEFVQIDHNDLFPYLLVNVGSGVSMIKVDGYGKFQRVSGTNVGGGTFWGL  243

Query  951   GRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENK  1130
             GRLLTKCKSFD++LELSQRGDN  +DMLVGDIYGGMDYSKIGLSASTIASSFGK ISE+K
Sbjct  244   GRLLTKCKSFDEILELSQRGDNSAVDMLVGDIYGGMDYSKIGLSASTIASSFGKVISESK  303

Query  1131  ELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVN  1310
             +L +YRPEDISLSLLRMISYNIGQISYLNALRYGL RIFFGGFFIRGHAYTMDTISFAV+
Sbjct  304   DLSEYRPEDISLSLLRMISYNIGQISYLNALRYGLNRIFFGGFFIRGHAYTMDTISFAVH  363

Query  1311  FWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             FWSKGEA+AMFLRHEGFLGALGAFMSY+KHGL+
Sbjct  364   FWSKGEAQAMFLRHEGFLGALGAFMSYDKHGLE  396



>gb|AAM20690.1| putative protein [Arabidopsis thaliana]
Length=870

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/394 (85%), Positives = 360/394 (91%), Gaps = 3/394 (1%)
 Frame = +3

Query  231   SPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  410
             +P+HRS SRPQLDLS A IQGN EE+DPTILLPNQSDDISHLALDIGGSLIKL+YFSRHE
Sbjct  8     TPIHRSGSRPQLDLSKAEIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLLYFSRHE  67

Query  411   Grqved-krkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGG  587
                 +D KRKR +KER G++NGN RSYP+LGGRLHFVKFET K+NECLDFI SKQLH   
Sbjct  68    DYSNDDDKRKRTIKERLGITNGNLRSYPVLGGRLHFVKFETHKINECLDFIHSKQLH--R  125

Query  588   LDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAI  767
              D   WSS+       +IK TGGGA+KFADLFKERLGVSIEKEDEM+CLV+GANFLLKAI
Sbjct  126   RDPYPWSSKTLPLGTGVIKVTGGGAFKFADLFKERLGVSIEKEDEMHCLVSGANFLLKAI  185

Query  768   RHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWG  947
             RHEAFTH+EG KEFVQID NDL+PYLLVN+GSGVS+IKVDG+GKF+RVSGTNVGGGTYWG
Sbjct  186   RHEAFTHMEGEKEFVQIDPNDLYPYLLVNVGSGVSIIKVDGEGKFERVSGTNVGGGTYWG  245

Query  948   LGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISEN  1127
             LGRLLTKCKSFD+LLELSQ+GDN  IDMLVGDIYGGMDYSKIGLSASTIASSFGKAISEN
Sbjct  246   LGRLLTKCKSFDELLELSQKGDNSAIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISEN  305

Query  1128  KELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAV  1307
             KEL+DYRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV
Sbjct  306   KELDDYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAV  365

Query  1308  NFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             +FWSKGE +AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  366   HFWSKGEMQAMFLRHEGFLGALGAFMSYEKHGLD  399



>ref|XP_006412505.1| hypothetical protein EUTSA_v10024357mg [Eutrema salsugineum]
 gb|ESQ53958.1| hypothetical protein EUTSA_v10024357mg [Eutrema salsugineum]
Length=901

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/405 (83%), Positives = 362/405 (89%), Gaps = 3/405 (1%)
 Frame = +3

Query  198   ERGGVEKEKEISPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGS  377
             ER         S +HRS SRPQLDLS A IQGNFEE+DPTILLPNQSDDISHLALDIGGS
Sbjct  25    ERDMAPSAPGTSSIHRSGSRPQLDLSKAEIQGNFEERDPTILLPNQSDDISHLALDIGGS  84

Query  378   LIKLVYFSRHEGrqved-krkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLD  554
             LIKL+YFSRHE    +D KRKR +KER G++NGN RSYP+LGGRLHFVKFET K+NECLD
Sbjct  85    LIKLLYFSRHEDYSNDDDKRKRTIKERLGITNGNLRSYPVLGGRLHFVKFETHKINECLD  144

Query  555   FISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCL  734
             FI SKQLH    D   WSS+       +IK TGGGAYKFADLFKERLGVSIEKEDEM+CL
Sbjct  145   FIHSKQLH--RRDPYPWSSKTLPLGTGVIKVTGGGAYKFADLFKERLGVSIEKEDEMHCL  202

Query  735   VAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVS  914
             V+GANFLLKAIRHEAFTH+EG KEFVQID +DL+PYLLVN+GSGVS+IKVDG+GKF+RVS
Sbjct  203   VSGANFLLKAIRHEAFTHMEGEKEFVQIDPHDLYPYLLVNVGSGVSIIKVDGEGKFERVS  262

Query  915   GTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTI  1094
             GTNVGGGTYWGLGRLLTKCKSFD+LLELSQ+GDN  IDMLVGDIYGGMDYSKIGLSASTI
Sbjct  263   GTNVGGGTYWGLGRLLTKCKSFDELLELSQKGDNSAIDMLVGDIYGGMDYSKIGLSASTI  322

Query  1095  ASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgH  1274
             ASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGH
Sbjct  323   ASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGH  382

Query  1275  AYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             AYTMDTISFAV+FWSKGE +AMFLRHEGFLGA+GAFMSYEKHGLD
Sbjct  383   AYTMDTISFAVHFWSKGEMQAMFLRHEGFLGAMGAFMSYEKHGLD  427



>ref|XP_006282554.1| hypothetical protein CARUB_v10004099mg [Capsella rubella]
 gb|EOA15452.1| hypothetical protein CARUB_v10004099mg [Capsella rubella]
Length=905

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/437 (79%), Positives = 379/437 (87%), Gaps = 10/437 (2%)
 Frame = +3

Query  120   MAGVTTGDLPDLGIDDKNEKDNIAVLERGGVEKEKEISP------MHRSTSRPQLDLSGA  281
             MAG    +   + ++DK E +  +     GV  EK+++P      +HRS SRPQLDLS A
Sbjct  1     MAGPPGDEHDPIILEDKKEAEAKSSQVCVGV-GEKDMAPSASGTSIHRSGSRPQLDLSKA  59

Query  282   AIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqved-krkrkvkerF  458
              IQGN EE+DPTILLPNQSDDISHLALDIGGSLIKL+YFSRHE    +D KRKR +KER 
Sbjct  60    EIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLLYFSRHEDYSNDDDKRKRTIKERL  119

Query  459   GVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTI  638
             G++NGN RSYP+LGGRLHFVKFET K+NECLDFI SKQLH    D   WSS+       +
Sbjct  120   GITNGNLRSYPVLGGRLHFVKFETHKINECLDFIHSKQLH--RRDPYPWSSKTLPLGTGV  177

Query  639   IKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQI  818
             IK TGGGAYKFADLFKERLGVSI+KEDEM+CLV+GANFLLKAIRHEAFTH+EG KEFVQI
Sbjct  178   IKVTGGGAYKFADLFKERLGVSIDKEDEMHCLVSGANFLLKAIRHEAFTHMEGEKEFVQI  237

Query  819   DQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLEL  998
             D NDL+PYLLVN+GSGVS+IKVDG+GKF+RVSGTNVGGGTYWGLGRLLTKCKSFD+LLEL
Sbjct  238   DPNDLYPYLLVNVGSGVSIIKVDGEGKFERVSGTNVGGGTYWGLGRLLTKCKSFDELLEL  297

Query  999   SQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLR  1178
             SQ+GDN TIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL+DYRPEDISLSLLR
Sbjct  298   SQKGDNSTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELDDYRPEDISLSLLR  357

Query  1179  MISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEG  1358
             MISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV+FWSKGE +AMFLRHEG
Sbjct  358   MISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEMKAMFLRHEG  417

Query  1359  FLGALGAFMSYEKHGLD  1409
             FLGALGAFMSYEKHGLD
Sbjct  418   FLGALGAFMSYEKHGLD  434



>gb|KFK29830.1| hypothetical protein AALP_AA7G184400 [Arabis alpina]
Length=891

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/390 (86%), Positives = 357/390 (92%), Gaps = 3/390 (1%)
 Frame = +3

Query  243   RSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqv  422
             RS SRPQLDLS A IQGNFEE+DPTILLPNQSDDISHLALDIGGSLIKL+YFSRHE    
Sbjct  29    RSGSRPQLDLSKAEIQGNFEERDPTILLPNQSDDISHLALDIGGSLIKLLYFSRHEDYAN  88

Query  423   ed-krkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTP  599
             +D KRKR +KER G++NGN RSYP+LGGRLHFVKFET K+NECLDFI SKQLH    D  
Sbjct  89    DDDKRKRTIKERLGITNGNLRSYPVLGGRLHFVKFETHKINECLDFIHSKQLH--RRDPY  146

Query  600   RWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEA  779
              WSS+       +IK TGGGAYKFADLFKERLGVSIEKEDEM+CLV+GANFLLKAIRHEA
Sbjct  147   PWSSKTLPLGTGVIKVTGGGAYKFADLFKERLGVSIEKEDEMHCLVSGANFLLKAIRHEA  206

Query  780   FTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRL  959
             FTH+EG KEFVQID NDL+PYLLVN+GSGVS+IKVDG+GKF+RVSGTNVGGGTYWGLGRL
Sbjct  207   FTHMEGEKEFVQIDPNDLYPYLLVNVGSGVSIIKVDGEGKFERVSGTNVGGGTYWGLGRL  266

Query  960   LTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELE  1139
             LTKCKSFD+LLELSQ+GDN  IDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELE
Sbjct  267   LTKCKSFDELLELSQKGDNSAIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELE  326

Query  1140  DYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWS  1319
             DYRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV+FWS
Sbjct  327   DYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVHFWS  386

Query  1320  KGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             KGE +AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  387   KGEMQAMFLRHEGFLGALGAFMSYEKHGLD  416



>ref|XP_009108890.1| PREDICTED: pantothenate kinase 2 [Brassica rapa]
 emb|CDY61390.1| BnaA08g30620D [Brassica napus]
Length=899

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/424 (79%), Positives = 371/424 (88%), Gaps = 17/424 (4%)
 Frame = +3

Query  159   IDDKNEKDNIAVLERGGVEKEKEISP------MHRSTSRPQLDLSGAAIQGNFEEKDPTI  320
             +DDK E +            E++++P      +HRS SRPQLDLS A IQGNFEE+DPTI
Sbjct  14    LDDKTEAE--------AKSSERDMAPQGPGTSIHRSGSRPQLDLSKAEIQGNFEERDPTI  65

Query  321   LLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqved-krkrkvkerFGVSNGNRRSYPIL  497
             LLPNQSDDISHLALDIGGSLIKL+YFSRHE    +D KRK+ +KER G++NG  RSYP+L
Sbjct  66    LLPNQSDDISHLALDIGGSLIKLLYFSRHEDYSNDDDKRKKTIKERLGLTNGKLRSYPVL  125

Query  498   GGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFAD  677
             GGRLHFVKFET K+NECLDFI SKQLH    D   WSS+       +IK TGGGAYKFAD
Sbjct  126   GGRLHFVKFETHKINECLDFIHSKQLH--RRDPYPWSSKTLPLGTGVIKVTGGGAYKFAD  183

Query  678   LFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNI  857
             LFKERLGVSIEKEDEM+CLV+GANFLLKAIRHEA+TH+EG KEFVQI+ NDL+PYLLVN+
Sbjct  184   LFKERLGVSIEKEDEMHCLVSGANFLLKAIRHEAYTHMEGEKEFVQIEPNDLYPYLLVNV  243

Query  858   GSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLV  1037
             GSGVS+IKVDG+GKF+RVSGTNVGGGTYWGLGRLLTKCKSFD+LLELSQ+GDN TIDMLV
Sbjct  244   GSGVSIIKVDGEGKFERVSGTNVGGGTYWGLGRLLTKCKSFDELLELSQKGDNSTIDMLV  303

Query  1038  GDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLN  1217
             GDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLN
Sbjct  304   GDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLN  363

Query  1218  ALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEK  1397
             ALR+GLKRIFFGGFFIRGHAYTMDTISFAV+FWSKG+ +AMFLRHEGFLGA+GAFMSYEK
Sbjct  364   ALRFGLKRIFFGGFFIRGHAYTMDTISFAVHFWSKGDMQAMFLRHEGFLGAMGAFMSYEK  423

Query  1398  HGLD  1409
             HGLD
Sbjct  424   HGLD  427



>gb|EMT07573.1| Pantothenate kinase 2 [Aegilops tauschii]
Length=832

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/391 (84%), Positives = 354/391 (91%), Gaps = 8/391 (2%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             M+RS SRPQLDLSGAAI G  E+++PTILLPNQSDDISHLALDIGGSLIKLVYFSRH  +
Sbjct  1     MNRSGSRPQLDLSGAAIHGTLEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHADQ  60

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
               EDKRK   K R  +  G RRSYP+LGGRLHFVKFET K+NECLDFISSKQLH GG+D+
Sbjct  61    PTEDKRKLSTKRRLEIFTGARRSYPVLGGRLHFVKFETGKLNECLDFISSKQLHRGGVDS  120

Query  597   PRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHE  776
             P W S A Q +N +IKATGGGA+K+ADLFKERLGVS+EKEDEM+CLVAGANFLLKAIRHE
Sbjct  121   PSWRSGA-QPDNIVIKATGGGAFKYADLFKERLGVSLEKEDEMDCLVAGANFLLKAIRHE  179

Query  777   AFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             AFTH++G KE+VQIDQNDLFPYLLVN+GSGVS+IKVDG GKFQRVSGTNVGGGTYWGLG 
Sbjct  180   AFTHMDGQKEYVQIDQNDLFPYLLVNVGSGVSIIKVDGHGKFQRVSGTNVGGGTYWGLG-  238

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL  1136
                   SFD+LLELSQRGDN TIDMLVGDIYGG+DYSKIGLSASTIASSFGK IS+NKEL
Sbjct  239   ------SFDELLELSQRGDNSTIDMLVGDIYGGLDYSKIGLSASTIASSFGKTISDNKEL  292

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
              DYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAV+FW
Sbjct  293   SDYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAVHFW  352

Query  1317  SKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             SKGEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  353   SKGEAKAMFLRHEGFLGALGAFMSYEKHGLD  383



>gb|KHN18454.1| Pantothenate kinase 2 [Glycine soja]
Length=755

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/386 (84%), Positives = 348/386 (90%), Gaps = 2/386 (1%)
 Frame = +3

Query  255   RPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkr  434
             RPQLDLS A IQGNFEEK PTILLPNQS DISHLALDIGGSLIKLVYFSRH+ +   DKR
Sbjct  48    RPQLDLSKAEIQGNFEEKYPTILLPNQSHDISHLALDIGGSLIKLVYFSRHQDQSTYDKR  107

Query  435   krkvkerFGVS-NGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSS  611
              + VK R G   NGNRRSYPILGGRLHFVKFET+K+NECLDFISSKQLH  G    R+S 
Sbjct  108   VKNVKNRLGFPPNGNRRSYPILGGRLHFVKFETSKINECLDFISSKQLHSAGGGESRYS-  166

Query  612   EAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHI  791
             +A  + N IIKATGGGA+KFADLFKERLG+S++KEDEM+CLVAGANFLLKAIRHEAFTH+
Sbjct  167   DARTDSNAIIKATGGGAHKFADLFKERLGLSLDKEDEMSCLVAGANFLLKAIRHEAFTHM  226

Query  792   EGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKC  971
             EG KEFVQID NDLFPYLLVNIGSGVSMIKVDGDGK++RVSGTNVGGGTYWGLGRLLTKC
Sbjct  227   EGQKEFVQIDTNDLFPYLLVNIGSGVSMIKVDGDGKYERVSGTNVGGGTYWGLGRLLTKC  286

Query  972   KSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRP  1151
             +SFD+LLELSQ+GDN   DMLVGDI+GGMDYSKIGLSASTIASSFGKA SE K LEDYRP
Sbjct  287   ESFDELLELSQKGDNSNTDMLVGDIHGGMDYSKIGLSASTIASSFGKATSEKKGLEDYRP  346

Query  1152  EDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEA  1331
             EDISLSLLRMISYNI QI+YLNALR+GLKRIFFGGFFIRGHAYTMD ISFA++FWS G A
Sbjct  347   EDISLSLLRMISYNIAQIAYLNALRFGLKRIFFGGFFIRGHAYTMDAISFAIHFWSNGAA  406

Query  1332  EAMFLRHEGFLGALGAFMSYEKHGLD  1409
             +AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  407   QAMFLRHEGFLGALGAFMSYEKHGLD  432



>ref|XP_006600639.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Glycine max]
Length=902

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/386 (84%), Positives = 348/386 (90%), Gaps = 2/386 (1%)
 Frame = +3

Query  255   RPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkr  434
             RPQLDLS A IQGNFEEK PTILLPNQS DISHLALDIGGSLIKLVYFSRH+ +   DKR
Sbjct  48    RPQLDLSKAEIQGNFEEKYPTILLPNQSHDISHLALDIGGSLIKLVYFSRHQDQSTYDKR  107

Query  435   krkvkerFGVS-NGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSS  611
              + VK R G   NGNRRSYPILGGRLHFVKFET+K+NECLDFISSKQLH  G    R+S 
Sbjct  108   VKNVKNRLGFPPNGNRRSYPILGGRLHFVKFETSKINECLDFISSKQLHSAGGGESRYS-  166

Query  612   EAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHI  791
             +A  + N IIKATGGGA+KFADLFKERLG+S++KEDEM+CLVAGANFLLKAIRHEAFTH+
Sbjct  167   DARTDSNAIIKATGGGAHKFADLFKERLGLSLDKEDEMSCLVAGANFLLKAIRHEAFTHM  226

Query  792   EGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKC  971
             EG KEFVQID NDLFPYLLVNIGSGVSMIKVDGDGK++RVSGTNVGGGTYWGLGRLLTKC
Sbjct  227   EGQKEFVQIDTNDLFPYLLVNIGSGVSMIKVDGDGKYERVSGTNVGGGTYWGLGRLLTKC  286

Query  972   KSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRP  1151
             +SFD+LLELSQ+GDN   DMLVGDIYGGMDYSKIGLSASTIASSFGKA SE K LEDYRP
Sbjct  287   ESFDELLELSQKGDNSNTDMLVGDIYGGMDYSKIGLSASTIASSFGKATSEKKGLEDYRP  346

Query  1152  EDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEA  1331
             EDISLSLLRMISYNI QI+YLNALR+GLKRIFFGGFFIRGHAYTMD ISFA++FWS G A
Sbjct  347   EDISLSLLRMISYNIAQIAYLNALRFGLKRIFFGGFFIRGHAYTMDAISFAIHFWSNGAA  406

Query  1332  EAMFLRHEGFLGALGAFMSYEKHGLD  1409
             +AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  407   QAMFLRHEGFLGALGAFMSYEKHGLD  432



>ref|XP_006600640.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Glycine max]
Length=901

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/386 (84%), Positives = 350/386 (91%), Gaps = 3/386 (1%)
 Frame = +3

Query  255   RPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkr  434
             RPQLDLS A IQGNFEEK PTILLPNQS DISHLALDIGGSLIKLVYFSRH+ +   DKR
Sbjct  48    RPQLDLSKAEIQGNFEEKYPTILLPNQSHDISHLALDIGGSLIKLVYFSRHQDQSTYDKR  107

Query  435   krkvkerFGVS-NGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSS  611
              + VK R G   NGNRRSYPILGGRLHFVKFET+K+NECLDFISSKQLH  G ++ R+S 
Sbjct  108   VKNVKNRLGFPPNGNRRSYPILGGRLHFVKFETSKINECLDFISSKQLHSAGGES-RYS-  165

Query  612   EAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHI  791
             +A  + N IIKATGGGA+KFADLFKERLG+S++KEDEM+CLVAGANFLLKAIRHEAFTH+
Sbjct  166   DARTDSNAIIKATGGGAHKFADLFKERLGLSLDKEDEMSCLVAGANFLLKAIRHEAFTHM  225

Query  792   EGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKC  971
             EG KEFVQID NDLFPYLLVNIGSGVSMIKVDGDGK++RVSGTNVGGGTYWGLGRLLTKC
Sbjct  226   EGQKEFVQIDTNDLFPYLLVNIGSGVSMIKVDGDGKYERVSGTNVGGGTYWGLGRLLTKC  285

Query  972   KSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRP  1151
             +SFD+LLELSQ+GDN   DMLVGDIYGGMDYSKIGLSASTIASSFGKA SE K LEDYRP
Sbjct  286   ESFDELLELSQKGDNSNTDMLVGDIYGGMDYSKIGLSASTIASSFGKATSEKKGLEDYRP  345

Query  1152  EDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEA  1331
             EDISLSLLRMISYNI QI+YLNALR+GLKRIFFGGFFIRGHAYTMD ISFA++FWS G A
Sbjct  346   EDISLSLLRMISYNIAQIAYLNALRFGLKRIFFGGFFIRGHAYTMDAISFAIHFWSNGAA  405

Query  1332  EAMFLRHEGFLGALGAFMSYEKHGLD  1409
             +AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  406   QAMFLRHEGFLGALGAFMSYEKHGLD  431



>gb|EMS60500.1| Pantothenate kinase 2 [Triticum urartu]
Length=828

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/384 (84%), Positives = 347/384 (90%), Gaps = 8/384 (2%)
 Frame = +3

Query  258   PQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrk  437
             P LDLSGAAI G  E+++PTILLPNQSDDISHLALDIGGSLIKLVYFSRH  +  EDKRK
Sbjct  33    PVLDLSGAAIHGTLEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHADQPTEDKRK  92

Query  438   rkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEA  617
                K R  +  G RRSYP+LGGRLHFVKFET K+NECLDFISSKQLH GG+D+P W S A
Sbjct  93    LSTKRRLEIFTGARRSYPVLGGRLHFVKFETGKLNECLDFISSKQLHRGGVDSPSWRSGA  152

Query  618   PQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEG  797
              Q +N +IKATGGGA+K+ADLFKERLGVS+EKEDEM+CLVAGANFLLKAIRHEAFTH++G
Sbjct  153   -QPDNIVIKATGGGAFKYADLFKERLGVSLEKEDEMDCLVAGANFLLKAIRHEAFTHMDG  211

Query  798   HKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKS  977
              KE+VQIDQNDLFPYLLVN+GSGVS+IKVDG GKFQRVSGTNVGGGTYWGLG       S
Sbjct  212   QKEYVQIDQNDLFPYLLVNVGSGVSIIKVDGHGKFQRVSGTNVGGGTYWGLG-------S  264

Query  978   FDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPED  1157
             FD+LLELSQRGDN TIDMLVGDIYGG+DYSKIGLSASTIASSFGK IS+NKEL DYRPED
Sbjct  265   FDELLELSQRGDNSTIDMLVGDIYGGLDYSKIGLSASTIASSFGKTISDNKELSDYRPED  324

Query  1158  ISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEA  1337
             ISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAV+FWSKGEA+A
Sbjct  325   ISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEAKA  384

Query  1338  MFLRHEGFLGALGAFMSYEKHGLD  1409
             MFLRHEGFLGALGAFMSYEKHGLD
Sbjct  385   MFLRHEGFLGALGAFMSYEKHGLD  408



>gb|KDO69623.1| hypothetical protein CISIN_1g042742mg [Citrus sinensis]
Length=834

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/391 (83%), Positives = 343/391 (88%), Gaps = 30/391 (8%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             MHRS SRPQLDLS AAIQGNFE K+PTILLPNQSDDISHLALDIGGSLIKLVYFSRHE +
Sbjct  4     MHRSGSRPQLDLSKAAIQGNFEVKNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEDQ  63

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
              ++DKRK+ +KER G+SNGNRRSYPILGGRLHFVKFETTK++ECLDFI SKQLH GG   
Sbjct  64    SIDDKRKKTIKERLGISNGNRRSYPILGGRLHFVKFETTKISECLDFIHSKQLHRGG---  120

Query  597   PRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHE  776
                           I ATGGGAYKFADLFKERLGVS++KEDEM+CLVAGANFLLKAIRHE
Sbjct  121   --------------IHATGGGAYKFADLFKERLGVSLDKEDEMDCLVAGANFLLKAIRHE  166

Query  777   AFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             AFTH+EG KEFVQID NDLFPYLLVNIGSGVSMIKVDGDGKF+RVSGTNVGGGTYWGLGR
Sbjct  167   AFTHMEGQKEFVQIDTNDLFPYLLVNIGSGVSMIKVDGDGKFERVSGTNVGGGTYWGLGR  226

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL  1136
             LLTKCKSFD+LLELSQRGDNR             D+  IGLSASTIASSFGK IS+ KEL
Sbjct  227   LLTKCKSFDELLELSQRGDNR-------------DHRHIGLSASTIASSFGKTISDKKEL  273

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
              DYRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV FW
Sbjct  274   ADYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVQFW  333

Query  1317  SKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             SKGEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  334   SKGEAQAMFLRHEGFLGALGAFMSYEKHGLD  364



>ref|XP_007155432.1| hypothetical protein PHAVU_003G200700g [Phaseolus vulgaris]
 gb|ESW27426.1| hypothetical protein PHAVU_003G200700g [Phaseolus vulgaris]
Length=867

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/394 (81%), Positives = 351/394 (89%), Gaps = 4/394 (1%)
 Frame = +3

Query  231   SPMHRSTSRPQL-DLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRH  407
             S MH S+SRPQL DLS A IQGN EEK P+ILLPNQS DIS+LALDIGGSLIKL+YFSRH
Sbjct  7     SSMHGSSSRPQLLDLSKAEIQGNVEEKYPSILLPNQSHDISYLALDIGGSLIKLMYFSRH  66

Query  408   EGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGG  587
             + +   DKR R VK R G  + NRRSYPILGGRLHFVKFET K+NECLDFI SK+LH GG
Sbjct  67    QDQSTNDKRMRNVKNRLGFPS-NRRSYPILGGRLHFVKFETGKINECLDFIYSKRLHFGG  125

Query  588   LDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAI  767
              ++ R+S +     N IIKATGGGA+KFADLFKERLG+ ++KEDEM+CLVAGANFLLKAI
Sbjct  126   GES-RYS-DGSTELNAIIKATGGGAHKFADLFKERLGLILDKEDEMSCLVAGANFLLKAI  183

Query  768   RHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWG  947
             RHEAFTH+EG KEFVQID NDLFPYLLVNIGSGVSMIKVDGDGKF+R+SGTNVGGGTYWG
Sbjct  184   RHEAFTHMEGQKEFVQIDHNDLFPYLLVNIGSGVSMIKVDGDGKFERISGTNVGGGTYWG  243

Query  948   LGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISEN  1127
             LGRLLTKC+SFD+LLELSQ+GDNR  DMLVGDIYGGMDY+KIGLSASTIASSFGKA SE 
Sbjct  244   LGRLLTKCESFDELLELSQKGDNRNTDMLVGDIYGGMDYAKIGLSASTIASSFGKATSEK  303

Query  1128  KELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAV  1307
             K LEDYRPEDISLSLLRMISYNI QI+YLNALR+GLKRIFFGGFFIRGHAYTMD ISFA+
Sbjct  304   KGLEDYRPEDISLSLLRMISYNIAQIAYLNALRFGLKRIFFGGFFIRGHAYTMDAISFAI  363

Query  1308  NFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             +FWS G A+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  364   HFWSNGAAQAMFLRHEGFLGALGAFMSYEKHGLD  397



>gb|ACN39905.1| unknown [Picea sitchensis]
Length=895

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/390 (78%), Positives = 343/390 (88%), Gaps = 3/390 (1%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             + RS+SRPQLD+SGAAIQGN E+++PTILLPNQ+DDISH A+D+GGSLIKLVYFSRH G 
Sbjct  36    VKRSSSRPQLDVSGAAIQGNSEDRNPTILLPNQTDDISHFAVDLGGSLIKLVYFSRH-GE  94

Query  417   qvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDT  596
                      V+ R  +   NR S PILGGRLHFVKFET+K+++CLDFI SK  H  G + 
Sbjct  95    LPAGHGGSVVRRRKEMIERNRSS-PILGGRLHFVKFETSKLSDCLDFIHSKNFH-RGQNL  152

Query  597   PRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHE  776
               W        NTIIKATGGGAYKFAD+FKE+LGV+++KEDEM+CLVAGANFLLKAIRHE
Sbjct  153   NAWDCGESDTRNTIIKATGGGAYKFADVFKEKLGVTLDKEDEMDCLVAGANFLLKAIRHE  212

Query  777   AFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             AFTH+EGHKEFVQIDQ DLFPYLL N+GSGVSMIKVDGDG+FQRVSGTNVGGGT+WGLGR
Sbjct  213   AFTHLEGHKEFVQIDQIDLFPYLLCNVGSGVSMIKVDGDGQFQRVSGTNVGGGTFWGLGR  272

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL  1136
             LLTKCKSFD++LELSQ GDNR++DMLVGDIYGG+DYSKIGLSASTIASSFGK ++ENK+L
Sbjct  273   LLTKCKSFDEILELSQGGDNRSVDMLVGDIYGGLDYSKIGLSASTIASSFGKVVTENKDL  332

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
              DYR ED++LSLLRMISYNIGQI+YLNALRYGLKRIFFGGFFIRGHAYTMDTISFAV FW
Sbjct  333   SDYRQEDLALSLLRMISYNIGQIAYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAVKFW  392

Query  1317  SKGEAEAMFLRHEGFLGALGAFMSYEKHGL  1406
             SKG A+AMFLRHEGFLGALGAFMSY+KHGL
Sbjct  393   SKGAAQAMFLRHEGFLGALGAFMSYDKHGL  422



>gb|ERN02412.1| hypothetical protein AMTR_s00096p00126400 [Amborella trichopoda]
Length=516

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/400 (73%), Positives = 341/400 (85%), Gaps = 4/400 (1%)
 Frame = +3

Query  210   VEKEKEI----SPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGS  377
             +E+E E+    + M RS SRPQLDLSGAAIQGNFEE+ PTILLPNQ DDIS +ALDIGGS
Sbjct  27    LEREGEMVLAAASMRRSGSRPQLDLSGAAIQGNFEERSPTILLPNQFDDISRMALDIGGS  86

Query  378   LIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDF  557
             LIKLVYFSRHE    +DK+   +K++    NG+  SYP  GG+LHFVKFET K+NECL+F
Sbjct  87    LIKLVYFSRHEESSTKDKKNGHLKKKQEAPNGSAWSYPTRGGQLHFVKFETRKLNECLEF  146

Query  558   ISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLV  737
             I  KQLH  G D   W      +EN IIKATGGGAYKFA++FK+ LG ++EKEDEM+CLV
Sbjct  147   IRCKQLHSSGEDLHSWKFGGLPDENAIIKATGGGAYKFAEVFKDTLGFTVEKEDEMDCLV  206

Query  738   AGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSG  917
             AGANFLLK IR+EAFT+++G KEFVQIDQNDLFPYLLVNIGSGVS+IKVDGDG FQRVSG
Sbjct  207   AGANFLLKTIRYEAFTYMKGRKEFVQIDQNDLFPYLLVNIGSGVSVIKVDGDGSFQRVSG  266

Query  918   TNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIA  1097
             TNVGGGT+WGLG+LLTKCKSFD+LLELSQRG+N  +DMLVGDIYGGMDYSKIGLS+STIA
Sbjct  267   TNVGGGTFWGLGKLLTKCKSFDELLELSQRGNNTAVDMLVGDIYGGMDYSKIGLSSSTIA  326

Query  1098  SSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHA  1277
             SSFGK ISENK+L DY+PEDI+LSLLRM+SYNI QI+Y NAL YGLKR+ FGGFFIRGHA
Sbjct  327   SSFGKTISENKDLLDYKPEDIALSLLRMVSYNIAQIAYYNALLYGLKRVLFGGFFIRGHA  386

Query  1278  YTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEK  1397
             +TM+TIS  V+ WSKG+A+A+FLRHEG+LGALGA +SY+K
Sbjct  387   FTMETISVGVHSWSKGQAQALFLRHEGYLGALGALLSYDK  426



>ref|XP_006840737.2| PREDICTED: pantothenate kinase 2 isoform X1 [Amborella trichopoda]
Length=524

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/401 (74%), Positives = 340/401 (85%), Gaps = 1/401 (0%)
 Frame = +3

Query  195   LERGGVEKEKEISPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGG  374
             LER G E     + M RS SRPQLDLSGAAIQGNFEE+ PTILLPNQ DDIS +ALDIGG
Sbjct  35    LEREG-EMVLAAASMRRSGSRPQLDLSGAAIQGNFEERSPTILLPNQFDDISRMALDIGG  93

Query  375   SLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLD  554
             SLIKLVYFSRHE    +DK+   +K++    NG+  SYP  GG+LHFVKFET K+NECL+
Sbjct  94    SLIKLVYFSRHEESSTKDKKNGHLKKKQEAPNGSAWSYPTRGGQLHFVKFETRKLNECLE  153

Query  555   FISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCL  734
             FI  KQLH  G D   W      +EN IIKATGGGAYKFA++FK+ LG ++EKEDEM+CL
Sbjct  154   FIRCKQLHSSGEDLHSWKFGGLPDENAIIKATGGGAYKFAEVFKDTLGFTVEKEDEMDCL  213

Query  735   VAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVS  914
             VAGANFLLK IR+EAFT+++G KEFVQIDQNDLFPYLLVNIGSGVS+IKVDGDG FQRVS
Sbjct  214   VAGANFLLKTIRYEAFTYMKGRKEFVQIDQNDLFPYLLVNIGSGVSVIKVDGDGSFQRVS  273

Query  915   GTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTI  1094
             GTNVGGGT+WGLG+LLTKCKSFD+LLELSQRG+N  +DMLVGDIYGGMDYSKIGLS+STI
Sbjct  274   GTNVGGGTFWGLGKLLTKCKSFDELLELSQRGNNTAVDMLVGDIYGGMDYSKIGLSSSTI  333

Query  1095  ASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgH  1274
             ASSFGK ISENK+L DY+PEDI+LSLLRM+SYNI QI+Y NAL YGLKR+ FGGFFIRGH
Sbjct  334   ASSFGKTISENKDLLDYKPEDIALSLLRMVSYNIAQIAYYNALLYGLKRVLFGGFFIRGH  393

Query  1275  AYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEK  1397
             A+TM+TIS  V+ WSKG+A+A+FLRHEG+LGALGA +SY+K
Sbjct  394   AFTMETISVGVHSWSKGQAQALFLRHEGYLGALGALLSYDK  434



>ref|XP_011622019.1| PREDICTED: pantothenate kinase 2 isoform X2 [Amborella trichopoda]
Length=523

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/401 (74%), Positives = 340/401 (85%), Gaps = 1/401 (0%)
 Frame = +3

Query  195   LERGGVEKEKEISPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGG  374
             LER G E     + M RS SRPQLDLSGAAIQGNFEE+ PTILLPNQ DDIS +ALDIGG
Sbjct  35    LEREG-EMVLAAASMRRSGSRPQLDLSGAAIQGNFEERSPTILLPNQFDDISRMALDIGG  93

Query  375   SLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLD  554
             SLIKLVYFSRHE    +DK+   +K++    NG+  SYP  GG+LHFVKFET K+NECL+
Sbjct  94    SLIKLVYFSRHEESSTKDKKNGHLKKKQEAPNGSAWSYPTRGGQLHFVKFETRKLNECLE  153

Query  555   FISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCL  734
             FI  KQLH  G D   W      +EN IIKATGGGAYKFA++FK+ LG ++EKEDEM+CL
Sbjct  154   FIRCKQLHSSGEDLHSWKFGGLPDENAIIKATGGGAYKFAEVFKDTLGFTVEKEDEMDCL  213

Query  735   VAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVS  914
             VAGANFLLK IR+EAFT+++G KEFVQIDQNDLFPYLLVNIGSGVS+IKVDGDG FQRVS
Sbjct  214   VAGANFLLKTIRYEAFTYMKGRKEFVQIDQNDLFPYLLVNIGSGVSVIKVDGDGSFQRVS  273

Query  915   GTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTI  1094
             GTNVGGGT+WGLG+LLTKCKSFD+LLELSQRG+N  +DMLVGDIYGGMDYSKIGLS+STI
Sbjct  274   GTNVGGGTFWGLGKLLTKCKSFDELLELSQRGNNTAVDMLVGDIYGGMDYSKIGLSSSTI  333

Query  1095  ASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgH  1274
             ASSFGK ISENK+L DY+PEDI+LSLLRM+SYNI QI+Y NAL YGLKR+ FGGFFIRGH
Sbjct  334   ASSFGKTISENKDLLDYKPEDIALSLLRMVSYNIAQIAYYNALLYGLKRVLFGGFFIRGH  393

Query  1275  AYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEK  1397
             A+TM+TIS  V+ WSKG+A+A+FLRHEG+LGALGA +SY+K
Sbjct  394   AFTMETISVGVHSWSKGQAQALFLRHEGYLGALGALLSYDK  434



>ref|XP_001757682.1| predicted protein [Physcomitrella patens]
 gb|EDQ77322.1| predicted protein [Physcomitrella patens]
Length=884

 Score =   540 bits (1392),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 285/403 (71%), Positives = 335/403 (83%), Gaps = 21/403 (5%)
 Frame = +3

Query  234   PMHRSTS--RPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSR-  404
             P+   TS  RP LDLSGAAIQG+ E+K+P+I+LPNQS++ISH A+D+GGSLIKLVYFSR 
Sbjct  14    PVSSRTSPIRPLLDLSGAAIQGSREDKNPSIVLPNQSEEISHFAVDLGGSLIKLVYFSRR  73

Query  405   ------HEGrqvedkrkrkvkerFGVSNGNRRSY---PILGGRLHFVKFETTKVNECLDF  557
                   + G +     ++    + G      R Y   PILGGRLHFVKFET+KVN+CLDF
Sbjct  74    ADRETTNSGNRALSPVRKLDHLKRGGFEAELRRYGGFPILGGRLHFVKFETSKVNDCLDF  133

Query  558   ISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLV  737
             I SK+LH           +A   ++ +IKATGGGA+KFAD+FKERLG +I+KEDEM CLV
Sbjct  134   IQSKRLHL---------CKAGGAKDGVIKATGGGAFKFADMFKERLGATIDKEDEMGCLV  184

Query  738   AGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSG  917
             AGANFLL+AIR EAFTH+EG K+FVQID NDL+PYLLVNIGSGVSMIKVDGDG+++RVSG
Sbjct  185   AGANFLLRAIRDEAFTHLEGEKKFVQIDHNDLYPYLLVNIGSGVSMIKVDGDGQYERVSG  244

Query  918   TNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIA  1097
             TNVGGGT+WGLGRLLTK KSFD+LLE+SQ GDN  IDMLVGDIYGG+DYSKIGLSASTIA
Sbjct  245   TNVGGGTFWGLGRLLTKSKSFDELLEISQGGDNSAIDMLVGDIYGGLDYSKIGLSASTIA  304

Query  1098  SSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHA  1277
             SSFGK I ++K L +YR EDI+LSLLRMISYNIGQ++YLNALRYGLKRIFFGGFFIRGHA
Sbjct  305   SSFGKVIGQDKPLSEYRREDIALSLLRMISYNIGQVAYLNALRYGLKRIFFGGFFIRGHA  364

Query  1278  YTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGL  1406
             YTMDT+SFA+ +WSKGEA+AMFLRHEGFLGALGAF++Y+KHGL
Sbjct  365   YTMDTMSFAIRYWSKGEAQAMFLRHEGFLGALGAFLNYDKHGL  407



>ref|XP_010651426.1| PREDICTED: pantothenate kinase 1 [Vitis vinifera]
 emb|CBI28545.3| unnamed protein product [Vitis vinifera]
Length=419

 Score =   520 bits (1338),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 281/379 (74%), Positives = 321/379 (85%), Gaps = 10/379 (3%)
 Frame = +3

Query  279   AAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvk--e  452
             + I+ N E+     L P   D+ISHLALDIGG+LIKLVYFSR++   V+DK  +  K   
Sbjct  6     SGIERNSEDGGSKALAP---DEISHLALDIGGTLIKLVYFSRNDSWSVDDKGAKSPKGDS  62

Query  453   rFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNEN  632
                VS  N   YPIL GR+HF KFET KVNECL+FI SK+L  GG     W  EAP ++ 
Sbjct  63    PLRVSCSNL-DYPILYGRIHFAKFETIKVNECLEFIRSKKLLHGGC----WHHEAPVSDK  117

Query  633   TIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFV  812
              +IKATGGGAYKFADLFKE LG++++KEDEM+CLV+GANFLLKA+ HEAFT+++G KEFV
Sbjct  118   NVIKATGGGAYKFADLFKENLGLNLDKEDEMDCLVSGANFLLKAVHHEAFTYMDGQKEFV  177

Query  813   QIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLL  992
             QID NDL+PYLLVNIGSGVSM+KVDGDGKF+RVSGTNVGGGT+WGLGRLLTKCKSFD+LL
Sbjct  178   QIDHNDLYPYLLVNIGSGVSMLKVDGDGKFERVSGTNVGGGTFWGLGRLLTKCKSFDELL  237

Query  993   ELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSL  1172
             ELS +G+NR IDMLVGDIYGGMDYSK GL+++TIASSFGKAISENKELEDYRPED++ SL
Sbjct  238   ELSHQGNNRVIDMLVGDIYGGMDYSKFGLASTTIASSFGKAISENKELEDYRPEDVARSL  297

Query  1173  LRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRH  1352
             LRMIS NIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTIS AVNFWSKGEA+AMFLRH
Sbjct  298   LRMISNNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISVAVNFWSKGEAKAMFLRH  357

Query  1353  EGFLGALGAFMSYEKHGLD  1409
             EGFLGALGAFMSYEK+  D
Sbjct  358   EGFLGALGAFMSYEKNNYD  376



>gb|KHN34316.1| Pantothenate kinase 2 [Glycine soja]
Length=325

 Score =   513 bits (1322),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 264/327 (81%), Positives = 287/327 (88%), Gaps = 5/327 (2%)
 Frame = +3

Query  237   MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
             MHRS+SRPQLDLS A IQGNFEEK PTILLPNQS DISHLALDIGGSLIKLVYFSRH  +
Sbjct  1     MHRSSSRPQLDLSKAEIQGNFEEKYPTILLPNQSHDISHLALDIGGSLIKLVYFSRHRDQ  60

Query  417   qvedkrkrkvkerFGVS-NGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLD  593
                DKR   V  R G   NGNRRSYPILGGRLHFVKFET+K+NECLDFI+SKQLHCG  +
Sbjct  61    STYDKRMINVNNRLGFPPNGNRRSYPILGGRLHFVKFETSKINECLDFINSKQLHCGEGE  120

Query  594   TPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRH  773
             + R+S +A  + N IIKATGGGA+KFADLFKERLG+S++KEDEMNCLVAGANFLLKAIR 
Sbjct  121   S-RYS-DATTDSNAIIKATGGGAHKFADLFKERLGLSLDKEDEMNCLVAGANFLLKAIRR  178

Query  774   EAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLG  953
             EAFTH+EG KEFVQID NDLFPYLLVNIGSGVSMIKVDGDGK++RV+GTNVGGGTYWGLG
Sbjct  179   EAFTHMEGQKEFVQIDTNDLFPYLLVNIGSGVSMIKVDGDGKYERVNGTNVGGGTYWGLG  238

Query  954   RLLTKCKS--FDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISEN  1127
             RLLTKC+S  FD+LLELSQ+GDN   DMLVGDIYGGMDYSK GLSASTIASSFGK  SE 
Sbjct  239   RLLTKCESSNFDELLELSQKGDNSNTDMLVGDIYGGMDYSKTGLSASTIASSFGKVTSEK  298

Query  1128  KELEDYRPEDISLSLLRMISYNIGQIS  1208
             K L+DYRPEDISLSLLRMISYNI Q+S
Sbjct  299   KGLDDYRPEDISLSLLRMISYNIAQVS  325



>ref|XP_007044671.1| Pantothenate kinase 2 [Theobroma cacao]
 gb|EOY00503.1| Pantothenate kinase 2 [Theobroma cacao]
Length=412

 Score =   511 bits (1315),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 266/355 (75%), Positives = 307/355 (86%), Gaps = 5/355 (1%)
 Frame = +3

Query  345   ISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKF  524
             ISHLALDIGGSLIKLVYFSR+   + +D +++   E  GVS  +  S P+L GRLHF KF
Sbjct  19    ISHLALDIGGSLIKLVYFSRNNDSRRDDDQQKSRNESLGVSQSDT-SQPVLEGRLHFAKF  77

Query  525   ETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVS  704
             ET+K+N+CL+FI SK+L  GG         AP ++   IKATGGGAYKFADLFKE+L +S
Sbjct  78    ETSKINDCLEFIRSKKLLLGGFH----DHTAPSSDKIFIKATGGGAYKFADLFKEKLEIS  133

Query  705   IEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKV  884
             ++KEDEM+CLV GANFLLKA+  EAFT+++G KEFVQID NDL+PYLLVNIGSGVSMIKV
Sbjct  134   LDKEDEMDCLVTGANFLLKAVHQEAFTYLDGQKEFVQIDHNDLYPYLLVNIGSGVSMIKV  193

Query  885   DGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDY  1064
             DGDGKF+RVSGTN+GGGT+WGLGRLLTKCK+FD+LLELS +G+NR IDMLVGDIYGG DY
Sbjct  194   DGDGKFERVSGTNLGGGTFWGLGRLLTKCKNFDELLELSHQGNNRVIDMLVGDIYGGTDY  253

Query  1065  SKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKri  1244
             +K+GLSA+TIASSFGKAIS+NKELE+Y+PEDIS SLLRMIS NIGQISYLNALR+GLKRI
Sbjct  254   AKVGLSATTIASSFGKAISDNKELEEYKPEDISRSLLRMISNNIGQISYLNALRFGLKRI  313

Query  1245  ffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             FF GFFIRGHAYTMDTIS AV+FWSKGEA+AMFLRHEGFLGALGAFMSYEK  LD
Sbjct  314   FFAGFFIRGHAYTMDTISVAVHFWSKGEAKAMFLRHEGFLGALGAFMSYEKQSLD  368



>ref|XP_012085397.1| PREDICTED: pantothenate kinase 1 [Jatropha curcas]
 gb|KDP26598.1| hypothetical protein JCGZ_17756 [Jatropha curcas]
Length=412

 Score =   510 bits (1314),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 265/362 (73%), Positives = 311/362 (86%), Gaps = 6/362 (2%)
 Frame = +3

Query  327   PNQS-DDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGG  503
             P+QS   ISHLALDIGGSLIK+VYFSR+    V+ K +    +  GV NGNR+ + +L G
Sbjct  14    PSQSLGQISHLALDIGGSLIKVVYFSRNRDSSVDHKGESSSNDNPGVFNGNRK-HTVLKG  72

Query  504   RLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLF  683
             +LHF KFET+K+N+CL+FISSK+ H GG        E P  +   IKATGGGAYKFA+LF
Sbjct  73    KLHFAKFETSKINDCLEFISSKKHHLGGFQ----HHENPAKDKKFIKATGGGAYKFAELF  128

Query  684   KERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGS  863
             KE+LG+ ++KEDEM+CLVAGANFLLKA+  E +T+++GHKEF+QID NDL+PYLLVNIGS
Sbjct  129   KEKLGIGLDKEDEMDCLVAGANFLLKAVPREVYTYVDGHKEFLQIDHNDLYPYLLVNIGS  188

Query  864   GVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGD  1043
             GVSMIKVDGDGKF+RVSGTNVGGGT+WGLGRLLT+CKSFD+LLELS RG+NR IDMLVGD
Sbjct  189   GVSMIKVDGDGKFERVSGTNVGGGTFWGLGRLLTRCKSFDELLELSHRGNNRVIDMLVGD  248

Query  1044  IYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNAL  1223
             IYGG DYSKIGLS++TIASSFGKAIS+NKE++DY+PED++ SLLRMIS NIGQISYLNAL
Sbjct  249   IYGGTDYSKIGLSSTTIASSFGKAISDNKEIDDYKPEDVARSLLRMISNNIGQISYLNAL  308

Query  1224  RYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHG  1403
             R+GLKRIFFGGFFI+GH YTMDTIS AV+FWSKGEA+AMFLRHEGFLG LGAFMSY KH 
Sbjct  309   RFGLKRIFFGGFFIQGHPYTMDTISVAVHFWSKGEAKAMFLRHEGFLGVLGAFMSYAKHS  368

Query  1404  LD  1409
             LD
Sbjct  369   LD  370



>gb|KJB50223.1| hypothetical protein B456_008G159500 [Gossypium raimondii]
Length=412

 Score =   509 bits (1310),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 267/355 (75%), Positives = 301/355 (85%), Gaps = 6/355 (2%)
 Frame = +3

Query  345   ISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKF  524
             ISHLALDIGGSLIKLVYF R++    +D   R   E  G  + N R  P+LGG+LHF KF
Sbjct  19    ISHLALDIGGSLIKLVYFCRYDDSCRDDDELRSQNESLGSKSDNSR--PVLGGKLHFAKF  76

Query  525   ETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVS  704
             ET+K+N+CL+FI S +LH GG         AP ++   IKATGGGAYKFADLFKE+L VS
Sbjct  77    ETSKINDCLEFIHSMKLHLGGFH----DCTAPSSDKIFIKATGGGAYKFADLFKEKLSVS  132

Query  705   IEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKV  884
             ++KEDEM CLV GANFLLKA+  EAFT+++G KEF QID NDL+PYLLVNIGSGVSMIKV
Sbjct  133   LDKEDEMECLVTGANFLLKAVHQEAFTYLDGQKEFAQIDPNDLYPYLLVNIGSGVSMIKV  192

Query  885   DGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDY  1064
             DGDGKF+RVSGT++GGGT+WGLGRLLTKCK+FD+LLELS +G+NR IDMLVGDIYGG DY
Sbjct  193   DGDGKFERVSGTSLGGGTFWGLGRLLTKCKNFDELLELSHQGNNRVIDMLVGDIYGGTDY  252

Query  1065  SKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKri  1244
             +KIGLSA+TIASSFGKAIS+NKEL DY+PEDIS SLLRMIS NIGQISYLNALR+GLKRI
Sbjct  253   AKIGLSATTIASSFGKAISDNKELVDYKPEDISRSLLRMISNNIGQISYLNALRFGLKRI  312

Query  1245  ffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             FF GFFIRGHAYTMDTIS AVNFWSKGEAEAMFLRHEGFLGALGAFMSYEK  LD
Sbjct  313   FFAGFFIRGHAYTMDTISVAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKQCLD  367



>gb|KHG03138.1| hypothetical protein F383_26744 [Gossypium arboreum]
Length=410

 Score =   508 bits (1309),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 267/355 (75%), Positives = 301/355 (85%), Gaps = 6/355 (2%)
 Frame = +3

Query  345   ISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKF  524
             ISHLALDIGGSLIKLVYF R++    +D   R   E  G  + N R  P+LGG+LHF KF
Sbjct  19    ISHLALDIGGSLIKLVYFCRYDDNCRDDDELRSQNESLGSESDNSR--PVLGGKLHFAKF  76

Query  525   ETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVS  704
             ET+K+N+CL+FI S +LH GG         AP ++   IKATGGGAYKFADLFKE+LGVS
Sbjct  77    ETSKINDCLEFIHSMKLHLGGFH----DCTAPSSDKIFIKATGGGAYKFADLFKEKLGVS  132

Query  705   IEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKV  884
             ++KEDEM CLV GANFLLKA+  EAFT+++G KEF QID NDL+PYLLVNIGSGVSMIKV
Sbjct  133   LDKEDEMECLVTGANFLLKAVHQEAFTYLDGQKEFAQIDPNDLYPYLLVNIGSGVSMIKV  192

Query  885   DGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDY  1064
             DGDGKF+RVSGT++GGGT+WGLGRLLTKCK+FD+LLELS +G+NR IDMLVGDIYGG DY
Sbjct  193   DGDGKFERVSGTSLGGGTFWGLGRLLTKCKNFDELLELSHQGNNRVIDMLVGDIYGGTDY  252

Query  1065  SKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKri  1244
             +KIGLSA+TIASSFGKAIS+NK L DY+PEDIS SLLRMIS NIGQISYLNALR+GLKRI
Sbjct  253   AKIGLSATTIASSFGKAISDNKGLVDYKPEDISRSLLRMISNNIGQISYLNALRFGLKRI  312

Query  1245  ffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             FF GFFIRGHAYTMDTIS AVNFWSKGEAEAMFLRHEGFLGALGAFMSYEK  LD
Sbjct  313   FFAGFFIRGHAYTMDTISVAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKQCLD  367



>ref|XP_010100448.1| Pantothenate kinase 2 [Morus notabilis]
 gb|EXB82582.1| Pantothenate kinase 2 [Morus notabilis]
Length=405

 Score =   496 bits (1276),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 265/362 (73%), Positives = 307/362 (85%), Gaps = 8/362 (2%)
 Frame = +3

Query  327   PNQSDDISHLALDIGGSLIKLVYFSRHE--GrqvedkrkrkvkerFGVSNGNRRSYPILG  500
             P+Q + +SHLALDIGGSL KL YFSR+        ++ K   KE   VSNG+++  P+L 
Sbjct  6     PSQ-EHVSHLALDIGGSLTKLDYFSRNNECSNGDNNEEKSCSKESLLVSNGDKKC-PVLQ  63

Query  501   GRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADL  680
             GRLHF KFET+K+N+CL+FI   QLH GG         AP NE  IIKATGGGAYK ADL
Sbjct  64    GRLHFAKFETSKINDCLEFIQRNQLHLGGCQ----HGGAPGNEKRIIKATGGGAYKNADL  119

Query  681   FKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIG  860
             FKE+LG+ ++KEDEM+CLVAGANFLLKA+  EA+T+I+G KEFVQID++DL+PYLLVNIG
Sbjct  120   FKEKLGIFLDKEDEMDCLVAGANFLLKAVHEEAYTYIDGRKEFVQIDRDDLYPYLLVNIG  179

Query  861   SGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVG  1040
             SGVSMIKVDGDGK++RVSGTNVGGGT+WGLGRLLTKC+SFD+LLELS RG+NR IDMLVG
Sbjct  180   SGVSMIKVDGDGKYERVSGTNVGGGTFWGLGRLLTKCESFDELLELSHRGNNRVIDMLVG  239

Query  1041  DIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNA  1220
             DIYGGMDY+K GLS++TIASSFGKAIS+NKE+EDY  ED++ SLLRMIS NIGQISYLNA
Sbjct  240   DIYGGMDYTKFGLSSTTIASSFGKAISDNKEIEDYNAEDVARSLLRMISNNIGQISYLNA  299

Query  1221  LRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKH  1400
             LR+GLKRIFFGGFFIRGHAYTMDTIS  VNFWSKGEA+A+FLRHEGFLGALGAF SYEKH
Sbjct  300   LRFGLKRIFFGGFFIRGHAYTMDTISVGVNFWSKGEAKALFLRHEGFLGALGAFTSYEKH  359

Query  1401  GL  1406
             G 
Sbjct  360   GF  361



>ref|XP_007222331.1| hypothetical protein PRUPE_ppa005996mg [Prunus persica]
 gb|EMJ23530.1| hypothetical protein PRUPE_ppa005996mg [Prunus persica]
Length=433

 Score =   496 bits (1278),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 261/354 (74%), Positives = 298/354 (84%), Gaps = 10/354 (3%)
 Frame = +3

Query  345   ISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKF  524
             ISHLALDIGGSLIKLVYFS +        +         VS+GN    P+L G+LHF KF
Sbjct  46    ISHLALDIGGSLIKLVYFSTNSDSSSSSSKDSVA-----VSSGNE-GRPVLEGKLHFAKF  99

Query  525   ETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVS  704
             ET K+N+C+DFI SKQL   G         AP  E   IKATGGGAYK+ADLFKE+LG+ 
Sbjct  100   ETAKINDCIDFIRSKQLRLSGFQ----KHGAPAGERCTIKATGGGAYKYADLFKEKLGIC  155

Query  705   IEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKV  884
             ++KEDEM+CLVAG+NFLLKA+  EAFT+++G KEFVQID +DL+PY+LVNIGSGVSMIKV
Sbjct  156   LDKEDEMDCLVAGSNFLLKAVHTEAFTYMDGQKEFVQIDHDDLYPYMLVNIGSGVSMIKV  215

Query  885   DGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDY  1064
             DG GKF+RVSGTNVGGGT+WGLGRLLTKCKSFD+LLELS RG+NR IDMLVGDIYGGMDY
Sbjct  216   DGPGKFERVSGTNVGGGTFWGLGRLLTKCKSFDELLELSHRGNNRVIDMLVGDIYGGMDY  275

Query  1065  SKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKri  1244
             +KIGLS++TIASSFGKAIS+NKELEDY+PEDIS SLLRMIS NIGQISYLNALR+GLKRI
Sbjct  276   TKIGLSSTTIASSFGKAISDNKELEDYKPEDISRSLLRMISNNIGQISYLNALRFGLKRI  335

Query  1245  ffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGL  1406
             FF GFFIRGHAYTMDTI+ AV+FWSKGEA+AMFL+HEGFLGALG+FMSYEKHG 
Sbjct  336   FFAGFFIRGHAYTMDTIAVAVHFWSKGEAKAMFLKHEGFLGALGSFMSYEKHGF  389



>ref|XP_006438369.1| hypothetical protein CICLE_v10031717mg [Citrus clementina]
 ref|XP_006483869.1| PREDICTED: pantothenate kinase 1-like isoform X1 [Citrus sinensis]
 ref|XP_006483870.1| PREDICTED: pantothenate kinase 1-like isoform X2 [Citrus sinensis]
 gb|ESR51609.1| hypothetical protein CICLE_v10031717mg [Citrus clementina]
Length=403

 Score =   495 bits (1274),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 256/360 (71%), Positives = 301/360 (84%), Gaps = 17/360 (5%)
 Frame = +3

Query  330   NQSD-DISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGR  506
             N+S+  ISHLALDIGGSLIK+VYF R  G                V +  ++S P+L GR
Sbjct  15    NESESQISHLALDIGGSLIKVVYFLRSNGSGGS------------VDDSGKKSDPVLEGR  62

Query  507   LHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFK  686
             LHF KFET+K+ +CL+FI SK LH  G        +A  N+ T+IKATGGGAYKFADL K
Sbjct  63    LHFAKFETSKIIDCLEFIRSKNLHLAGFR----HHDASANDKTLIKATGGGAYKFADLIK  118

Query  687   ERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSG  866
             E+LGV ++KEDEM+CLV GANFLLKA+  EAFT+++G KEF+QIDQNDL+PYLLVNIGSG
Sbjct  119   EKLGVVLDKEDEMDCLVTGANFLLKAVHQEAFTYVDGQKEFLQIDQNDLYPYLLVNIGSG  178

Query  867   VSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDI  1046
             VSMIKVDGDGKF+R+SGT+VGGGT+WGLGRLLT CKSFD+LLELS +G+NR IDMLVGDI
Sbjct  179   VSMIKVDGDGKFERISGTSVGGGTFWGLGRLLTNCKSFDELLELSHQGNNRVIDMLVGDI  238

Query  1047  YGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALR  1226
             YGG +YSKIGL+++ IASSFGKAIS+NKEL+DY+PED++ SLLRMIS NIGQISYLNALR
Sbjct  239   YGGSEYSKIGLTSTNIASSFGKAISDNKELKDYKPEDVARSLLRMISNNIGQISYLNALR  298

Query  1227  YGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGL  1406
             +GLKRIFF GFFIRGHAYTMDTIS AV+FWSKG+A+AMFLRHEGFLGALGAF+SYE HGL
Sbjct  299   FGLKRIFFAGFFIRGHAYTMDTISVAVSFWSKGDAKAMFLRHEGFLGALGAFVSYENHGL  358



>ref|XP_002314614.1| pantothenate kinase 2 family protein [Populus trichocarpa]
 gb|EEF00785.1| pantothenate kinase 2 family protein [Populus trichocarpa]
Length=398

 Score =   494 bits (1272),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 257/354 (73%), Positives = 295/354 (83%), Gaps = 16/354 (5%)
 Frame = +3

Query  345   ISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKF  524
             IS LALDIGGSLIKLVYFSR  G   +            +SNG       + GRLHF KF
Sbjct  18    ISRLALDIGGSLIKLVYFSRDSGDHEDPLNDSVR-----ISNG-------VNGRLHFAKF  65

Query  525   ETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVS  704
             ETT +N+CL FIS+ +L  GG        E P N+ + IKATGGGAYKF+DLFKE+LG+S
Sbjct  66    ETTNINDCLQFISANKLFFGGFQ----HQENPTNDRSFIKATGGGAYKFSDLFKEKLGIS  121

Query  705   IEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKV  884
             +EKEDEM+CLV GANFLLKA+ HEAFT++ G KEFVQID NDL+PYLLVNIGSGVSMIKV
Sbjct  122   LEKEDEMDCLVTGANFLLKAVNHEAFTYLNGQKEFVQIDHNDLYPYLLVNIGSGVSMIKV  181

Query  885   DGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDY  1064
             DGDGKF+RVSGT+VGGGT+WGLG+LLTKC+SFD+LLELSQRG+NR +DMLVGDIYGGM+Y
Sbjct  182   DGDGKFERVSGTSVGGGTFWGLGKLLTKCQSFDELLELSQRGNNRVLDMLVGDIYGGMEY  241

Query  1065  SKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKri  1244
             SKIGLS++ IASSFG+AIS + EL DY+PED+S SLLRMIS NIGQISYLNALR+GLKRI
Sbjct  242   SKIGLSSTAIASSFGRAISNSNELHDYKPEDVSRSLLRMISNNIGQISYLNALRFGLKRI  301

Query  1245  ffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGL  1406
             FFGGFF RGH+YTMDTIS AV+FWSKGEA+AMFLRHEGFLGALGAFMSYE+H L
Sbjct  302   FFGGFFTRGHSYTMDTISVAVHFWSKGEAKAMFLRHEGFLGALGAFMSYERHSL  355



>ref|XP_010044613.1| PREDICTED: pantothenate kinase 1 [Eucalyptus grandis]
 gb|KCW86705.1| hypothetical protein EUGRSUZ_B03313 [Eucalyptus grandis]
Length=395

 Score =   494 bits (1271),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 263/364 (72%), Positives = 307/364 (84%), Gaps = 7/364 (2%)
 Frame = +3

Query  321   LLPNQSD-DISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPIL  497
             +LP +S   + HLA+DIGGSLIKLVY+SR+     ED +    KE  GVSNG   ++P+ 
Sbjct  1     MLPAESRAPMPHLAIDIGGSLIKLVYYSRNGDWLPEDNKIWSSKESLGVSNG-EGNHPLS  59

Query  498   GGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFAD  677
              GRLHF KFET+K+N+C++FI SKQLH GG        E P     IIKATGGGA+KF D
Sbjct  60    EGRLHFAKFETSKINDCIEFIRSKQLHVGG-----QHHEVPSKNKIIIKATGGGAFKFTD  114

Query  678   LFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNI  857
             LFKE+LG+ ++KEDEM+CLVAGANFLLKA++ EAF +++G K+FVQID  DL+PYLLVNI
Sbjct  115   LFKEKLGIVLDKEDEMDCLVAGANFLLKAVQREAFFYMDGQKQFVQIDHKDLYPYLLVNI  174

Query  858   GSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLV  1037
             GSGVSMIKVDGDGKF+RVSGT+VGGGT+WGLGRLLTKC+SFD+LLELS  G+NR IDMLV
Sbjct  175   GSGVSMIKVDGDGKFERVSGTSVGGGTFWGLGRLLTKCQSFDELLELSHVGNNRVIDMLV  234

Query  1038  GDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLN  1217
             GDIYGG DY+KIGLS++ IASSFGKAIS +KELEDY+PEDIS SLLRMIS NIGQI+YLN
Sbjct  235   GDIYGGTDYAKIGLSSTNIASSFGKAISVDKELEDYQPEDISRSLLRMISNNIGQIAYLN  294

Query  1218  ALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEK  1397
             ALRYGLKRIFFGGFFIRGHAYTMDTIS AV++WSKGEA+AMFLRHEGFLGALGAF SYE+
Sbjct  295   ALRYGLKRIFFGGFFIRGHAYTMDTISVAVHYWSKGEAQAMFLRHEGFLGALGAFASYER  354

Query  1398  HGLD  1409
             HG D
Sbjct  355   HGFD  358



>gb|KCW86704.1| hypothetical protein EUGRSUZ_B03313 [Eucalyptus grandis]
Length=387

 Score =   493 bits (1268),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 263/364 (72%), Positives = 307/364 (84%), Gaps = 7/364 (2%)
 Frame = +3

Query  321   LLPNQSD-DISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPIL  497
             +LP +S   + HLA+DIGGSLIKLVY+SR+     ED +    KE  GVSNG   ++P+ 
Sbjct  1     MLPAESRAPMPHLAIDIGGSLIKLVYYSRNGDWLPEDNKIWSSKESLGVSNG-EGNHPLS  59

Query  498   GGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFAD  677
              GRLHF KFET+K+N+C++FI SKQLH GG        E P     IIKATGGGA+KF D
Sbjct  60    EGRLHFAKFETSKINDCIEFIRSKQLHVGG-----QHHEVPSKNKIIIKATGGGAFKFTD  114

Query  678   LFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNI  857
             LFKE+LG+ ++KEDEM+CLVAGANFLLKA++ EAF +++G K+FVQID  DL+PYLLVNI
Sbjct  115   LFKEKLGIVLDKEDEMDCLVAGANFLLKAVQREAFFYMDGQKQFVQIDHKDLYPYLLVNI  174

Query  858   GSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLV  1037
             GSGVSMIKVDGDGKF+RVSGT+VGGGT+WGLGRLLTKC+SFD+LLELS  G+NR IDMLV
Sbjct  175   GSGVSMIKVDGDGKFERVSGTSVGGGTFWGLGRLLTKCQSFDELLELSHVGNNRVIDMLV  234

Query  1038  GDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLN  1217
             GDIYGG DY+KIGLS++ IASSFGKAIS +KELEDY+PEDIS SLLRMIS NIGQI+YLN
Sbjct  235   GDIYGGTDYAKIGLSSTNIASSFGKAISVDKELEDYQPEDISRSLLRMISNNIGQIAYLN  294

Query  1218  ALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEK  1397
             ALRYGLKRIFFGGFFIRGHAYTMDTIS AV++WSKGEA+AMFLRHEGFLGALGAF SYE+
Sbjct  295   ALRYGLKRIFFGGFFIRGHAYTMDTISVAVHYWSKGEAQAMFLRHEGFLGALGAFASYER  354

Query  1398  HGLD  1409
             HG D
Sbjct  355   HGFD  358



>ref|XP_008221833.1| PREDICTED: pantothenate kinase 1 [Prunus mume]
Length=433

 Score =   494 bits (1271),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 260/354 (73%), Positives = 297/354 (84%), Gaps = 10/354 (3%)
 Frame = +3

Query  345   ISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKF  524
             ISHLALDIGGSLIKLVYFS +        +         VS+GN    P+L G+LHF KF
Sbjct  46    ISHLALDIGGSLIKLVYFSTNSDSSSSSSKDSVA-----VSSGNE-GRPVLEGKLHFAKF  99

Query  525   ETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVS  704
             ET K+N+C+DFI SKQL   G         AP  E   IKATGGGAYK+ DLFKE+LG+ 
Sbjct  100   ETAKINDCIDFIRSKQLRHSGFQ----KHGAPAGEKCTIKATGGGAYKYTDLFKEKLGIC  155

Query  705   IEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKV  884
             ++KEDEM+CLVAG+NFLLKA+  EAFT+++G KEFVQID +DL+PY+LVNIGSGVSMIKV
Sbjct  156   LDKEDEMDCLVAGSNFLLKAVHTEAFTYMDGQKEFVQIDHDDLYPYMLVNIGSGVSMIKV  215

Query  885   DGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDY  1064
             DG GKF+RVSGTNVGGGT+WGLGRLLTKCKSFD+LLELS RG+NR IDMLVGDIYGGMDY
Sbjct  216   DGPGKFERVSGTNVGGGTFWGLGRLLTKCKSFDELLELSHRGNNRVIDMLVGDIYGGMDY  275

Query  1065  SKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKri  1244
             +KIGLS++TIASSFGKAIS+NKELEDY+PEDIS SLLRMIS NIGQISYLNALR+GLKRI
Sbjct  276   TKIGLSSTTIASSFGKAISDNKELEDYKPEDISRSLLRMISNNIGQISYLNALRFGLKRI  335

Query  1245  ffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGL  1406
             FF GFFIRGHAYTMDTI+ AV+FWSKGEA+AMFL+HEGFLGALG+FMSYEKHG 
Sbjct  336   FFAGFFIRGHAYTMDTIAVAVHFWSKGEAKAMFLKHEGFLGALGSFMSYEKHGF  389



>ref|XP_002525366.1| Pantothenate kinase, putative [Ricinus communis]
 gb|EEF37004.1| Pantothenate kinase, putative [Ricinus communis]
Length=414

 Score =   492 bits (1267),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 258/369 (70%), Positives = 302/369 (82%), Gaps = 7/369 (2%)
 Frame = +3

Query  309   DPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedk--rkrkvkerFGVSNGNRR  482
             DP          ISHLALDIGGSLIK+VY SR+     + +        +   +SN N  
Sbjct  9     DPNSESTQSIGQISHLALDIGGSLIKVVYLSRYSNNSADIEGESSSSDDDTLVLSNVNGE  68

Query  483   SYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGA  662
              + IL GRLHF KFET+K+N+CL+FISSK+LH GG        E P  +   IKATGGGA
Sbjct  69    HH-ILEGRLHFAKFETSKINDCLEFISSKKLHLGGFQR----HENPTKDRNFIKATGGGA  123

Query  663   YKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPY  842
             YKF D FKE+LG S++KEDEM+CLVAGANFLLKA+ HEA+T+++G KEFVQID NDL+PY
Sbjct  124   YKFTDFFKEKLGFSLDKEDEMDCLVAGANFLLKAVHHEAYTYMDGQKEFVQIDHNDLYPY  183

Query  843   LLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRT  1022
             LLVNIGSGVSMI+V+GDGKF+RVSGT+VGGGT+WGLG+LLTKCK FD+LLELS +G+NR 
Sbjct  184   LLVNIGSGVSMIRVEGDGKFERVSGTSVGGGTFWGLGKLLTKCKCFDELLELSHQGNNRV  243

Query  1023  IDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQ  1202
             IDMLVGDIYGG DYSK GLS++TIASSFGKA+S+NKELEDY+PED++ SLLRMIS NIGQ
Sbjct  244   IDMLVGDIYGGTDYSKFGLSSTTIASSFGKAVSDNKELEDYKPEDVARSLLRMISNNIGQ  303

Query  1203  ISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAF  1382
             ISYLNALR+GLKRIFFGGFFI+GH+YTMDTIS AV+FWSKGEA+AMFLRHEGFLGALGAF
Sbjct  304   ISYLNALRFGLKRIFFGGFFIQGHSYTMDTISVAVHFWSKGEAKAMFLRHEGFLGALGAF  363

Query  1383  MSYEKHGLD  1409
              SYEK  LD
Sbjct  364   RSYEKRSLD  372



>ref|XP_011071090.1| PREDICTED: pantothenate kinase 1 [Sesamum indicum]
Length=397

 Score =   491 bits (1265),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 260/359 (72%), Positives = 305/359 (85%), Gaps = 7/359 (2%)
 Frame = +3

Query  333   QSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLH  512
             +S  +SHLALDIGGSLIK+VYF  +  R ++D+     K+    S G+   Y +L GRLH
Sbjct  14    ESGGVSHLALDIGGSLIKMVYFPSNSSRSIDDQVNGSSKDGLAASGGDLH-YSLLNGRLH  72

Query  513   FVKFETTKVNECLDFISSKQL-HCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKE  689
             F KFET+KVN+C+DFISS+ L HCG  D     +EAP +   IIKATGGGA+KFADLFKE
Sbjct  73    FFKFETSKVNDCIDFISSELLRHCGARD-----NEAPISGKNIIKATGGGAFKFADLFKE  127

Query  690   RLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGV  869
             RLG++++K DEM+CLV GANFLLK + HEAFT+++G K++VQID  DL+PYLLVNIGSGV
Sbjct  128   RLGITLDKVDEMDCLVRGANFLLKTVHHEAFTYMDGQKDYVQIDHKDLYPYLLVNIGSGV  187

Query  870   SMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIY  1049
             SMIKV+ D KFQRVSGT+VGGGT+WGLG+LLTKCKSFD+LLELS RG+NR IDMLVGDIY
Sbjct  188   SMIKVESDSKFQRVSGTSVGGGTFWGLGKLLTKCKSFDELLELSHRGNNRVIDMLVGDIY  247

Query  1050  GGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRY  1229
             GGMDYSKIGL+++ IASSFGK ISENKELEDYR EDI+ SLLRMIS NIGQI+YLNALR+
Sbjct  248   GGMDYSKIGLTSTAIASSFGKPISENKELEDYRAEDIARSLLRMISNNIGQIAYLNALRF  307

Query  1230  GLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGL  1406
             GLKRIFFGGFFIRGH+YTMDTIS AVNFWSKGEA+AMFLRHEGFLGALGAF+SYE+H L
Sbjct  308   GLKRIFFGGFFIRGHSYTMDTISVAVNFWSKGEAKAMFLRHEGFLGALGAFLSYEEHDL  366



>ref|XP_011011123.1| PREDICTED: pantothenate kinase 1-like isoform X1 [Populus euphratica]
Length=398

 Score =   490 bits (1261),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 254/354 (72%), Positives = 296/354 (84%), Gaps = 16/354 (5%)
 Frame = +3

Query  345   ISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKF  524
             IS LALD+GGSLIKLVYFSR+ G   +            +SNG       + GRLHF KF
Sbjct  18    ISRLALDMGGSLIKLVYFSRNSGDHEDPLNDSVP-----ISNG-------VNGRLHFAKF  65

Query  525   ETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVS  704
             ETT +N+CL FIS+ +L  GG        E P N+ + IKATGGGAYKF++LFKE+LG+ 
Sbjct  66    ETTNINDCLQFISANKLFFGGFQ----HQENPTNDRSFIKATGGGAYKFSELFKEKLGII  121

Query  705   IEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKV  884
             +EKEDEM+CLV GANFLLKA+ HEAFT++ G KEFVQID NDL+PYLLVNIGSGVSMIKV
Sbjct  122   LEKEDEMDCLVTGANFLLKAVNHEAFTYLNGQKEFVQIDHNDLYPYLLVNIGSGVSMIKV  181

Query  885   DGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDY  1064
             DGDGKF+RVSGT+VGGGT+WGLG+LLTKC+SFD+LLELSQRG+NR IDMLVGDIYGG+DY
Sbjct  182   DGDGKFERVSGTSVGGGTFWGLGKLLTKCQSFDELLELSQRGNNRVIDMLVGDIYGGIDY  241

Query  1065  SKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKri  1244
             SKIGLS++ IASSFG+A+S + EL+DY+PED+S SLLRMIS NIGQISYLNALR+GLKRI
Sbjct  242   SKIGLSSTAIASSFGRAVSNSNELDDYKPEDVSRSLLRMISNNIGQISYLNALRFGLKRI  301

Query  1245  ffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGL  1406
             FFGGFF RGH+YTMDTIS AV+FWSKGEA+AMFLRHEGFLGALGAFMSYE+H L
Sbjct  302   FFGGFFTRGHSYTMDTISVAVHFWSKGEAKAMFLRHEGFLGALGAFMSYERHSL  355



>ref|NP_001063766.1| Os09g0533100 [Oryza sativa Japonica Group]
 dbj|BAF25680.1| Os09g0533100, partial [Oryza sativa Japonica Group]
Length=755

 Score =   502 bits (1292),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 255/288 (89%), Positives = 276/288 (96%), Gaps = 1/288 (0%)
 Frame = +3

Query  546   CLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEM  725
             CLDFISSKQLH GG+D+P W S A Q +N +IKATGGGA+K+ADLFKERLGVS+EKEDEM
Sbjct  1     CLDFISSKQLHRGGVDSPSWRSGA-QPDNIVIKATGGGAFKYADLFKERLGVSLEKEDEM  59

Query  726   NCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQ  905
             +CLVAGANFLLK+IRHEAFTH++G KE+VQIDQNDLFP+LLVN+GSGVS+IKVDG GKFQ
Sbjct  60    DCLVAGANFLLKSIRHEAFTHMDGQKEYVQIDQNDLFPFLLVNVGSGVSIIKVDGHGKFQ  119

Query  906   RVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSA  1085
             RVSGTNVGGGTYWGLGRL+TKCKSFD+LLELSQRGDN TIDMLVGDIYGG+DYSKIGLSA
Sbjct  120   RVSGTNVGGGTYWGLGRLMTKCKSFDELLELSQRGDNSTIDMLVGDIYGGLDYSKIGLSA  179

Query  1086  STIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffi  1265
             STIASSFGK IS++KEL DYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFI
Sbjct  180   STIASSFGKTISDDKELSDYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFI  239

Query  1266  rgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             RGHAYTMDTISFAVNFWSKGEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  240   RGHAYTMDTISFAVNFWSKGEAKAMFLRHEGFLGALGAFMSYEKHGLD  287



>ref|XP_004297480.1| PREDICTED: pantothenate kinase 1 [Fragaria vesca subsp. vesca]
Length=404

 Score =   487 bits (1254),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 254/355 (72%), Positives = 297/355 (84%), Gaps = 12/355 (3%)
 Frame = +3

Query  345   ISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKF  524
             ISHLA+DIGGSL+KLVYFS++             K    VSNGN+ +  ++ G+L F KF
Sbjct  19    ISHLAVDIGGSLVKLVYFSQNS-------EDDSSKSNVQVSNGNKGA-AVIEGKLQFAKF  70

Query  525   ETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVS  704
             ET K+++C+DFI SKQL   G       + A  NE  +IKATGGGA+KFADLFKE+LGV 
Sbjct  71    ETAKIHDCIDFIKSKQLRLTGCQ----HNGASANEECVIKATGGGAHKFADLFKEKLGVC  126

Query  705   IEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKV  884
             + KEDEM+ LVAGANFLLK+++ EAFT+++G KEF QIDQ+DL+PYLLVNIGSGVSMIKV
Sbjct  127   LGKEDEMDSLVAGANFLLKSVQDEAFTYMDGQKEFAQIDQDDLYPYLLVNIGSGVSMIKV  186

Query  885   DGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDY  1064
             DG GKF+RVSGTNVGGGT+WGLGRLLTKC SFD+LLELS RG+NR IDMLVGDIYGG DY
Sbjct  187   DGPGKFERVSGTNVGGGTFWGLGRLLTKCNSFDELLELSHRGNNRAIDMLVGDIYGGTDY  246

Query  1065  SKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKri  1244
              KIGL+++ IASSFGKAIS+NKEL+DY+PEDI+ SLLRMIS NIGQISYLNALR+GLKRI
Sbjct  247   KKIGLTSTAIASSFGKAISDNKELDDYKPEDITRSLLRMISNNIGQISYLNALRFGLKRI  306

Query  1245  ffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             FF GFF+RGHAYTMDTI+ AV+FWSKGEA+AMFLRHEGFLGALGAFMSYEKHG D
Sbjct  307   FFAGFFLRGHAYTMDTIAVAVHFWSKGEAKAMFLRHEGFLGALGAFMSYEKHGFD  361



>ref|XP_003552023.1| PREDICTED: pantothenate kinase 2-like [Glycine max]
 gb|KHN25531.1| Pantothenate kinase 2 [Glycine soja]
Length=413

 Score =   487 bits (1254),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 252/369 (68%), Positives = 310/369 (84%), Gaps = 5/369 (1%)
 Frame = +3

Query  300   EEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNR  479
             E +   IL PNQ   + HLALDIGGSL KLVYF++ +   V+ +     ++ F  SNG++
Sbjct  5     EGQTQPILDPNQPSHVYHLALDIGGSLAKLVYFTKDDDHLVDGEEGISHRKAFEKSNGSK  64

Query  480   RSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGG  659
             + YP+L GRL+F KFET+K+N+C++FI S +LH GG   P+   E P +++  IKATGGG
Sbjct  65    Q-YPVLNGRLNFKKFETSKINDCIEFIKSMKLHIGG-SQPQ---ENPGSQSIAIKATGGG  119

Query  660   AYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFP  839
             AYK+ADLFKERLG+  +KEDEM+CLVAGANFLL+ +  EAFT++   K+FVQIDQNDL+P
Sbjct  120   AYKYADLFKERLGIIFDKEDEMDCLVAGANFLLEVVHQEAFTYMGDQKQFVQIDQNDLYP  179

Query  840   YLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNR  1019
             YLLVNIGSGV MIKV+G+GKF+RVSGT++GGGT+WGLG+LLT+CKSFD+LL+LS RG+NR
Sbjct  180   YLLVNIGSGVGMIKVEGEGKFERVSGTSIGGGTFWGLGKLLTECKSFDELLDLSYRGNNR  239

Query  1020  TIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIG  1199
              +DMLVGDIYGGMDYSKIGLS++ IASSFGKAIS+NKE EDY+PEDI+ SLLRMIS NIG
Sbjct  240   AVDMLVGDIYGGMDYSKIGLSSTAIASSFGKAISDNKEREDYKPEDIARSLLRMISNNIG  299

Query  1200  QISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGA  1379
             QISYLNALR+G+KRIFFGGFFIR H +TMDT+S AVNFWSKGEA+AMFLRHEGFLG +GA
Sbjct  300   QISYLNALRFGMKRIFFGGFFIRRHPFTMDTLSVAVNFWSKGEAKAMFLRHEGFLGGVGA  359

Query  1380  FMSYEKHGL  1406
             FMS +KHGL
Sbjct  360   FMSSDKHGL  368



>ref|XP_008353021.1| PREDICTED: pantothenate kinase 1-like [Malus domestica]
Length=407

 Score =   486 bits (1252),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 259/370 (70%), Positives = 300/370 (81%), Gaps = 15/370 (4%)
 Frame = +3

Query  300   EEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNR  479
             E   PT    N    ISHLALDIGGSLIKLVYFS                +    SNG+R
Sbjct  10    EVSKPT----NSEAQISHLALDIGGSLIKLVYFST------NSDDSSSSNDSLAASNGDR  59

Query  480   RSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGG  659
                P+L G+LHF KFET K+N+C+DFI SKQL   G +    S  A      +IKATGGG
Sbjct  60    -GRPVLEGKLHFAKFETQKINDCIDFIRSKQLRLTGSEQHGASGSA----KCVIKATGGG  114

Query  660   AYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFP  839
             A+K+ADLFKE+LG+S++K DEM+CLVAGANFLLKA+  EAFT++ G KEFV+ID +DL+P
Sbjct  115   AFKYADLFKEKLGISLDKADEMDCLVAGANFLLKAVHPEAFTYMGGQKEFVKIDHDDLYP  174

Query  840   YLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNR  1019
             YLLVNIGSGVSMIKVDG GKF+RVSGTNVGGGT+WGLG+LLTKCK+FD+LLELS RG+NR
Sbjct  175   YLLVNIGSGVSMIKVDGPGKFERVSGTNVGGGTFWGLGKLLTKCKNFDELLELSHRGNNR  234

Query  1020  TIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIG  1199
              IDMLVGDIYGGMDY+KIGL ++ IASSFGKAIS+NKELEDY+PEDIS SLLRMIS N+G
Sbjct  235   VIDMLVGDIYGGMDYTKIGLVSTAIASSFGKAISDNKELEDYKPEDISRSLLRMISNNVG  294

Query  1200  QISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGA  1379
             QISYLNALR+GLKRIFF GFFIRGHAYTMDTI+ AV+FWSKGEA+AMFL+HEGFLGALG+
Sbjct  295   QISYLNALRFGLKRIFFAGFFIRGHAYTMDTIAVAVHFWSKGEAKAMFLKHEGFLGALGS  354

Query  1380  FMSYEKHGLD  1409
             FMSYEKHG +
Sbjct  355   FMSYEKHGFE  364



>ref|XP_002312701.2| hypothetical protein POPTR_0008s19380g [Populus trichocarpa]
 gb|EEE90068.2| hypothetical protein POPTR_0008s19380g [Populus trichocarpa]
Length=399

 Score =   482 bits (1240),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 256/355 (72%), Positives = 293/355 (83%), Gaps = 15/355 (4%)
 Frame = +3

Query  345   ISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKF  524
             IS LALDIGGSLIKLV+FSR+ G   +  +        GVS+G       + GRLHF KF
Sbjct  18    ISRLALDIGGSLIKLVFFSRNSGDDEDPPKDLV-----GVSSG-------VNGRLHFAKF  65

Query  525   ETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVS  704
             ET K+N+CL FIS+ +L  GG        E   N+ + IKATGGGAYKF++LFKE+LG+S
Sbjct  66    ETAKINDCLQFISANKLLLGG---GFQHQENCTNDRSFIKATGGGAYKFSELFKEKLGIS  122

Query  705   IEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKV  884
             +EKEDEM+CLV GANFLLKA+  EAFT++ G KEFVQID NDL+PYLLVNIGSGVSMIKV
Sbjct  123   LEKEDEMDCLVTGANFLLKAVNQEAFTYLNGSKEFVQIDHNDLYPYLLVNIGSGVSMIKV  182

Query  885   DGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDY  1064
             DGDGKF+RVSGT+VGGGT+WGLG+LLTK +SFD+LLELS RGDNR ID LVGDIYGGMDY
Sbjct  183   DGDGKFERVSGTSVGGGTFWGLGKLLTKSQSFDELLELSHRGDNRAIDTLVGDIYGGMDY  242

Query  1065  SKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKri  1244
              KIGLS++TIASSFGKA S NK+LEDY+PEDIS SLLRMIS NIGQISYLNALR+GLKRI
Sbjct  243   LKIGLSSTTIASSFGKATSHNKQLEDYKPEDISRSLLRMISNNIGQISYLNALRFGLKRI  302

Query  1245  ffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
              FGGFFIR H+YTMDTI+ AV+FWSKGEA+AMFLRHEGFLGALGAFMSYE H LD
Sbjct  303   IFGGFFIRSHSYTMDTIAVAVHFWSKGEAKAMFLRHEGFLGALGAFMSYETHSLD  357



>ref|XP_010682543.1| PREDICTED: pantothenate kinase 1 [Beta vulgaris subsp. vulgaris]
Length=425

 Score =   483 bits (1242),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 257/356 (72%), Positives = 290/356 (81%), Gaps = 6/356 (2%)
 Frame = +3

Query  339   DDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFV  518
             D  S  ALDIGGSLIKLVYF   +    +   K    E  G+   N ++YP L G+LHF 
Sbjct  25    DHNSPWALDIGGSLIKLVYFCGEDSGLEKSSEKSVGVEGVGLVT-NSKNYPFLNGKLHFA  83

Query  519   KFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLG  698
             KFET+K+NECLDFI S  LH     +     E    +  +IKATGGGAYK+ADLFKE+ G
Sbjct  84    KFETSKINECLDFIES-NLH----GSRCRDQEVSDKKKLMIKATGGGAYKYADLFKEKFG  138

Query  699   VSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMI  878
             V ++KEDEM+CLVAG+NFLLKA+  E FT+IEG KEFV+ID NDLFPYLLVNIGSGVSMI
Sbjct  139   VRLDKEDEMDCLVAGSNFLLKAVPCETFTYIEGQKEFVKIDSNDLFPYLLVNIGSGVSMI  198

Query  879   KVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGM  1058
             KVDGDGKF+RVSGT+VGGGT+WGLGRLLTKC+SFDDLLELS +G+NR IDMLVGDIYGG 
Sbjct  199   KVDGDGKFERVSGTSVGGGTFWGLGRLLTKCQSFDDLLELSHQGNNRVIDMLVGDIYGGS  258

Query  1059  DYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLK  1238
             DYSKIGLSA+TIASSFGKAISE KELEDY+PED++ SLLR+IS NIGQI+YLNALRYGLK
Sbjct  259   DYSKIGLSATTIASSFGKAISEKKELEDYKPEDVARSLLRLISNNIGQIAYLNALRYGLK  318

Query  1239  riffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGL  1406
             RI FGGFFIR H YTMDTIS  V FWSKGEA+AMFLRHEGFLGALGAF SYEKHGL
Sbjct  319   RIIFGGFFIRSHEYTMDTISVGVQFWSKGEAKAMFLRHEGFLGALGAFKSYEKHGL  374



>ref|XP_007153743.1| hypothetical protein PHAVU_003G061300g [Phaseolus vulgaris]
 gb|ESW25737.1| hypothetical protein PHAVU_003G061300g [Phaseolus vulgaris]
Length=413

 Score =   480 bits (1236),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 248/363 (68%), Positives = 302/363 (83%), Gaps = 5/363 (1%)
 Frame = +3

Query  318   ILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPIL  497
             IL PNQ   + HLALDIGGSL KLVYF++ +   V+ +     ++       + + +P+L
Sbjct  11    ILDPNQPTHVYHLALDIGGSLAKLVYFTKDDNHLVDGEEGVSHRKTLQKCK-DSKQHPVL  69

Query  498   GGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFAD  677
              GRL F  FET+K+N+CL+FI S +LH GG      S E P ++   IKATGGGAYK+AD
Sbjct  70    NGRLSFKTFETSKINDCLEFIKSMKLHIGG----SQSQENPGSQPIAIKATGGGAYKYAD  125

Query  678   LFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNI  857
             LFKERLG+ ++KEDEM+CLVAGANFLL+ +  EAFT++   K+FVQID+NDL+PYLLVNI
Sbjct  126   LFKERLGIILDKEDEMDCLVAGANFLLEVVHQEAFTYMGDQKQFVQIDKNDLYPYLLVNI  185

Query  858   GSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLV  1037
             GSGV MIKV+G+GKF+RVSGT++GGGT+WGLG+LLTKCKSFD+LLELS RG+NR +DMLV
Sbjct  186   GSGVGMIKVEGEGKFERVSGTSIGGGTFWGLGKLLTKCKSFDELLELSYRGNNRQVDMLV  245

Query  1038  GDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLN  1217
             GDIYGGMDYSKIGLS++TIASSFGKAIS+N+E EDY+PEDI+ SLLRMIS NIGQISYLN
Sbjct  246   GDIYGGMDYSKIGLSSTTIASSFGKAISDNREREDYKPEDIARSLLRMISNNIGQISYLN  305

Query  1218  ALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEK  1397
             ALR+GLKRIFFGGFFIR H +TMDT+S AVNFWSKGEA+AMFLRHEGFLGA+G+FMS +K
Sbjct  306   ALRFGLKRIFFGGFFIRKHPFTMDTLSVAVNFWSKGEAKAMFLRHEGFLGAVGSFMSSDK  365

Query  1398  HGL  1406
             HGL
Sbjct  366   HGL  368



>emb|CDP13172.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   480 bits (1235),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 253/356 (71%), Positives = 297/356 (83%), Gaps = 5/356 (1%)
 Frame = +3

Query  339   DDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFV  518
             + +SHLALDIGGSL+K+VYF          +     KE  G+SNGN     +L G+LHF 
Sbjct  21    EQVSHLALDIGGSLVKMVYFCGENSGSEHQQGILSSKESCGLSNGNTNC-SVLRGKLHFR  79

Query  519   KFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLG  698
             KFET+K+NECL+F+SSKQ H  G D       A  +E  IIKATGGGA+KFADLFKE+LG
Sbjct  80    KFETSKINECLEFMSSKQFHRNGEDCHG----ASVSEKNIIKATGGGAFKFADLFKEKLG  135

Query  699   VSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMI  878
             ++++K DEMN LVAGANFLLKA   EA+T+++G KE+VQIDQNDL+PYLLVNIGSGVSMI
Sbjct  136   MTLDKVDEMNSLVAGANFLLKAASLEAYTYMDGQKEYVQIDQNDLYPYLLVNIGSGVSMI  195

Query  879   KVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGM  1058
             KVDGDGKF+RVSGT+VGGGT+WGLG+LLTKCKSFD+LL LS  G+NR IDMLVGDIYGGM
Sbjct  196   KVDGDGKFERVSGTSVGGGTFWGLGKLLTKCKSFDELLGLSYSGNNRVIDMLVGDIYGGM  255

Query  1059  DYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLK  1238
             DYSKIGLS++ IASSFGKA+SE+K+LE+Y+PED++ SLLRMIS NIGQI+YLNALR+GLK
Sbjct  256   DYSKIGLSSTAIASSFGKAVSEDKDLEEYKPEDVARSLLRMISNNIGQIAYLNALRFGLK  315

Query  1239  riffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGL  1406
             RIFFGGFFIRGHAYTMDTIS  VNFWS GEA+AMFLRHEGFLGALGAFMS+ K G 
Sbjct  316   RIFFGGFFIRGHAYTMDTISVGVNFWSNGEAKAMFLRHEGFLGALGAFMSHRKDGF  371



>ref|XP_011034129.1| PREDICTED: pantothenate kinase 1-like isoform X1 [Populus euphratica]
Length=399

 Score =   478 bits (1231),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 256/355 (72%), Positives = 294/355 (83%), Gaps = 15/355 (4%)
 Frame = +3

Query  345   ISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKF  524
             IS LALDIGGSLIKLVYFSR+ G   +  + +      GVS+G       + GRLHF  F
Sbjct  18    ISRLALDIGGSLIKLVYFSRNSGDDEDPPKDKV-----GVSSG-------VNGRLHFAMF  65

Query  525   ETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVS  704
             ET K+N+CL FIS+ +L  GG        E   N  + IKATGGGAYKF++LFKE+LG+ 
Sbjct  66    ETAKINDCLQFISANKLLLGG---GFQHQENCTNGMSFIKATGGGAYKFSELFKEKLGII  122

Query  705   IEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKV  884
             +EKEDEM+CLV GANFLLKA+  EAFT++ G KEFVQI+ NDL+PYLLVNIGSGVSMIKV
Sbjct  123   LEKEDEMDCLVTGANFLLKAVNQEAFTYLNGSKEFVQINHNDLYPYLLVNIGSGVSMIKV  182

Query  885   DGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDY  1064
             DGDGKF+RVSGT+VGGGT+WGLG+LLTKC+SFD+LLELS RGDN+ ID LVGDIYGGMDY
Sbjct  183   DGDGKFERVSGTSVGGGTFWGLGKLLTKCQSFDELLELSHRGDNKAIDTLVGDIYGGMDY  242

Query  1065  SKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKri  1244
             SKIGLS++TIASSFGKA S  KELEDY+PEDIS SLLRMIS NIGQISYLNALR+GLKRI
Sbjct  243   SKIGLSSTTIASSFGKATSHCKELEDYKPEDISWSLLRMISNNIGQISYLNALRFGLKRI  302

Query  1245  ffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             FFGGFFIR H+YTMDTI+ AV+FWSKGEA+AMFLRHEGFLGALGAFMSYE+H LD
Sbjct  303   FFGGFFIRSHSYTMDTIAVAVHFWSKGEAKAMFLRHEGFLGALGAFMSYERHSLD  357



>ref|XP_009621068.1| PREDICTED: pantothenate kinase 1 [Nicotiana tomentosiformis]
Length=430

 Score =   479 bits (1233),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 256/372 (69%), Positives = 305/372 (82%), Gaps = 8/372 (2%)
 Frame = +3

Query  285   IQGNFEEKDPTILLPNQS-DDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFG  461
             I G  E  D T  L  QS D+ISHLA+DIGGSLIK+VYFS +      D+     KER  
Sbjct  6     IDGKLENTDSTSELIKQSADEISHLAIDIGGSLIKIVYFSTNSKCSTNDEAPTLPKERQE  65

Query  462   VSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLH-CGGLDTPRWSSEAPQNENTI  638
             V NG+  ++ IL GRLHFVKFET+K+ +C++F+SSK+L  CG          +   +   
Sbjct  66    VPNGDL-NHHILSGRLHFVKFETSKIEDCINFLSSKKLQQCGA-----QCHHSHTVDKIK  119

Query  639   IKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQI  818
             IKATGGGA+KFADLFKE+LG++++K +EM  LVAGANFLLKA+ HEA+T+I G KE++QI
Sbjct  120   IKATGGGAFKFADLFKEKLGITLDKVEEMESLVAGANFLLKAVNHEAYTYIGGRKEYMQI  179

Query  819   DQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLEL  998
             DQNDL+PYLLVNIGSGVSMIKVDGD KFQRVSGT+VGGGT+WGLG+LLTKCKSFD+LLEL
Sbjct  180   DQNDLYPYLLVNIGSGVSMIKVDGDEKFQRVSGTSVGGGTFWGLGKLLTKCKSFDELLEL  239

Query  999   SQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLR  1178
             S  G+NR IDMLVGDIYGGMDY+KIGL+++ IASSFGK +SEN+ELEDY+PEDI+ SLLR
Sbjct  240   SHEGNNRVIDMLVGDIYGGMDYAKIGLASTAIASSFGKPVSENRELEDYKPEDIARSLLR  299

Query  1179  MISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEG  1358
             MIS NIGQI+YLNALR+GLKRI  GGFFIR HAYTMDTIS AV+FWSKGEA+AMFLRHEG
Sbjct  300   MISNNIGQIAYLNALRFGLKRIILGGFFIRDHAYTMDTISVAVDFWSKGEAKAMFLRHEG  359

Query  1359  FLGALGAFMSYE  1394
             FLGALGAFM+Y+
Sbjct  360   FLGALGAFMNYK  371



>ref|XP_003532004.1| PREDICTED: pantothenate kinase 2-like [Glycine max]
 gb|KHN26885.1| Pantothenate kinase 2 [Glycine soja]
Length=413

 Score =   475 bits (1222),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 247/369 (67%), Positives = 305/369 (83%), Gaps = 5/369 (1%)
 Frame = +3

Query  300   EEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNR  479
             E +   IL PNQ   + HLALDIGGSL KLVYF++ +   V+ +     ++    S+ ++
Sbjct  5     EGQTQPILDPNQPSHVYHLALDIGGSLAKLVYFTKDDDHLVDGEEGISHRKALEKSDSSK  64

Query  480   RSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGG  659
             + YP+L G+L+F KFET+++N+C++FI S +LH GG   P+   E P ++   IKATGGG
Sbjct  65    Q-YPVLNGKLNFKKFETSRINDCIEFIKSMKLHIGG-SQPQ---ENPGSQPIAIKATGGG  119

Query  660   AYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFP  839
             AYK+ DLFKERLG+ ++KEDEM+CLVAGANFLL+ +  EAFT++   K+FVQID NDL+P
Sbjct  120   AYKYPDLFKERLGIILDKEDEMDCLVAGANFLLEVVHQEAFTYMGDQKQFVQIDPNDLYP  179

Query  840   YLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNR  1019
             YLLVNIGSGV MIKV+G+GKF+RVSGT++GGGT+WGLG+LLTKCKSFD+LLELS RG+NR
Sbjct  180   YLLVNIGSGVGMIKVEGEGKFERVSGTSIGGGTFWGLGKLLTKCKSFDELLELSYRGNNR  239

Query  1020  TIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIG  1199
              +DMLVGDIYGGMDYSKIGLS++ IASSFGKAIS+NKE  DY+PEDI+ SLLRMIS NIG
Sbjct  240   AVDMLVGDIYGGMDYSKIGLSSTAIASSFGKAISDNKERGDYKPEDIARSLLRMISNNIG  299

Query  1200  QISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGA  1379
             QISYLNALR+GLKRIFFGGFFIR H +TMDT+S AVNFWSKGEA+AMFLRHEGFLG +GA
Sbjct  300   QISYLNALRFGLKRIFFGGFFIRRHPFTMDTLSVAVNFWSKGEAKAMFLRHEGFLGGVGA  359

Query  1380  FMSYEKHGL  1406
             FMS +KHGL
Sbjct  360   FMSSDKHGL  368



>ref|XP_004509755.1| PREDICTED: pantothenate kinase 2-like [Cicer arietinum]
Length=412

 Score =   473 bits (1217),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 241/360 (67%), Positives = 297/360 (83%), Gaps = 5/360 (1%)
 Frame = +3

Query  327   PNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGR  506
             PN    + HLALDIGGSL KLVYF++ +    + +     +     S  +R ++P+L G+
Sbjct  14    PNSDTHVYHLALDIGGSLNKLVYFTKDDDHSDDGEVGISPRNTLEKSKASR-NHPVLKGK  72

Query  507   LHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFK  686
             L+F KFET+K+N+C+DFI + +LH G     R   E+P N    IKATGGG+YK+ADLF 
Sbjct  73    LNFKKFETSKINDCIDFIKTMKLHLG----DRQQQESPGNHPISIKATGGGSYKYADLFM  128

Query  687   ERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSG  866
             ERLG++++KEDEM+CLVAGANFLL+ +  EAFT++  HK+FV ID+NDL+PYLLVNIGSG
Sbjct  129   ERLGITLDKEDEMDCLVAGANFLLEVVDREAFTYMADHKQFVHIDKNDLYPYLLVNIGSG  188

Query  867   VSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDI  1046
             V MIKV+GDG+F+RVSGT++GGGT+WGLG+LLTKCKSFD+LLELS +G+NR IDMLVGDI
Sbjct  189   VGMIKVEGDGEFERVSGTSIGGGTFWGLGKLLTKCKSFDELLELSYQGNNRAIDMLVGDI  248

Query  1047  YGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALR  1226
             YGGMDYSKIGLS++ IASSFGK +S+ KE EDY+PEDI+ SLLRMIS NIGQISYLNALR
Sbjct  249   YGGMDYSKIGLSSTAIASSFGKTVSDKKEREDYKPEDIARSLLRMISNNIGQISYLNALR  308

Query  1227  YGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGL  1406
             +GLKRIFFGGFFIR H +TMDT+S AVNFWSKGEA+AMFLRHEGFLGA+GAFMS +KHGL
Sbjct  309   FGLKRIFFGGFFIRRHPFTMDTLSVAVNFWSKGEAKAMFLRHEGFLGAVGAFMSSDKHGL  368



>ref|XP_009792509.1| PREDICTED: pantothenate kinase 1 [Nicotiana sylvestris]
Length=430

 Score =   473 bits (1218),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 249/359 (69%), Positives = 300/359 (84%), Gaps = 7/359 (2%)
 Frame = +3

Query  321   LLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILG  500
             L+   +D+ISHLA+DIGGSLIK+VYFS +      D+     KER  V NG+  ++ IL 
Sbjct  19    LIKQSADEISHLAIDIGGSLIKIVYFSTNSKCSTNDEAPTLPKERQEVPNGDL-NHHILS  77

Query  501   GRLHFVKFETTKVNECLDFISSKQLH-CGGLDTPRWSSEAPQNENTIIKATGGGAYKFAD  677
             G LHFVKFET+K+ +C++F+SSK+L  CG          +   +   IKATGGGA+KFAD
Sbjct  78    GGLHFVKFETSKIEDCINFLSSKKLQQCGA-----QCHHSHAVDKIKIKATGGGAFKFAD  132

Query  678   LFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNI  857
             LFKE+LG++++K +EM  LVAGANFLLKA+ HEA+T+I G KE+VQIDQNDL+PYLLVNI
Sbjct  133   LFKEKLGITLDKVEEMESLVAGANFLLKAVNHEAYTYIGGRKEYVQIDQNDLYPYLLVNI  192

Query  858   GSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLV  1037
             GSGVSMIKVDGD KFQRVSGT+VGGGT+WGLG+LLTKCKSFD+LLELS +G+NR IDMLV
Sbjct  193   GSGVSMIKVDGDEKFQRVSGTSVGGGTFWGLGKLLTKCKSFDELLELSHQGNNRVIDMLV  252

Query  1038  GDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLN  1217
             GDIYGGMDY+KIGL+++ IASSFGK +SEN+ELEDY+PEDI+ SLLRMIS NIGQI+YLN
Sbjct  253   GDIYGGMDYAKIGLASTAIASSFGKPVSENRELEDYKPEDIARSLLRMISNNIGQIAYLN  312

Query  1218  ALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYE  1394
             ALR+GLKRI  GGFFIR HAYTMDTIS AV+FWSKGEA+AMFLRHEGFLGALGAFM+Y+
Sbjct  313   ALRFGLKRIILGGFFIRDHAYTMDTISVAVDFWSKGEAKAMFLRHEGFLGALGAFMNYK  371



>gb|KEH20031.1| pantothenate kinase [Medicago truncatula]
Length=414

 Score =   469 bits (1207),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 239/361 (66%), Positives = 304/361 (84%), Gaps = 5/361 (1%)
 Frame = +3

Query  327   PNQSDD-ISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGG  503
             PN S   + HLALDIGGSL KLVYF++ +   V+ + +   +     S G+RR++P+L G
Sbjct  14    PNPSTTHVYHLALDIGGSLNKLVYFTKDDDHFVDGEAEISPRNTSEKSKGSRRNHPVLKG  73

Query  504   RLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLF  683
             +L+F KFET+K+++C+DFI + +LH GG        E P ++   IKATGGG+YK+AD F
Sbjct  74    KLNFKKFETSKIDDCIDFIKTMKLHPGG----SRQQENPGSQPISIKATGGGSYKYADPF  129

Query  684   KERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGS  863
             KERLG++++KEDEM+CLVAGANFLL+ +  EA+T++   ++FVQIDQNDL+PYLLVNIGS
Sbjct  130   KERLGINLDKEDEMDCLVAGANFLLEVVDREAYTYMGDQRQFVQIDQNDLYPYLLVNIGS  189

Query  864   GVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGD  1043
             GVSMIKV+G+GKF+RVSGT++GGGT+WGLG+LLT+CKSFD+LLELS +G+N+ +DMLVGD
Sbjct  190   GVSMIKVEGNGKFERVSGTSIGGGTFWGLGKLLTQCKSFDELLELSYQGNNKEVDMLVGD  249

Query  1044  IYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNAL  1223
             IYGGMDY+KIGLS++ IASSFGKA+S+ KE EDYRPED++ SLLRMIS NIGQISYLNAL
Sbjct  250   IYGGMDYAKIGLSSTAIASSFGKAMSDKKEREDYRPEDMARSLLRMISNNIGQISYLNAL  309

Query  1224  RYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHG  1403
             R+GLKRIFFGGFFI+ H +TMDT+S AVNFWSKGEA+AMFLRHEGFLGA+GAFMS +KHG
Sbjct  310   RFGLKRIFFGGFFIQRHPFTMDTLSVAVNFWSKGEAKAMFLRHEGFLGAVGAFMSSDKHG  369

Query  1404  L  1406
             L
Sbjct  370   L  370



>ref|XP_011086577.1| PREDICTED: pantothenate kinase 1-like isoform X1 [Sesamum indicum]
Length=418

 Score =   468 bits (1204),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 247/355 (70%), Positives = 299/355 (84%), Gaps = 5/355 (1%)
 Frame = +3

Query  339   DDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFV  518
             D +SHLALDIGGSLIK+VYFS       +D+    ++E    S+GN   Y +L GRLHF+
Sbjct  21    DQVSHLALDIGGSLIKMVYFSSSSSCSTDDQENGFIREGTNTSSGNLE-YRVLSGRLHFL  79

Query  519   KFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLG  698
             KFET+K++EC++FISSK+L   G        EAP  +  I+KATGGGA+KF+DLFKE+LG
Sbjct  80    KFETSKISECIEFISSKRLQHYG----DQGDEAPAGDKHIVKATGGGAFKFSDLFKEKLG  135

Query  699   VSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMI  878
             + ++K DEM+ LVAGANFLLKA+ HEAFT+++G K++VQID  DL+PYLLVN+GSGVSMI
Sbjct  136   IILDKVDEMSSLVAGANFLLKAVHHEAFTYMDGVKDYVQIDHKDLYPYLLVNVGSGVSMI  195

Query  879   KVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGM  1058
             KVDGD +F+RVSGT+VGGGT+WGLG+LLTKCKSFD+LLELS +G+NR IDMLVGDIYGG 
Sbjct  196   KVDGDNEFERVSGTSVGGGTFWGLGKLLTKCKSFDELLELSHQGNNRVIDMLVGDIYGGT  255

Query  1059  DYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLK  1238
              YSKIGL+++TIASSFGKA+S+NKELEDYR ED++ SLLRMIS NIGQI+YLNALR+GLK
Sbjct  256   GYSKIGLTSTTIASSFGKAVSQNKELEDYRTEDVARSLLRMISNNIGQIAYLNALRFGLK  315

Query  1239  riffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHG  1403
             RIFFGGFFIRGH YTMDTIS AV+FWS GEA+A+FL HEGFLGALGAFMSYEK G
Sbjct  316   RIFFGGFFIRGHEYTMDTISVAVHFWSNGEAKALFLHHEGFLGALGAFMSYEKQG  370



>ref|XP_008389660.1| PREDICTED: LOW QUALITY PROTEIN: pantothenate kinase 1 [Malus 
domestica]
Length=401

 Score =   467 bits (1202),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 247/360 (69%), Positives = 293/360 (81%), Gaps = 10/360 (3%)
 Frame = +3

Query  330   NQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRL  509
             N    ISHLALDIGGSLIKLVYFS +         +         SNG+R  + +L G+L
Sbjct  16    NSEAQISHLALDIGGSLIKLVYFSTNSVDSSSSSNESLA-----ASNGDRGRH-VLEGKL  69

Query  510   HFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKE  689
             HF KFET K+N+C+DFI SKQL   G      S  A      +IKATGGGAYKF DLFKE
Sbjct  70    HFAKFETEKINDCIDFIRSKQLLLAGSQQEGASGSA----KCVIKATGGGAYKFPDLFKE  125

Query  690   RLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGV  869
             +LG+S++K DEM+CLVAG+NFLLKA++ EAFT+++G +EFV+ID +DL+PYLLVNIGSGV
Sbjct  126   KLGISLDKADEMDCLVAGSNFLLKAVQREAFTYMDGQREFVKIDHDDLYPYLLVNIGSGV  185

Query  870   SMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIY  1049
             SMIKVDG GKF+RVSGT+VGGGT+WGLG+LLTKCK+FD+LLELS +G+NR IDMLVGDIY
Sbjct  186   SMIKVDGPGKFERVSGTSVGGGTFWGLGKLLTKCKNFDELLELSHQGNNRVIDMLVGDIY  245

Query  1050  GGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRY  1229
             GGMDY+KIGL ++ IASSF K IS++KEL+DY+PEDIS SLLRMIS NIGQISYLNALR+
Sbjct  246   GGMDYTKIGLISTAIASSFSKVISDDKELKDYKPEDISRSLLRMISNNIGQISYLNALRF  305

Query  1230  GLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             GLKRI F GFFIRGHAYTMDTI+  V+FWSKGEA+AMFL+ EGFLGALG+FMSYEKHG D
Sbjct  306   GLKRIIFAGFFIRGHAYTMDTIAVGVHFWSKGEAKAMFLKREGFLGALGSFMSYEKHGFD  365



>ref|XP_006477543.1| PREDICTED: pantothenate kinase 2-like [Citrus sinensis]
Length=865

 Score =   483 bits (1243),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 246/275 (89%), Positives = 260/275 (95%), Gaps = 0/275 (0%)
 Frame = +3

Query  585   GLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKA  764
             G+D+  W+     N+N +IKATGGGAYKFADLFKERLGVS++KEDEM+CLVAGANFLLKA
Sbjct  121   GVDSCHWNPGVQANDNAVIKATGGGAYKFADLFKERLGVSLDKEDEMDCLVAGANFLLKA  180

Query  765   IRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYW  944
             IRHEAFTH+EG KEFVQID NDLFPYLLVNIGSGVSMIKVDGDGKF+RVSGTNVGGGTYW
Sbjct  181   IRHEAFTHMEGQKEFVQIDTNDLFPYLLVNIGSGVSMIKVDGDGKFERVSGTNVGGGTYW  240

Query  945   GLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISE  1124
             GLGRLLTKCKSFD+LLELSQRGDN TIDMLVGDIYGGMDYSKIGLSASTIASSFGK IS+
Sbjct  241   GLGRLLTKCKSFDELLELSQRGDNGTIDMLVGDIYGGMDYSKIGLSASTIASSFGKTISD  300

Query  1125  NKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFA  1304
              KEL DYRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFA
Sbjct  301   KKELADYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFA  360

Query  1305  VNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             V FWSKGEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  361   VQFWSKGEAQAMFLRHEGFLGALGAFMSYEKHGLD  395


 Score = 97.4 bits (241),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  219  EKEISPMHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYF  398
            E+E+  MHRS SRPQLDLS AAIQGNFE KDPTILLPNQSDDISHLALDIGG  + L++ 
Sbjct  61   EREMPSMHRSGSRPQLDLSKAAIQGNFEVKDPTILLPNQSDDISHLALDIGGDTLILLWL  120



>ref|NP_001234124.1| partially similar to pantothenate kinase family protein [Solanum 
lycopersicum]
 dbj|BAD95798.1| partially similar to pantothenate kinase family protein [Solanum 
lycopersicum]
Length=426

 Score =   468 bits (1204),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 253/376 (67%), Positives = 303/376 (81%), Gaps = 12/376 (3%)
 Frame = +3

Query  285   IQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGV  464
             I G  E+ D T      +D+ISHL++DIGGSLIK+VYFS +      D+     KER  V
Sbjct  6     IDGKLEKSDST-----SADEISHLSIDIGGSLIKIVYFSTNSKCSTNDEAPTLSKERQEV  60

Query  465   SNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLH-CGGLDTPRWSSEAPQNENTII  641
              NG+  ++ IL GRL+F+KFET+K+ +C+ F+SSK+L  CG          +   +   I
Sbjct  61    PNGDL-NHHILSGRLYFIKFETSKIEDCIKFLSSKKLQKCGA-----QCHHSHAVDKIKI  114

Query  642   KATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQID  821
             KATGGGA+KFADLFKE+LG++++K +EM  LV GANFLLKA  HE +T+I G KE+VQID
Sbjct  115   KATGGGAFKFADLFKEKLGLTLDKVEEMESLVTGANFLLKAANHEVYTYIGGQKEYVQID  174

Query  822   QNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELS  1001
             QNDL+PYLLVNIGSGVSMIKVDGDGKFQRVSGT+VGGGT+ GLG+LLTKC+SFD+LLELS
Sbjct  175   QNDLYPYLLVNIGSGVSMIKVDGDGKFQRVSGTSVGGGTFLGLGKLLTKCQSFDELLELS  234

Query  1002  QRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRM  1181
               G+NR IDMLVGDIYGG+DYSKIGL+++ IASSFGKAISENKELEDY+PEDI+ SLLRM
Sbjct  235   HLGNNRVIDMLVGDIYGGLDYSKIGLASTAIASSFGKAISENKELEDYKPEDIARSLLRM  294

Query  1182  ISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGF  1361
             IS NIGQI+YLNALR+GLKRIF GGFFIR HAYTMDTIS AV+FWSKGEA+AMFLRHEGF
Sbjct  295   ISNNIGQIAYLNALRFGLKRIFLGGFFIRDHAYTMDTISVAVDFWSKGEAKAMFLRHEGF  354

Query  1362  LGALGAFMSYEKHGLD  1409
             LGALGAFM+Y+    D
Sbjct  355   LGALGAFMNYKDGSTD  370



>ref|XP_006356432.1| PREDICTED: pantothenate kinase 1-like [Solanum tuberosum]
Length=426

 Score =   466 bits (1200),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 251/376 (67%), Positives = 303/376 (81%), Gaps = 12/376 (3%)
 Frame = +3

Query  285   IQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGV  464
             I G  E+ D T      +D+ISHL++DIGGSLIK+VYFS +      D+     KER  V
Sbjct  6     IDGKLEKSDST-----SADEISHLSIDIGGSLIKIVYFSTNSKCSTNDEAPTLSKERQEV  60

Query  465   SNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLH-CGGLDTPRWSSEAPQNENTII  641
              NG+  ++ IL GRL+FV FET+K+ +C+ F+SSK+L  CG          +   +   I
Sbjct  61    PNGDL-NHHILSGRLYFVNFETSKIEDCIKFLSSKKLQQCGA-----QCHHSHAVDKIKI  114

Query  642   KATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQID  821
             KATGGGA+KFADLFKE+LG++++K +EM  +V GANFLLKA+ HE +T+I G KE+VQID
Sbjct  115   KATGGGAFKFADLFKEKLGLTLDKVEEMESVVTGANFLLKAVNHEVYTYIGGQKEYVQID  174

Query  822   QNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELS  1001
             QNDL+PYLLVNIGSGV MIKVDGDGKFQRVSGT+VGGGT+ GLG+LLTKC+SFD+LLELS
Sbjct  175   QNDLYPYLLVNIGSGVGMIKVDGDGKFQRVSGTSVGGGTFLGLGKLLTKCQSFDELLELS  234

Query  1002  QRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRM  1181
              +G+NR IDMLVGDIYGG+DYSKIGL+++ IASSFGKAISENKELEDY+PEDI+ SLLRM
Sbjct  235   HQGNNRVIDMLVGDIYGGLDYSKIGLASTAIASSFGKAISENKELEDYKPEDIARSLLRM  294

Query  1182  ISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGF  1361
             IS NIGQI+YLNALR+GLKRIF GGFFIR HAYTMDTIS AV+FWSKGEA+AMFLRHEGF
Sbjct  295   ISNNIGQIAYLNALRFGLKRIFLGGFFIRDHAYTMDTISVAVDFWSKGEAKAMFLRHEGF  354

Query  1362  LGALGAFMSYEKHGLD  1409
             LGALGAFM+Y+    D
Sbjct  355   LGALGAFMNYKDESTD  370



>gb|EYU28448.1| hypothetical protein MIMGU_mgv1a008312mg [Erythranthe guttata]
Length=378

 Score =   457 bits (1175),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 228/308 (74%), Positives = 274/308 (89%), Gaps = 4/308 (1%)
 Frame = +3

Query  483   SYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGA  662
             +Y +L GRLHF+KFETTK++EC+ FIS+K+L     +      EA  ++  IIKATGGGA
Sbjct  28    NYTVLSGRLHFLKFETTKISECMKFISTKRLQ----EYGDKDDEASASDKNIIKATGGGA  83

Query  663   YKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPY  842
             +KFADLFKE+LG+ ++K DEM+CLVAGANFLLKA+  EAFT+++G K++VQID  DL+PY
Sbjct  84    FKFADLFKEKLGIILDKVDEMSCLVAGANFLLKAVHQEAFTYLDGQKDYVQIDHKDLYPY  143

Query  843   LLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRT  1022
             LLVN+GSGVSMIKVDGD +F+RVSGT+VGGGT+WGLG+LLTKC+SFD+LLELS++G+NR 
Sbjct  144   LLVNVGSGVSMIKVDGDNEFERVSGTSVGGGTFWGLGKLLTKCQSFDELLELSRQGNNRV  203

Query  1023  IDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQ  1202
             IDMLVGDIYGGMDYSKIGL+++ IASSFGKA+SENKELEDYR ED++ SLLRMIS NIGQ
Sbjct  204   IDMLVGDIYGGMDYSKIGLTSTAIASSFGKAVSENKELEDYRAEDVARSLLRMISNNIGQ  263

Query  1203  ISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAF  1382
             I+YLNALR+GLKRIFFGGFFIRGHAYTMDT+S AVNFWSKGEA+A+FLRHEGFLGALGAF
Sbjct  264   IAYLNALRFGLKRIFFGGFFIRGHAYTMDTLSVAVNFWSKGEAKALFLRHEGFLGALGAF  323

Query  1383  MSYEKHGL  1406
             MSYEK G 
Sbjct  324   MSYEKKGF  331



>ref|XP_002311775.2| pantothenate kinase 2 family protein [Populus trichocarpa]
 gb|EEE89142.2| pantothenate kinase 2 family protein [Populus trichocarpa]
Length=381

 Score =   455 bits (1171),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 248/355 (70%), Positives = 284/355 (80%), Gaps = 33/355 (9%)
 Frame = +3

Query  345   ISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKF  524
             IS LALDIGGSLIKLV+FSR+ G   +  +        GVS+G       + GRLHF KF
Sbjct  18    ISRLALDIGGSLIKLVFFSRNSGDDEDPPKDLV-----GVSSG-------VNGRLHFAKF  65

Query  525   ETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVS  704
             ET K+N+CL FIS+                     N ++   GGGAYKF++LFKE+LG+S
Sbjct  66    ETAKINDCLQFISA---------------------NKLLLGGGGGAYKFSELFKEKLGIS  104

Query  705   IEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKV  884
             +EKEDEM+CLV GANFLLKA+  EAFT++ G KEFVQID NDL+PYLLVNIGSGVSMIKV
Sbjct  105   LEKEDEMDCLVTGANFLLKAVNQEAFTYLNGSKEFVQIDHNDLYPYLLVNIGSGVSMIKV  164

Query  885   DGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDY  1064
             DGDGKF+RVSGT+VGGGT+WGLG+LLTK +SFD+LLELS RGDNR ID LVGDIYGGMDY
Sbjct  165   DGDGKFERVSGTSVGGGTFWGLGKLLTKSQSFDELLELSHRGDNRAIDTLVGDIYGGMDY  224

Query  1065  SKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKri  1244
              KIGLS++TIASSFGKA S NK+LEDY+PEDIS SLLRMIS NIGQISYLNALR+GLKRI
Sbjct  225   LKIGLSSTTIASSFGKATSHNKQLEDYKPEDISRSLLRMISNNIGQISYLNALRFGLKRI  284

Query  1245  ffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
              FGGFFIR H+YTMDTI+ AV+FWSKGEA+AMFLRHEGFLGALGAFMSYE H LD
Sbjct  285   IFGGFFIRSHSYTMDTIAVAVHFWSKGEAKAMFLRHEGFLGALGAFMSYETHSLD  339



>gb|KJB50225.1| hypothetical protein B456_008G159500 [Gossypium raimondii]
Length=336

 Score =   452 bits (1162),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 238/324 (73%), Positives = 272/324 (84%), Gaps = 6/324 (2%)
 Frame = +3

Query  345   ISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKF  524
             ISHLALDIGGSLIKLVYF R++    +D   R   E  G  + N R  P+LGG+LHF KF
Sbjct  19    ISHLALDIGGSLIKLVYFCRYDDSCRDDDELRSQNESLGSKSDNSR--PVLGGKLHFAKF  76

Query  525   ETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVS  704
             ET+K+N+CL+FI S +LH GG         AP ++   IKATGGGAYKFADLFKE+L VS
Sbjct  77    ETSKINDCLEFIHSMKLHLGGFH----DCTAPSSDKIFIKATGGGAYKFADLFKEKLSVS  132

Query  705   IEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKV  884
             ++KEDEM CLV GANFLLKA+  EAFT+++G KEF QID NDL+PYLLVNIGSGVSMIKV
Sbjct  133   LDKEDEMECLVTGANFLLKAVHQEAFTYLDGQKEFAQIDPNDLYPYLLVNIGSGVSMIKV  192

Query  885   DGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDY  1064
             DGDGKF+RVSGT++GGGT+WGLGRLLTKCK+FD+LLELS +G+NR IDMLVGDIYGG DY
Sbjct  193   DGDGKFERVSGTSLGGGTFWGLGRLLTKCKNFDELLELSHQGNNRVIDMLVGDIYGGTDY  252

Query  1065  SKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKri  1244
             +KIGLSA+TIASSFGKAIS+NKEL DY+PEDIS SLLRMIS NIGQISYLNALR+GLKRI
Sbjct  253   AKIGLSATTIASSFGKAISDNKELVDYKPEDISRSLLRMISNNIGQISYLNALRFGLKRI  312

Query  1245  ffggffirgHAYTMDTISFAVNFW  1316
             FF GFFIRGHAYTMDTIS AVNFW
Sbjct  313   FFAGFFIRGHAYTMDTISVAVNFW  336



>ref|XP_010447428.1| PREDICTED: pantothenate kinase 2 isoform X2 [Camelina sativa]
Length=765

 Score =   461 bits (1187),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 235/257 (91%), Positives = 251/257 (98%), Gaps = 0/257 (0%)
 Frame = +3

Query  639   IKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQI  818
             ++ TGGGAYKFADLFKERLGVSIEKEDEM+CLV+GANFLLKAIRHEAFTH+EG KEFVQI
Sbjct  38    LQVTGGGAYKFADLFKERLGVSIEKEDEMHCLVSGANFLLKAIRHEAFTHMEGEKEFVQI  97

Query  819   DQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLEL  998
             D NDL+PYLLVN+GSGVS+IKVDG+GKF+RVSGTNVGGGTYWGLGRLLTKCKSFD+LLEL
Sbjct  98    DPNDLYPYLLVNVGSGVSIIKVDGEGKFERVSGTNVGGGTYWGLGRLLTKCKSFDELLEL  157

Query  999   SQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLR  1178
             SQ+GDN  IDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL+DYRPEDISLSLLR
Sbjct  158   SQKGDNSAIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELDDYRPEDISLSLLR  217

Query  1179  MISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEG  1358
             MISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISFAV+FWSKGE +AMFLRHEG
Sbjct  218   MISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEMQAMFLRHEG  277

Query  1359  FLGALGAFMSYEKHGLD  1409
             FLGALGAFMSYEKHGLD
Sbjct  278   FLGALGAFMSYEKHGLD  294



>ref|XP_008446201.1| PREDICTED: pantothenate kinase 1 [Cucumis melo]
Length=397

 Score =   448 bits (1152),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 242/360 (67%), Positives = 294/360 (82%), Gaps = 15/360 (4%)
 Frame = +3

Query  333   QSD-DISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRL  509
             QSD  ISHLALDIGG+L KLVYF  ++     D+ +        V  G R S  I+ G+L
Sbjct  15    QSDSQISHLALDIGGTLAKLVYFCGNKRLLKNDEVQSS------VKAGGR-SRTIIQGKL  67

Query  510   HFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKE  689
             HF KFET+K++EC+ FI+ KQL   G   P+       N+  ++KATGGGA+KFA+LFKE
Sbjct  68    HFTKFETSKIDECIAFINRKQL---GSHHPK----DLDNDRIVVKATGGGAFKFAELFKE  120

Query  690   RLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGV  869
             +L   ++KEDEM+CLVAGANFLLKA+  EAFT+I G KEFVQI+Q+DL+PYLLVNIGSGV
Sbjct  121   KLDFCLDKEDEMDCLVAGANFLLKAVDQEAFTYIGGQKEFVQINQDDLYPYLLVNIGSGV  180

Query  870   SMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIY  1049
             SMIKVDG+GKF+RVSGT++GGGT+WGLG+LLTKC SFD+LLELS +G+NR +DMLVGDIY
Sbjct  181   SMIKVDGNGKFERVSGTSLGGGTFWGLGKLLTKCNSFDELLELSHQGNNRVVDMLVGDIY  240

Query  1050  GGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRY  1229
             GG+DYSK+GLS++ IASSFGK IS NK LE+YR ED++ SLLRMIS NIGQ++YL ALR+
Sbjct  241   GGIDYSKMGLSSTAIASSFGKTISTNKVLENYRTEDLARSLLRMISNNIGQLAYLTALRF  300

Query  1230  GLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             GLKRIFFGGFFIRGHAYTMDTIS AV++WSKGEA+AMFLRHEGFLGALGAF++Y K G D
Sbjct  301   GLKRIFFGGFFIRGHAYTMDTISVAVHYWSKGEAQAMFLRHEGFLGALGAFVNYNKQGHD  360



>ref|XP_004135249.1| PREDICTED: pantothenate kinase 1 [Cucumis sativus]
 gb|KGN51801.1| hypothetical protein Csa_5G601510 [Cucumis sativus]
Length=397

 Score =   444 bits (1143),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 240/360 (67%), Positives = 292/360 (81%), Gaps = 15/360 (4%)
 Frame = +3

Query  333   QSD-DISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRL  509
             QSD  ISHLALDIGG+L KLVYF  ++     D+ +        V  G R S  I+ G+L
Sbjct  15    QSDSQISHLALDIGGTLAKLVYFCGNKKLLKNDEVQSS------VKAGGR-SRTIIQGKL  67

Query  510   HFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKE  689
             HF KFET+K++EC+ FI+ KQL   G   P+       N+  ++KATGGGA+KFADLFKE
Sbjct  68    HFTKFETSKIDECVAFINRKQL---GSHHPK----DLDNDRIVVKATGGGAFKFADLFKE  120

Query  690   RLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGV  869
             +L   ++KEDEM+CLVAGANFLLKA+  EAFT+I G KEFVQI+Q+DL+PYLLVNIGSGV
Sbjct  121   KLDFCLDKEDEMDCLVAGANFLLKAVNQEAFTYIGGQKEFVQINQDDLYPYLLVNIGSGV  180

Query  870   SMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIY  1049
             SMIKVDG+GKF+RVSGT++GGGT+WGLG+LLTKC SFD+LLELS +G+NR +DMLVGDIY
Sbjct  181   SMIKVDGNGKFERVSGTSLGGGTFWGLGKLLTKCNSFDELLELSHQGNNRVVDMLVGDIY  240

Query  1050  GGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRY  1229
             GG DYSK+GLS++ IASSFGK IS NK LE+YR ED++ SLLRMIS NIGQ++YL ALR+
Sbjct  241   GGTDYSKMGLSSTAIASSFGKTISTNKVLENYRTEDLARSLLRMISNNIGQLAYLTALRF  300

Query  1230  GLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             GLKRIFFGGFFIRG +YTMDTIS AV++WSKG+A+AMFLRHEGFLGALGAF++Y K G D
Sbjct  301   GLKRIFFGGFFIRGQSYTMDTISVAVHYWSKGDAQAMFLRHEGFLGALGAFVNYNKQGHD  360



>gb|KJB50224.1| hypothetical protein B456_008G159500 [Gossypium raimondii]
Length=372

 Score =   438 bits (1127),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 243/355 (68%), Positives = 272/355 (77%), Gaps = 46/355 (13%)
 Frame = +3

Query  345   ISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKF  524
             ISHLALDIGGSLIKLVYF R++    +D   R   E  G  + N R  P+LGG+LHF KF
Sbjct  19    ISHLALDIGGSLIKLVYFCRYDDSCRDDDELRSQNESLGSKSDNSR--PVLGGKLHFAKF  76

Query  525   ETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVS  704
             ET+K+N+CL+FI S +LH                        GGGAYKFADLFKE+L V 
Sbjct  77    ETSKINDCLEFIHSMKLH-----------------------LGGGAYKFADLFKEKLSV-  112

Query  705   IEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKV  884
                                 I  EAFT+++G KEF QID NDL+PYLLVNIGSGVSMIKV
Sbjct  113   --------------------IHQEAFTYLDGQKEFAQIDPNDLYPYLLVNIGSGVSMIKV  152

Query  885   DGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDY  1064
             DGDGKF+RVSGT++GGGT+WGLGRLLTKCK+FD+LLELS +G+NR IDMLVGDIYGG DY
Sbjct  153   DGDGKFERVSGTSLGGGTFWGLGRLLTKCKNFDELLELSHQGNNRVIDMLVGDIYGGTDY  212

Query  1065  SKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKri  1244
             +KIGLSA+TIASSFGKAIS+NKEL DY+PEDIS SLLRMIS NIGQISYLNALR+GLKRI
Sbjct  213   AKIGLSATTIASSFGKAISDNKELVDYKPEDISRSLLRMISNNIGQISYLNALRFGLKRI  272

Query  1245  ffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             FF GFFIRGHAYTMDTIS AVNFWSKGEAEAMFLRHEGFLGALGAFMSYEK  LD
Sbjct  273   FFAGFFIRGHAYTMDTISVAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKQCLD  327



>gb|KJB50222.1| hypothetical protein B456_008G159500 [Gossypium raimondii]
Length=322

 Score =   433 bits (1114),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 224/280 (80%), Positives = 248/280 (89%), Gaps = 4/280 (1%)
 Frame = +3

Query  570   QLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGAN  749
             +LH GG         AP ++   IKATGGGAYKFADLFKE+L VS++KEDEM CLV GAN
Sbjct  2     KLHLGGFH----DCTAPSSDKIFIKATGGGAYKFADLFKEKLSVSLDKEDEMECLVTGAN  57

Query  750   FLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVG  929
             FLLKA+  EAFT+++G KEF QID NDL+PYLLVNIGSGVSMIKVDGDGKF+RVSGT++G
Sbjct  58    FLLKAVHQEAFTYLDGQKEFAQIDPNDLYPYLLVNIGSGVSMIKVDGDGKFERVSGTSLG  117

Query  930   GGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFG  1109
             GGT+WGLGRLLTKCK+FD+LLELS +G+NR IDMLVGDIYGG DY+KIGLSA+TIASSFG
Sbjct  118   GGTFWGLGRLLTKCKNFDELLELSHQGNNRVIDMLVGDIYGGTDYAKIGLSATTIASSFG  177

Query  1110  KAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMD  1289
             KAIS+NKEL DY+PEDIS SLLRMIS NIGQISYLNALR+GLKRIFF GFFIRGHAYTMD
Sbjct  178   KAISDNKELVDYKPEDISRSLLRMISNNIGQISYLNALRFGLKRIFFAGFFIRGHAYTMD  237

Query  1290  TISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             TIS AVNFWSKGEAEAMFLRHEGFLGALGAFMSYEK  LD
Sbjct  238   TISVAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKQCLD  277



>gb|KHG02710.1| hypothetical protein F383_25888 [Gossypium arboreum]
Length=810

 Score =   449 bits (1154),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 239/290 (82%), Positives = 251/290 (87%), Gaps = 35/290 (12%)
 Frame = +3

Query  645   ATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQ  824
             ATGGGAYKFADLFKERLGVSI+KEDEM+CLVAGANFLLKAIRHEAFTH+EGHKEFVQID 
Sbjct  2     ATGGGAYKFADLFKERLGVSIDKEDEMDCLVAGANFLLKAIRHEAFTHMEGHKEFVQIDH  61

Query  825   NDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQ  1004
             NDLFPYLLVN+GSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKC SFD+LLELSQ
Sbjct  62    NDLFPYLLVNVGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCNSFDELLELSQ  121

Query  1005  RGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMI  1184
             RGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAIS+ KELED+RPEDISLSLLRMI
Sbjct  122   RGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISDKKELEDHRPEDISLSLLRMI  181

Query  1185  SYNIGQ-----------------------------------ISYLNALRYGLKriffggf  1259
             SYNIGQ                                   ISYLNALR+GLKRIFFGGF
Sbjct  182   SYNIGQELIIRIRLNVLLELCSRIILPKRAILAIFFRFLRRISYLNALRFGLKRIFFGGF  241

Query  1260  firgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             FIRGHAYTMDTISFAV+FWS+G+A+AMFLRHEGFLGALGAFMSYEK GLD
Sbjct  242   FIRGHAYTMDTISFAVHFWSQGQAQAMFLRHEGFLGALGAFMSYEKLGLD  291



>ref|XP_011011124.1| PREDICTED: pantothenate kinase 1-like isoform X2 [Populus euphratica]
Length=331

 Score =   431 bits (1107),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 213/265 (80%), Positives = 246/265 (93%), Gaps = 0/265 (0%)
 Frame = +3

Query  612   EAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHI  791
             E P N+ + IKATGGGAYKF++LFKE+LG+ +EKEDEM+CLV GANFLLKA+ HEAFT++
Sbjct  24    ENPTNDRSFIKATGGGAYKFSELFKEKLGIILEKEDEMDCLVTGANFLLKAVNHEAFTYL  83

Query  792   EGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKC  971
              G KEFVQID NDL+PYLLVNIGSGVSMIKVDGDGKF+RVSGT+VGGGT+WGLG+LLTKC
Sbjct  84    NGQKEFVQIDHNDLYPYLLVNIGSGVSMIKVDGDGKFERVSGTSVGGGTFWGLGKLLTKC  143

Query  972   KSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRP  1151
             +SFD+LLELSQRG+NR IDMLVGDIYGG+DYSKIGLS++ IASSFG+A+S + EL+DY+P
Sbjct  144   QSFDELLELSQRGNNRVIDMLVGDIYGGIDYSKIGLSSTAIASSFGRAVSNSNELDDYKP  203

Query  1152  EDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEA  1331
             ED+S SLLRMIS NIGQISYLNALR+GLKRIFFGGFF RGH+YTMDTIS AV+FWSKGEA
Sbjct  204   EDVSRSLLRMISNNIGQISYLNALRFGLKRIFFGGFFTRGHSYTMDTISVAVHFWSKGEA  263

Query  1332  EAMFLRHEGFLGALGAFMSYEKHGL  1406
             +AMFLRHEGFLGALGAFMSYE+H L
Sbjct  264   KAMFLRHEGFLGALGAFMSYERHSL  288



>ref|XP_010554952.1| PREDICTED: LOW QUALITY PROTEIN: pantothenate kinase 1 [Tarenaya 
hassleriana]
Length=421

 Score =   431 bits (1109),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 244/351 (70%), Positives = 288/351 (82%), Gaps = 7/351 (2%)
 Frame = +3

Query  348   SHLALDIGGSLIKLVYFS--RHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVK  521
             SHLALDIGG+LIKLVYFS   +E  +  D  +      F V +G   S P+L GRL F K
Sbjct  44    SHLALDIGGTLIKLVYFSIDGNEDDRGSDVCETSRDGEFEVVHGAGAS-PVLRGRLCFAK  102

Query  522   FETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGV  701
             FET  + +CL+FI +  LH  G+            + T +KATGGGAYKFADLFKE+LG+
Sbjct  103   FETRNIGDCLEFIRADNLHYTGVQ----HQHGVARDKTFVKATGGGAYKFADLFKEKLGI  158

Query  702   SIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIK  881
               +KEDEM+CLV GANFLLK +  EA+T+++G KEFVQID NDLFPYLLVNIGSGVSMIK
Sbjct  159   LFDKEDEMHCLVGGANFLLKTVPQEAYTYLDGRKEFVQIDHNDLFPYLLVNIGSGVSMIK  218

Query  882   VDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMD  1061
             V+GDGK++RVSGT++GGGT+ GLG+LLTKCKSFD+LLE+SQ+G+NR IDMLVGDIYGGMD
Sbjct  219   VEGDGKYERVSGTSLGGGTFLGLGKLLTKCKSFDELLEISQQGNNRAIDMLVGDIYGGMD  278

Query  1062  YSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKr  1241
             YSKIGLS++TIASSFGKAIS+ KELEDY+PED++ SLLRMIS NIGQI+YLNALR+GLKR
Sbjct  279   YSKIGLSSTTIASSFGKAISDIKELEDYKPEDVARSLLRMISNNIGQIAYLNALRFGLKR  338

Query  1242  iffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYE  1394
             IFFGGFFIR H YTMDTIS AV+FWS+GEA+AMFLRHEGFLGALGAF SYE
Sbjct  339   IFFGGFFIRSHEYTMDTISVAVHFWSRGEAKAMFLRHEGFLGALGAFTSYE  389



>gb|KEH20032.1| pantothenate kinase [Medicago truncatula]
Length=340

 Score =   415 bits (1066),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 213/331 (64%), Positives = 275/331 (83%), Gaps = 5/331 (2%)
 Frame = +3

Query  327   PNQSDD-ISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGG  503
             PN S   + HLALDIGGSL KLVYF++ +   V+ + +   +     S G+RR++P+L G
Sbjct  14    PNPSTTHVYHLALDIGGSLNKLVYFTKDDDHFVDGEAEISPRNTSEKSKGSRRNHPVLKG  73

Query  504   RLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLF  683
             +L+F KFET+K+++C+DFI + +LH GG        E P ++   IKATGGG+YK+AD F
Sbjct  74    KLNFKKFETSKIDDCIDFIKTMKLHPGG----SRQQENPGSQPISIKATGGGSYKYADPF  129

Query  684   KERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGS  863
             KERLG++++KEDEM+CLVAGANFLL+ +  EA+T++   ++FVQIDQNDL+PYLLVNIGS
Sbjct  130   KERLGINLDKEDEMDCLVAGANFLLEVVDREAYTYMGDQRQFVQIDQNDLYPYLLVNIGS  189

Query  864   GVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGD  1043
             GVSMIKV+G+GKF+RVSGT++GGGT+WGLG+LLT+CKSFD+LLELS +G+N+ +DMLVGD
Sbjct  190   GVSMIKVEGNGKFERVSGTSIGGGTFWGLGKLLTQCKSFDELLELSYQGNNKEVDMLVGD  249

Query  1044  IYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNAL  1223
             IYGGMDY+KIGLS++ IASSFGKA+S+ KE EDYRPED++ SLLRMIS NIGQISYLNAL
Sbjct  250   IYGGMDYAKIGLSSTAIASSFGKAMSDKKEREDYRPEDMARSLLRMISNNIGQISYLNAL  309

Query  1224  RYGLKriffggffirgHAYTMDTISFAVNFW  1316
             R+GLKRIFFGGFFI+ H +TMDT+S AVNFW
Sbjct  310   RFGLKRIFFGGFFIQRHPFTMDTLSVAVNFW  340



>ref|XP_006300508.1| hypothetical protein CARUB_v10020467mg [Capsella rubella]
 gb|EOA33406.1| hypothetical protein CARUB_v10020467mg [Capsella rubella]
Length=380

 Score =   410 bits (1053),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 238/360 (66%), Positives = 284/360 (79%), Gaps = 25/360 (7%)
 Frame = +3

Query  327   PNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRS--YPILG  500
             P Q   ISHLALDIGG+L+KLVYFS +                 G  N   RS    ++ 
Sbjct  3     PTQ---ISHLALDIGGTLVKLVYFSAN-----------------GDYNEESRSNGCSVVK  42

Query  501   GRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADL  680
             GRL F KFET K+++CL+FI    L   G+   + S+ A  ++   +KATGGGA+KFADL
Sbjct  43    GRLCFAKFETRKIDDCLEFIRFNILQHSGV---QHSNGAVHDDYLSVKATGGGAFKFADL  99

Query  681   FKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIG  860
             FKE+LG+  +KEDEM+ LV G NFLLK +  EAFT+++G KEFV+ID NDL+PYLLVNIG
Sbjct  100   FKEKLGILFDKEDEMHSLVGGVNFLLKTVPREAFTYLDGQKEFVEIDHNDLYPYLLVNIG  159

Query  861   SGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVG  1040
             SGVSMIKVDGDGK++R+SGT++GGGT+ GLG+LLTKCKSFD+LLELS  G+NR IDMLVG
Sbjct  160   SGVSMIKVDGDGKYERISGTSLGGGTFLGLGKLLTKCKSFDELLELSHHGNNRVIDMLVG  219

Query  1041  DIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNA  1220
             DIYGG DYSKIGLS++ IASSFGKAIS+ KELEDY+PED++ SLLRMIS NIGQI+YLNA
Sbjct  220   DIYGGTDYSKIGLSSTAIASSFGKAISDGKELEDYQPEDVARSLLRMISNNIGQIAYLNA  279

Query  1221  LRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKH  1400
             LR+GLKRIFFGGFFIRG  YTMDTIS AV+FWS+GEA+AMFLRHEGFLGALGAF SYE H
Sbjct  280   LRFGLKRIFFGGFFIRGLEYTMDTISVAVHFWSRGEAKAMFLRHEGFLGALGAFTSYETH  339



>ref|XP_002886619.1| ATCOAA/ATPANK1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62878.1| ATCOAA/ATPANK1 [Arabidopsis lyrata subsp. lyrata]
Length=384

 Score =   408 bits (1048),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 232/354 (66%), Positives = 279/354 (79%), Gaps = 20/354 (6%)
 Frame = +3

Query  330   NQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRL  509
             + +  ISHLALDIGG+LIKLVYFS +                   S  +R    ++ G+L
Sbjct  2     DSTKKISHLALDIGGTLIKLVYFSANGD----------------YSEESRNGCSVVHGKL  45

Query  510   HFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKE  689
              F KFET K+++CL+FI    LH  G+  P        ++   +KATGGGA+KFADLFKE
Sbjct  46    CFAKFETRKIDDCLEFIRFNILHHSGVQHP----NGVAHDKLYVKATGGGAFKFADLFKE  101

Query  690   RLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGV  869
             +LG+  +KEDEM+ LV G NFLLK +  EAFT+++G KEFV+ID NDL+PYLLVNIGSGV
Sbjct  102   KLGILFDKEDEMHSLVGGVNFLLKTVPREAFTYLDGQKEFVEIDHNDLYPYLLVNIGSGV  161

Query  870   SMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIY  1049
             SMIKVDGDGK++R+SGT++GGGT+ GLG+LLTKCKSFD+LLELS  G+NR IDMLVGDIY
Sbjct  162   SMIKVDGDGKYERISGTSLGGGTFLGLGKLLTKCKSFDELLELSHHGNNRVIDMLVGDIY  221

Query  1050  GGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRY  1229
             GG DYSKIGLS++ IASSFGKAIS+ KELEDY+PED++ SLLRMIS NIGQI+YLNALR+
Sbjct  222   GGTDYSKIGLSSTAIASSFGKAISDGKELEDYQPEDVARSLLRMISNNIGQIAYLNALRF  281

Query  1230  GLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSY  1391
             GLKRIFFGGFFIRG  YTMDTIS AV+FWS+GEA+AMFLRHEGFLGALGAF SY
Sbjct  282   GLKRIFFGGFFIRGLEYTMDTISVAVHFWSRGEAKAMFLRHEGFLGALGAFTSY  335



>ref|XP_009113211.1| PREDICTED: pantothenate kinase 1 [Brassica rapa]
Length=396

 Score =   407 bits (1046),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 235/353 (67%), Positives = 280/353 (79%), Gaps = 15/353 (4%)
 Frame = +3

Query  336   SDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHF  515
             S  ISHLALDIGG+LIKLVYFS +     +            +  GN     +  GRL F
Sbjct  9     STQISHLALDIGGTLIKLVYFSPNGDNCEDG----------SIVVGNNGCSAV-QGRLCF  57

Query  516   VKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERL  695
              KFET K+++CLDFI    L   G+  P  +    + +   +KATGGGA+KFADLFKE+L
Sbjct  58    AKFETRKIDDCLDFIRLNILQHSGVQHPNGT----ERDKLSVKATGGGAFKFADLFKEKL  113

Query  696   GVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSM  875
             G+  +KEDEM+ LV G NFLLK +  EAFT+++G KEFVQID NDL+PYLLVNIGSGVSM
Sbjct  114   GIVFDKEDEMHSLVCGVNFLLKTVPREAFTYLDGQKEFVQIDHNDLYPYLLVNIGSGVSM  173

Query  876   IKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGG  1055
             IKVDGDGK++R+SGT++GGGT+ GLG+LLTKCKSFD+LLELS +G+NR IDMLVGDIYGG
Sbjct  174   IKVDGDGKYERISGTSLGGGTFLGLGKLLTKCKSFDELLELSHQGNNRVIDMLVGDIYGG  233

Query  1056  MDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGL  1235
              DYSKIGLS++ IASSFGKAIS+ KELEDY+PED++ SLLRMIS NIGQI+YLNALR+GL
Sbjct  234   TDYSKIGLSSTAIASSFGKAISDGKELEDYQPEDVARSLLRMISNNIGQIAYLNALRFGL  293

Query  1236  KriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYE  1394
             KRIFFGGFFIRG  YTMDTIS AV+FWS+GEA+AMFLRHEGFLGALGAF SY+
Sbjct  294   KRIFFGGFFIRGLEYTMDTISVAVHFWSRGEAKAMFLRHEGFLGALGAFTSYK  346



>ref|NP_176247.2| Pantothenate kinase 1 [Arabidopsis thaliana]
 sp|O80765.2|PANK1_ARATH RecName: Full=Pantothenate kinase 1; Short=AtPANK1; AltName: 
Full=AtCoaA; AltName: Full=Pantothenic acid kinase 1 [Arabidopsis 
thaliana]
 gb|AAR25641.1| At1g60440 [Arabidopsis thaliana]
 gb|AAU05507.1| At1g60440 [Arabidopsis thaliana]
 dbj|BAF01190.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33687.1| Pantothenate kinase 1 [Arabidopsis thaliana]
Length=383

 Score =   405 bits (1042),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 234/355 (66%), Positives = 278/355 (78%), Gaps = 23/355 (6%)
 Frame = +3

Query  327   PNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGR  506
             P Q   ISHLALDIGG+LIKLVYFS +                   S  +R    ++ GR
Sbjct  3     PTQ---ISHLALDIGGTLIKLVYFSANGD----------------YSEESRNGCSVVKGR  43

Query  507   LHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFK  686
             L F KFET K+++CL+FI    LH  G+  P        ++   +KATGGGA+KFADLFK
Sbjct  44    LCFAKFETRKIDDCLEFIRFNILHHSGVQQP----NGEGHDKLYVKATGGGAFKFADLFK  99

Query  687   ERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSG  866
             E+LG+  +KEDEM  LV G NFLLK +  EAFT+++G K+FV+ID NDL+PYLLVNIGSG
Sbjct  100   EKLGILFDKEDEMCSLVGGVNFLLKTVPREAFTYLDGQKKFVEIDHNDLYPYLLVNIGSG  159

Query  867   VSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDI  1046
             VSMIKVDGDGK++R+SGT++GGGT+ GLG+LLTKCKSFD+LLELS  G+NR IDMLVGDI
Sbjct  160   VSMIKVDGDGKYERISGTSLGGGTFLGLGKLLTKCKSFDELLELSHHGNNRVIDMLVGDI  219

Query  1047  YGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALR  1226
             YGG DYSKIGLS++ IASSFGKAIS+ KELEDY+PED++ SLLRMIS NIGQI+YLNALR
Sbjct  220   YGGTDYSKIGLSSTAIASSFGKAISDGKELEDYQPEDVARSLLRMISNNIGQIAYLNALR  279

Query  1227  YGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSY  1391
             +GLKRIFFGGFFIRG  YTMDTIS AV+FWS+GEA+AMFLRHEGFLGALGAF SY
Sbjct  280   FGLKRIFFGGFFIRGLEYTMDTISVAVHFWSRGEAKAMFLRHEGFLGALGAFTSY  334



>ref|XP_010417978.1| PREDICTED: pantothenate kinase 1-like [Camelina sativa]
Length=383

 Score =   405 bits (1040),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 232/358 (65%), Positives = 278/358 (78%), Gaps = 24/358 (7%)
 Frame = +3

Query  327   PNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGR  506
             P Q   ISHLALDIGG+L+KLVYFS +                 G    +R    ++ G+
Sbjct  4     PTQ---ISHLALDIGGTLVKLVYFSSN-----------------GSEEESRNGCSVVKGK  43

Query  507   LHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFK  686
             L F KFET K+++CLDFI    LH  G+           ++   +KATGGGA+KFADLFK
Sbjct  44    LCFAKFETRKIDDCLDFIRFNILHHSGVQ----HQNGAVHDYLSVKATGGGAFKFADLFK  99

Query  687   ERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSG  866
             E+LG+  +KEDEM+ LV G NFLLK +  EAFT+++G K+FV ID NDL+PYLLVNIGSG
Sbjct  100   EKLGILFDKEDEMHSLVGGVNFLLKTVPREAFTYLDGQKDFVNIDHNDLYPYLLVNIGSG  159

Query  867   VSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDI  1046
             VSMIKVDGDGK++R+SGT++GGGT+ GLG+LLTKCKSFD+LLELS  G+NR IDMLVGDI
Sbjct  160   VSMIKVDGDGKYERISGTSLGGGTFLGLGKLLTKCKSFDELLELSHHGNNRVIDMLVGDI  219

Query  1047  YGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALR  1226
             YGG DYSKIGLS++ IASSFGK IS+ KELEDY+PED++ SLLRMIS NIGQI+YLNALR
Sbjct  220   YGGTDYSKIGLSSTAIASSFGKPISDGKELEDYQPEDVARSLLRMISNNIGQIAYLNALR  279

Query  1227  YGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKH  1400
             +GLKRIFFGGFFIRG  YTMDTIS AV+FWS+GEA+AMFLRHEGFLGALGAF SY+ H
Sbjct  280   FGLKRIFFGGFFIRGLEYTMDTISVAVHFWSRGEAKAMFLRHEGFLGALGAFTSYKTH  337



>gb|KFK40789.1| hypothetical protein AALP_AA2G041200 [Arabis alpina]
Length=397

 Score =   405 bits (1040),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 237/356 (67%), Positives = 280/356 (79%), Gaps = 18/356 (5%)
 Frame = +3

Query  336   SDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHF  515
             S  ISHLALDIGG+LIKLVYFS + G   E+ R   +    G S        +L GRL F
Sbjct  9     STQISHLALDIGGTLIKLVYFSAN-GDHCEESRDGSIFVCSGCS--------VLQGRLCF  59

Query  516   VKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQ---NENTIIKATGGGAYKFADLFK  686
              KFET K+++CL+FI    L          S + P     +   IKATGGGA+KFADLF 
Sbjct  60    AKFETRKIDDCLEFIRFNILQ------QHSSVQHPNGTARDKLSIKATGGGAFKFADLFN  113

Query  687   ERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSG  866
             E+ G+  +KEDEM+CLV GAN+LLK +  EAFT+++G KEFVQID NDL+PYLLVNIGSG
Sbjct  114   EKFGILFDKEDEMHCLVGGANYLLKTVPREAFTYLDGQKEFVQIDHNDLYPYLLVNIGSG  173

Query  867   VSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDI  1046
             VSMIKVDGDGK++R+SGT++GGGT+ GLG+LLTKCKSFD+LLELS  G+NR IDMLVGDI
Sbjct  174   VSMIKVDGDGKYERISGTSLGGGTFLGLGKLLTKCKSFDELLELSHHGNNRVIDMLVGDI  233

Query  1047  YGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALR  1226
             YGG DYSKIGLS++ IASSFGKAIS+ KELEDY+PED++ SLLRMIS NIGQI+YLNALR
Sbjct  234   YGGTDYSKIGLSSTAIASSFGKAISDGKELEDYQPEDVARSLLRMISNNIGQIAYLNALR  293

Query  1227  YGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYE  1394
             +GLK IFFGGFFIRGH YTMDTIS AV+FWS+GEA+AMFL HEGFLGALGAF SY+
Sbjct  294   FGLKSIFFGGFFIRGHEYTMDTISVAVHFWSRGEAKAMFLTHEGFLGALGAFASYK  349



>emb|CDY53055.1| BnaA09g14200D [Brassica napus]
Length=582

 Score =   407 bits (1047),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 237/360 (66%), Positives = 282/360 (78%), Gaps = 17/360 (5%)
 Frame = +3

Query  336   SDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHF  515
             S  ISHLALDIGG+LIKLVYFS +     +            +  GN     +  GRL F
Sbjct  9     STQISHLALDIGGTLIKLVYFSPNGDNCEDG----------SIVVGNNGCSAV-QGRLCF  57

Query  516   VKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERL  695
              KFET K+++CLDFI    L   G+  P  +    + +   +KATGGGA+KFADLFKE+L
Sbjct  58    AKFETRKIDDCLDFIRLNILQHSGVQHPNGT----ERDKLSVKATGGGAFKFADLFKEKL  113

Query  696   GVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSM  875
             G+  +KEDEM+ LV G NFLLK +  EAFT+++G KEFVQID NDL+PYLLVNIGSGVSM
Sbjct  114   GIVFDKEDEMHSLVCGVNFLLKTVPREAFTYLDGQKEFVQIDHNDLYPYLLVNIGSGVSM  173

Query  876   IKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGG  1055
             IKVDGDGK++R+SGT++GGGT+ GLG+LLTKCKSFD+LLELS +G+NR IDMLVGDIYGG
Sbjct  174   IKVDGDGKYERISGTSLGGGTFLGLGKLLTKCKSFDELLELSHQGNNRVIDMLVGDIYGG  233

Query  1056  MDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGL  1235
              DYSKIGLS++ IASSFGKAIS+ KELEDY+PED++ SLLRMIS NIGQI+YLNALR+GL
Sbjct  234   TDYSKIGLSSTAIASSFGKAISDGKELEDYQPEDVARSLLRMISNNIGQIAYLNALRFGL  293

Query  1236  KriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSY--EKHGLD  1409
             KRIFFGGFFIRG  YTMDTIS AV+FWS+GEA+AMFLRHEGFLGALGAF SY  + H  D
Sbjct  294   KRIFFGGFFIRGLEYTMDTISVAVHFWSRGEAKAMFLRHEGFLGALGAFTSYKDQSHSTD  353



>dbj|BAD33319.1| putative pantothenate kinase 4 [Oryza sativa Japonica Group]
 dbj|BAD46028.1| putative pantothenate kinase 4 [Oryza sativa Japonica Group]
Length=697

 Score =   411 bits (1057),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 210/229 (92%), Positives = 224/229 (98%), Gaps = 0/229 (0%)
 Frame = +3

Query  723   MNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKF  902
             M+CLVAGANFLLK+IRHEAFTH++G KE+VQIDQNDLFP+LLVN+GSGVS+IKVDG GKF
Sbjct  1     MDCLVAGANFLLKSIRHEAFTHMDGQKEYVQIDQNDLFPFLLVNVGSGVSIIKVDGHGKF  60

Query  903   QRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLS  1082
             QRVSGTNVGGGTYWGLGRL+TKCKSFD+LLELSQRGDN TIDMLVGDIYGG+DYSKIGLS
Sbjct  61    QRVSGTNVGGGTYWGLGRLMTKCKSFDELLELSQRGDNSTIDMLVGDIYGGLDYSKIGLS  120

Query  1083  ASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggff  1262
             ASTIASSFGK IS++KEL DYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFF
Sbjct  121   ASTIASSFGKTISDDKELSDYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFF  180

Query  1263  irgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             IRGHAYTMDTISFAVNFWSKGEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  181   IRGHAYTMDTISFAVNFWSKGEAKAMFLRHEGFLGALGAFMSYEKHGLD  229



>ref|XP_010510949.1| PREDICTED: pantothenate kinase 1-like [Camelina sativa]
Length=385

 Score =   400 bits (1029),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 233/361 (65%), Positives = 278/361 (77%), Gaps = 33/361 (9%)
 Frame = +3

Query  327   PNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRR-----SYP  491
             P Q   ISHLALDIGG+L+KLVYFS                     SNG+          
Sbjct  4     PTQ---ISHLALDIGGTLVKLVYFS---------------------SNGSEEESRNGCCS  39

Query  492   ILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKF  671
             ++ GRL F KFET K+++CL+FI    L   G+           ++   +KATGGGA+KF
Sbjct  40    VVKGRLCFAKFETRKIDDCLEFIRFNILQHSGVQ----HQNGAVHDYLSVKATGGGAFKF  95

Query  672   ADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLV  851
             ADLFKE+LG+  +K+DEM+ LV G NFLLK +  EAFT+++G KEFV+ID NDL+PYLLV
Sbjct  96    ADLFKEKLGILFDKQDEMHSLVGGVNFLLKTVPREAFTYLDGQKEFVEIDHNDLYPYLLV  155

Query  852   NIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDM  1031
             NIGSGVSMIKVDGDGK++R+SGT++GGGT+ GLG+LLTKCKSFD+LLELS  G+NR IDM
Sbjct  156   NIGSGVSMIKVDGDGKYERISGTSLGGGTFLGLGKLLTKCKSFDELLELSHHGNNRVIDM  215

Query  1032  LVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISY  1211
             LVGDIYGG DYSKIGLS++ IASSFGKAIS+ KELEDY+PED++ SLLRMIS NIGQI+Y
Sbjct  216   LVGDIYGGTDYSKIGLSSTAIASSFGKAISDGKELEDYQPEDVARSLLRMISNNIGQIAY  275

Query  1212  LNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSY  1391
             LNALR+GLKRIFFGGFFIRG  YTMDTIS AV+FWS+GEA+AMFLRHEGFLGALGAF SY
Sbjct  276   LNALRFGLKRIFFGGFFIRGLEYTMDTISVAVHFWSRGEAKAMFLRHEGFLGALGAFTSY  335

Query  1392  E  1394
             E
Sbjct  336   E  336



>ref|XP_005649526.1| fumble-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE24982.1| fumble-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=890

 Score =   415 bits (1066),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 226/390 (58%), Positives = 293/390 (75%), Gaps = 28/390 (7%)
 Frame = +3

Query  231   SPMHRSTSRPQLDLSGAAI--QGNFEEKD-PTILLPNQSDD-ISHLALDIGGSLIKLVYF  398
             SP  RS +   LDL+ A I  Q + + +D P+I+LP+Q+ + ISH+A+DIGGSLIKLVYF
Sbjct  40    SPSKRSAA---LDLTDAVISLQTDPKRRDAPSIVLPHQNAEFISHIAIDIGGSLIKLVYF  96

Query  399   SRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLH  578
             S  + +              G  NG  R+    GG++HFVKFET ++++C+DFI +K LH
Sbjct  97    SPEDTQAE------------GWENGKTRNQ--AGGKIHFVKFETQRIDDCIDFIEAKGLH  142

Query  579   CGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLL  758
                      + +   +    I ATGGGA+K+AD F+ERLGV +EKEDEM+CLV+G+NFLL
Sbjct  143   ------RTHNGKGEPDGRVRIVATGGGAFKYADKFEERLGVLLEKEDEMDCLVSGSNFLL  196

Query  759   KAIRHEAFTHIEGHKEFVQIDQN-DLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGG  935
             KAIRHEAF +      F   + + DL+PYLLVNIGSGVSM+KVDGDG+++RVSG+++GGG
Sbjct  197   KAIRHEAFMYENSQTIFAPSNTDQDLYPYLLVNIGSGVSMLKVDGDGQYERVSGSSLGGG  256

Query  936   TYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKA  1115
             T+WGL RLLTKC+SFD++LELS RGDN  +DMLVGDIYG  DYS IGLSASTIASSFGK 
Sbjct  257   TFWGLCRLLTKCRSFDEMLELSSRGDNSKVDMLVGDIYGDRDYSAIGLSASTIASSFGKV  316

Query  1116  ISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTI  1295
             ++ENK+LEDY P DI+++L RM+SYNI  ++YLNA  YG++R+FFGGF+IRGH YTM+TI
Sbjct  317   VAENKDLEDYDPADIAVALTRMVSYNISHLAYLNAKAYGIQRVFFGGFYIRGHPYTMETI  376

Query  1296  SFAVNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             S+A+ FWSKG   A FLRHEGFLGA+GAF+
Sbjct  377   SYAIRFWSKGSMSAKFLRHEGFLGAVGAFL  406



>ref|XP_011034131.1| PREDICTED: pantothenate kinase 1-like isoform X2 [Populus euphratica]
Length=360

 Score =   397 bits (1021),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 226/355 (64%), Positives = 261/355 (74%), Gaps = 54/355 (15%)
 Frame = +3

Query  345   ISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKF  524
             IS LALDIGGSLIKLVYFSR+ G   +  + +      GVS+G       + GRLHF  F
Sbjct  18    ISRLALDIGGSLIKLVYFSRNSGDDEDPPKDKV-----GVSSG-------VNGRLHFAMF  65

Query  525   ETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVS  704
             ET K+N+CL FIS+ +L  GG                                       
Sbjct  66    ETAKINDCLQFISANKLLLGG---------------------------------------  86

Query  705   IEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKV  884
                + + NC   G +F+ KA+  EAFT++ G KEFVQI+ NDL+PYLLVNIGSGVSMIKV
Sbjct  87    -GFQHQENC-TNGMSFI-KAVNQEAFTYLNGSKEFVQINHNDLYPYLLVNIGSGVSMIKV  143

Query  885   DGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDY  1064
             DGDGKF+RVSGT+VGGGT+WGLG+LLTKC+SFD+LLELS RGDN+ ID LVGDIYGGMDY
Sbjct  144   DGDGKFERVSGTSVGGGTFWGLGKLLTKCQSFDELLELSHRGDNKAIDTLVGDIYGGMDY  203

Query  1065  SKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKri  1244
             SKIGLS++TIASSFGKA S  KELEDY+PEDIS SLLRMIS NIGQISYLNALR+GLKRI
Sbjct  204   SKIGLSSTTIASSFGKATSHCKELEDYKPEDISWSLLRMISNNIGQISYLNALRFGLKRI  263

Query  1245  ffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             FFGGFFIR H+YTMDTI+ AV+FWSKGEA+AMFLRHEGFLGALGAFMSYE+H LD
Sbjct  264   FFGGFFIRSHSYTMDTIAVAVHFWSKGEAKAMFLRHEGFLGALGAFMSYERHSLD  318



>emb|CDY47225.1| BnaC09g14740D [Brassica napus]
Length=581

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 236/357 (66%), Positives = 280/357 (78%), Gaps = 24/357 (7%)
 Frame = +3

Query  336   SDDISHLALDIGGSLIKLVYFSRH----EGrqvedkrkrkvkerFGVSNGNRRSYPILGG  503
             S  ISHLALDIGG+LIKLVYFS +    EG  +             V NG      ++ G
Sbjct  9     STQISHLALDIGGTLIKLVYFSPNGDNCEGGSIV------------VGNG----CSVVQG  52

Query  504   RLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLF  683
             RL F KFET K+++CLDFI    L   G+      +     +   +KATGGGA+KFADLF
Sbjct  53    RLCFAKFETRKIDDCLDFIRFNILQHSGVQ----HTNGTARDKLSVKATGGGAFKFADLF  108

Query  684   KERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGS  863
             KE+LG+  +KEDEM+ LV G NFLLK +  EAFT+++G KEFVQID NDL+PYLLVNIGS
Sbjct  109   KEKLGIVFDKEDEMHSLVCGVNFLLKTVPREAFTYLDGQKEFVQIDHNDLYPYLLVNIGS  168

Query  864   GVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGD  1043
             GVSMIKVDGDGK++R+SGT++GGGT+ GLG+LLT CKSFD+LLELS +G+NR IDMLVGD
Sbjct  169   GVSMIKVDGDGKYERISGTSLGGGTFLGLGKLLTNCKSFDELLELSHQGNNRVIDMLVGD  228

Query  1044  IYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNAL  1223
             IYGG DYSKIGLS++ IASSFGKAIS+ KELEDY+PED++ SLLRMIS NIGQI+YLNAL
Sbjct  229   IYGGTDYSKIGLSSTAIASSFGKAISDGKELEDYQPEDVARSLLRMISNNIGQIAYLNAL  288

Query  1224  RYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYE  1394
             R+GLKRIFFGGFFIRG  YTMDTIS AV+FWS+GEA+AMFLRHEGFLGALGAF SY+
Sbjct  289   RFGLKRIFFGGFFIRGLEYTMDTISVAVHFWSRGEAKAMFLRHEGFLGALGAFTSYK  345



>pir||T02294 hypothetical protein T13D8.31 - Arabidopsis thaliana
 gb|AAC24069.1| T13D8.31 [Arabidopsis thaliana]
Length=404

 Score =   395 bits (1016),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 234/372 (63%), Positives = 278/372 (75%), Gaps = 36/372 (10%)
 Frame = +3

Query  327   PNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGR  506
             P Q   ISHLALDIGG+LIKLVYFS +                   S  +R    ++ GR
Sbjct  3     PTQ---ISHLALDIGGTLIKLVYFSANGDY----------------SEESRNGCSVVKGR  43

Query  507   LHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNE-----------------NT  635
             L F KFET K+++CL+FI    LH   +    +S+   +                     
Sbjct  44    LCFAKFETRKIDDCLEFIRFNILHHSEVTIQVYSNRMAKVMINFMLSGIFVCKLIMVWYI  103

Query  636   IIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQ  815
             I KATGGGA+KFADLFKE+LG+  +KEDEM  LV G NFLLK +  EAFT+++G K+FV+
Sbjct  104   IPKATGGGAFKFADLFKEKLGILFDKEDEMCSLVGGVNFLLKTVPREAFTYLDGQKKFVE  163

Query  816   IDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLE  995
             ID NDL+PYLLVNIGSGVSMIKVDGDGK++R+SGT++GGGT+ GLG+LLTKCKSFD+LLE
Sbjct  164   IDHNDLYPYLLVNIGSGVSMIKVDGDGKYERISGTSLGGGTFLGLGKLLTKCKSFDELLE  223

Query  996   LSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLL  1175
             LS  G+NR IDMLVGDIYGG DYSKIGLS++ IASSFGKAIS+ KELEDY+PED++ SLL
Sbjct  224   LSHHGNNRVIDMLVGDIYGGTDYSKIGLSSTAIASSFGKAISDGKELEDYQPEDVARSLL  283

Query  1176  RMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHE  1355
             RMIS NIGQI+YLNALR+GLKRIFFGGFFIRG  YTMDTIS AV+FWS+GEA+AMFLRHE
Sbjct  284   RMISNNIGQIAYLNALRFGLKRIFFGGFFIRGLEYTMDTISVAVHFWSRGEAKAMFLRHE  343

Query  1356  GFLGALGAFMSY  1391
             GFLGALGAF SY
Sbjct  344   GFLGALGAFTSY  355



>ref|XP_002991207.1| hypothetical protein SELMODRAFT_161467 [Selaginella moellendorffii]
 gb|EFJ07751.1| hypothetical protein SELMODRAFT_161467 [Selaginella moellendorffii]
Length=711

 Score =   405 bits (1041),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 203/243 (84%), Positives = 230/243 (95%), Gaps = 0/243 (0%)
 Frame = +3

Query  678   LFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNI  857
             +FKERLGV+++KEDEM+CLVAGANFL +AIR EAFTH+EG+K+FVQIDQ+D+FPYLLVNI
Sbjct  1     MFKERLGVTLDKEDEMDCLVAGANFLQRAIRDEAFTHLEGNKQFVQIDQSDMFPYLLVNI  60

Query  858   GSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLV  1037
             GSGVSMIKVD DG+FQRVSGTNVGGGT+WGLGRLLT CK+FD +LELSQ+GDN  IDMLV
Sbjct  61    GSGVSMIKVDADGQFQRVSGTNVGGGTFWGLGRLLTGCKTFDQILELSQQGDNSAIDMLV  120

Query  1038  GDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLN  1217
             GDIYGG+DYSKIGLSASTIASSFG+ ISE K L DYR EDI+LSLLRMISYNIGQI+YLN
Sbjct  121   GDIYGGLDYSKIGLSASTIASSFGRVISETKSLSDYRKEDIALSLLRMISYNIGQIAYLN  180

Query  1218  ALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEK  1397
             A+RY LKRIFFGGFFIRGHAYTMDT+SFA++FWSKGEA+AMFLRHEGFLGALGAF+SY+K
Sbjct  181   AIRYKLKRIFFGGFFIRGHAYTMDTMSFAISFWSKGEAQAMFLRHEGFLGALGAFLSYDK  240

Query  1398  HGL  1406
             HGL
Sbjct  241   HGL  243



>ref|XP_006579568.1| PREDICTED: pantothenate kinase 2-like [Glycine max]
Length=246

 Score =   388 bits (997),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 199/247 (81%), Positives = 218/247 (88%), Gaps = 3/247 (1%)
 Frame = +3

Query  237  MHRSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGr  416
            MHRS+SRPQLDLS A IQGNFEEK PTILLPNQS DISHLALDIGGSLIKLVYFSRH  +
Sbjct  1    MHRSSSRPQLDLSKAEIQGNFEEKYPTILLPNQSHDISHLALDIGGSLIKLVYFSRHRDQ  60

Query  417  qvedkrkrkvkerFGVS-NGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLD  593
               DKR   V  R G   NGNRRSYPILGGRLHFVKFET+K+NECLDFI+SKQLHCG  +
Sbjct  61   STYDKRMINVNNRLGFPPNGNRRSYPILGGRLHFVKFETSKINECLDFINSKQLHCGEGE  120

Query  594  TPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRH  773
            + R+S +A  + N IIKATGGGA+KFADLFKERLG+S++KEDEMNCLVAGANFLLKAIR 
Sbjct  121  S-RYS-DATTDSNAIIKATGGGAHKFADLFKERLGLSLDKEDEMNCLVAGANFLLKAIRR  178

Query  774  EAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLG  953
            EAFTH+EG KEFVQID NDLFPYLLVNIGSGVSMIKVDGDGK++RV+GTNVGGGTYWGLG
Sbjct  179  EAFTHMEGQKEFVQIDTNDLFPYLLVNIGSGVSMIKVDGDGKYERVNGTNVGGGTYWGLG  238

Query  954  RLLTKCK  974
            RLLTKC+
Sbjct  239  RLLTKCE  245



>emb|CCD74517.1| Pantothenate kinase 1 [Arabidopsis halleri subsp. halleri]
Length=572

 Score =   396 bits (1018),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 237/387 (61%), Positives = 283/387 (73%), Gaps = 49/387 (13%)
 Frame = +3

Query  330   NQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRL  509
             + +  ISHLALDIGG+LIKLVYFS +                   S  +R    ++ G+L
Sbjct  2     DSTQKISHLALDIGGTLIKLVYFSANGD----------------YSEESRNGCSVVHGKL  45

Query  510   HFVKFETTKVNECLDFISSKQLH---CGGLDTPRWSSEAP----QNENT-----------  635
              F KFET K+++CL+FI    LH    G L  P   S++     Q E T           
Sbjct  46    CFAKFETRKIDDCLEFIRFNILHHSVNGFLQHPILDSKSAEVVTQTETTSADVEPGMGGN  105

Query  636   ---------------IIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIR  770
                             +KATGGGA+KFADLFKE+LG+  +KEDEM+ LV G NFLLK + 
Sbjct  106   DSGVQHPNGEALDKLYVKATGGGAFKFADLFKEKLGILFDKEDEMHSLVGGVNFLLKTVP  165

Query  771   HEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGL  950
              EAFT+++G KEFV+ID NDL+PYLLVNIGSGVSMIKVDGDGK++R+SGT++GGGT+ GL
Sbjct  166   REAFTYLDGQKEFVKIDHNDLYPYLLVNIGSGVSMIKVDGDGKYERISGTSLGGGTFLGL  225

Query  951   GRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENK  1130
             G+LLTKCKSFD+LLELS  G+NR IDMLVGDIYGG DYSKIGLS++ IASSFGKAIS+ K
Sbjct  226   GKLLTKCKSFDELLELSHHGNNRVIDMLVGDIYGGTDYSKIGLSSTAIASSFGKAISDGK  285

Query  1131  ELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVN  1310
             ELEDY+PED++ SLLRMIS NIGQI+YLNALR+GLKRIFFGGFFIRG  YTMDTIS AV+
Sbjct  286   ELEDYQPEDVARSLLRMISNNIGQIAYLNALRFGLKRIFFGGFFIRGLEYTMDTISVAVH  345

Query  1311  FWSKGEAEAMFLRHEGFLGALGAFMSY  1391
             FWS+GEA+AMFLRHEGFLGALGAF SY
Sbjct  346   FWSRGEAKAMFLRHEGFLGALGAFTSY  372



>ref|XP_005849803.1| hypothetical protein CHLNCDRAFT_34679 [Chlorella variabilis]
 gb|EFN57701.1| hypothetical protein CHLNCDRAFT_34679 [Chlorella variabilis]
Length=815

 Score =   401 bits (1030),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 214/353 (61%), Positives = 257/353 (73%), Gaps = 14/353 (4%)
 Frame = +3

Query  312   PTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYP  491
             P I+LP+QSD +SH+ALDIGGSLIKL+YF   +  +       +     G +       P
Sbjct  19    PCIVLPHQSDYVSHIALDIGGSLIKLIYFRMDDDEERLHAADVQSCSVHGAAG-----RP  73

Query  492   ILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKF  671
               GG+LHFVKFET KV EC+ FI +K LH          S         +KATGGGAYKF
Sbjct  74    ARGGKLHFVKFETAKVEECIAFIEAKGLH---------RSNDGSGIKMRVKATGGGAYKF  124

Query  672   ADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLV  851
             A+LFKERLG+ IE EDEM C+V G NF L A+RHEAF +  G  +FV +   + +PYLLV
Sbjct  125   AELFKERLGLIIEGEDEMACMVEGCNFFLNAVRHEAFQYENGQLQFVDLPTAEHYPYLLV  184

Query  852   NIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDM  1031
             NIGSGVSM++VDG+ KFQRVSGTN+GGGT+WGL +LLT   +FDD+L LS +GDN  +DM
Sbjct  185   NIGSGVSMVRVDGESKFQRVSGTNIGGGTFWGLCKLLTGMDNFDDILSLSSQGDNSNVDM  244

Query  1032  LVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISY  1211
             LVGDIYGG DY+ IGLSA+TIASSFGK I++++ELE Y   D+  SL RMISYNIGQ++Y
Sbjct  245   LVGDIYGGRDYTGIGLSANTIASSFGKVINQHQELEQYNSADVVQSLCRMISYNIGQLAY  304

Query  1212  LNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGA  1370
             LNA RY L RIFFGGFFIRGH YTM+TISFA+ FWSKGE  AMFLRHEGFLGA
Sbjct  305   LNAKRYNLSRIFFGGFFIRGHPYTMETISFAIRFWSKGEMAAMFLRHEGFLGA  357



>ref|XP_006374524.1| hypothetical protein POPTR_0015s08830g [Populus trichocarpa]
 ref|XP_002322167.2| hypothetical protein POPTR_0015s08830g [Populus trichocarpa]
 gb|ERP52321.1| hypothetical protein POPTR_0015s08830g [Populus trichocarpa]
 gb|EEF06294.2| hypothetical protein POPTR_0015s08830g [Populus trichocarpa]
Length=715

 Score =   397 bits (1021),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 205/216 (95%), Positives = 212/216 (98%), Gaps = 0/216 (0%)
 Frame = +3

Query  762   AIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTY  941
             AIRHEAFTH+EG KEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKF+RVSGTNVGGGTY
Sbjct  30    AIRHEAFTHMEGQKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFERVSGTNVGGGTY  89

Query  942   WGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAIS  1121
             WGLGRLLTKCKSFD+LLELSQRGDNRTIDMLVGDIYGGMDY+KIGLSASTIASSFGK IS
Sbjct  90    WGLGRLLTKCKSFDELLELSQRGDNRTIDMLVGDIYGGMDYNKIGLSASTIASSFGKTIS  149

Query  1122  ENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISF  1301
             E KEL DYRPEDISLSLLRMISYNIGQISYLNALR+GLKRIFFGGFFIRGHAYTMDTISF
Sbjct  150   EKKELADYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISF  209

Query  1302  AVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             AV+FWSKGEA+AMFLRHEGFLGALGAFMSYEKHGLD
Sbjct  210   AVHFWSKGEAQAMFLRHEGFLGALGAFMSYEKHGLD  245



>ref|XP_002951581.1| hypothetical protein VOLCADRAFT_61514 [Volvox carteri f. nagariensis]
 gb|EFJ47392.1| hypothetical protein VOLCADRAFT_61514, partial [Volvox carteri 
f. nagariensis]
Length=842

 Score =   400 bits (1029),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 220/373 (59%), Positives = 280/373 (75%), Gaps = 29/373 (8%)
 Frame = +3

Query  312   PTILLPNQ-SDDISHLALDIGGSLIKLVYFSRH--------EGrqvedkrkrkvkerFGV  464
             P+I LPNQ ++ +SH+A+DIGGSLIKLVYFS          EG           +   G+
Sbjct  1     PSIQLPNQDAEYVSHIAIDIGGSLIKLVYFSPDPIDTGSAGEGDTPSGSPPVNSE---GL  57

Query  465   SNGNRRSYPILG---GRLHFVKFETTKVNECLDFISSKQLH--CGGLDTPRWSSEAPQNE  629
             S  + RS P      G+LHFVKFET +V + ++FI +K LH  CG   T          +
Sbjct  58    SQASSRS-PQQNSQRGKLHFVKFETNRVEDAINFIEAKGLHRYCGRNGT----------K  106

Query  630   NTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEF  809
                +KATGGGAYK+AD+FKERLGV +EKEDEM CLV+G NFLLKAI HEAFT+  G   F
Sbjct  107   EMRVKATGGGAYKYADVFKERLGVVLEKEDEMACLVSGCNFLLKAIHHEAFTYEAGATTF  166

Query  810   VQIDQN-DLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDD  986
             V  +++ DL+PYLLVNIGSGVSM+KV GD  F+RVSG+++GGGTYWGL +LLT+  +FD+
Sbjct  167   VPTNEDSDLYPYLLVNIGSGVSMVKVSGDNLFERVSGSSIGGGTYWGLCQLLTQRTNFDE  226

Query  987   LLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISL  1166
             +LELS RGDN ++DMLVGDIYGG DY+ IGLSA+TIASSFGK ++++K L DY P D+ L
Sbjct  227   MLELSVRGDNSSVDMLVGDIYGGRDYASIGLSATTIASSFGKVVTQDKSLADYNPADMCL  286

Query  1167  SLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFL  1346
             +L RM++YNIGQ++++NA+R+G+KRIFFGGFFIRGH YTM+TIS+A+ FWSKGE  AMFL
Sbjct  287   ALCRMVAYNIGQLAHMNAVRHGIKRIFFGGFFIRGHPYTMETISYAIRFWSKGEMAAMFL  346

Query  1347  RHEGFLGALGAFM  1385
             RHEGFLGA+GAF+
Sbjct  347   RHEGFLGAVGAFL  359



>ref|XP_011395801.1| Pantothenate kinase 2 [Auxenochlorella protothecoides]
 gb|KFM22935.1| Pantothenate kinase 2 [Auxenochlorella protothecoides]
Length=951

 Score =   400 bits (1029),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 221/392 (56%), Positives = 274/392 (70%), Gaps = 46/392 (12%)
 Frame = +3

Query  243   RSTSRPQLDLSGAAIQ--------GNFEEKD-PTILLPNQSDDISHLALDIGGSLIKLVY  395
             ++ S   LDL+ A I         G    +D P ILLP+Q++ + H+ALDIGGSLIKLVY
Sbjct  2     KTASPSTLDLTDACISQEAPSAESGTQRRRDAPLILLPHQNEYVGHIALDIGGSLIKLVY  61

Query  396   FSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQL  575
             F++                                 +LHFVKFE++K+ EC+DF+ +K+L
Sbjct  62    FTKGSSDASSSAGG----------------------KLHFVKFESSKIEECMDFMEAKRL  99

Query  576   H--CGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGAN  749
             H   GG            NE   +KATGGGA+K+A+ FKERLG+ +E+EDEM+CLV G N
Sbjct  100   HRSNGG------------NEPMRVKATGGGAFKYAERFKERLGLILEREDEMSCLVEGCN  147

Query  750   FLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVG  929
             FLLKA+RHEAF + E  +   +    DL+PYLLVNIGSGVSM+KVDG+GK+ RVSGTNVG
Sbjct  148   FLLKAVRHEAFMY-ENQQMIFEETGPDLYPYLLVNIGSGVSMVKVDGEGKYTRVSGTNVG  206

Query  930   GGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFG  1109
             GGT+WGL RLLT   +FDD+L LS +GDN  +DMLVGDIYGG DY+ IGLSA+TIASSFG
Sbjct  207   GGTFWGLCRLLTGVNNFDDILTLSSQGDNSNVDMLVGDIYGGRDYTGIGLSANTIASSFG  266

Query  1110  KAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMD  1289
             K I+ + E  DY P DI++SL RMISYNIGQ++YLNA RY L RI+FGGFFIRGH YTMD
Sbjct  267   KVINTSMEPSDYNPADIAMSLCRMISYNIGQLAYLNAKRYNLPRIYFGGFFIRGHPYTMD  326

Query  1290  TISFAVNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             TISFA+ FWSKGE  A FLRHEGFLGA+GA++
Sbjct  327   TISFAIQFWSKGEMSAKFLRHEGFLGAVGAYL  358



>ref|XP_011086582.1| PREDICTED: pantothenate kinase 1-like isoform X5 [Sesamum indicum]
Length=306

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 190/291 (65%), Positives = 239/291 (82%), Gaps = 5/291 (2%)
 Frame = +3

Query  339   DDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFV  518
             D +SHLALDIGGSLIK+VYFS       +D+    ++E    S+GN   Y +L GRLHF+
Sbjct  21    DQVSHLALDIGGSLIKMVYFSSSSSCSTDDQENGFIREGTNTSSGNLE-YRVLSGRLHFL  79

Query  519   KFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLG  698
             KFET+K++EC++FISSK+L   G        EAP  +  I+KATGGGA+KF+DLFKE+LG
Sbjct  80    KFETSKISECIEFISSKRLQHYG----DQGDEAPAGDKHIVKATGGGAFKFSDLFKEKLG  135

Query  699   VSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMI  878
             + ++K DEM+ LVAGANFLLKA+ HEAFT+++G K++VQID  DL+PYLLVN+GSGVSMI
Sbjct  136   IILDKVDEMSSLVAGANFLLKAVHHEAFTYMDGVKDYVQIDHKDLYPYLLVNVGSGVSMI  195

Query  879   KVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGM  1058
             KVDGD +F+RVSGT+VGGGT+WGLG+LLTKCKSFD+LLELS +G+NR IDMLVGDIYGG 
Sbjct  196   KVDGDNEFERVSGTSVGGGTFWGLGKLLTKCKSFDELLELSHQGNNRVIDMLVGDIYGGT  255

Query  1059  DYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISY  1211
              YSKIGL+++TIASSFGKA+S+NKELEDYR ED++ SLLRMIS NIGQ+ +
Sbjct  256   GYSKIGLTSTTIASSFGKAVSQNKELEDYRTEDVARSLLRMISNNIGQVKW  306



>ref|XP_011086580.1| PREDICTED: pantothenate kinase 1-like isoform X3 [Sesamum indicum]
Length=339

 Score =   379 bits (972),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 191/297 (64%), Positives = 240/297 (81%), Gaps = 5/297 (2%)
 Frame = +3

Query  339   DDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFV  518
             D +SHLALDIGGSLIK+VYFS       +D+    ++E    S+GN   Y +L GRLHF+
Sbjct  21    DQVSHLALDIGGSLIKMVYFSSSSSCSTDDQENGFIREGTNTSSGNLE-YRVLSGRLHFL  79

Query  519   KFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLG  698
             KFET+K++EC++FISSK+L   G        EAP  +  I+KATGGGA+KF+DLFKE+LG
Sbjct  80    KFETSKISECIEFISSKRLQHYG----DQGDEAPAGDKHIVKATGGGAFKFSDLFKEKLG  135

Query  699   VSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMI  878
             + ++K DEM+ LVAGANFLLKA+ HEAFT+++G K++VQID  DL+PYLLVN+GSGVSMI
Sbjct  136   IILDKVDEMSSLVAGANFLLKAVHHEAFTYMDGVKDYVQIDHKDLYPYLLVNVGSGVSMI  195

Query  879   KVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGM  1058
             KVDGD +F+RVSGT+VGGGT+WGLG+LLTKCKSFD+LLELS +G+NR IDMLVGDIYGG 
Sbjct  196   KVDGDNEFERVSGTSVGGGTFWGLGKLLTKCKSFDELLELSHQGNNRVIDMLVGDIYGGT  255

Query  1059  DYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRY  1229
              YSKIGL+++TIASSFGKA+S+NKELEDYR ED++ SLLRMIS NIGQ   +   +Y
Sbjct  256   GYSKIGLTSTTIASSFGKAVSQNKELEDYRTEDVARSLLRMISNNIGQTILMYMKKY  312



>ref|XP_011086579.1| PREDICTED: pantothenate kinase 1-like isoform X2 [Sesamum indicum]
Length=344

 Score =   378 bits (971),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 194/298 (65%), Positives = 241/298 (81%), Gaps = 6/298 (2%)
 Frame = +3

Query  339   DDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFV  518
             D +SHLALDIGGSLIK+VYFS       +D+    ++E    S+GN   Y +L GRLHF+
Sbjct  21    DQVSHLALDIGGSLIKMVYFSSSSSCSTDDQENGFIREGTNTSSGNLE-YRVLSGRLHFL  79

Query  519   KFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLG  698
             KFET+K++EC++FISSK+L   G        EAP  +  I+KATGGGA+KF+DLFKE+LG
Sbjct  80    KFETSKISECIEFISSKRLQHYG----DQGDEAPAGDKHIVKATGGGAFKFSDLFKEKLG  135

Query  699   VSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMI  878
             + ++K DEM+ LVAGANFLLKA+ HEAFT+++G K++VQID  DL+PYLLVN+GSGVSMI
Sbjct  136   IILDKVDEMSSLVAGANFLLKAVHHEAFTYMDGVKDYVQIDHKDLYPYLLVNVGSGVSMI  195

Query  879   KVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGM  1058
             KVDGD +F+RVSGT+VGGGT+WGLG+LLTKCKSFD+LLELS +G+NR IDMLVGDIYGG 
Sbjct  196   KVDGDNEFERVSGTSVGGGTFWGLGKLLTKCKSFDELLELSHQGNNRVIDMLVGDIYGGT  255

Query  1059  DYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQ-ISYLNALRY  1229
              YSKIGL+++TIASSFGKA+S+NKELEDYR ED++ SLLRMIS NIGQ IS    L Y
Sbjct  256   GYSKIGLTSTTIASSFGKAVSQNKELEDYRTEDVARSLLRMISNNIGQMISAQTILMY  313



>ref|XP_008789287.1| PREDICTED: pantothenate kinase 1-like [Phoenix dactylifera]
Length=628

 Score =   387 bits (995),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 216/385 (56%), Positives = 280/385 (73%), Gaps = 25/385 (6%)
 Frame = +3

Query  261   QLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSR-HEGrqvedkrk  437
             +L+LSGA I GN +E++P I LPNQ  D S LALDIGG+LIKLVYFS  +EG +      
Sbjct  7     KLELSGAEISGNLDERNPPICLPNQPSDASLLALDIGGTLIKLVYFSGGNEGNEQ-----  61

Query  438   rkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQL-HCGGLDTPRWSSE  614
                     + +GN      LGG L FVKFE  ++ +CL+FI SK+L H  G+ T      
Sbjct  62    --------IGSGN----ATLGGELRFVKFERRRLGDCLEFIKSKKLIHDSGIIT------  103

Query  615   APQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIE  794
                N +  IKATGGGAYKFAD+FKE+LGVS++K DEM+ +VAGANFLLK I  E+FTH++
Sbjct  104   GLSNGHVAIKATGGGAYKFADVFKEKLGVSLDKLDEMDSVVAGANFLLKKIPGESFTHMD  163

Query  795   GHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCK  974
             G +  ++I+Q +LFPYLLVNIGSGV +IKV G+  F+RV+GT++GGGT +GL +LLT C 
Sbjct  164   GKRTPIEINQKNLFPYLLVNIGSGVGIIKVTGNKIFERVTGTHIGGGTIFGLAKLLTGCT  223

Query  975   SFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPE  1154
             S+DD L+LSQ+GDN  +D++V DI G +   K GLSAST+ASSFGK I   ++L DYR E
Sbjct  224   SYDDFLKLSQQGDNLVLDLIVKDICGELACQKQGLSASTLASSFGKVIDSKRKLSDYRAE  283

Query  1155  DISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAE  1334
             D++ +LL   +YNI QIS+L A   GLKR+FFGG +IRGHA TMD IS+A+++WSKG+ +
Sbjct  284   DLATTLLSAFTYNIAQISFLVAALLGLKRVFFGGSYIRGHASTMDNISYAIDYWSKGQMQ  343

Query  1335  AMFLRHEGFLGALGAFMSYEKHGLD  1409
             A+FLRHEGFLGALGA MSYE   +D
Sbjct  344   AIFLRHEGFLGALGALMSYENLDVD  368


 Score =   211 bits (538),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 150/196 (77%), Gaps = 2/196 (1%)
 Frame = +3

Query  822   QNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELS  1001
             ++++FPYLLVNIGSGVSM++V G GKF+R+ GT++GGGT  GL RLLT C S+++ L+LS
Sbjct  401   ESNIFPYLLVNIGSGVSMVEVIGKGKFERIIGTHLGGGTILGLARLLTGCTSYEEFLQLS  460

Query  1002  QRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRM  1181
             Q+G+N ++D+ VGDIYG + Y K GL AST ASSFGK +S NK L DY+ ED++ +LL  
Sbjct  461   QQGNNLSVDLTVGDIYGELGYPKHGLPASTTASSFGK-VSSNK-LSDYKAEDLAAALLNA  518

Query  1182  ISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGF  1361
              +YNIGQISY  A   GLK+IFF G +I GHA T+D IS ++ +WSKG+ +  FL HEGF
Sbjct  519   FTYNIGQISYFVANLSGLKKIFFRGAYICGHAKTIDKISRSLKYWSKGQVQTTFLCHEGF  578

Query  1362  LGALGAFMSYEKHGLD  1409
             L A+GAF SYE  G+D
Sbjct  579   LEAVGAFWSYENMGID  594



>ref|XP_011086581.1| PREDICTED: pantothenate kinase 1-like isoform X4 [Sesamum indicum]
Length=313

 Score =   376 bits (966),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 190/288 (66%), Positives = 237/288 (82%), Gaps = 5/288 (2%)
 Frame = +3

Query  339   DDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFV  518
             D +SHLALDIGGSLIK+VYFS       +D+    ++E    S+GN   Y +L GRLHF+
Sbjct  21    DQVSHLALDIGGSLIKMVYFSSSSSCSTDDQENGFIREGTNTSSGNLE-YRVLSGRLHFL  79

Query  519   KFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLG  698
             KFET+K++EC++FISSK+L   G        EAP  +  I+KATGGGA+KF+DLFKE+LG
Sbjct  80    KFETSKISECIEFISSKRLQHYG----DQGDEAPAGDKHIVKATGGGAFKFSDLFKEKLG  135

Query  699   VSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMI  878
             + ++K DEM+ LVAGANFLLKA+ HEAFT+++G K++VQID  DL+PYLLVN+GSGVSMI
Sbjct  136   IILDKVDEMSSLVAGANFLLKAVHHEAFTYMDGVKDYVQIDHKDLYPYLLVNVGSGVSMI  195

Query  879   KVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGM  1058
             KVDGD +F+RVSGT+VGGGT+WGLG+LLTKCKSFD+LLELS +G+NR IDMLVGDIYGG 
Sbjct  196   KVDGDNEFERVSGTSVGGGTFWGLGKLLTKCKSFDELLELSHQGNNRVIDMLVGDIYGGT  255

Query  1059  DYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQ  1202
              YSKIGL+++TIASSFGKA+S+NKELEDYR ED++ SLLRMIS NIGQ
Sbjct  256   GYSKIGLTSTTIASSFGKAVSQNKELEDYRTEDVARSLLRMISNNIGQ  303



>ref|XP_010932472.1| PREDICTED: pantothenate kinase 1 isoform X2 [Elaeis guineensis]
Length=526

 Score =   382 bits (982),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 212/385 (55%), Positives = 282/385 (73%), Gaps = 25/385 (6%)
 Frame = +3

Query  261   QLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSR-HEGrqvedkrk  437
             +L+LSGA I GN +E++P + LPNQ  D S LALDIGG+LIKLVYFS  +EG +      
Sbjct  7     KLELSGAEIFGNLDERNPPVRLPNQPSDASLLALDIGGTLIKLVYFSDGNEGNEQ-----  61

Query  438   rkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQL-HCGGLDTPRWSSE  614
                     + +GN      LGG L FVKFE  ++++CL+FI SK+L H  G+ T      
Sbjct  62    --------IGSGN----AALGGELRFVKFERRRLDDCLEFIKSKKLIHSSGIVT------  103

Query  615   APQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIE  794
                + +  IKATGGGAYKF D+FKE+LGVS++K DEM+ +VAGAN LLK I  E+FTH++
Sbjct  104   GLSDGHLTIKATGGGAYKFTDVFKEKLGVSLDKLDEMDGVVAGANLLLKKIPGESFTHMD  163

Query  795   GHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCK  974
             G +  ++I++ +LFPYLLVNIGSGVS+IKV G+ KF+RV+GT++GGGT +GL +LLT C 
Sbjct  164   GKRTPIEINRKNLFPYLLVNIGSGVSIIKVTGNKKFERVTGTHIGGGTMFGLAKLLTGCT  223

Query  975   SFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPE  1154
             S+D+ L+LSQ+GDN  +D++V DI G +   K GLSAST+ASSFGK I+  ++L DYR E
Sbjct  224   SYDEFLKLSQQGDNLVLDLIVKDICGELACQKQGLSASTLASSFGKVINSKRKLSDYRAE  283

Query  1155  DISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAE  1334
             D++ +LL   +YNI QIS+L A   GLKR+FFGG +IRGHA TMD IS+A+++WSKG+ +
Sbjct  284   DLATTLLSAFTYNIAQISFLVAALLGLKRVFFGGSYIRGHASTMDNISYAIDYWSKGQMQ  343

Query  1335  AMFLRHEGFLGALGAFMSYEKHGLD  1409
             A+FLRHEGFLGALGA MSYE   +D
Sbjct  344   AIFLRHEGFLGALGALMSYENLDVD  368


 Score =   155 bits (391),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 100/127 (79%), Gaps = 2/127 (2%)
 Frame = +3

Query  822   QNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELS  1001
             +N++FPYLLVNIGSGVSM++V G GKF+R+ GT++GGGT  GL RLLT C S+++ LELS
Sbjct  401   ENNIFPYLLVNIGSGVSMVEVIGKGKFERIIGTHLGGGTILGLARLLTGCTSYEEFLELS  460

Query  1002  QRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRM  1181
             Q+G+N  +D+ VGDIYG + Y K GL AST ASSFGK +S NK L DY+ ED++ +LL  
Sbjct  461   QQGNNLAVDLTVGDIYGELGYPKHGLPASTTASSFGK-VSSNK-LSDYKAEDLAAALLNA  518

Query  1182  ISYNIGQ  1202
              +YNIGQ
Sbjct  519   FTYNIGQ  525



>ref|XP_010932471.1| PREDICTED: pantothenate kinase 1 isoform X1 [Elaeis guineensis]
Length=669

 Score =   382 bits (982),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 212/385 (55%), Positives = 282/385 (73%), Gaps = 25/385 (6%)
 Frame = +3

Query  261   QLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSR-HEGrqvedkrk  437
             +L+LSGA I GN +E++P + LPNQ  D S LALDIGG+LIKLVYFS  +EG +      
Sbjct  7     KLELSGAEIFGNLDERNPPVRLPNQPSDASLLALDIGGTLIKLVYFSDGNEGNEQ-----  61

Query  438   rkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQL-HCGGLDTPRWSSE  614
                     + +GN      LGG L FVKFE  ++++CL+FI SK+L H  G+ T      
Sbjct  62    --------IGSGN----AALGGELRFVKFERRRLDDCLEFIKSKKLIHSSGIVT------  103

Query  615   APQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIE  794
                + +  IKATGGGAYKF D+FKE+LGVS++K DEM+ +VAGAN LLK I  E+FTH++
Sbjct  104   GLSDGHLTIKATGGGAYKFTDVFKEKLGVSLDKLDEMDGVVAGANLLLKKIPGESFTHMD  163

Query  795   GHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCK  974
             G +  ++I++ +LFPYLLVNIGSGVS+IKV G+ KF+RV+GT++GGGT +GL +LLT C 
Sbjct  164   GKRTPIEINRKNLFPYLLVNIGSGVSIIKVTGNKKFERVTGTHIGGGTMFGLAKLLTGCT  223

Query  975   SFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPE  1154
             S+D+ L+LSQ+GDN  +D++V DI G +   K GLSAST+ASSFGK I+  ++L DYR E
Sbjct  224   SYDEFLKLSQQGDNLVLDLIVKDICGELACQKQGLSASTLASSFGKVINSKRKLSDYRAE  283

Query  1155  DISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAE  1334
             D++ +LL   +YNI QIS+L A   GLKR+FFGG +IRGHA TMD IS+A+++WSKG+ +
Sbjct  284   DLATTLLSAFTYNIAQISFLVAALLGLKRVFFGGSYIRGHASTMDNISYAIDYWSKGQMQ  343

Query  1335  AMFLRHEGFLGALGAFMSYEKHGLD  1409
             A+FLRHEGFLGALGA MSYE   +D
Sbjct  344   AIFLRHEGFLGALGALMSYENLDVD  368


 Score =   214 bits (545),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 148/196 (76%), Gaps = 2/196 (1%)
 Frame = +3

Query  822   QNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELS  1001
             +N++FPYLLVNIGSGVSM++V G GKF+R+ GT++GGGT  GL RLLT C S+++ LELS
Sbjct  401   ENNIFPYLLVNIGSGVSMVEVIGKGKFERIIGTHLGGGTILGLARLLTGCTSYEEFLELS  460

Query  1002  QRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRM  1181
             Q+G+N  +D+ VGDIYG + Y K GL AST ASSFGK +S NK L DY+ ED++ +LL  
Sbjct  461   QQGNNLAVDLTVGDIYGELGYPKHGLPASTTASSFGK-VSSNK-LSDYKAEDLAAALLNA  518

Query  1182  ISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGF  1361
              +YNIGQISY  A   GLK+IFF G +I GH  T+D IS ++ +WSKG+ +  FL HEGF
Sbjct  519   FTYNIGQISYFVANLSGLKKIFFRGAYICGHTKTIDKISRSLKYWSKGQVQTTFLCHEGF  578

Query  1362  LGALGAFMSYEKHGLD  1409
             L ALGAF SYE  G+D
Sbjct  579   LEALGAFWSYENMGID  594



>ref|XP_002991270.1| hypothetical protein SELMODRAFT_269774 [Selaginella moellendorffii]
 gb|EFJ07698.1| hypothetical protein SELMODRAFT_269774 [Selaginella moellendorffii]
Length=696

 Score =   380 bits (977),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = +3

Query  723   MNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKF  902
             M+CLVAGANFL +AIR EAFTH+EG+K+FVQIDQ+D+FPYLLVNIGSGVSMIKVD DG+F
Sbjct  1     MDCLVAGANFLQRAIRDEAFTHLEGNKQFVQIDQSDMFPYLLVNIGSGVSMIKVDADGQF  60

Query  903   QRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLS  1082
             QRVSGTNVGGGT+WGLGRLLT CK+FD +LELSQ+GDN  IDMLVGDIYGG+DYSKIGLS
Sbjct  61    QRVSGTNVGGGTFWGLGRLLTGCKTFDQILELSQQGDNSAIDMLVGDIYGGLDYSKIGLS  120

Query  1083  ASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggff  1262
             ASTIASSFG+ ISE K L DYR EDI+LSLLRMISYNIGQI+YLNA+RY LKRIFFGGFF
Sbjct  121   ASTIASSFGRVISETKSLSDYRKEDIALSLLRMISYNIGQIAYLNAIRYKLKRIFFGGFF  180

Query  1263  irgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGL  1406
             IRGHAYTMDT+SFA++FWSKGEA+AMFLRHEGFLGALGAF+SY+KHGL
Sbjct  181   IRGHAYTMDTMSFAISFWSKGEAQAMFLRHEGFLGALGAFLSYDKHGL  228



>ref|XP_001768632.1| predicted protein [Physcomitrella patens]
 gb|EDQ66570.1| predicted protein [Physcomitrella patens]
Length=700

 Score =   380 bits (976),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 191/228 (84%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = +3

Query  723   MNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKF  902
             M CLVAGANFLL+AIR EAFTH+EG K+FVQID NDL+PYLLVNIGSGVSMIKVDGDG++
Sbjct  1     MGCLVAGANFLLRAIRDEAFTHLEGEKKFVQIDHNDLYPYLLVNIGSGVSMIKVDGDGQY  60

Query  903   QRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLS  1082
             +RVSGTNVGGGT+WGLGRLLTKCK+FD++LELSQ GDN  IDMLVGDIYGG+DYSKIGLS
Sbjct  61    ERVSGTNVGGGTFWGLGRLLTKCKNFDEILELSQGGDNSAIDMLVGDIYGGLDYSKIGLS  120

Query  1083  ASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggff  1262
             ASTIASSFGK I+++K+L +YR EDI+LSLLRMISYNIGQ++YLNALRYGLKRIFFGGFF
Sbjct  121   ASTIASSFGKVIAQDKDLSEYRREDIALSLLRMISYNIGQVAYLNALRYGLKRIFFGGFF  180

Query  1263  irgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGL  1406
             IRGHAYTMDT+SFA+ +WSKGEA+AMFLRHEGFLGALGAF+SY+KHGL
Sbjct  181   IRGHAYTMDTMSFAIRYWSKGEAQAMFLRHEGFLGALGAFLSYDKHGL  228



>gb|EPS71980.1| hypothetical protein M569_02777 [Genlisea aurea]
Length=537

 Score =   369 bits (948),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 222/354 (63%), Positives = 274/354 (77%), Gaps = 18/354 (5%)
 Frame = +3

Query  345   ISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPIL-GGRLHFVK  521
             IS LA+DIGGSLIK+VY S  +G  V      ++       N +   + I  GG L F+ 
Sbjct  196   ISRLAIDIGGSLIKVVYLS-GDGHNVSSSADERL-------NHDSSLHDIFPGGGLDFLT  247

Query  522   FETTKVNECLDFISSKQLHCGGL-DTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLG  698
             FET+K+NE ++F+SS  L  G   D   WS      E  ++KATGGGA+KFA LF E+LG
Sbjct  248   FETSKINEFIEFLSSVLLQRGARRDEAEWS------EKLVVKATGGGAFKFASLFMEKLG  301

Query  699   VSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMI  878
             ++++K DEM+ LVAGAN +LKA   EAFT+++G KE+V+ID+ DL+PYLLVNIGSGVSMI
Sbjct  302   ITLDKVDEMDSLVAGANLVLKAWDREAFTYMDGRKEYVEIDEKDLYPYLLVNIGSGVSMI  361

Query  879   KVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGM  1058
             KVD   KF+RVSGT++GGGT  GLGRLLTKCKSFD+LLELS  G+NR +DMLVGDIYGGM
Sbjct  362   KVDSGDKFERVSGTSIGGGTLLGLGRLLTKCKSFDELLELSVEGNNRAVDMLVGDIYGGM  421

Query  1059  DYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIG--QISYLNALRYG  1232
             DY+KIGL+++ IASSFGKA+SE KELEDYR ED++ SLLRMIS NI   QI+YLNAL + 
Sbjct  422   DYAKIGLTSTAIASSFGKAVSERKELEDYRGEDVARSLLRMISNNIAQVQIAYLNALHHS  481

Query  1233  LKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYE  1394
             +KRI FGGFFIRGH YTMDTIS  V++WSKGEA+AMFLRHEGFLGALGAF++Y+
Sbjct  482   MKRILFGGFFIRGHEYTMDTISVGVHYWSKGEAKAMFLRHEGFLGALGAFLAYD  535



>gb|ADN33844.1| pantotenate kinase family protein [Cucumis melo subsp. melo]
Length=303

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/292 (64%), Positives = 231/292 (79%), Gaps = 15/292 (5%)
 Frame = +3

Query  333   QSD-DISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRL  509
             QSD  ISHLALDIGG+L KLVYF  ++     D+ +        V  G R S  I+ G+L
Sbjct  15    QSDSQISHLALDIGGTLAKLVYFCGNKRLLKNDEVQSS------VKAGGR-SRTIIQGKL  67

Query  510   HFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKE  689
             HF KFET+K++EC+ FI+ KQL   G   P+       N+  ++KATGGGA+KFA+LFKE
Sbjct  68    HFTKFETSKIDECIAFINRKQL---GSHHPK----DLDNDRIVVKATGGGAFKFAELFKE  120

Query  690   RLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGV  869
             +L   ++KEDEM+CLVAGANFLLKA+  EAFT+I G KEFVQI+Q+DL+PYLLVNIGSGV
Sbjct  121   KLDFCLDKEDEMDCLVAGANFLLKAVDQEAFTYIGGQKEFVQINQDDLYPYLLVNIGSGV  180

Query  870   SMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIY  1049
             SMIKVDG+GKF+RVSGT++GGGT+WGLG+LLTKC SFD+LLELS +G+NR +DMLVGDIY
Sbjct  181   SMIKVDGNGKFERVSGTSLGGGTFWGLGKLLTKCNSFDELLELSHQGNNRVVDMLVGDIY  240

Query  1050  GGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQI  1205
             GG+DYSK+GLS++ IASSFGK IS NK LE+YR ED++ SLLRMIS NIGQ+
Sbjct  241   GGIDYSKMGLSSTAIASSFGKTISTNKVLENYRTEDLARSLLRMISNNIGQV  292



>ref|XP_009419129.1| PREDICTED: pantothenate kinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=662

 Score =   371 bits (952),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 201/382 (53%), Positives = 269/382 (70%), Gaps = 37/382 (10%)
 Frame = +3

Query  264   LDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrk  443
             L+L GA I+G+ +E++P I LPNQ  D S LALDIGG+LIKLVYFS              
Sbjct  8     LNLGGAEIRGDPDERNPPIFLPNQPPDSSLLALDIGGTLIKLVYFSE-------------  54

Query  444   vkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQ  623
                                G LHFVKFE  ++++CLDFI SK+L      +P   S  P 
Sbjct  55    -------------------GLLHFVKFERRRLHDCLDFIRSKKL-----ISPNGFSAEPS  90

Query  624   NENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHK  803
             N +  IKATGGGA+KF   FKE LGVS++K DE++ +VAGANFLLK I  E+FTH++G +
Sbjct  91    NGHATIKATGGGAFKFTGRFKEILGVSLDKLDEIDSVVAGANFLLKEIPGESFTHMDGKR  150

Query  804   EFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFD  983
             + V+ID+N+LFPYLLVNIGSGV +IKV G+ KF+RV+GT++GGGT +GL +LLT C S+D
Sbjct  151   QPVEIDRNNLFPYLLVNIGSGVGLIKVTGNRKFERVTGTHIGGGTMFGLAKLLTGCLSYD  210

Query  984   DLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDIS  1163
             + L+LSQ+GDN  +D++V DI G +   + GLSAST+ASSFGK I+  + L DY+PED++
Sbjct  211   EFLKLSQQGDNLVLDLIVKDICGDLVSEQQGLSASTLASSFGKVITSKRTLSDYKPEDLA  270

Query  1164  LSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMF  1343
              +LL   +YNI Q+++L A   G  R+FFGG +IRGH  TMD IS+A+++WSKG+ +A F
Sbjct  271   TTLLSAFTYNIAQVAFLVAALLGFNRVFFGGSYIRGHPSTMDNISYAISYWSKGQMQATF  330

Query  1344  LRHEGFLGALGAFMSYEKHGLD  1409
             LRHEGFLGALGA MSY++ G++
Sbjct  331   LRHEGFLGALGALMSYKELGIE  352


 Score =   207 bits (526),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = +3

Query  819   DQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLEL  998
             +++++FPYLLVN+GSGVSMI+V G  KF+R+ GT++GGGT  GL RLLT C S+++ LEL
Sbjct  385   NEHNIFPYLLVNVGSGVSMIEVIGKWKFERIIGTHLGGGTILGLARLLTGCTSYEEFLEL  444

Query  999   SQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLR  1178
             SQRG+N  +D+ VGDIYG   Y K GL AST ASSFGK  S   +L DY+ ED++ +LL 
Sbjct  445   SQRGNNLAVDLTVGDIYGKEGYPKHGLPASTTASSFGKVTS--NKLSDYKAEDLAAALLN  502

Query  1179  MISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEG  1358
               +YNIGQIS   A   GLK+IFF G +I GH   MD IS ++ +WSKG+ +  FL HEG
Sbjct  503   AFTYNIGQISCFVAKLSGLKKIFFRGTYICGHEKIMDKISCSMKYWSKGQLQTTFLCHEG  562

Query  1359  FLGALGAFMSYEKHGLD  1409
             FLGA+GAF SYE  G+D
Sbjct  563   FLGAVGAFWSYENMGID  579



>ref|XP_002507494.1| pantothenate kinase [Micromonas sp. RCC299]
 gb|ACO68752.1| pantothenate kinase [Micromonas sp. RCC299]
Length=940

 Score =   377 bits (967),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 205/365 (56%), Positives = 259/365 (71%), Gaps = 31/365 (8%)
 Frame = +3

Query  303   EKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRR  482
             E  P+I LP QS D+ H A+D+GGSL+KLVYFS     +               ++  R 
Sbjct  57    EAVPSITLPRQSSDVRHFAMDMGGSLVKLVYFSPDAEDE--------------AADSLRP  102

Query  483   SYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGA  662
             S+ I GGRLHF KFE +K+ +C+ FI  K+LH G            +    ++KATGGGA
Sbjct  103   SF-IGGGRLHFRKFEASKIEQCVRFIEQKRLHLGA-----------EGGKAVVKATGGGA  150

Query  663   YKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQ----IDQND  830
             +K ++LF ++ G+ ++KEDEM C VAGANFLL+AIR EAFT  EG K +V        +D
Sbjct  151   FKNSELFLDQFGIQLQKEDEMKCAVAGANFLLQAIRDEAFTFTEGRKNYVAHKDGSHDDD  210

Query  831   LFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRG  1010
             LFPYLLVNIGSGVS+IKVD DG F+RV GTN+GGGT+WGL RLLT  + FD +L  S  G
Sbjct  211   LFPYLLVNIGSGVSIIKVDTDG-FERVGGTNIGGGTFWGLCRLLTGMRDFDQMLACSAIG  269

Query  1011  DNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISY  1190
             DN  +DMLVGDIYGG DY+K+GLS++TIASSFG+ + +   L DY   DI+LSLLRMISY
Sbjct  270   DNSKVDMLVGDIYGGRDYAKVGLSSTTIASSFGRVVMDGGSLTDYNKADITLSLLRMISY  329

Query  1191  NIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGA  1370
             NI  I+ + A+++ LKRI+FGG+FIRGHAYTM+TISFAV++WSKG   AMFLRHEGFLGA
Sbjct  330   NISHIATMTAVKHDLKRIYFGGYFIRGHAYTMNTISFAVDYWSKGNLRAMFLRHEGFLGA  389

Query  1371  LGAFM  1385
             LGAF+
Sbjct  390   LGAFL  394



>ref|XP_001417152.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95445.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=772

 Score =   369 bits (946),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 200/345 (58%), Positives = 248/345 (72%), Gaps = 27/345 (8%)
 Frame = +3

Query  360   LDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKV  539
             +D+GGSL+KLVYFS                     S  +     + GGRLHF KF +  +
Sbjct  1     MDLGGSLVKLVYFS--------------------PSGTDASGRAVAGGRLHFRKFPSAHL  40

Query  540   NECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKED  719
             N+C+DFI  K+LH GG  T     E   +    +KATGGGAYKF+  F++RLG++++KED
Sbjct  41    NDCMDFIEFKKLHVGGSGTTEGDGE---DGGVTVKATGGGAYKFSKTFQDRLGITLQKED  97

Query  720   EMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQID---QNDLFPYLLVNIGSGVSMIKVDG  890
             EM C VAGANFLL+ IR EAFT+ +  K F+  D   +  LFPYLLVNIGSGVS+IKVD 
Sbjct  98    EMACAVAGANFLLETIRDEAFTYTDDEKAFISKDALTRESLFPYLLVNIGSGVSIIKVDK  157

Query  891   DGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSK  1070
             DG  +RVSG+N+GGGT+WGL RLLT  K +D++L+LS + DN  +DMLVGDIYGG DY  
Sbjct  158   DGH-ERVSGSNIGGGTFWGLCRLLTGLKDYDEMLKLSAQADNAKVDMLVGDIYGGRDYPN  216

Query  1071  IGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriff  1250
             IGLS+ TIASSFG+ + +   LEDY   DI+LSLLRMISYNI  IS +NA++YGLKRIFF
Sbjct  217   IGLSSETIASSFGRVVMDEGSLEDYSKADITLSLLRMISYNIAHISTMNAVKYGLKRIFF  276

Query  1251  ggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             GG+FIR HAYTM+TISFAV+FWSKG  +A FLRHEGFLGALGAF+
Sbjct  277   GGYFIRNHAYTMNTISFAVDFWSKGSLKASFLRHEGFLGALGAFL  321



>ref|XP_003078604.1| eukaryotic pantothenate kinase family protein (ISS) [Ostreococcus 
tauri]
 emb|CAL51484.1| Type II pantothenate kinase [Ostreococcus tauri]
Length=901

 Score =   367 bits (943),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 210/391 (54%), Positives = 266/391 (68%), Gaps = 35/391 (9%)
 Frame = +3

Query  228   ISPMHR-STSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSR  404
             I P +R S+SR     +  A+ G  + + P I LP Q + + H A+D+GGSL+KLVYFS 
Sbjct  40    IEPTNRPSSSRA----TSRALSGAPKPEAPAITLPRQREAVRHFAMDLGGSLVKLVYFSA  95

Query  405   HEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCG  584
                               G S+ +       GGRLHF KF + +++EC+DFI  K+LH G
Sbjct  96    ------------------GASDASGTQGGTQGGRLHFRKFPSKRLDECMDFIEFKKLHVG  137

Query  585   GLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKA  764
                           +   +KATGGGAYK+   F+ERLG++++KEDEM C VAGANFLL+ 
Sbjct  138   -------GDGGEGGDGVSVKATGGGAYKYGTTFQERLGITLQKEDEMACAVAGANFLLET  190

Query  765   IRHEAFTHIEGHKEFVQID---QNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGG  935
             IR EAFT+    K F+  D   +  LFPYLLVNIGSGVS+IKVD DG  +RVSG+N+GGG
Sbjct  191   IRDEAFTYRNDEKVFISKDDLTRESLFPYLLVNIGSGVSIIKVDKDGH-ERVSGSNIGGG  249

Query  936   TYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYG-GMDYSKIGLSASTIASSFGK  1112
             T+WGL RLLT  K +D++L+LS   DN  +DMLVGDIYG G  Y  IGLS+ TIASSFG+
Sbjct  250   TFWGLCRLLTGLKDYDEMLKLSAEADNAKVDMLVGDIYGRGRGYPNIGLSSETIASSFGR  309

Query  1113  AISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDT  1292
              + +   L+DY   DI+LSLLRMISYNI  I+ +NA +Y LKRIFFGG+FIR H+YTM+T
Sbjct  310   VVMDEGSLDDYSKADITLSLLRMISYNIAHIATMNAAKYDLKRIFFGGYFIRNHSYTMNT  369

Query  1293  ISFAVNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             ISFAV+FWSKGE +AMFLRHEGFLGALGAF+
Sbjct  370   ISFAVDFWSKGEMKAMFLRHEGFLGALGAFL  400



>ref|XP_003056202.1| pantothenate kinase [Micromonas pusilla CCMP1545]
 gb|EEH59578.1| pantothenate kinase [Micromonas pusilla CCMP1545]
Length=928

 Score =   357 bits (917),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 218/400 (55%), Positives = 269/400 (67%), Gaps = 45/400 (11%)
 Frame = +3

Query  246   STSRPQLDLSGAAIQG-------NF--------EEKDPTILLPNQSDDISHLALDIGGSL  380
             S  +  LDL+GAAI         +F         E  P+I LP QS  I H ALD+GGSL
Sbjct  7     SVCQNNLDLTGAAIATADRTPNRDFIDDQILVERENVPSISLPRQSTGICHFALDMGGSL  66

Query  381   IKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFI  560
             +K+VYFS+    +  D                  S  + GGRLHF KF+ T++  CL+FI
Sbjct  67    VKVVYFSQDSEDKTGDLPLDS-------------SSMLGGGRLHFRKFQATQLEICLNFI  113

Query  561   SSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVA  740
                +LH G            +    I+KATGGGAYK + LF+ R G+ ++KEDEM C VA
Sbjct  114   EQNRLHLGA-----------EGRKAIVKATGGGAYKNSLLFQRRFGIQLQKEDEMECAVA  162

Query  741   GANFLLKAIRHEAFTHIEGHKEFV-----QIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQ  905
             GANFLL+ IR EAFT   G K++V       D +DLFPYLLVNIGSGVS+IKVD    F+
Sbjct  163   GANFLLETIRDEAFTFTHGQKDYVVPEDLHEDNDDLFPYLLVNIGSGVSIIKVD-RSSFE  221

Query  906   RVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSA  1085
             R+ GTN+GGGT+WGL RLLT  + FD++L  S  GDN  +DMLVGDIYGG DY K+GLS+
Sbjct  222   RIGGTNIGGGTFWGLCRLLTGLQDFDEMLACSAAGDNSKVDMLVGDIYGGRDYLKVGLSS  281

Query  1086  STIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffi  1265
             STIASSFG+ ++E   LEDY   DI+LSLLRMISYNI  I+ L A+++GLKRIFFGG+FI
Sbjct  282   STIASSFGRVVTEEGSLEDYNKADITLSLLRMISYNISHIATLMAVKHGLKRIFFGGYFI  341

Query  1266  rgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             RGHAYTM+TISFAV++WSKGE +AMFLRHEGFLGALGAF+
Sbjct  342   RGHAYTMNTISFAVDYWSKGELKAMFLRHEGFLGALGAFL  381



>gb|AFW85383.1| hypothetical protein ZEAMMB73_434998 [Zea mays]
Length=447

 Score =   340 bits (871),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 189/376 (50%), Positives = 255/376 (68%), Gaps = 35/376 (9%)
 Frame = +3

Query  264   LDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrk  443
             +DLSGA I+G+ E+++P I LP Q      LALDIGG+LIKLVY +   G          
Sbjct  12    VDLSGAEIRGDLEDRNPPIFLPRQPAASPLLALDIGGTLIKLVYTASRGGGAD-------  64

Query  444   vkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQ  623
                               G  L F KFE  ++ EC +FI ++ L          +S A  
Sbjct  65    ------------------GTDLRFAKFERRRLQECFNFIRAEGL---------LASNA-G  96

Query  624   NENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHK  803
              E   +KATGGGAYKFAD F E+LGV ++K DEM+ +V+GANFLL++I   AFTH+ G +
Sbjct  97    GEGVTLKATGGGAYKFADDFLEKLGVCLDKLDEMDSVVSGANFLLQSIPGAAFTHMNGLR  156

Query  804   EFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFD  983
               V +  N+LFPYLLVNIGSGVS++KV G+ KF+RV+GT++GGGT +GL +LLT CKS+D
Sbjct  157   NPVDVSPNNLFPYLLVNIGSGVSILKVTGNRKFERVTGTHIGGGTMFGLAKLLTGCKSYD  216

Query  984   DLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDIS  1163
             + L+LSQ+GDN  +D++V DI G +   K GLS ST+ASSFGK I+  K+L DY+PED++
Sbjct  217   EFLQLSQKGDNFVLDLIVKDICGELVCQKQGLSTSTLASSFGKVITSKKKLTDYKPEDLA  276

Query  1164  LSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMF  1343
              +LL   +YNI QI++L A   GL+R+FFGG +IRGH  TM+ IS+A++FWS+ + +A+F
Sbjct  277   STLLSAFTYNIAQIAFLVASLLGLRRVFFGGSYIRGHKSTMENISYAIDFWSQSQMQAVF  336

Query  1344  LRHEGFLGALGAFMSY  1391
             LRHEG+LGALGA MSY
Sbjct  337   LRHEGYLGALGALMSY  352


 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 48/71 (68%), Gaps = 8/71 (11%)
 Frame = +3

Query  792  EGHKEFVQID--------QNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWG  947
            E H E   +D         +++FPYLLVNIGSGVSMI+V G GKF+R+ G+++GGGT  G
Sbjct  366  EPHHESAPVDGTSADEESDSNIFPYLLVNIGSGVSMIEVIGKGKFERIIGSHLGGGTILG  425

Query  948  LGRLLTKCKSF  980
            L RLLT C  +
Sbjct  426  LARLLTGCSRY  436



>ref|XP_004964926.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Setaria italica]
Length=667

 Score =   344 bits (883),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 191/377 (51%), Positives = 255/377 (68%), Gaps = 26/377 (7%)
 Frame = +3

Query  264   LDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrk  443
             +DLSGA I+G+ E ++P I LP Q      LALDIGG+LIKLVY +              
Sbjct  12    VDLSGAEIRGDIEGRNPPIFLPRQPAASPLLALDIGGTLIKLVYTASCG-----------  60

Query  444   vkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSK-QLHCGGLDTPRWSSEAP  620
                               G  L F KFE  ++ EC DF+ +K  L C G  + +      
Sbjct  61    ------GGGSGDGDGDGDGAELRFAKFERRRLQECFDFVRAKGLLGCNGTRSSK------  108

Query  621   QNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGH  800
               EN  +KATGGGAYKFAD F+E+LGV ++K DEM+ +V+GANFLL+ I   AFTH+ G 
Sbjct  109   --ENMPLKATGGGAYKFADDFREKLGVCLDKLDEMDSVVSGANFLLQNIPGAAFTHMNGQ  166

Query  801   KEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSF  980
             +  V +  N+LFPYLLVNIGSGVS++KV G+ KF+RV+GT++GGGT +GL +LLT CKS+
Sbjct  167   RNPVDVSPNNLFPYLLVNIGSGVSILKVTGNRKFERVTGTHIGGGTMFGLAKLLTGCKSY  226

Query  981   DDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDI  1160
             D+ L+LSQ+GDN  +D++V DI G +   K GLS ST+ASSFGK I+  K+L DY+PED+
Sbjct  227   DEFLQLSQKGDNFVLDLIVKDICGELVCQKQGLSMSTLASSFGKVITSKKKLTDYKPEDL  286

Query  1161  SLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAM  1340
             + +LL   +YNI QI++L A   GL+R+FFGG +IRGH  TM+ ISFA++FWS+ + +A+
Sbjct  287   ASTLLSAFTYNIAQIAFLVASLLGLRRVFFGGSYIRGHKSTMENISFAIDFWSQSQMQAV  346

Query  1341  FLRHEGFLGALGAFMSY  1391
             FLRHEG+LGALGA MSY
Sbjct  347   FLRHEGYLGALGALMSY  363


 Score =   219 bits (557),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 131/252 (52%), Positives = 166/252 (66%), Gaps = 17/252 (7%)
 Frame = +3

Query  654   GGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDL  833
             G    + DL  E L +   KE E +              HEA   ++G     + D N +
Sbjct  358   GALMSYGDLSGENLTLEESKEKEPH--------------HEATAPVDGISADEENDSN-I  402

Query  834   FPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGD  1013
             FPYLLVNIGSGVSMI+V G GKF+R+ G+++GGGT  GL RLLT C S+++ LELSQRG+
Sbjct  403   FPYLLVNIGSGVSMIEVIGKGKFERIIGSHLGGGTILGLARLLTGCSSYEEFLELSQRGN  462

Query  1014  NRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYN  1193
             N ++D+ VGDIYG   Y KIGL AST A+SFGK ++ NK L DY+ ED++ +LL   +YN
Sbjct  463   NLSVDLTVGDIYGEEGYPKIGLPASTTAASFGK-VNSNK-LSDYKMEDLAAALLNSFTYN  520

Query  1194  IGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGAL  1373
             IGQI+Y  A   GLKRIFF G ++ GH  TMD IS ++ +WSKGE E  FL HEGFLG L
Sbjct  521   IGQIAYFVANLSGLKRIFFRGAYVCGHEKTMDKISRSLKYWSKGEVETTFLCHEGFLGTL  580

Query  1374  GAFMSYEKHGLD  1409
             GAF SYE  G+D
Sbjct  581   GAFWSYENMGID  592



>gb|KDD75300.1| fumble, partial [Helicosporidium sp. ATCC 50920]
Length=307

 Score =   331 bits (848),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 183/331 (55%), Positives = 235/331 (71%), Gaps = 37/331 (11%)
 Frame = +3

Query  312   PTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYP  491
             P I+LPNQS+++S +ALDIGGSLIKLVYF++                    S+G      
Sbjct  14    PCIVLPNQSEEVSLVALDIGGSLIKLVYFTKD-------------------SSGA-----  49

Query  492   ILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKF  671
               GG+LHF KF +T+V EC+DFI +K LH          + A +     +KATGGGA+K+
Sbjct  50    --GGKLHFCKFPSTQVEECIDFIEAKALH----------APAARGARLRVKATGGGAFKY  97

Query  672   ADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLV  851
             A+ FKERLG+ +E+EDEM C+V G NFLL+ +R EAF+  +    F  +  ++++PYLLV
Sbjct  98    AERFKERLGLLVEREDEMACMVDGCNFLLRTVRDEAFSFEQQQMAFEDVASDEVYPYLLV  157

Query  852   NIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDM  1031
             NIGSGVSM+KV+G+ +F RVSGTN+GGGT+ GL RLLT    FD++L+LS RGDN  +DM
Sbjct  158   NIGSGVSMVKVEGEKQFVRVSGTNIGGGTFLGLSRLLTGLNDFDEILDLSSRGDNSNVDM  217

Query  1032  LVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISY  1211
             LVGDIYGG DY+ IGLSA+TIASSFGK +    E   +R ED+ +SL RMISYNIGQ++Y
Sbjct  218   LVGDIYGGRDYTGIGLSATTIASSFGKVLHAPAEAR-FRSEDMVVSLCRMISYNIGQLAY  276

Query  1212  LNALRYGLKriffggffirgHAYTMDTISFA  1304
             LNA RY L+RIFFGGFFIRGH +TMDTISFA
Sbjct  277   LNAKRYNLRRIFFGGFFIRGHPHTMDTISFA  307



>gb|KDO82397.1| hypothetical protein CISIN_1g025826mg [Citrus sinensis]
Length=247

 Score =   327 bits (839),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 192/243 (79%), Gaps = 16/243 (7%)
 Frame = +3

Query  345   ISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKF  524
             ISHLALDIGGSLIK+VYF R  G                V +  ++S P+L GRLHF KF
Sbjct  21    ISHLALDIGGSLIKVVYFLRSNGSGGS------------VDDSGKKSDPVLEGRLHFAKF  68

Query  525   ETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVS  704
             ET+K+ +CL+FI SK LH  G        +A  ++ T+IKATGGGAYKFADL KE+LGV 
Sbjct  69    ETSKIIDCLEFIRSKNLHLAGF----RHHDASASDKTLIKATGGGAYKFADLIKEKLGVV  124

Query  705   IEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKV  884
             ++KEDEM+CLV GANFLLKA+  EAFT+++G KEFVQIDQNDL+PYLLVNIGSGVSMIKV
Sbjct  125   LDKEDEMDCLVTGANFLLKAVHQEAFTYVDGQKEFVQIDQNDLYPYLLVNIGSGVSMIKV  184

Query  885   DGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDY  1064
             DGDGKF+R+SGT+VGGGT+WGLGRLLT CKSFD+LLELS +G+NR IDMLVGDIYGG +Y
Sbjct  185   DGDGKFERISGTSVGGGTFWGLGRLLTNCKSFDELLELSHQGNNRVIDMLVGDIYGGSEY  244

Query  1065  SKI  1073
             SK+
Sbjct  245   SKV  247



>ref|NP_001147318.1| LOC100280926 [Zea mays]
 gb|ACG26766.1| pantothenate kinase family protein [Zea mays]
 gb|AFW85384.1| pantothenate kinase family protein [Zea mays]
Length=656

 Score =   339 bits (870),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 189/376 (50%), Positives = 255/376 (68%), Gaps = 35/376 (9%)
 Frame = +3

Query  264   LDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrk  443
             +DLSGA I+G+ E+++P I LP Q      LALDIGG+LIKLVY +   G          
Sbjct  12    VDLSGAEIRGDLEDRNPPIFLPRQPAASPLLALDIGGTLIKLVYTASRGGGAD-------  64

Query  444   vkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQ  623
                               G  L F KFE  ++ EC +FI ++ L          +S A  
Sbjct  65    ------------------GTDLRFAKFERRRLQECFNFIRAEGL---------LASNA-G  96

Query  624   NENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHK  803
              E   +KATGGGAYKFAD F E+LGV ++K DEM+ +V+GANFLL++I   AFTH+ G +
Sbjct  97    GEGVTLKATGGGAYKFADDFLEKLGVCLDKLDEMDSVVSGANFLLQSIPGAAFTHMNGLR  156

Query  804   EFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFD  983
               V +  N+LFPYLLVNIGSGVS++KV G+ KF+RV+GT++GGGT +GL +LLT CKS+D
Sbjct  157   NPVDVSPNNLFPYLLVNIGSGVSILKVTGNRKFERVTGTHIGGGTMFGLAKLLTGCKSYD  216

Query  984   DLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDIS  1163
             + L+LSQ+GDN  +D++V DI G +   K GLS ST+ASSFGK I+  K+L DY+PED++
Sbjct  217   EFLQLSQKGDNFVLDLIVKDICGELVCQKQGLSTSTLASSFGKVITSKKKLTDYKPEDLA  276

Query  1164  LSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMF  1343
              +LL   +YNI QI++L A   GL+R+FFGG +IRGH  TM+ IS+A++FWS+ + +A+F
Sbjct  277   STLLSAFTYNIAQIAFLVASLLGLRRVFFGGSYIRGHKSTMENISYAIDFWSQSQMQAVF  336

Query  1344  LRHEGFLGALGAFMSY  1391
             LRHEG+LGALGA MSY
Sbjct  337   LRHEGYLGALGALMSY  352


 Score =   212 bits (539),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 151/214 (71%), Gaps = 10/214 (5%)
 Frame = +3

Query  792   EGHKEFVQID--------QNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWG  947
             E H E   +D         +++FPYLLVNIGSGVSMI+V G GKF+R+ G+++GGGT  G
Sbjct  366   EPHHESAPVDGTSADEESDSNIFPYLLVNIGSGVSMIEVIGKGKFERIIGSHLGGGTILG  425

Query  948   LGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISEN  1127
             L RLLT C S+++ LELSQRG+N ++D+ VGDIYG   Y KIGL AST A+SFGK  S  
Sbjct  426   LARLLTGCSSYEEFLELSQRGNNLSVDLTVGDIYGEEGYPKIGLPASTTAASFGKVNS--  483

Query  1128  KELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAV  1307
              +L +Y+ ED++ +LL   +YNIGQI+Y  A   GLKRIFF G ++ GH  TMD IS ++
Sbjct  484   SKLSEYKVEDLAAALLNSFTYNIGQIAYFVANLSGLKRIFFRGAYVCGHEKTMDKISRSL  543

Query  1308  NFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
              +WSKGE +  FL HEGFLG LGAF SYE  G+D
Sbjct  544   KYWSKGEVQTTFLCHEGFLGTLGAFWSYENMGID  577



>emb|CEG69228.1| Putative Pantothenate kinase [Rhizopus microsporus]
Length=369

 Score =   328 bits (842),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 193/387 (50%), Positives = 263/387 (68%), Gaps = 44/387 (11%)
 Frame = +3

Query  264   LDLSGAAI-QGNFEEKDPT-ILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrk  437
             ++L GA++ +  F   +   I+LPNQ++ ++H+A+DIGGSL K+VYF+            
Sbjct  9     MNLDGASVSEATFAAHETRDIVLPNQNEHVAHVAIDIGGSLAKIVYFT------------  56

Query  438   rkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEA  617
                      S+ NR+     GGRLHF KFET K++EC+D++++  L       PR     
Sbjct  57    ---------SSANRK-----GGRLHFKKFETEKIDECIDYVAA--LMADAKLEPR-----  95

Query  618   PQNENTIIKATGGGAYKFADLFKERL-GVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIE  794
               N N ++KATGGGA+ F D  KERL GV IEKEDEM+CL+ G NF +  I +E FT+ E
Sbjct  96    NNNNNLVLKATGGGAHLFYDKLKERLSGVIIEKEDEMDCLITGLNFFITEIPYEVFTYNE  155

Query  795   GHKEFVQIDQ--NDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTK  968
                E ++ ++  N+L+PY+LVNIGSGVS++KV G  +F R+SGT++GGGT WGL  LLT 
Sbjct  156   HDPEPMKFEKKANNLYPYMLVNIGSGVSILKVTGPDEFSRISGTSLGGGTLWGLMSLLTD  215

Query  969   CKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISE--NKELED  1142
               SFDD+LE+S+ GDNR +D+LVGDIYG  DYSK+GL ++ IASSFGK   +   +    
Sbjct  216   ATSFDDMLEMSKTGDNRNVDLLVGDIYGS-DYSKLGLKSTRIASSFGKVFKKGVRQAQGK  274

Query  1143  YRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSK  1322
             ++  DI+ SLL M+S NIGQI+YLNA ++ L RI+FGG FIRGH  TM+T+S+A+NFWS 
Sbjct  275   FQSPDIAKSLLFMVSNNIGQIAYLNAKQHNLTRIYFGGCFIRGHPITMNTLSYAINFWSN  334

Query  1323  GEAEAMFLRHEGFLGALGAFMSYEKHG  1403
             GE +A+FLRHEG LGA GAF+   KHG
Sbjct  335   GEMKALFLRHEGHLGATGAFL---KHG  358



>ref|XP_006392166.1| hypothetical protein EUTSA_v10023550mg [Eutrema salsugineum]
 gb|ESQ29452.1| hypothetical protein EUTSA_v10023550mg [Eutrema salsugineum]
Length=358

 Score =   326 bits (836),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 207/357 (58%), Positives = 250/357 (70%), Gaps = 60/357 (17%)
 Frame = +3

Query  336   SDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGN---RRSYPILGGR  506
             S  ISHLALDIGG+LIKLVYFS +     E             S+G+   R    ++ GR
Sbjct  9     STQISHLALDIGGTLIKLVYFSANGDNFEES------------SDGSIVVRSGCSVVEGR  56

Query  507   LHFVKFETTKVNECLDFISSKQLH-CGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLF  683
             L F KFET K+++CL+FI    LH   G+  P  ++     +   +KATGGGA++FADLF
Sbjct  57    LCFAKFETRKIDDCLEFIRFNILHHSSGVKHPNGTAM----DKLSVKATGGGAFRFADLF  112

Query  684   KERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGS  863
             KE+LG+  +KEDEM+CLV GANFLL                                   
Sbjct  113   KEKLGILFDKEDEMHCLVVGANFLL-----------------------------------  137

Query  864   GVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGD  1043
                  KVDGDG+++R+SGT++GGGT+ GLG+LLTKCKSFD+LLELS  G+NR IDMLVGD
Sbjct  138   -----KVDGDGEYERISGTSLGGGTFLGLGKLLTKCKSFDELLELSHHGNNRVIDMLVGD  192

Query  1044  IYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNAL  1223
             IYGG DYSKIGLS++ IASSFGKAIS+ KELEDY+PED++ SLLRMIS NIGQI+YLNAL
Sbjct  193   IYGGTDYSKIGLSSTAIASSFGKAISDGKELEDYQPEDVARSLLRMISNNIGQIAYLNAL  252

Query  1224  RYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYE  1394
             R+GLKRIFFGGFFIRG  YTMDTIS AV+FWS+GEA+A+FLRHEGFLGALGAF SYE
Sbjct  253   RFGLKRIFFGGFFIRGLEYTMDTISVAVHFWSRGEAKALFLRHEGFLGALGAFTSYE  309



>gb|EMT19063.1| Pantothenate kinase 2 [Aegilops tauschii]
Length=668

 Score =   336 bits (861),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 186/378 (49%), Positives = 253/378 (67%), Gaps = 35/378 (9%)
 Frame = +3

Query  261   QLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkr  440
             ++DLSGA I+ +  +  P I LP Q      LALDIGG+LIKLVY +   G +       
Sbjct  4     RIDLSGAEIRADHGDGSPPIFLPRQPAASPLLALDIGGTLIKLVYTASCGGEE-------  56

Query  441   kvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSK-QLHCGGLDTPRWSSEA  617
                                   L F KFE  ++++C DF+ ++  L C G  T       
Sbjct  57    ---------------------ELRFAKFERRRLDDCFDFVRAQGLLGCNGTTT------G  89

Query  618   PQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEG  797
                EN  +KATGGG+YKF D F+++LGVS++K DEM+ +V+GANFLL+ +   AFTH+ G
Sbjct  90    SSKENMTLKATGGGSYKFGDDFRQKLGVSLDKLDEMDSVVSGANFLLQNVPGAAFTHMSG  149

Query  798   HKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKS  977
                 + I  ++LFPYLLVNIGSGVS++KV G+GKF+RV+GT++GGGT +GL +LLT CKS
Sbjct  150   KMNSIDISPDNLFPYLLVNIGSGVSILKVTGNGKFERVTGTHIGGGTMFGLAKLLTGCKS  209

Query  978   FDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPED  1157
             +D+ L+LSQ+GDN  +D++V DI G +   K GLS ST+ASSFGK I+  K+L DY+PED
Sbjct  210   YDEFLQLSQKGDNFVLDLVVKDICGELACQKQGLSTSTLASSFGKVITSMKKLADYKPED  269

Query  1158  ISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEA  1337
             ++ +LL   +YNI QIS+L A   GL+R+FFGG +IRGH  TMD IS+A+NFWS+ + +A
Sbjct  270   LASALLSAFTYNIAQISFLVASLLGLRRVFFGGSYIRGHKSTMDNISYALNFWSESQMQA  329

Query  1338  MFLRHEGFLGALGAFMSY  1391
              FL+HEG+LGALGA MSY
Sbjct  330   SFLQHEGYLGALGALMSY  347


 Score =   202 bits (513),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 146/207 (71%), Gaps = 12/207 (6%)
 Frame = +3

Query  819   DQNDLFPYLLVNIGSGVSMI----------KVDGDGKFQRVSGTNVGGGTYWGLGRLLTK  968
             + +++FPYLLVNIGSGVSMI          +V G GKF+R+ G+++GGGT  GL RLLT 
Sbjct  381   NDSNIFPYLLVNIGSGVSMIEHFYQQKQSCQVIGKGKFERIIGSHLGGGTILGLARLLTG  440

Query  969   CKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYR  1148
             C S+++ L+LS+RGDN  +D+ VGDIYG   Y KIGL AST A+SFGK  S   +L +Y+
Sbjct  441   CSSYEEFLDLSRRGDNLAVDLTVGDIYGERGYPKIGLPASTTAASFGKVNS--GKLSEYK  498

Query  1149  PEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGE  1328
              ED++ +LL   +YNIGQI+Y  A   GLKRIFF G ++ GH  TMD IS ++ +WSKGE
Sbjct  499   AEDLAAALLNSFTYNIGQIAYFVANLSGLKRIFFRGAYVCGHEKTMDKISRSLKYWSKGE  558

Query  1329  AEAMFLRHEGFLGALGAFMSYEKHGLD  1409
              +  FL HEGFLG LGAF SYE  G+D
Sbjct  559   VQTTFLCHEGFLGTLGAFWSYENMGID  585



>ref|XP_635721.1| pantothenate kinase [Dictyostelium discoideum AX4]
 gb|EAL62216.1| pantothenate kinase [Dictyostelium discoideum AX4]
Length=685

 Score =   336 bits (861),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 189/380 (50%), Positives = 253/380 (67%), Gaps = 44/380 (12%)
 Frame = +3

Query  297   FEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGN  476
             F  KD  I LPNQS  I H ALDIGG+L KLVYF                     V N +
Sbjct  220   FNPKDRPISLPNQSGPIKHFALDIGGTLAKLVYF---------------------VQNKD  258

Query  477   RRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGG  656
             + +   LGG+LHF+KF T  +++CL+FI    LH      P+           +++ TGG
Sbjct  259   KSNVNELGGKLHFIKFRTADIDDCLNFIIENNLHIEDSGLPK-----------VVRVTGG  307

Query  657   GAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIE-----GHKEFVQID  821
             GAYK+A+LF++RLG  I KEDEM CL+ G NFLL  I+ E+FT+         KEF+   
Sbjct  308   GAYKYAELFEKRLGCKIVKEDEMQCLIWGTNFLLNNIKRESFTYSTTPNAISPKEFIDKT  367

Query  822   QNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELS  1001
              N  +PYLLVNIGSGVS+IKV+ +  FQRV GT++GGGT+WGL  LLT    +D++LE++
Sbjct  368   DNH-YPYLLVNIGSGVSIIKVESETSFQRVDGTSLGGGTFWGLCSLLTGVSDYDEMLEMT  426

Query  1002  QRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKEL-----EDYRPEDISL  1166
             + G +  +D++VGDIY G DY+KIGLS+ TIASSFGK I EN++      E+ + EDI+ 
Sbjct  427   KNGQSNHVDLVVGDIY-GTDYTKIGLSSDTIASSFGKVIYENEKKKISGEENIKKEDIAQ  485

Query  1167  SLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFL  1346
             SLL+M+S NIGQI+YLN+ RYGL +I+FGGFFIR H  TM  ISFA++FWSKG+ +AMFL
Sbjct  486   SLLKMVSNNIGQIAYLNSQRYGLNKIYFGGFFIRDHPNTMQRISFAIDFWSKGQTKAMFL  545

Query  1347  RHEGFLGALGAFMSYEKHGL  1406
              H+G+LGALG+F++ ++  L
Sbjct  546   VHDGYLGALGSFLAPDEDDL  565



>ref|XP_003287654.1| hypothetical protein DICPUDRAFT_54979 [Dictyostelium purpureum]
 gb|EGC35817.1| hypothetical protein DICPUDRAFT_54979 [Dictyostelium purpureum]
Length=535

 Score =   331 bits (848),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 189/374 (51%), Positives = 252/374 (67%), Gaps = 43/374 (11%)
 Frame = +3

Query  297   FEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGN  476
             F  KD  I LPNQS  I H ALDIGG+L KLVYF                     V N +
Sbjct  108   FNPKDRPISLPNQSAPIKHFALDIGGTLAKLVYF---------------------VQNKD  146

Query  477   RRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGG  656
             + +   +GG+LHF+KF T  ++ CLDFI    LH             P++    ++ TGG
Sbjct  147   KSNVNEIGGKLHFIKFRTKDIDLCLDFIIENNLHI--------EDGKPKD----VRVTGG  194

Query  657   GAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIE-----GHKEFVQID  821
             GA+K+++LF+ RLG  + KEDEM CL+ G NFLL  I+ E+FT+         KEF+   
Sbjct  195   GAFKYSELFENRLGCKLIKEDEMQCLIWGTNFLLNNIKKESFTYSTTPNAISPKEFID-K  253

Query  822   QNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELS  1001
              +D +P+LLVNIGSGVS+IKVD    FQRV GT++GGGT++GL  LLT    +D++LEL+
Sbjct  254   TDDQYPFLLVNIGSGVSIIKVDSPTSFQRVDGTSLGGGTFFGLCSLLTGVTDYDEMLELT  313

Query  1002  QRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISEN---KELEDYRPEDISLSL  1172
             + G++ T+D++VGDIYG  DYSKIGLS+ TIASSFGK I +N   ++L+D + EDI+ SL
Sbjct  314   RNGESNTVDLVVGDIYG-TDYSKIGLSSDTIASSFGKIIYKNPDGEKLDDIKKEDIAQSL  372

Query  1173  LRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRH  1352
             L+M+S NIGQI+YLN+ RYGL +I+FGGFFIR H  TM  ISFA++FWSKG+ +AMFL H
Sbjct  373   LKMVSNNIGQIAYLNSQRYGLNKIYFGGFFIRDHPNTMQRISFAIDFWSKGKTKAMFLVH  432

Query  1353  EGFLGALGAFMSYE  1394
             +G+LGALGAF++ E
Sbjct  433   DGYLGALGAFLAPE  446



>ref|XP_003564125.1| PREDICTED: pantothenate kinase 1 isoform X2 [Brachypodium distachyon]
Length=657

 Score =   334 bits (857),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 189/379 (50%), Positives = 256/379 (68%), Gaps = 36/379 (9%)
 Frame = +3

Query  261   QLDLSGAAIQGN-FEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrk  437
             ++DLSGA I+G+  E+  P I LP Q      LALDIGG+LIKLVY +   G        
Sbjct  4     RIDLSGAEIRGDPAEDGGPPIFLPRQPAASPLLALDIGGTLIKLVYTASCGGE-------  56

Query  438   rkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSK-QLHCGGLDTPRWSSE  614
                                    L F KFE  +++EC +F+ ++  L C G  T      
Sbjct  57    ---------------------AELRFAKFERRRLDECFEFVRAEGLLGCNGTKT------  89

Query  615   APQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIE  794
                 EN I+KATGGGAYKF D F+E+LGVS++K DEM+ +V+GANFLL+ +   AFTH+ 
Sbjct  90    GSSKENMILKATGGGAYKFGDDFREKLGVSLDKLDEMDSVVSGANFLLQNVPGAAFTHMN  149

Query  795   GHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCK  974
             G +  V I  ++LFPYLLVNIGSGVS++KV+G+ KF+RV+GT++GGGT +GL +LLT CK
Sbjct  150   GKRNSVDISPDNLFPYLLVNIGSGVSILKVNGNRKFERVTGTHIGGGTMFGLAKLLTGCK  209

Query  975   SFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPE  1154
             S+D+ L+LSQ+GDN  +D++V DI G +   K GLS ST+ASSFGK I+  K+L DYR E
Sbjct  210   SYDEFLQLSQKGDNFVLDLIVKDICGELVCQKQGLSTSTLASSFGKVITSMKKLTDYRSE  269

Query  1155  DISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAE  1334
             D++ +LL   +YNI QIS+L A   GL+R+FFGG +IRGH  TM+ IS+A++FWS+ + +
Sbjct  270   DLASTLLSAFTYNIAQISFLVASLLGLRRVFFGGSYIRGHKSTMENISYALDFWSQSQNQ  329

Query  1335  AMFLRHEGFLGALGAFMSY  1391
             A+FL+HEG+LGALGA MSY
Sbjct  330   AVFLQHEGYLGALGALMSY  348


 Score =   211 bits (538),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 146/197 (74%), Gaps = 2/197 (1%)
 Frame = +3

Query  819   DQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLEL  998
             + +++FPYLLVNIGSGVSMI+V G GKF+R+ G+++GGGT  GL RLLT C S+++ L+L
Sbjct  384   NDSNIFPYLLVNIGSGVSMIEVIGKGKFERIIGSHLGGGTILGLARLLTGCSSYEEFLDL  443

Query  999   SQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLR  1178
             SQRG+N  +D+ VGDIYG   Y KIGL AST A+SFGK  S   +L DY+ ED++ +LL 
Sbjct  444   SQRGNNLAVDLTVGDIYGEHGYPKIGLPASTTAASFGKVNS--SKLSDYKVEDLAAALLN  501

Query  1179  MISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEG  1358
               +YNIGQI+Y  A   GLKRIFF G ++ GH  TMD IS ++ +WSKGE +  FL HEG
Sbjct  502   SFTYNIGQIAYFVANLSGLKRIFFRGAYVCGHEKTMDKISRSLKYWSKGEVQTTFLCHEG  561

Query  1359  FLGALGAFMSYEKHGLD  1409
             FLG LGAF SYE  G+D
Sbjct  562   FLGTLGAFWSYENMGID  578



>ref|XP_010227876.1| PREDICTED: pantothenate kinase 1 isoform X1 [Brachypodium distachyon]
Length=667

 Score =   334 bits (857),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 189/379 (50%), Positives = 256/379 (68%), Gaps = 36/379 (9%)
 Frame = +3

Query  261   QLDLSGAAIQGN-FEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrk  437
             ++DLSGA I+G+  E+  P I LP Q      LALDIGG+LIKLVY +   G        
Sbjct  4     RIDLSGAEIRGDPAEDGGPPIFLPRQPAASPLLALDIGGTLIKLVYTASCGGE-------  56

Query  438   rkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSK-QLHCGGLDTPRWSSE  614
                                    L F KFE  +++EC +F+ ++  L C G  T      
Sbjct  57    ---------------------AELRFAKFERRRLDECFEFVRAEGLLGCNGTKT------  89

Query  615   APQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIE  794
                 EN I+KATGGGAYKF D F+E+LGVS++K DEM+ +V+GANFLL+ +   AFTH+ 
Sbjct  90    GSSKENMILKATGGGAYKFGDDFREKLGVSLDKLDEMDSVVSGANFLLQNVPGAAFTHMN  149

Query  795   GHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCK  974
             G +  V I  ++LFPYLLVNIGSGVS++KV+G+ KF+RV+GT++GGGT +GL +LLT CK
Sbjct  150   GKRNSVDISPDNLFPYLLVNIGSGVSILKVNGNRKFERVTGTHIGGGTMFGLAKLLTGCK  209

Query  975   SFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPE  1154
             S+D+ L+LSQ+GDN  +D++V DI G +   K GLS ST+ASSFGK I+  K+L DYR E
Sbjct  210   SYDEFLQLSQKGDNFVLDLIVKDICGELVCQKQGLSTSTLASSFGKVITSMKKLTDYRSE  269

Query  1155  DISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAE  1334
             D++ +LL   +YNI QIS+L A   GL+R+FFGG +IRGH  TM+ IS+A++FWS+ + +
Sbjct  270   DLASTLLSAFTYNIAQISFLVASLLGLRRVFFGGSYIRGHKSTMENISYALDFWSQSQNQ  329

Query  1335  AMFLRHEGFLGALGAFMSY  1391
             A+FL+HEG+LGALGA MSY
Sbjct  330   AVFLQHEGYLGALGALMSY  348


 Score =   211 bits (538),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 146/197 (74%), Gaps = 2/197 (1%)
 Frame = +3

Query  819   DQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLEL  998
             + +++FPYLLVNIGSGVSMI+V G GKF+R+ G+++GGGT  GL RLLT C S+++ L+L
Sbjct  394   NDSNIFPYLLVNIGSGVSMIEVIGKGKFERIIGSHLGGGTILGLARLLTGCSSYEEFLDL  453

Query  999   SQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLR  1178
             SQRG+N  +D+ VGDIYG   Y KIGL AST A+SFGK  S   +L DY+ ED++ +LL 
Sbjct  454   SQRGNNLAVDLTVGDIYGEHGYPKIGLPASTTAASFGKVNS--SKLSDYKVEDLAAALLN  511

Query  1179  MISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEG  1358
               +YNIGQI+Y  A   GLKRIFF G ++ GH  TMD IS ++ +WSKGE +  FL HEG
Sbjct  512   SFTYNIGQIAYFVANLSGLKRIFFRGAYVCGHEKTMDKISRSLKYWSKGEVQTTFLCHEG  571

Query  1359  FLGALGAFMSYEKHGLD  1409
             FLG LGAF SYE  G+D
Sbjct  572   FLGTLGAFWSYENMGID  588



>dbj|BAK03535.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   334 bits (856),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 184/378 (49%), Positives = 254/378 (67%), Gaps = 35/378 (9%)
 Frame = +3

Query  261   QLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkr  440
             ++DLSGA I+ +  +  P I LP Q      LALDIGG+LIKLVY +   G+        
Sbjct  4     RIDLSGAEIRADPGDGSPPIFLPRQPAASPLLALDIGGTLIKLVYTASCGGQ--------  55

Query  441   kvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQL-HCGGLDTPRWSSEA  617
                                   L F KFE  ++++C DF+ ++ L  C G  T       
Sbjct  56    --------------------AELRFAKFERRRLDDCFDFVRAQGLLGCNGTTT------G  89

Query  618   PQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEG  797
                EN  +KATGGG+YKF D F+++LGVS++K DEM+ +V+GANFLL+ +   AFTH++G
Sbjct  90    SSKENVTLKATGGGSYKFGDDFRQKLGVSLDKLDEMDSVVSGANFLLQNVPGAAFTHMKG  149

Query  798   HKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKS  977
              +  + I  +++FPYLLVNIGSGVS++KV G+ KF+RV+GT++GGGT +GL +LLT CKS
Sbjct  150   KRNSIDISPDNMFPYLLVNIGSGVSILKVTGNRKFERVTGTHIGGGTMFGLAKLLTGCKS  209

Query  978   FDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPED  1157
             +D+ L+LSQ+GDN  +D++V DI G +   K GLS ST+ASSFGK I+  K+L DY+PED
Sbjct  210   YDEFLQLSQKGDNFVLDLVVKDICGELVCQKQGLSTSTLASSFGKVITSMKKLADYKPED  269

Query  1158  ISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEA  1337
             ++ +LL   +YNI QIS+L A   GL+R+FFGG +IRGH  TMD IS+A+NFWS+ + +A
Sbjct  270   LASALLSAFTYNIAQISFLVASLLGLRRVFFGGSYIRGHKSTMDNISYALNFWSESQMQA  329

Query  1338  MFLRHEGFLGALGAFMSY  1391
              FL+HEG+LGALGA MSY
Sbjct  330   SFLQHEGYLGALGALMSY  347


 Score =   207 bits (528),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 143/194 (74%), Gaps = 2/194 (1%)
 Frame = +3

Query  828   DLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQR  1007
             ++FPYLLVNIGSGVSMI+V G GKF+R+ G+++GGGT  GL RLLT C S+++ LELS+ 
Sbjct  384   NIFPYLLVNIGSGVSMIEVIGKGKFERIIGSHLGGGTILGLERLLTGCSSYEEFLELSRS  443

Query  1008  GDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMIS  1187
             GDN  +D+ VGDIYG   Y KIGL AST A+SFGK  S   +L +Y+ ED++ +LL   +
Sbjct  444   GDNLAVDLTVGDIYGERGYPKIGLPASTTAASFGKVSS--GKLSEYKAEDLAAALLNSFT  501

Query  1188  YNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLG  1367
             YNIGQI+Y  A   GLKRIFF G ++ GH  TMD IS ++ +WSKGE +  FL HEGFLG
Sbjct  502   YNIGQIAYFVANLSGLKRIFFRGAYVCGHEKTMDKISRSLKYWSKGEVQTTFLCHEGFLG  561

Query  1368  ALGAFMSYEKHGLD  1409
              LGAF SYE  G+D
Sbjct  562   TLGAFWSYENMGID  575



>gb|EPB91645.1| pantothenate kinase [Mucor circinelloides f. circinelloides 1006PhL]
Length=398

 Score =   324 bits (831),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 189/379 (50%), Positives = 258/379 (68%), Gaps = 43/379 (11%)
 Frame = +3

Query  270   LSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvk  449
             +S A +  N E +D  I+LPNQ++ ++H+A+DIGGSL K+VYF+                
Sbjct  15    VSEANLSAN-ETRD--IVLPNQNEHVAHIAVDIGGSLAKIVYFT----------------  55

Query  450   erFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNE  629
                  S+ +R      GGRLHF K ET K++EC+DFI+        L         P+N 
Sbjct  56    -----SSPDRA-----GGRLHFKKIETEKIDECIDFIADLVADARLL--------KPENT  97

Query  630   NTIIKATGGGAYKFADLFKERL-GVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKE  806
             N ++KATGGGAY F D  +ERL GV I+KEDEM+CL+ G NF +  I +E FT+ E   +
Sbjct  98    NYVLKATGGGAYLFFDKLQERLPGVIIQKEDEMDCLINGLNFFITEIPYEVFTYNEQETD  157

Query  807   FVQIDQN--DLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSF  980
              ++ ++   D++PY+LVNIGSGVS++KV G  +F R+SGT++GGGT WGL  LLTK  SF
Sbjct  158   PMRFEEKTRDIYPYMLVNIGSGVSILKVTGPDEFSRISGTSLGGGTLWGLMSLLTKATSF  217

Query  981   DDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISE--NKELEDYRPE  1154
             D++LE+S+ GDN+ +D+LVGDIY G DY+K+GL AS IASSFGK   +      +D+R  
Sbjct  218   DEMLEISKDGDNKNVDLLVGDIY-GTDYTKLGLKASKIASSFGKVFKKGVQHSQDDFRAC  276

Query  1155  DISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAE  1334
             DI+ SLL M+S NIGQI+YLNA ++ LKRI+FGG FIRGH  TM+T+S+A+NFWS G+ +
Sbjct  277   DIAKSLLFMVSNNIGQIAYLNAKQHNLKRIYFGGCFIRGHPITMNTLSYAINFWSNGDMK  336

Query  1335  AMFLRHEGFLGALGAFMSY  1391
             A+FLRHEG LGA GAF+ +
Sbjct  337   ALFLRHEGHLGATGAFLKH  355



>gb|EIE83745.1| pantothenate kinase [Rhizopus delemar RA 99-880]
Length=399

 Score =   323 bits (828),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 182/383 (48%), Positives = 258/383 (67%), Gaps = 42/383 (11%)
 Frame = +3

Query  264   LDLSGAAIQGNFEEKDPT--ILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrk  437
             ++L+GA++  +      T  I+LPNQ + ++H+A+DIGGSL K+VYF+            
Sbjct  9     MNLTGASVSESILAAHETRDIVLPNQDEHVAHVAIDIGGSLAKMVYFTS-----------  57

Query  438   rkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEA  617
                            S  I GGRL+F KFET K++EC++F+++              +++
Sbjct  58    ---------------STDIKGGRLNFKKFETEKIDECIEFVAALMADV--------RAKS  94

Query  618   PQNENTIIKATGGGAYKFADLFKERL-GVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIE  794
              QN   ++KATGGGAY F D  KE+L GV I+KEDEM CL+ G NF +  I +E FT+ E
Sbjct  95    RQNNKLVLKATGGGAYLFYDKLKEKLPGVVIQKEDEMECLITGLNFFITEIPYEVFTYNE  154

Query  795   GHKEFVQIDQ--NDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTK  968
                + ++ ++  ND++PY+LVNIGSGVS++KV G  +F R+SGT++GGGT WGL  LLT 
Sbjct  155   QDSDPMKFEKKTNDIYPYMLVNIGSGVSILKVTGPDEFSRISGTSLGGGTLWGLMSLLTN  214

Query  969   CKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISE--NKELED  1142
               SFDD+LE+S+ GDNR ID++VGDIYG  DY+K+GL ++ IASSFGK   +   +   +
Sbjct  215   ATSFDDMLEISKTGDNRNIDLMVGDIYGS-DYTKLGLKSTRIASSFGKVFKKGVRQSQGN  273

Query  1143  YRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSK  1322
             ++ +DI+ SLL M+S NIGQI+YLNA ++ L RI+FGG FIRGH  TM+T+S+A+NFWS 
Sbjct  274   FQAQDIAKSLLFMVSNNIGQIAYLNAKQHNLTRIYFGGCFIRGHPITMNTLSYAINFWSN  333

Query  1323  GEAEAMFLRHEGFLGALGAFMSY  1391
             GE +A+FLRHEG LGA GAF+ +
Sbjct  334   GEMKALFLRHEGHLGATGAFLKH  356



>emb|CDY40427.1| BnaA04g20900D [Brassica napus]
Length=298

 Score =   320 bits (819),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 179/290 (62%), Positives = 219/290 (76%), Gaps = 15/290 (5%)
 Frame = +3

Query  336   SDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHF  515
             S  ISHLALDIGG+LIKLVYFS +     +            +  GN     +  GRL F
Sbjct  15    STQISHLALDIGGTLIKLVYFSPNGDNCEDGS----------IVVGNNGCSAV-QGRLCF  63

Query  516   VKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERL  695
              KFET K+++CLDFI    L   G+     ++     +   +KATGGGA+KFADLFKE+L
Sbjct  64    AKFETRKIDDCLDFIRLNILQHSGVQHTNGTAR----DKLSVKATGGGAFKFADLFKEKL  119

Query  696   GVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSM  875
             G+  +KEDEM+ LV G NFLLK +  EAFT+++G KEFVQID NDL+PYLLVNIGSGVSM
Sbjct  120   GIVFDKEDEMHSLVCGVNFLLKTVPREAFTYLDGQKEFVQIDHNDLYPYLLVNIGSGVSM  179

Query  876   IKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGG  1055
             IKVDGDGK++R+SGT++GGGT+ GLG+LLT CKSFD+LLELS +G+NR IDMLVGDIYGG
Sbjct  180   IKVDGDGKYERISGTSLGGGTFLGLGKLLTNCKSFDELLELSHQGNNRVIDMLVGDIYGG  239

Query  1056  MDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQI  1205
              DYSKIGLS++ IASSFGKAIS+ KELEDY+PED++ SLLRMIS NIGQ+
Sbjct  240   TDYSKIGLSSTAIASSFGKAISDGKELEDYQPEDVARSLLRMISNNIGQV  289



>emb|CEP10507.1| hypothetical protein [Parasitella parasitica]
Length=398

 Score =   320 bits (819),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 189/393 (48%), Positives = 263/393 (67%), Gaps = 46/393 (12%)
 Frame = +3

Query  237   MHRSTSRPQLD---LSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRH  407
             M+ +TS   +D   +S A    N E +D  I+LPNQ++ ++H+A+DIGGSL K+VYF+  
Sbjct  1     MNDNTSVMNVDGASVSEAVFAAN-ETRD--IVLPNQNEHVAHIAVDIGGSLAKIVYFT--  55

Query  408   EGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGG  587
                                S+ +R     +GGRLHF K ET K++EC+DFI+        
Sbjct  56    -------------------SSPDR-----VGGRLHFKKIETEKIDECIDFIADLVADARV  91

Query  588   LDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERL-GVSIEKEDEMNCLVAGANFLLKA  764
             L         P+N N ++KATGGGAY F D  +ERL GV I+KEDEM+CL+ G NF +  
Sbjct  92    L--------TPENTNYVLKATGGGAYLFFDKLQERLPGVIIQKEDEMDCLINGLNFFITE  143

Query  765   IRHEAFTHIEGHKEFVQIDQN--DLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGT  938
             I +E FT+ E   + ++ ++   D++PY+LVNIGSGVS++KV G  +F R+SGT+  GGT
Sbjct  144   IPYEVFTYNEQETDPMRFEEKTRDVYPYMLVNIGSGVSILKVTGPDEFSRISGTSASGGT  203

Query  939   YWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI  1118
              WGL  LLTK  SFD++LE+S+ GDN+ +D+LVGDIY G DY+K+GL A+ IASSFGK  
Sbjct  204   LWGLMSLLTKATSFDEMLEISKDGDNKNVDLLVGDIY-GTDYTKLGLKATKIASSFGKVF  262

Query  1119  SE--NKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDT  1292
              +   +  +++   DI+ SLL M+S NIGQI+YLNA ++ LKRI+FGG FIRGH  TM+T
Sbjct  263   KKGVQQSQDNFNACDIAKSLLFMVSNNIGQIAYLNAKQHDLKRIYFGGCFIRGHPITMNT  322

Query  1293  ISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSY  1391
             +S+A+NFWS G+ +A+FLRHEG LGA GAF+ +
Sbjct  323   LSYAINFWSNGDMKALFLRHEGHLGATGAFLKH  355



>ref|XP_010473224.1| PREDICTED: pantothenate kinase 1 [Camelina sativa]
Length=273

 Score =   315 bits (807),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 176/226 (78%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +3

Query  723   MNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKF  902
             M+ LV G NFLLK +  EAFT+++G K+FV+ID NDL+PYLLVNIGSGVSMIKVDGDGK+
Sbjct  1     MHSLVGGVNFLLKTVPREAFTYLDGQKDFVEIDHNDLYPYLLVNIGSGVSMIKVDGDGKY  60

Query  903   QRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLS  1082
             +R+SGT++GGGT+ GLG+LLTKCKSFD+LLELS  G+NR IDMLVGDIYGG DYSKIGLS
Sbjct  61    ERISGTSLGGGTFLGLGKLLTKCKSFDELLELSHHGNNRVIDMLVGDIYGGTDYSKIGLS  120

Query  1083  ASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggff  1262
             ++ IASSFGKAIS+ KELEDY+PED++ SLLRMIS NIGQI+YLNALR+GLKRIFFGGFF
Sbjct  121   STAIASSFGKAISDGKELEDYQPEDVARSLLRMISNNIGQIAYLNALRFGLKRIFFGGFF  180

Query  1263  irgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKH  1400
             IRG  YTMDTIS AV+FWS+GEA+AMFLRHEGFLGALGAF SYE H
Sbjct  181   IRGLEYTMDTISVAVHFWSRGEAKAMFLRHEGFLGALGAFTSYETH  226



>ref|XP_007512793.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17393.1| predicted protein [Bathycoccus prasinos]
Length=1064

 Score =   336 bits (862),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 200/408 (49%), Positives = 254/408 (62%), Gaps = 62/408 (15%)
 Frame = +3

Query  312   PTILLPNQS-DDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSY  488
             P+I LP Q  D + H ALD+GGSLIKLVYFS +      +      ++    S+  + + 
Sbjct  97    PSISLPRQRGDAVKHFALDLGGSLIKLVYFSANSDTNAMNGEDGSQQQTKEASS--KTTT  154

Query  489   PILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYK  668
               LGGRLHF +F ++ + ECLDFI  K+LH  G               + IKATGGG++K
Sbjct  155   ATLGGRLHFRRFPSSSLKECLDFIERKKLHYSG---------GFGQHKSEIKATGGGSFK  205

Query  669   FADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQN-------  827
                 F++ LG+ ++KEDEM C V GANFLLK IR EAFT     K FV  + N       
Sbjct  206   HQRTFRDALGIELQKEDEMACAVRGANFLLKTIRDEAFTFENDTKTFVDTNFNVNNFNST  265

Query  828   -----------------------------------------DLFPYLLVNIGSGVSMIKV  884
                                                      +LFPYLLVNIGSGVS+IKV
Sbjct  266   ATTTGGASGSISGSISGGGGIGGGGVESHSYSASSSNSSSNNLFPYLLVNIGSGVSIIKV  325

Query  885   DGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDY  1064
                G  +R+SG+N+GGGT+WGL RLLT  + +D++L+ SQ  D+  +DMLVGDIYG  DY
Sbjct  326   TETGH-ERISGSNIGGGTFWGLCRLLTGMRDYDEMLKCSQNADSARVDMLVGDIYG-RDY  383

Query  1065  SKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKri  1244
             +K+GLS+  IASSFG+ + E  +L DY   DI+LSLLRMISYNI  ++ +NA  +GL+RI
Sbjct  384   AKVGLSSDVIASSFGRVVMEEGDLSDYSKADITLSLLRMISYNIAHLATMNAKAHGLQRI  443

Query  1245  ffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMS  1388
             FFGG+FIRGHAYTM+TISFAVNFWSKGE +AMFLRHEGFLGALGAF+S
Sbjct  444   FFGGYFIRGHAYTMNTISFAVNFWSKGETKAMFLRHEGFLGALGAFLS  491



>ref|NP_001057098.1| Os06g0207000 [Oryza sativa Japonica Group]
 sp|Q69TF4.1|PANK1_ORYSJ RecName: Full=Pantothenate kinase 1; AltName: Full=Pantothenic 
acid kinase 1 [Oryza sativa Japonica Group]
 dbj|BAD35853.1| pantothenate kinase 1-like [Oryza sativa Japonica Group]
 dbj|BAF19012.1| Os06g0207000 [Oryza sativa Japonica Group]
 dbj|BAG90276.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80206.1| hypothetical protein OsI_22093 [Oryza sativa Indica Group]
Length=666

 Score =   325 bits (834),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 185/388 (48%), Positives = 251/388 (65%), Gaps = 39/388 (10%)
 Frame = +3

Query  261   QLDLSGAAIQ-------GNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrq  419
             ++DLSGA I+          +   P + LP Q      LALDIGG+LIKLVY +   G  
Sbjct  5     RVDLSGAEIRVDPACGAAADDGGSPPVFLPRQPAAPPLLALDIGGTLIKLVYTASCGGG-  63

Query  420   vedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTP  599
                                       G  L F KFE  ++ EC DF+ ++     GL   
Sbjct  64    --------------------------GAELRFAKFERRRMQECFDFVRAQ-----GLVHR  92

Query  600   RWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEA  779
               S+     EN  +KA+GGGAYK+ + F+E+LGV ++K DEM+ +V+GANFLL+++   A
Sbjct  93    NGSTMGSSKENIALKASGGGAYKYTEDFREKLGVCLDKVDEMDSVVSGANFLLQSVPGAA  152

Query  780   FTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRL  959
             FTH+ G K  V I  N+LFPYLLVNIGSGVS++KV G+ KF+RV+GT++GGGT +GL +L
Sbjct  153   FTHMNGKKSSVDISPNNLFPYLLVNIGSGVSILKVTGNRKFERVTGTHIGGGTMFGLAKL  212

Query  960   LTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELE  1139
             LT CKS+D+ L+LSQ+GDN  +D++V DI G +   K GLS ST+ASSFGK I+  K+L 
Sbjct  213   LTGCKSYDEFLQLSQKGDNFVLDLIVKDICGELVCQKQGLSTSTLASSFGKVITSKKKLT  272

Query  1140  DYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWS  1319
             DYRPED++ +LL   +YNI QIS+L A    L+R+FFGG +IRGH  TM  IS+A++FWS
Sbjct  273   DYRPEDLASTLLSAFTYNIAQISFLVASILHLRRVFFGGSYIRGHKSTMQNISYAIDFWS  332

Query  1320  KGEAEAMFLRHEGFLGALGAFMSYEKHG  1403
             + + +A+FL+HEG+LGALGA MSY   G
Sbjct  333   QSKMQAVFLQHEGYLGALGALMSYGDSG  360


 Score =   215 bits (547),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 153/215 (71%), Gaps = 7/215 (3%)
 Frame = +3

Query  771   HEAFTHIEGHKEFVQIDQND--LFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYW  944
             HE+ T I+   E    + ND  +FPYLLVNIGSGVSMI+V G+GKF+R+ G+++GGGT  
Sbjct  376   HESATPID---ETSTDEHNDGNIFPYLLVNIGSGVSMIEVTGNGKFERIIGSHLGGGTIL  432

Query  945   GLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISE  1124
             GL RLLT C S+D+ LELSQRG+N  +D+ VGDIYG   Y KIGL AST A+SFGK  S 
Sbjct  433   GLARLLTGCSSYDEFLELSQRGNNLAVDLTVGDIYGEHGYPKIGLPASTTAASFGKVSSS  492

Query  1125  NKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFA  1304
                L +Y+ ED++ +LL   +YNIGQI+Y  A   GLKRIFF G +I GH  TMD IS +
Sbjct  493   --RLSEYKVEDLAAALLNSFTYNIGQIAYFVANLSGLKRIFFRGAYICGHEKTMDKISHS  550

Query  1305  VNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             + +WSKG+ +  FL HEGFLG LGAF SYE  G+D
Sbjct  551   LKYWSKGQVQTTFLCHEGFLGTLGAFWSYENMGID  585



>gb|EEE65295.1| hypothetical protein OsJ_20527 [Oryza sativa Japonica Group]
Length=650

 Score =   325 bits (832),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 185/388 (48%), Positives = 251/388 (65%), Gaps = 39/388 (10%)
 Frame = +3

Query  261   QLDLSGAAIQ-------GNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrq  419
             ++DLSGA I+          +   P + LP Q      LALDIGG+LIKLVY +   G  
Sbjct  5     RVDLSGAEIRVDPACGAAADDGGSPPVFLPRQPAAPPLLALDIGGTLIKLVYTASCGGG-  63

Query  420   vedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTP  599
                                       G  L F KFE  ++ EC DF+ ++     GL   
Sbjct  64    --------------------------GAELRFAKFERRRMQECFDFVRAQ-----GLVHR  92

Query  600   RWSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEA  779
               S+     EN  +KA+GGGAYK+ + F+E+LGV ++K DEM+ +V+GANFLL+++   A
Sbjct  93    NGSTMGSSKENIALKASGGGAYKYTEDFREKLGVCLDKVDEMDSVVSGANFLLQSVPGAA  152

Query  780   FTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRL  959
             FTH+ G K  V I  N+LFPYLLVNIGSGVS++KV G+ KF+RV+GT++GGGT +GL +L
Sbjct  153   FTHMNGKKSSVDISPNNLFPYLLVNIGSGVSILKVTGNRKFERVTGTHIGGGTMFGLAKL  212

Query  960   LTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELE  1139
             LT CKS+D+ L+LSQ+GDN  +D++V DI G +   K GLS ST+ASSFGK I+  K+L 
Sbjct  213   LTGCKSYDEFLQLSQKGDNFVLDLIVKDICGELVCQKQGLSTSTLASSFGKVITSKKKLT  272

Query  1140  DYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWS  1319
             DYRPED++ +LL   +YNI QIS+L A    L+R+FFGG +IRGH  TM  IS+A++FWS
Sbjct  273   DYRPEDLASTLLSAFTYNIAQISFLVASILHLRRVFFGGSYIRGHKSTMQNISYAIDFWS  332

Query  1320  KGEAEAMFLRHEGFLGALGAFMSYEKHG  1403
             + + +A+FL+HEG+LGALGA MSY   G
Sbjct  333   QSKMQAVFLQHEGYLGALGALMSYGDSG  360


 Score =   182 bits (461),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 127/177 (72%), Gaps = 2/177 (1%)
 Frame = +3

Query  879   KVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGM  1058
             +V G+GKF+R+ G+++GGGT  GL RLLT C S+D+ LELSQRG+N  +D+ VGDIYG  
Sbjct  372   EVTGNGKFERIIGSHLGGGTILGLARLLTGCSSYDEFLELSQRGNNLAVDLTVGDIYGEH  431

Query  1059  DYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLK  1238
              Y KIGL AST A+SFGK  S    L +Y+ ED++ +LL   +YNIGQI+Y  A   GLK
Sbjct  432   GYPKIGLPASTTAASFGKVSSS--RLSEYKVEDLAAALLNSFTYNIGQIAYFVANLSGLK  489

Query  1239  riffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             RIFF G +I GH  TMD IS ++ +WSKG+ +  FL HEGFLG LGAF SYE  G+D
Sbjct  490   RIFFRGAYICGHEKTMDKISHSLKYWSKGQVQTTFLCHEGFLGTLGAFWSYENMGID  546



>ref|XP_002485965.1| pantothenate kinase, putative [Talaromyces stipitatus ATCC 10500]
 gb|EED13727.1| pantothenate kinase, putative [Talaromyces stipitatus ATCC 10500]
Length=447

 Score =   318 bits (815),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 189/387 (49%), Positives = 244/387 (63%), Gaps = 53/387 (14%)
 Frame = +3

Query  297   FEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGN  476
             +E KD  I LP+ +  +SH+A+DIGGSL KLVYF+R      E                 
Sbjct  57    YERKD--IRLPHHTSVVSHVAVDIGGSLAKLVYFTRELSSHSE-----------------  97

Query  477   RRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGG  656
                    GGRL+F+KFET +++ C+DFI  KQL     D  R +  AP      + ATGG
Sbjct  98    -------GGRLNFIKFETERIDRCIDFI--KQLKE---DHERLNGAAPG--ELCVVATGG  143

Query  657   GAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLF  836
             GAYK+ D  KE L V I +EDEM+CL+ G NF +  I HE F++ E            ++
Sbjct  144   GAYKYYDKLKETLKVDISQEDEMDCLITGLNFFITEIPHEVFSYSETEPMKFAEPNTSVY  203

Query  837   PYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDN  1016
             PYLLVNIGSGVSMIKV G  +FQRV GT++GGGT+WGL  LLT   SFDD+L ++ RGDN
Sbjct  204   PYLLVNIGSGVSMIKVSGPKEFQRVGGTHLGGGTFWGLMALLTGATSFDDMLAMADRGDN  263

Query  1017  RTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI----SENKELED--------------  1142
              ++DMLVGDIY GMDY+KIGL ++ IAS+FGK +    S  +  ED              
Sbjct  264   SSVDMLVGDIY-GMDYNKIGLKSTAIASTFGKVLKLKRSAEQRAEDGSDLGEDPEDTPPV  322

Query  1143  -YRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWS  1319
              +R ED+S SLL  IS NIGQI+YL + ++ LK I+FGG FIRGH  TM+T+S+A+ FWS
Sbjct  323   QFRHEDMSRSLLFAISNNIGQIAYLQSEKHQLKHIYFGGSFIRGHLQTMNTLSYAIKFWS  382

Query  1320  KGEAEAMFLRHEGFLGALGAFMSYEKH  1400
             KGE +A FLRHEG+LGA+GAF+  + H
Sbjct  383   KGEKQAYFLRHEGYLGAVGAFLKRQPH  409



>gb|KKA22937.1| Pantothenate kinase [Rasamsonia emersonii CBS 393.64]
Length=443

 Score =   315 bits (807),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 185/384 (48%), Positives = 247/384 (64%), Gaps = 54/384 (14%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP  +  +SH+A+DIGGSL KLVYF+R  G   +                
Sbjct  55    HYEGKD--IRLPYHTTVVSHVAVDIGGSLAKLVYFTRELGSADQ----------------  96

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATG  653
                     GGRL+F+KFET +++ C+DFI  KQL     D  + +  AP  +   + ATG
Sbjct  97    --------GGRLNFIKFETHRIDLCIDFI--KQLKD---DHEKLNGSAP--DELCVVATG  141

Query  654   GGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDL  833
             GGAYK+ D  KE L V I +EDEM CL+AG +F +  I +E FT+ E         + D+
Sbjct  142   GGAYKYYDRLKEALNVDIRREDEMECLIAGLDFFITQIPNEVFTYSETEPMRFAEARPDV  201

Query  834   FPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGD  1013
             +PYLLVNIGSGVSMIKV G  +FQRV GT++GGGT+WGL  LLT  ++FD++L ++  GD
Sbjct  202   YPYLLVNIGSGVSMIKVSGPNQFQRVGGTHLGGGTFWGLMSLLTGARTFDEMLTMADNGD  261

Query  1014  NRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI----SENKELED-------------  1142
             N  +DMLVGDIY GMDY+KIGL ++ IAS+FGK +    +  +E ED             
Sbjct  262   NSGVDMLVGDIY-GMDYNKIGLKSTAIASTFGKVLRMKRAAEREAEDGKGLSQADSEAKT  320

Query  1143  ---YRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNF  1313
                +RPED+S SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH  TM+T+S+A+ F
Sbjct  321   NVQFRPEDMSRSLLYAISNNIGQIAYLQSEKHQVKHIYFGGSFIRGHRQTMNTLSYAIKF  380

Query  1314  WSKGEAEAMFLRHEGFLGALGAFM  1385
             WSKGE +A FLRHEG+LGA+GAF+
Sbjct  381   WSKGEKQAYFLRHEGYLGAVGAFL  404



>gb|KDO82398.1| hypothetical protein CISIN_1g025826mg [Citrus sinensis]
Length=229

 Score =   306 bits (785),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/243 (63%), Positives = 181/243 (74%), Gaps = 34/243 (14%)
 Frame = +3

Query  345   ISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPILGGRLHFVKF  524
             ISHLALDIGGSLIK+VYF R  G                V +  ++S P+L GRLHF KF
Sbjct  21    ISHLALDIGGSLIKVVYFLRSNGSGGS------------VDDSGKKSDPVLEGRLHFAKF  68

Query  525   ETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFADLFKERLGVS  704
             ET+K+ +CL+FI SK LH                        GGGAYKFADL KE+LGV 
Sbjct  69    ETSKIIDCLEFIRSKNLHL----------------------AGGGAYKFADLIKEKLGVV  106

Query  705   IEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKV  884
             ++KEDEM+CLV GANFLLKA+  EAFT+++G KEFVQIDQNDL+PYLLVNIGSGVSMIKV
Sbjct  107   LDKEDEMDCLVTGANFLLKAVHQEAFTYVDGQKEFVQIDQNDLYPYLLVNIGSGVSMIKV  166

Query  885   DGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDY  1064
             DGDGKF+R+SGT+VGGGT+WGLGRLLT CKSFD+LLELS +G+NR IDMLVGDIYGG +Y
Sbjct  167   DGDGKFERISGTSVGGGTFWGLGRLLTNCKSFDELLELSHQGNNRVIDMLVGDIYGGSEY  226

Query  1065  SKI  1073
             SK+
Sbjct  227   SKV  229



>ref|XP_006656748.1| PREDICTED: pantothenate kinase 2-like [Oryza brachyantha]
Length=631

 Score =   314 bits (804),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 164/299 (55%), Positives = 222/299 (74%), Gaps = 7/299 (2%)
 Frame = +3

Query  498   GGRLHFVKFETTKVNECLDFISSKQL-HCGGLDTPRWSSEAPQNENTIIKATGGGAYKFA  674
             G  L F KFE  ++ EC DFI ++ L  C G      S+     EN  +KA+GGGAYKF 
Sbjct  31    GAELRFAKFERRRLQECFDFIRAQGLVRCNG------SAMGSSKENMTLKASGGGAYKFT  84

Query  675   DLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVN  854
             + F+E+LGV ++K DEM+ +V+GANFLL+ I   AFTH+ G +  + I  N+LFPYLLVN
Sbjct  85    EDFREKLGVFLDKVDEMDSVVSGANFLLQNIPGAAFTHMNGKRSSIDISPNNLFPYLLVN  144

Query  855   IGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDML  1034
             IGSGVS++KV G+ KF+RV+GT++GGGT +GL +LLT CKS+D+ L+LSQ+GDN  +D++
Sbjct  145   IGSGVSILKVTGNKKFERVTGTHIGGGTMFGLAKLLTGCKSYDEFLQLSQKGDNFVLDLI  204

Query  1035  VGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQISYL  1214
             V DI G +   K GLS ST+ASSFGK I+  K+L DYRPED++ +LL   +YNI QIS+L
Sbjct  205   VKDICGELVCQKQGLSTSTLASSFGKVITSKKKLTDYRPEDLASTLLSAFTYNIAQISFL  264

Query  1215  NALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFMSY  1391
              A   GL+R+FFGG +IRGH  TM+ IS+A++FWS+G+ +A+FL+HEG+LGALGA MSY
Sbjct  265   VASILGLRRVFFGGSYIRGHKSTMENISYAIDFWSQGQMQAVFLQHEGYLGALGALMSY  323


 Score =   213 bits (543),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 151/213 (71%), Gaps = 3/213 (1%)
 Frame = +3

Query  771   HEAFTHIEGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGL  950
             HE+   ++G       D N +FPYLLVNIGSGVSMI+V G+GKF+R+ G+++GGGT  GL
Sbjct  343   HESAVPVDGTSTGEHNDGN-IFPYLLVNIGSGVSMIEVIGNGKFERIIGSHLGGGTILGL  401

Query  951   GRLLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENK  1130
              RLLT C S+D+ LELSQRG+N  +D+ VGDIYG   Y KIGL AST A+SFGK  S   
Sbjct  402   ARLLTGCSSYDEFLELSQRGNNLAVDLTVGDIYGEHGYPKIGLPASTTAASFGKVSSS--  459

Query  1131  ELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVN  1310
              L +Y+ ED++ +LL   +YNIGQI+Y  A   GLKRIFF G ++ GH  TMD IS ++ 
Sbjct  460   RLAEYKVEDLAAALLNSFTYNIGQIAYFVANLSGLKRIFFRGAYVCGHEKTMDKISRSLK  519

Query  1311  FWSKGEAEAMFLRHEGFLGALGAFMSYEKHGLD  1409
             +WSKG+ +  FL HEGFLG LGAF SYE  G+D
Sbjct  520   YWSKGQVQTTFLCHEGFLGTLGAFWSYENMGID  552



>gb|EPS71982.1| pantothenate kinase family protein-like protein, partial [Genlisea 
aurea]
Length=261

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/258 (60%), Positives = 204/258 (79%), Gaps = 0/258 (0%)
 Frame = +3

Query  612   EAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHI  791
             E   +E  +IKATGGGA+KFA+LF E+LG+S+E+ DE++ LVAGA+F LKA   EAFT++
Sbjct  4     ELNSSEKIVIKATGGGAFKFANLFMEKLGISLEQVDEVDSLVAGADFALKAWHREAFTYM  63

Query  792   EGHKEFVQIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKC  971
              G KE++ +D  +L+PYLLVNIG+GVS+ KVD +   Q VSG+++GGGT+ GLG+LLTKC
Sbjct  64    NGEKEYILLDPQNLYPYLLVNIGTGVSITKVDSENTSQLVSGSSIGGGTFVGLGKLLTKC  123

Query  972   KSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRP  1151
             KSF++LLE S +G+ R IDMLV DIYG ++YSK+    + +A SFG+AI +NKELEDYR 
Sbjct  124   KSFNELLEQSHQGNTRAIDMLVEDIYGELEYSKLRFPRNALACSFGQAIHQNKELEDYRS  183

Query  1152  EDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEA  1331
             EDI+LSLLRMISYNI Q++++NA+ YG+KRIFFGG FI  + Y M  IS  ++ WS GEA
Sbjct  184   EDIALSLLRMISYNIAQLAFMNAVLYGVKRIFFGGSFIHSNEYAMVKISEGIHDWSGGEA  243

Query  1332  EAMFLRHEGFLGALGAFM  1385
             +A FL HEG LGALGAF+
Sbjct  244   KATFLSHEGVLGALGAFL  261



>dbj|GAM43950.1| fumble family pantothenate kinase [Talaromyces cellulolyticus]
Length=446

 Score =   306 bits (783),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 183/385 (48%), Positives = 243/385 (63%), Gaps = 53/385 (14%)
 Frame = +3

Query  297   FEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGN  476
             +E KD  I LP+ +  +SH+A+DIGGSL KLVYF+R                   +S+ +
Sbjct  56    YERKD--IRLPHHTSVVSHVAVDIGGSLAKLVYFTRE------------------ISSQS  95

Query  477   RRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGG  656
                    GGRL+F+KFET +++ C++FI  KQL     D  R +  AP      + ATGG
Sbjct  96    E------GGRLNFIKFETERIDRCIEFI--KQLKE---DHERLNGSAPG--ELCVVATGG  142

Query  657   GAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLF  836
             GAYK+ D  KE L V I +EDEM+CL+ G NF +  I HE F++ E            ++
Sbjct  143   GAYKYYDKLKETLKVDILREDEMDCLITGLNFFITEIPHEVFSYSETEPMKFAEPNGSVY  202

Query  837   PYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDN  1016
             PYLLVNIGSGVSMIKV G  +FQRV GT++GGGT+WG+  LLT   +FDD+L ++ RGDN
Sbjct  203   PYLLVNIGSGVSMIKVSGPNEFQRVGGTHLGGGTFWGIMALLTGATTFDDMLAMADRGDN  262

Query  1017  RTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAIS--------------ENKELEDYRP-  1151
               +DMLVGDIY GMDY+KIGL ++ IAS+FGK +                 ++ ED  P 
Sbjct  263   SGVDMLVGDIY-GMDYNKIGLKSTAIASTFGKVLKLKRSAEQRAEDGSDPGEDPEDTPPV  321

Query  1152  ----EDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWS  1319
                  D+S SLL  IS NIGQI+YL + ++ LK I+FGG FIRGH  TM+T+S+A+ FWS
Sbjct  322   QFSHADMSRSLLFAISNNIGQIAYLQSEKHQLKHIYFGGSFIRGHLQTMNTLSYAIKFWS  381

Query  1320  KGEAEAMFLRHEGFLGALGAFMSYE  1394
             KGE +A FLRHEG+LGA+GAF+  +
Sbjct  382   KGEKQAYFLRHEGYLGAVGAFLKLQ  406



>gb|KIX01921.1| pantothenate kinase [Rhinocladiella mackenziei CBS 650.93]
Length=435

 Score =   303 bits (777),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 182/388 (47%), Positives = 243/388 (63%), Gaps = 59/388 (15%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP+ +D +SH+A+DIGGSL KLVYFSR  G                    
Sbjct  58    HWERKD--IRLPHHTDVVSHVAVDIGGSLAKLVYFSREPGSTHG----------------  99

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISS-KQLHCGGLDTPRWSSEAPQNENTIIKAT  650
                     GGRL+FV FET +++ C+DFI   KQ         + +   PQ    I+ AT
Sbjct  100   --------GGRLNFVNFETDRIDMCIDFIQELKQTQS------KLNGSTPQQ--LIVMAT  143

Query  651   GGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQND  830
             GGGAYKF +  KE L V + +EDEM CL+ G +F +  I  E FT+ E         + D
Sbjct  144   GGGAYKFYNRMKEVLHVDVVQEDEMECLIIGLDFFITEIPREVFTYSEEEPMQFAEARAD  203

Query  831   LFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRG  1010
             ++PYLLVNIGSGVSM+KV G  +FQRV GT++GGGT+WGL  LLT  ++FD++L L+++G
Sbjct  204   IYPYLLVNIGSGVSMVKVSGPREFQRVGGTSLGGGTFWGLLSLLTGARTFDEMLRLAEKG  263

Query  1011  DNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI----------------------SE  1124
             DN  +DMLVGDIYGG  YSKIGL ++TIAS+FGK                         E
Sbjct  264   DNSGVDMLVGDIYGG-GYSKIGLKSTTIASTFGKVFRMKRLAERHAEDGEGLSNGDPHGE  322

Query  1125  NKE-LEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISF  1301
             N++ L  ++ ED++ SLL  IS NIGQI+YL + ++ L+ I+FGG FIRGH  TM+T+S+
Sbjct  323   NEDRLGGFKMEDMARSLLYAISNNIGQIAYLQSEKHNLQHIYFGGSFIRGHTQTMNTLSY  382

Query  1302  AVNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             A+ FWSKGE +A FLRHEG+LGA+GAF+
Sbjct  383   AIKFWSKGEKQAYFLRHEGYLGAVGAFL  410



>ref|XP_754888.1| pantothenate kinase [Aspergillus fumigatus Af293]
 gb|EAL92850.1| pantothenate kinase, putative [Aspergillus fumigatus Af293]
 gb|EDP53016.1| pantothenate kinase, putative [Aspergillus fumigatus A1163]
 gb|KEY78639.1| pantothenate kinase [Aspergillus fumigatus var. RP-2014]
Length=456

 Score =   303 bits (775),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 177/385 (46%), Positives = 239/385 (62%), Gaps = 55/385 (14%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E +D  I LP+ +  +SH+A+DIGGSL KLVYF++                       
Sbjct  69    HYESQD--IRLPHHTGLVSHVAVDIGGSLAKLVYFTK-----------------------  103

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATG  653
                  P  GGRL+F+ FET +++ C+DFI         L         P  +   + ATG
Sbjct  104   -ELDSPDNGGRLNFINFETHRIDLCIDFIRQ-------LKDEHERLNGPSRDELCVVATG  155

Query  654   GGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDL  833
             GGAYK+ D  KE L V+I +EDEM CL+ G +F +  I +E FT+ E         + D+
Sbjct  156   GGAYKYYDKLKETLKVNIIREDEMECLITGLDFFITEIPNEVFTYSEAEPMQFAEARPDV  215

Query  834   FPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGD  1013
             +PYLLVNIGSGVSMIKV G  +F+RV GT++GGGT+WGL  LLT  ++FDD+L ++ RGD
Sbjct  216   YPYLLVNIGSGVSMIKVSGPKQFERVGGTHLGGGTFWGLMSLLTGTRNFDDMLAMADRGD  275

Query  1014  NRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI----SENKELED-------------  1142
             N  +DMLVGDIY GMDYSKIGL ++ IAS+FGK +    +  +  ED             
Sbjct  276   NSGVDMLVGDIY-GMDYSKIGLKSTAIASTFGKVLRLQNAAERHAEDGEGLCNGGPEQQN  334

Query  1143  ----YRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVN  1310
                 +R ED+S SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH  TM+T+S+A+ 
Sbjct  335   GEVKFRHEDMSRSLLYAISNNIGQIAYLQSEKHQVKHIYFGGSFIRGHHQTMNTLSYAIR  394

Query  1311  FWSKGEAEAMFLRHEGFLGALGAFM  1385
             FWSKGE +A FLRHEG+LGA+GAF+
Sbjct  395   FWSKGEKQAYFLRHEGYLGAVGAFL  419



>gb|EFA83432.1| pantothenate kinase [Polysphondylium pallidum PN500]
Length=629

 Score =   308 bits (788),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 179/385 (46%), Positives = 245/385 (64%), Gaps = 32/385 (8%)
 Frame = +3

Query  273   SGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvke  452
             SG+  + +  + +  I LPNQS  I H ALDIGG+L KLVYF ++      +        
Sbjct  183   SGSPPKQHHVKDERPISLPNQSSPIKHFALDIGGTLSKLVYFVQNNSHNNNNNNNTSTST  242

Query  453   rFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNEN  632
                 S   +     LGG+LHF+KF+T  + +CL+FI   +LH             P++  
Sbjct  243   IPSSSTTTQNE---LGGKLHFIKFQTKNIEDCLNFIIDNKLH--------LEDGKPKD--  289

Query  633   TIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFV  812
               ++ TGGGAYK+ADLF E+LG  + KEDEM+CL+ G NFLL  I+ E++T+        
Sbjct  290   --VRVTGGGAYKYADLFNEKLGCRLIKEDEMHCLIVGTNFLLNNIQRESYTYSPTPNA--  345

Query  813   QIDQNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLL  992
              I   +    +++ IGSGVS+IKVD +  FQRV GT++GGGT+WGL  LLT    FD++L
Sbjct  346   -ITPREFVDKVVLQIGSGVSVIKVDSETSFQRVDGTSLGGGTFWGLCSLLTGVTDFDEML  404

Query  993   ELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI-------------SENKE  1133
             E+++ G +  +D++VGDIYG  DYSKIGLS+ TIASSFGK I               N  
Sbjct  405   EMTKNGHSNNVDLVVGDIYG-TDYSKIGLSSETIASSFGKIIYQSSTEQSSDSSDGNNNN  463

Query  1134  LEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNF  1313
              + +R EDI+ SLL+M+S NIGQI+YLN+ RYGL +I+FGGFFIR H  TM  ISFA++F
Sbjct  464   KQQFRKEDIAQSLLKMVSNNIGQIAYLNSQRYGLNKIYFGGFFIRDHPNTMQRISFAIDF  523

Query  1314  WSKGEAEAMFLRHEGFLGALGAFMS  1388
             WSKG+ +AMFL H+G+LGALGAF++
Sbjct  524   WSKGKTKAMFLVHDGYLGALGAFLA  548



>gb|KFX49665.1| Pantothenate kinase [Talaromyces marneffei PM1]
 gb|KFX49666.1| Pantothenate kinase [Talaromyces marneffei PM1]
Length=449

 Score =   302 bits (774),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 182/382 (48%), Positives = 242/382 (63%), Gaps = 53/382 (14%)
 Frame = +3

Query  297   FEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGN  476
             +E KD  I LP+ +  +SH+A+DIGGSL KLVYF+R                   +S+ +
Sbjct  56    YERKD--IRLPHHTSVVSHVAVDIGGSLAKLVYFTRE------------------ISSQS  95

Query  477   RRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGG  656
                    GGRL+F+KFET +++ C++FI  KQL     D  R +   P  +   + ATGG
Sbjct  96    D------GGRLNFIKFETERIDRCIEFI--KQLKE---DHERLNGSVP--DELCVVATGG  142

Query  657   GAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLF  836
             GAYK+ D  KE L V I +EDEM+CL+ G NF +  I +E F++ E            ++
Sbjct  143   GAYKYYDKLKETLKVDILREDEMDCLITGLNFFITEIPNEVFSYSETEPMKFAEPNGSVY  202

Query  837   PYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDN  1016
             PYLLVNIGSGVSMIKV G  +FQRV GT++GGGT+WGL  LLT   +FDD+L ++ RGDN
Sbjct  203   PYLLVNIGSGVSMIKVSGPKEFQRVGGTHLGGGTFWGLMALLTGATTFDDMLAMADRGDN  262

Query  1017  RTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENK--------------ELEDYRP-  1151
               +DMLVGDIY GMDY+KIGL ++ IAS+FGK +   +              + ED  P 
Sbjct  263   SGVDMLVGDIY-GMDYNKIGLKSTAIASTFGKVLKLKRSAEQRAEDGSDLGEDPEDTPPV  321

Query  1152  ----EDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWS  1319
                  D+S SLL  IS NIGQI+YL + ++ LK I+FGG FIRGH  TM+T+S+A+ FWS
Sbjct  322   QFSHADMSRSLLFAISNNIGQIAYLQSEKHELKHIYFGGSFIRGHLQTMNTLSYAIKFWS  381

Query  1320  KGEAEAMFLRHEGFLGALGAFM  1385
             KGE +A FLRHEG+LGA+GAF+
Sbjct  382   KGEKQAYFLRHEGYLGAVGAFL  403



>ref|XP_002152387.1| pantothenate kinase, putative [Talaromyces marneffei ATCC 18224]
 gb|EEA19450.1| pantothenate kinase, putative [Talaromyces marneffei ATCC 18224]
Length=450

 Score =   302 bits (773),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 182/382 (48%), Positives = 242/382 (63%), Gaps = 53/382 (14%)
 Frame = +3

Query  297   FEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGN  476
             +E KD  I LP+ +  +SH+A+DIGGSL KLVYF+R                   +S+ +
Sbjct  57    YERKD--IRLPHHTSVVSHVAVDIGGSLAKLVYFTRE------------------ISSQS  96

Query  477   RRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGG  656
                    GGRL+F+KFET +++ C++FI  KQL     D  R +   P  +   + ATGG
Sbjct  97    D------GGRLNFIKFETERIDRCIEFI--KQLKE---DHERLNGSVP--DELCVVATGG  143

Query  657   GAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLF  836
             GAYK+ D  KE L V I +EDEM+CL+ G NF +  I +E F++ E            ++
Sbjct  144   GAYKYYDKLKETLKVDILREDEMDCLITGLNFFITEIPNEVFSYSETEPMKFAEPNGSVY  203

Query  837   PYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDN  1016
             PYLLVNIGSGVSMIKV G  +FQRV GT++GGGT+WGL  LLT   +FDD+L ++ RGDN
Sbjct  204   PYLLVNIGSGVSMIKVSGPKEFQRVGGTHLGGGTFWGLMALLTGATTFDDMLAMADRGDN  263

Query  1017  RTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENK--------------ELEDYRP-  1151
               +DMLVGDIY GMDY+KIGL ++ IAS+FGK +   +              + ED  P 
Sbjct  264   SGVDMLVGDIY-GMDYNKIGLKSTAIASTFGKVLKLKRSAEQRAEDGSDLGEDPEDTPPV  322

Query  1152  ----EDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWS  1319
                  D+S SLL  IS NIGQI+YL + ++ LK I+FGG FIRGH  TM+T+S+A+ FWS
Sbjct  323   QFSHADMSRSLLFAISNNIGQIAYLQSEKHELKHIYFGGSFIRGHLQTMNTLSYAIKFWS  382

Query  1320  KGEAEAMFLRHEGFLGALGAFM  1385
             KGE +A FLRHEG+LGA+GAF+
Sbjct  383   KGEKQAYFLRHEGYLGAVGAFL  404



>ref|XP_001400486.2| pantothenate kinase [Aspergillus niger CBS 513.88]
Length=419

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 175/360 (49%), Positives = 232/360 (64%), Gaps = 39/360 (11%)
 Frame = +3

Query  318   ILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPIL  497
             I LP+ +  +SH+A+DIGGSL KLVYF+R                   V N         
Sbjct  57    IRLPHHTGLVSHVAVDIGGSLAKLVYFTRELDS---------------VDN---------  92

Query  498   GGRLHFVKFETTKVNECLDFISS-KQLH--CGGLDTPRWSSEAPQNENTIIKATGGGAYK  668
             GGRL+F+ FET++++ C+DFI   K+ H   GG          P  +   + ATGGGA+K
Sbjct  93    GGRLNFINFETSRIDLCIDFIKQLKEEHEKLGG----------PSGDALCVMATGGGAFK  142

Query  669   FADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLL  848
             + D  KE L V I +EDEM CL+ G +F +  I +E FT+ E         + D++PYLL
Sbjct  143   YYDKLKEALNVDIIREDEMECLITGLDFFITEIPNEVFTYSETEPMQFAEARPDVYPYLL  202

Query  849   VNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTID  1028
             VNIGSGVSMIKV G  +FQRV GT++GGGT+WG+  LLT  ++FDD+L ++ RGDN  +D
Sbjct  203   VNIGSGVSMIKVSGPKQFQRVGGTHLGGGTFWGIMSLLTGARTFDDMLAMADRGDNSGVD  262

Query  1029  MLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELE-DYRPEDISLSLLRMISYNIGQI  1205
             MLVGDIY GMDYSKIGL  + IAS+FGK        E  +  ED+S SLL  IS NIGQI
Sbjct  263   MLVGDIY-GMDYSKIGLKNTAIASTFGKVFPGQTNGEPKFHHEDMSRSLLYAISNNIGQI  321

Query  1206  SYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             +YL + ++ +K I+FGG FIRGH  TM+T+S+A+ FWSKGE +A FLRHEG++GA+G F+
Sbjct  322   AYLQSEKHQVKHIYFGGSFIRGHRQTMNTLSYAIKFWSKGEKQAYFLRHEGYIGAVGVFL  381



>gb|KFH68550.1| pantothenate kinase [Mortierella verticillata NRRL 6337]
Length=392

 Score =   300 bits (767),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 189/369 (51%), Positives = 255/369 (69%), Gaps = 41/369 (11%)
 Frame = +3

Query  285   IQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGV  464
             +QG  E +D  I LPN ++ +S +++D+GGSL K+VYFSR  G +               
Sbjct  17    VQG--EARD--IQLPN-TEHVSQISVDVGGSLAKVVYFSRRAGTK---------------  56

Query  465   SNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIK  644
                        GGRL+F KFET K+++C++FI  ++L    L+  R  +  P +E  +IK
Sbjct  57    -----------GGRLNFRKFETEKIDDCIEFI--RRL----LEESR--AHRPGHE-FVIK  96

Query  645   ATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQ  824
             ATGGGA+ + + F++ LGV+I++EDEM+CL+ G NFL+  I  E FT+ E +    +   
Sbjct  97    ATGGGAHLYYERFRDTLGVNIQREDEMDCLITGLNFLITEIPFEVFTYSETNPMCFEETP  156

Query  825   NDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQ  1004
              D FPY+LVNIGSGVS++KV     F+R+SGT++GGGT WGL  LLT  K+FD++LE SQ
Sbjct  157   VDQFPYMLVNIGSGVSILKVTSATTFERISGTSLGGGTLWGLLSLLTGAKTFDEMLEASQ  216

Query  1005  RGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMI  1184
              GDNR +DMLVGDIY G DYSKIGL ++TIASS GK   +N +   +RPEDIS SLL M+
Sbjct  217   EGDNRNVDMLVGDIY-GTDYSKIGLKSTTIASSMGKVFKKNVDKRQFRPEDISRSLLYMV  275

Query  1185  SYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFL  1364
             S NIGQI+YLNA  +GL RI+FGG FIRGH  TM+T+S+A+NFWSKG  +A+FLRHEG+L
Sbjct  276   SNNIGQIAYLNAQAHGLDRIYFGGCFIRGHPITMNTLSYAINFWSKGSKKALFLRHEGYL  335

Query  1365  GALGAFMSY  1391
             GA+GAFM +
Sbjct  336   GAVGAFMKH  344



>ref|XP_001270736.1| pantothenate kinase, putative [Aspergillus clavatus NRRL 1]
 gb|EAW09310.1| pantothenate kinase, putative [Aspergillus clavatus NRRL 1]
Length=454

 Score =   301 bits (772),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 177/384 (46%), Positives = 233/384 (61%), Gaps = 55/384 (14%)
 Frame = +3

Query  297   FEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGN  476
             +E +D  I LP+ +  +SH+A+DIGGSL KLVYFSR                        
Sbjct  68    YESQD--IRLPHHTGLVSHVAVDIGGSLAKLVYFSR------------------------  101

Query  477   RRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGG  656
                 P  GGRL+F+ FET ++  C+DFI         L         P  +   I ATGG
Sbjct  102   ELDSPDNGGRLNFINFETHRIELCIDFIRQ-------LKEEHLRLNGPSEDELCIIATGG  154

Query  657   GAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLF  836
             GAYK+ D  KE L V+I +EDEM CL+ G +F +  I +E FT+ E         + D++
Sbjct  155   GAYKYYDKLKEALNVNIIREDEMECLITGLDFFITEIPNEVFTYSEAEPMQFAEARPDVY  214

Query  837   PYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDN  1016
             PYLLVNIGSGVSMIKV G  +F+RV GT++GGGT+WGL  LLT  ++FDD+L ++ RGDN
Sbjct  215   PYLLVNIGSGVSMIKVSGPKQFERVGGTHLGGGTFWGLMSLLTGARTFDDMLAMADRGDN  274

Query  1017  RTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI----SENKELED--------------  1142
               +DMLVGDIY GMDY KIGL ++ IAS+FGK      +  +  ED              
Sbjct  275   SGVDMLVGDIY-GMDYGKIGLKSTAIASTFGKVFRMMNTAERRAEDGVGLSVHESDQTNG  333

Query  1143  ---YRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNF  1313
                + PED+  SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH  TM+T+S+A+ F
Sbjct  334   EVKFSPEDMGRSLLYAISNNIGQIAYLQSEKHQVKHIYFGGSFIRGHHQTMNTLSYAIRF  393

Query  1314  WSKGEAEAMFLRHEGFLGALGAFM  1385
             WSKGE +  FLRHEG+LGA+GAF+
Sbjct  394   WSKGEKQGYFLRHEGYLGAVGAFL  417



>ref|XP_003172870.1| pantothenate kinase [Microsporum gypseum CBS 118893]
 gb|EFR02459.1| pantothenate kinase [Microsporum gypseum CBS 118893]
Length=441

 Score =   301 bits (770),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 176/383 (46%), Positives = 247/383 (64%), Gaps = 54/383 (14%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP+ +D +SH+A+DIGG+L KLVYFS                    +S  
Sbjct  70    HYEHKD--IRLPHHTDVVSHVAVDIGGTLAKLVYFSPE------------------ISQS  109

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISS-KQLHCGGLDTPRWSSEAPQNENTIIKAT  650
                     GGRL+F+ FET++++ C+DF+   K+ H       + +  AP      + AT
Sbjct  110   GS------GGRLNFINFETSRIDLCIDFLKELKENH------KKRNGSAPYE--LCVMAT  155

Query  651   GGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQND  830
             GGGAYKF D+ KE LGV++ +EDEM CL+ G +F +  I +E FT+ E         + D
Sbjct  156   GGGAYKFYDMLKEALGVNVLREDEMECLIIGLDFFITEIPNEVFTYSETTPMQFAEARAD  215

Query  831   LFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRG  1010
             ++PYLLVNIGSGVSM+KV G  +F+RV GT++GGGT+WGL  LLT  ++FD++L +++RG
Sbjct  216   VYPYLLVNIGSGVSMVKVSGPRRFERVGGTSLGGGTFWGLMALLTGARTFDEMLAMAERG  275

Query  1011  DNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI---------SEN---------KEL  1136
             DN  +DMLVGDIY G DY KIGL ++ IAS+FGK +         +EN         +++
Sbjct  276   DNSGVDMLVGDIY-GTDYGKIGLKSTAIASTFGKVLKLKRLEERNAENSGSESPTSEQDI  334

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
               +  ED+S SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH  TM+T+S+A+ FW
Sbjct  335   SHFSHEDMSQSLLFAISNNIGQIAYLQSEKHQIKHIYFGGSFIRGHRQTMNTLSYAIRFW  394

Query  1317  SKGEAEAMFLRHEGFLGALGAFM  1385
             SKGE +A FLRHEG+LGA+GAF+
Sbjct  395   SKGEKQAYFLRHEGYLGAVGAFL  417



>ref|XP_001263732.1| pantothenate kinase, putative [Neosartorya fischeri NRRL 181]
 gb|EAW21835.1| pantothenate kinase, putative [Neosartorya fischeri NRRL 181]
Length=456

 Score =   301 bits (771),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 178/385 (46%), Positives = 240/385 (62%), Gaps = 55/385 (14%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E +D  I LP+ +  +SH+A+DIGGSL KLVYF+R                    S+ 
Sbjct  69    HYESQD--IRLPHHTGLVSHVAVDIGGSLAKLVYFTRELD-----------------SSD  109

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATG  653
             N       GGRL+F+ FET +++ C+DFI         L         P  +   + ATG
Sbjct  110   N-------GGRLNFINFETHRIDLCIDFIRQ-------LKEEHERLNGPSRDELCVVATG  155

Query  654   GGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDL  833
             GGAYK+ D  KE L V+I +EDEM CL+ G +F +  I +E FT+ E         + D+
Sbjct  156   GGAYKYYDKLKETLNVNIIREDEMECLITGLDFFITEIPNEVFTYSEAEPMQFAEARPDV  215

Query  834   FPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGD  1013
             +PYLLVNIGSGVSMIKV G  +F+RV GT++GGGT+WGL  LLT  ++FDD+L ++ RGD
Sbjct  216   YPYLLVNIGSGVSMIKVSGPKQFERVGGTHLGGGTFWGLMSLLTGTRNFDDMLAMADRGD  275

Query  1014  NRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI----SENKELED-------------  1142
             N  +DMLVGDIY GMDYSKIGL ++ IAS+FGK +    +  +  ED             
Sbjct  276   NSGVDMLVGDIY-GMDYSKIGLKSTAIASTFGKVLRLQNAAERHAEDGEGLCNGGPEQQN  334

Query  1143  ----YRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVN  1310
                 +R ED+S SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH  TM+T+S+A+ 
Sbjct  335   GEVKFRHEDMSRSLLYAISNNIGQIAYLQSEKHQVKHIYFGGSFIRGHHQTMNTLSYAIR  394

Query  1311  FWSKGEAEAMFLRHEGFLGALGAFM  1385
             FWSKGE +  FLRHEG+LGA+GAF+
Sbjct  395   FWSKGEKQGYFLRHEGYLGAVGAFL  419



>ref|XP_868828.1| hypothetical protein AN9446.2 [Aspergillus nidulans FGSC A4]
 gb|AAD09811.1| pantothenate kinase [Aspergillus nidulans]
 gb|EAA60034.1| hypothetical protein AN9446.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF76699.1| TPA: Pantothenate kinasePutative uncharacterized protein (EC 
2.7.1.33); [Source:UniProtKB/TrEMBL;Acc:O93921] [Aspergillus 
nidulans FGSC A4]
Length=420

 Score =   300 bits (767),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 177/383 (46%), Positives = 237/383 (62%), Gaps = 53/383 (14%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E +D  I LP+ +  +SH+A+DIGGSL KLVYF+R                       
Sbjct  50    HYEGQD--IRLPHHTGVVSHVAVDIGGSLAKLVYFTRE----------------------  85

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATG  653
                  P  GGRL+F+ FET ++N CL+FI         L      S     E   + ATG
Sbjct  86    --LDSPDNGGRLNFINFETDRINLCLEFIKR-------LKEEHRDSNGGTKEELCVVATG  136

Query  654   GGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDL  833
             GGAYK+ D  KE L V I +EDEM CL+ G +F +  I +E FT+ E         + D+
Sbjct  137   GGAYKYYDKLKETLNVDIMREDEMECLITGLDFFITEIPNEIFTYSETEPMQFAEARPDV  196

Query  834   FPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGD  1013
             +PYLLVNIGSGVSMIKV G  +FQRV GT++GGGT+WG+  LLT  ++FDD+L ++ RGD
Sbjct  197   YPYLLVNIGSGVSMIKVSGPKQFQRVGGTHLGGGTFWGIMSLLTGARTFDDMLAMADRGD  256

Query  1014  NRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI---------SENKELED--------  1142
             N  +DMLVGDIY GMDY KIGL ++ IAS+FGK           S+ +  +D        
Sbjct  257   NSGVDMLVGDIY-GMDYGKIGLKSTAIASTFGKVFRLQNRERVASDGEAPQDGSRQKADE  315

Query  1143  --YRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
               ++ ED+S SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH  TM+T+S+A+ FW
Sbjct  316   PIFKHEDMSRSLLYAISNNIGQIAYLQSEKHQVKHIYFGGSFIRGHRQTMNTLSYAIRFW  375

Query  1317  SKGEAEAMFLRHEGFLGALGAFM  1385
             SKGE +A FLRHEG++GA+GAF+
Sbjct  376   SKGEKQAYFLRHEGYIGAVGAFL  398



>ref|XP_001246572.1| hypothetical protein CIMG_00343 [Coccidioides immitis RS]
 ref|XP_003066627.1| pantothenate kinase, putative [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EER24482.1| pantothenate kinase, putative [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EFW18402.1| pantothenate kinase [Coccidioides posadasii str. Silveira]
Length=462

 Score =   301 bits (770),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 181/386 (47%), Positives = 245/386 (63%), Gaps = 57/386 (15%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP+ +D +SH+A+DIGGSL KLVYFS   G   +                
Sbjct  71    HYEHKD--IRLPHHTDVVSHVAVDIGGSLAKLVYFSPELGSSAD----------------  112

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATG  653
                     GGRL+F+ FET +++ C+DF+  KQL     +  + +  AP      I ATG
Sbjct  113   --------GGRLNFLNFETERIDLCIDFL--KQLK---ENHRKLNGSAPG--PLCIMATG  157

Query  654   GGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHK-EFVQIDQND  830
             GGAYK+ D  KE LGV I +EDEM CL+ G +F +  I +E FT+ E    EF +  + D
Sbjct  158   GGAYKYYDRLKEELGVDIIREDEMECLIIGLDFFITEIPNEVFTYSETSPMEFAEA-RPD  216

Query  831   LFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRG  1010
             ++PYLLVNIGSGVSM+KV    +F+RV GT++GGGT+WGL  LLT  ++FD++L +++ G
Sbjct  217   VYPYLLVNIGSGVSMVKVSAPRRFERVGGTSLGGGTFWGLMSLLTGARTFDEMLAMAELG  276

Query  1011  DNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAIS---------------------EN  1127
             DN  +DMLVGDIY G DY+KIGL +STIAS+FGK                          
Sbjct  277   DNSGVDMLVGDIY-GTDYTKIGLKSSTIASTFGKVFKMQRLAERSAQGSECLCESDSESE  335

Query  1128  KELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAV  1307
             +++  +R EDIS SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH  TM+T+S+A+
Sbjct  336   RDVSQFRREDISRSLLFAISNNIGQIAYLQSEKHQIKHIYFGGSFIRGHRQTMNTLSYAI  395

Query  1308  NFWSKGEAEAMFLRHEGFLGALGAFM  1385
              FWSKGE +A FLRHEG+LGA+GAF+
Sbjct  396   RFWSKGEKQAYFLRHEGYLGAVGAFL  421



>dbj|GAD92341.1| pantothenate kinase, putative [Byssochlamys spectabilis No. 5]
Length=444

 Score =   300 bits (768),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 181/387 (47%), Positives = 244/387 (63%), Gaps = 60/387 (16%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP+ +  +SH+A+DIGGSL KLVYF+R                       
Sbjct  67    HYENKD--IRLPHHTGLVSHVAVDIGGSLAKLVYFTRELDSADN----------------  108

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATG  653
                     GGRL+F+ FET +++ C+DFI  KQL            +   ++   + ATG
Sbjct  109   --------GGRLNFINFETARIDLCIDFI--KQL-------KEEHEKLNGSDELCVVATG  151

Query  654   GGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHK-EFVQIDQND  830
             GGAYK+ D  +E L V++ +EDEM CL+ G +F +  I +E FT+ E H  EF +  + D
Sbjct  152   GGAYKYYDKLREVLDVNVLREDEMQCLITGLDFFITEIPNEVFTYSETHPMEFAEA-RPD  210

Query  831   LFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRG  1010
             ++PYLLVNIGSGVSMIKV G  +FQRV GT++GGGT+WGL  LLT  +SFD++L ++ RG
Sbjct  211   VYPYLLVNIGSGVSMIKVSGPRQFQRVGGTHLGGGTFWGLMSLLTGARSFDEMLAMADRG  270

Query  1011  DNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI----SENKELED------------  1142
             DN  +DMLVGDIY GMDY+KIGL ++ IAS+FGK      +  +E ED            
Sbjct  271   DNSGVDMLVGDIY-GMDYNKIGLKSTAIASTFGKVFRMKRAAEREAEDGEGLIQSDADPG  329

Query  1143  ------YRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFA  1304
                   +  ED+S SLL  IS NIGQISYL + ++ +K I+FGG FIRGH  TM+T+S+A
Sbjct  330   NDRGAKFSHEDMSRSLLYAISNNIGQISYLQSEKHEVKHIYFGGSFIRGHPQTMNTLSYA  389

Query  1305  VNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             + FWSKGE +A FLRHEG+LGA+GAF+
Sbjct  390   IRFWSKGEKQAYFLRHEGYLGAVGAFL  416



>gb|KIW79137.1| pantothenate kinase [Fonsecaea pedrosoi CBS 271.37]
Length=443

 Score =   300 bits (768),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 179/387 (46%), Positives = 241/387 (62%), Gaps = 57/387 (15%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP+ +D +SH+ALDIGGSL KLVYFSR  G                    
Sbjct  66    HWEHKD--IRLPHHTDVVSHVALDIGGSLAKLVYFSREPGSTHG----------------  107

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATG  653
                     GGRL+FV FET +++ C+DFI   +         + +   PQ     + ATG
Sbjct  108   --------GGRLNFVNFETDRIDLCIDFIQELKK-----TQSKLNGSTPQE--LCVMATG  152

Query  654   GGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDL  833
             GGAYKF +  KE L V + +EDEM CL+ G +F +  I  E FT+ E         + D+
Sbjct  153   GGAYKFYNRMKELLHVDVVQEDEMECLIIGLDFFITEIPREVFTYSEEEPMQFAEARADI  212

Query  834   FPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGD  1013
             +PYLLVNIGSGVSM+KV G  +FQRV GT++GGGT+WG+  LLT  ++FD++L L++RGD
Sbjct  213   YPYLLVNIGSGVSMVKVSGPREFQRVGGTSLGGGTFWGILSLLTGARTFDEMLRLAERGD  272

Query  1014  NRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI---------SENKE-----------  1133
             N  +DMLVGDIYGG  YSKIGL ++TIAS+FGK           +E+ E           
Sbjct  273   NSGVDMLVGDIYGG-GYSKIGLKSTTIASTFGKVFRMKRMAERHAEDGEGLFNGDGQDDD  331

Query  1134  ---LEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFA  1304
                L  ++ ED++ SLL  IS NIGQI+YL + ++ L+ I+FGG FIRGH  TM+T+S+A
Sbjct  332   HDMLRGFKTEDMARSLLYAISNNIGQIAYLQSEKHKLQHIYFGGSFIRGHTQTMNTLSYA  391

Query  1305  VNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             + FWS+GE +A FLRHEG+LGA+GAF+
Sbjct  392   IKFWSQGEKQAYFLRHEGYLGAVGAFL  418



>gb|ESA02283.1| hypothetical protein GLOINDRAFT_337485 [Rhizophagus irregularis 
DAOM 181602]
Length=773

 Score =   308 bits (790),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 188/362 (52%), Positives = 248/362 (69%), Gaps = 37/362 (10%)
 Frame = +3

Query  318   ILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPIL  497
             I+LPNQ++ +S +A+DIGGSL K+VYFS                                
Sbjct  20    IVLPNQTESVSQIAVDIGGSLAKVVYFSNISK----------------------------  51

Query  498   GGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFAD  677
             GGRL+F+KFET K++EC+DFI +          P  SS+    +  +IKATGGGA+KF D
Sbjct  52    GGRLNFIKFETEKIDECIDFIRN---LIAARRNPD-SSDLNLKKRIVIKATGGGAHKFYD  107

Query  678   LFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQN--DLFPYLLV  851
              F ++L V +EKEDEM CL+ G NFL+  I +E FT+ E      +   N  ++FPY+LV
Sbjct  108   AFIDKLKVKVEKEDEMECLITGLNFLISEIPYEVFTYNENDPMCFEDTPNPTNMFPYMLV  167

Query  852   NIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDM  1031
             NIGSGVS++KV    KF+R+SGT++GGGT WGL  LLT  KSFD++LELS+ GDN  +DM
Sbjct  168   NIGSGVSILKVTESNKFERISGTSLGGGTLWGLLSLLTGAKSFDEMLELSKHGDNTNVDM  227

Query  1032  LVGDIYGGMDYSKIGLSASTIASSFGKAISEN--KELEDYRPEDISLSLLRMISYNIGQI  1205
             LVGDIYG  DY+KIGL ++TIASS GK   +N  + + ++R EDIS SLL M+S NIGQI
Sbjct  228   LVGDIYGS-DYNKIGLKSTTIASSMGKVFKKNIKQSVGNFRSEDISKSLLYMVSNNIGQI  286

Query  1206  SYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             +YLNA  +GLKRI+FGG FIRGH  TM+T+S+A+NFWS+G  +A+FLRHEG+LGA+GAF+
Sbjct  287   AYLNAQAHGLKRIYFGGCFIRGHPITMNTLSYAINFWSQGTMKALFLRHEGYLGAVGAFL  346

Query  1386  SY  1391
              Y
Sbjct  347   QY  348



>gb|EXX62049.1| pantothenate kinase [Rhizophagus irregularis DAOM 197198w]
 gb|EXX73216.1| pantothenate kinase [Rhizophagus irregularis DAOM 197198w]
Length=773

 Score =   308 bits (790),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 188/362 (52%), Positives = 248/362 (69%), Gaps = 37/362 (10%)
 Frame = +3

Query  318   ILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPIL  497
             I+LPNQ++ +S +A+DIGGSL K+VYFS                                
Sbjct  20    IVLPNQTESVSQIAVDIGGSLAKVVYFSNISK----------------------------  51

Query  498   GGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFAD  677
             GGRL+F+KFET K++EC+DFI +          P  SS+    +  +IKATGGGA+KF D
Sbjct  52    GGRLNFIKFETEKIDECIDFIRN---LIAARRNPD-SSDLNLKKRIVIKATGGGAHKFYD  107

Query  678   LFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQN--DLFPYLLV  851
              F ++L V +EKEDEM CL+ G NFL+  I +E FT+ E      +   N  ++FPY+LV
Sbjct  108   AFIDKLKVKVEKEDEMECLITGLNFLISEIPYEVFTYNENDPMCFEDTPNPTNMFPYMLV  167

Query  852   NIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDM  1031
             NIGSGVS++KV    KF+R+SGT++GGGT WGL  LLT  KSFD++LELS+ GDN  +DM
Sbjct  168   NIGSGVSILKVTESNKFERISGTSLGGGTLWGLLSLLTGAKSFDEMLELSKHGDNTNVDM  227

Query  1032  LVGDIYGGMDYSKIGLSASTIASSFGKAISEN--KELEDYRPEDISLSLLRMISYNIGQI  1205
             LVGDIYG  DY+KIGL ++TIASS GK   +N  + + ++R EDIS SLL M+S NIGQI
Sbjct  228   LVGDIYGS-DYNKIGLKSTTIASSMGKVFKKNIKQSVGNFRSEDISKSLLYMVSNNIGQI  286

Query  1206  SYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             +YLNA  +GLKRI+FGG FIRGH  TM+T+S+A+NFWS+G  +A+FLRHEG+LGA+GAF+
Sbjct  287   AYLNAQAHGLKRIYFGGCFIRGHPITMNTLSYAINFWSQGTMKALFLRHEGYLGAVGAFL  346

Query  1386  SY  1391
              Y
Sbjct  347   QY  348



>gb|EZF35858.1| pantothenate kinase [Trichophyton interdigitale H6]
 gb|KDB23057.1| pantothenate kinase [Trichophyton interdigitale MR816]
Length=446

 Score =   299 bits (765),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 173/383 (45%), Positives = 245/383 (64%), Gaps = 54/383 (14%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP+ +D +SH+A+DIGG+L KLVYFS                    +S  
Sbjct  70    HYEHKD--IRLPHHTDVVSHVAVDIGGTLAKLVYFSPE------------------ISQS  109

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISS-KQLHCGGLDTPRWSSEAPQNENTIIKAT  650
                     GGRL+F+ FET+++  C+DF+   K+ H       + +  AP      + AT
Sbjct  110   GS------GGRLNFINFETSRIELCIDFLKKLKENHM------KRNGSAPYE--LCVMAT  155

Query  651   GGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQND  830
             GGGAYKF D+ K+ LGV++ +EDEM CL+ G +F +  I +E FT+ E         + D
Sbjct  156   GGGAYKFYDMLKDALGVNVLREDEMECLIIGLDFFITEIPNEVFTYSETTPMQFAEARAD  215

Query  831   LFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRG  1010
             ++PYLLVNIGSGVSM+KV G  +F+RV GT++GGGT+WGL  LLT  ++FD++L +++RG
Sbjct  216   VYPYLLVNIGSGVSMVKVSGPRQFERVGGTSLGGGTFWGLMALLTGARTFDEMLAMAERG  275

Query  1011  DNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI------------------SENKEL  1136
             DN  +DMLVGDIY G DY KIGL ++ IAS+FGK +                  + ++++
Sbjct  276   DNSGVDMLVGDIY-GTDYGKIGLKSTAIASTFGKVLKLKRLEERNAESSGSESPTSDQDI  334

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
               +  ED+S SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH  TM+T+S+A+ FW
Sbjct  335   SHFSHEDMSQSLLFAISNNIGQIAYLQSEKHKIKHIYFGGSFIRGHRQTMNTLSYAIRFW  394

Query  1317  SKGEAEAMFLRHEGFLGALGAFM  1385
             SKGE +A FLRHEG+LGA+GAF+
Sbjct  395   SKGEKQAYFLRHEGYLGAVGAFL  417



>ref|XP_009152742.1| type II pantothenate kinase [Exophiala dermatitidis NIH/UT8656]
 gb|EHY52281.1| type II pantothenate kinase [Exophiala dermatitidis NIH/UT8656]
Length=440

 Score =   299 bits (765),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 177/387 (46%), Positives = 239/387 (62%), Gaps = 58/387 (15%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E+KD  I LP   D +SH+A+DIGGSL KLVYFSR  G                    
Sbjct  64    HWEDKD--IRLPYHDDVVSHVAVDIGGSLAKLVYFSREPGETHG----------------  105

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISS-KQLHCGGLDTPRWSSEAPQNENTIIKAT  650
                     GGRL+FV FET +++ C+DFI   KQ         + +   PQ     + AT
Sbjct  106   --------GGRLNFVNFETDRIDLCIDFIQELKQTQS------KLNGSTPQQ--LCVMAT  149

Query  651   GGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQND  830
             GGGAYKF D  KE L V + +EDEM CL+ G +F +  I  E FT+ E         + D
Sbjct  150   GGGAYKFYDRMKEVLHVDVVQEDEMECLIIGLDFFITEIPQEVFTYSEEEPMQFAEARPD  209

Query  831   LFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRG  1010
             ++PYLLVNIGSGVSM+KV G  +FQRV GT++GGGT+WG+  LLT  ++FD++L+L+++G
Sbjct  210   VYPYLLVNIGSGVSMVKVSGPREFQRVGGTSLGGGTFWGILSLLTGARTFDEMLKLAEKG  269

Query  1011  DNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI----------------------SE  1124
             DN  +DMLVGDIY G DY KIGL ++TIAS+FGK                          
Sbjct  270   DNAGVDMLVGDIY-GTDYGKIGLKSTTIASTFGKVFRMKRMAERNAEDGEGLFNGDHGDS  328

Query  1125  NKELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFA  1304
             +  L  ++ ED++ SLL  IS NIGQI+YL + ++ L+ I+FGG FIRGHA TM+T+S+A
Sbjct  329   DHRLGGFKIEDMARSLLYAISNNIGQIAYLQSEKHNLQHIYFGGSFIRGHAQTMNTLSYA  388

Query  1305  VNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             + FWS+G+ +A FLRHEG+LGA+GAF+
Sbjct  389   IKFWSQGQKQAYFLRHEGYLGAVGAFL  415



>gb|KIY00074.1| hypothetical protein Z520_03759 [Fonsecaea multimorphosa CBS 
102226]
Length=443

 Score =   299 bits (765),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 179/387 (46%), Positives = 240/387 (62%), Gaps = 57/387 (15%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP+ +D +SH+ALDIGGSL KLVYFSR  G                    
Sbjct  66    HWEHKD--IRLPHHTDVVSHVALDIGGSLAKLVYFSREPGSTHG----------------  107

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATG  653
                     GGRL+F+ FET +++ C+DFI   +         R +   PQ     + ATG
Sbjct  108   --------GGRLNFLNFETDRIDLCIDFIQELKK-----TQSRLNGSTPQE--LCVMATG  152

Query  654   GGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDL  833
             GGAYKF +  KE L V + +EDEM CL+ G +F +  I  E FT+ E         + D+
Sbjct  153   GGAYKFYNRMKELLHVDVVQEDEMECLIIGLDFFITEIPREVFTYSEEEPMQFAEARADI  212

Query  834   FPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGD  1013
             +PYLLVNIGSGVSM+KV G  +FQRV GT++GGGT+WG+  LLT  ++FD++L L++ GD
Sbjct  213   YPYLLVNIGSGVSMVKVSGPREFQRVGGTSLGGGTFWGILSLLTGARTFDEMLRLAEMGD  272

Query  1014  NRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI---------SENKE-----------  1133
             N  +DMLVGDIYGG  YSKIGL ++TIAS+FGK           +E+ E           
Sbjct  273   NSGVDMLVGDIYGG-GYSKIGLKSTTIASTFGKVFRMKRLAERHAEDGEGLFNGDGQGED  331

Query  1134  ---LEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFA  1304
                L  ++ ED++ SLL  IS NIGQI+YL + ++ L+ I+FGG FIRGH  TM+T+S+A
Sbjct  332   HDMLRGFKIEDMARSLLYAISNNIGQIAYLQSEKHNLQHIYFGGSFIRGHTQTMNTLSYA  391

Query  1305  VNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             + FWSKGE +A FLRHEG+LGA+GAF+
Sbjct  392   IKFWSKGEKQAYFLRHEGYLGAVGAFL  418



>gb|EGD95495.1| pantothenate kinase [Trichophyton tonsurans CBS 112818]
Length=446

 Score =   299 bits (765),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 173/383 (45%), Positives = 244/383 (64%), Gaps = 54/383 (14%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP+ +D +SH+A+DIGG+L KLVYFS                    +S  
Sbjct  70    HYEHKD--IRLPHHTDVVSHVAVDIGGTLAKLVYFSPE------------------ISQS  109

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISS-KQLHCGGLDTPRWSSEAPQNENTIIKAT  650
                     GGRL+F+ FET+++  C+DF+   K+ H       + +  AP      + AT
Sbjct  110   GS------GGRLNFINFETSRIELCIDFLKKLKENHM------KRNGSAPYE--LCVMAT  155

Query  651   GGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQND  830
             GGGAYKF D+ K+ LGV++ +EDEM CL+ G +F +  I +E FT+ E         + D
Sbjct  156   GGGAYKFYDMLKDALGVNVLREDEMECLIIGLDFFITEIPNEVFTYSETTPMQFAEARAD  215

Query  831   LFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRG  1010
             ++PYLLVNIGSGVSM+KV G  +F+RV GT++GGGT+WGL  LLT  ++FD++L +++RG
Sbjct  216   VYPYLLVNIGSGVSMVKVSGPRQFERVGGTSLGGGTFWGLMALLTGARTFDEMLAMAERG  275

Query  1011  DNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI------------------SENKEL  1136
             DN  +DMLVGDIY G DY KIGL ++ IAS+FGK +                  +  +++
Sbjct  276   DNSGVDMLVGDIY-GTDYGKIGLKSTAIASTFGKVLKLKRLEERNAESSGSESPTSEQDI  334

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
               +  ED+S SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH  TM+T+S+A+ FW
Sbjct  335   SHFSHEDMSQSLLFAISNNIGQIAYLQSEKHKIKHIYFGGSFIRGHRQTMNTLSYAIRFW  394

Query  1317  SKGEAEAMFLRHEGFLGALGAFM  1385
             SKGE +A FLRHEG+LGA+GAF+
Sbjct  395   SKGEKQAYFLRHEGYLGAVGAFL  417



>gb|KIW48966.1| pantothenate kinase [Exophiala xenobiotica]
Length=441

 Score =   298 bits (764),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 180/388 (46%), Positives = 245/388 (63%), Gaps = 59/388 (15%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP+ +D +SH+A+DIGGSL KLVYFSR  G                    
Sbjct  64    HWEHKD--IRLPHHTDVVSHVAVDIGGSLAKLVYFSREPGSTHG----------------  105

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATG  653
                     GGRL+FV FET +++ C+DFI   + H       + +   PQ     + ATG
Sbjct  106   --------GGRLNFVNFETDRIDLCIDFIQELK-HT----QSKLNGSTPQQ--LCVMATG  150

Query  654   GGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHK-EFVQIDQND  830
             GGA+KF    KE L V + +EDEM CL+ G +F +  I HE FT+ E    +FV+  + D
Sbjct  151   GGAFKFYHKMKEVLHVDVIQEDEMECLIIGLDFFITEIPHEVFTYSEDEPIQFVEA-RAD  209

Query  831   LFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRG  1010
             ++PYLLVNIGSGVSM+KV G G+FQRV GT++GGGT+WG+  LLT  ++FD++L L+++G
Sbjct  210   VYPYLLVNIGSGVSMVKVSGPGEFQRVGGTSLGGGTFWGILSLLTGARTFDEMLALAEKG  269

Query  1011  DNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI---------SENKE----------  1133
             DN  +DMLVGDIY G  Y KIGL A+TIAS+FGK           +E+ E          
Sbjct  270   DNSGVDMLVGDIY-GTGYGKIGLKATTIASTFGKVFRMKRLAERNAEDGEGLSNGDPHGD  328

Query  1134  ----LEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISF  1301
                 ++ ++ ED++ SLL  IS NIGQI+YL + ++ LK I+FGG FIRGH  TM+T+S+
Sbjct  329   GDGRVQGFKIEDMARSLLYAISNNIGQIAYLQSEKHNLKHIYFGGSFIRGHTQTMNTLSY  388

Query  1302  AVNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             A+ FWSK E +A FLRHEG+LGA+GAF+
Sbjct  389   AIRFWSKSEKQAYFLRHEGYLGAVGAFL  416



>gb|EGE05796.1| pantothenate kinase [Trichophyton equinum CBS 127.97]
Length=446

 Score =   298 bits (764),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 173/383 (45%), Positives = 244/383 (64%), Gaps = 54/383 (14%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP+ +D +SH+A+DIGG+L KLVYFS                    +S  
Sbjct  70    HYEHKD--IRLPHHTDVVSHVAVDIGGTLAKLVYFSPE------------------ISQS  109

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISS-KQLHCGGLDTPRWSSEAPQNENTIIKAT  650
                     GGRL+F+ FET+++  C+DF+   K+ H       + +  AP      + AT
Sbjct  110   GS------GGRLNFINFETSRIELCIDFLKKLKENHM------KRNGSAPYE--LCVMAT  155

Query  651   GGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQND  830
             GGGAYKF D+ K+ LGV++ +EDEM CL+ G +F +  I +E FT+ E         + D
Sbjct  156   GGGAYKFYDMLKDALGVNVLREDEMECLIIGLDFFITEIPNEVFTYSETTPMQFAEARAD  215

Query  831   LFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRG  1010
             ++PYLLVNIGSGVSM+KV G  +F+RV GT++GGGT+WGL  LLT  ++FD++L +++RG
Sbjct  216   VYPYLLVNIGSGVSMVKVSGPRQFERVGGTSLGGGTFWGLMALLTGARTFDEMLAMAERG  275

Query  1011  DNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI------------------SENKEL  1136
             DN  +DMLVGDIY G DY KIGL ++ IAS+FGK +                  +  +++
Sbjct  276   DNSGVDMLVGDIY-GTDYGKIGLKSTAIASTFGKVLKLKRLEERNAESSGSESPTSEQDI  334

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
               +  ED+S SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH  TM+T+S+A+ FW
Sbjct  335   SHFSHEDMSQSLLFAISNNIGQIAYLQSEKHKIKHIYFGGSFIRGHRQTMNTLSYAIRFW  394

Query  1317  SKGEAEAMFLRHEGFLGALGAFM  1385
             SKGE +A FLRHEG+LGA+GAF+
Sbjct  395   SKGEKQAYFLRHEGYLGAVGAFL  417



>ref|XP_003237627.1| pantothenate kinase [Trichophyton rubrum CBS 118892]
 gb|EGD86078.1| pantothenate kinase [Trichophyton rubrum CBS 118892]
 gb|EZF11936.1| pantothenate kinase [Trichophyton rubrum MR850]
 gb|EZF38795.1| pantothenate kinase [Trichophyton rubrum CBS 100081]
 gb|EZF49429.1| pantothenate kinase [Trichophyton rubrum CBS 288.86]
 gb|EZF60095.1| pantothenate kinase [Trichophyton rubrum CBS 289.86]
 gb|EZF70559.1| pantothenate kinase [Trichophyton soudanense CBS 452.61]
 gb|EZF81441.1| pantothenate kinase [Trichophyton rubrum MR1448]
 gb|EZF92054.1| pantothenate kinase [Trichophyton rubrum MR1459]
 gb|EZG03369.1| pantothenate kinase [Trichophyton rubrum CBS 735.88]
 gb|EZG13572.1| pantothenate kinase [Trichophyton rubrum CBS 202.88]
 gb|KDB30541.1| pantothenate kinase [Trichophyton rubrum D6]
Length=446

 Score =   298 bits (763),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 172/383 (45%), Positives = 244/383 (64%), Gaps = 54/383 (14%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP+ +D +SH+A+DIGG+L KLVYFS                    +S  
Sbjct  70    HYEHKD--IRLPHHTDVVSHVAVDIGGTLAKLVYFSPE------------------ISQS  109

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISS-KQLHCGGLDTPRWSSEAPQNENTIIKAT  650
                     GGRL+F+ FET+++  C+DF+   K+ H       + +  AP      + AT
Sbjct  110   GS------GGRLNFINFETSRIELCIDFLKKLKENHM------KRNGSAPYE--LCVMAT  155

Query  651   GGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQND  830
             GGGAYKF D+ ++ LGV++ +EDEM CL+ G +F +  I +E FT+ E         + D
Sbjct  156   GGGAYKFYDMLRDALGVNVLREDEMECLIIGLDFFITEIPNEVFTYSEATPMQFAEARAD  215

Query  831   LFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRG  1010
             ++PYLLVNIGSGVSM+KV G  +F+RV GT++GGGT+WGL  LLT  ++FD++L +++RG
Sbjct  216   VYPYLLVNIGSGVSMVKVSGPRQFERVGGTSLGGGTFWGLMALLTGARTFDEMLAMAERG  275

Query  1011  DNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI------------------SENKEL  1136
             DN  +DMLVGDIY G DY KIGL ++ IAS+FGK +                  +  +++
Sbjct  276   DNSGVDMLVGDIY-GTDYGKIGLKSTAIASTFGKVLKLKRLEERNAESSGSESPTSEQDI  334

Query  1137  EDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFW  1316
               +  ED+S SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH  TM+T+S+A+ FW
Sbjct  335   SHFSHEDMSQSLLFAISNNIGQIAYLQSEKHKIKHIYFGGSFIRGHRQTMNTLSYAIRFW  394

Query  1317  SKGEAEAMFLRHEGFLGALGAFM  1385
             SKGE +A FLRHEG+LGA+GAF+
Sbjct  395   SKGEKQAYFLRHEGYLGAVGAFL  417



>ref|XP_008721632.1| pantothenate kinase [Cladophialophora carrionii CBS 160.54]
 gb|ETI27558.1| pantothenate kinase [Cladophialophora carrionii CBS 160.54]
Length=443

 Score =   298 bits (763),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 180/391 (46%), Positives = 246/391 (63%), Gaps = 64/391 (16%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP+ +D +SH+A+DIGGSL KLVYFSR  G                    
Sbjct  65    HWEHKD--IRLPHHTDVVSHVAVDIGGSLAKLVYFSRETGSMHG----------------  106

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFIS---SKQLHCGGLDTPRWSSEAPQNENTIIK  644
                     GGRL+F+ FET +++ C+DFI      QL   G  TP         +   + 
Sbjct  107   --------GGRLNFLNFETDRIDLCIDFIQELKKTQLKLNG-STP---------QELCVM  148

Query  645   ATGGGAYKFADLFKERLGVSIEKEDEMNCLV-AGANFLLKAIRHEAFTHIEGHKEFVQID  821
             ATGGGAYKF +  KE L V + +EDEM CL+ AG +F +  I  E FT+ E         
Sbjct  149   ATGGGAYKFYNRMKEVLHVDVVQEDEMECLIIAGLDFFITEIPREVFTYSEEEPMQFAEA  208

Query  822   QNDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELS  1001
             + D++PYLLVNIGSGVSM+KV G  +FQRV GT++GGGT+WG+  LLT  ++FD++L L+
Sbjct  209   RADIYPYLLVNIGSGVSMVKVSGPREFQRVGGTSLGGGTFWGILSLLTGARTFDEMLRLA  268

Query  1002  QRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKA----------------------  1115
             ++GDN  +DMLVGDIYGG  YSKIGL ++TIAS+FGK                       
Sbjct  269   EKGDNAGVDMLVGDIYGG-GYSKIGLKSTTIASTFGKVFRMKRLAERHAEDGEGLFNGDD  327

Query  1116  ISENKELE-DYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDT  1292
             +S+++E++  ++ ED++ SLL  IS NIGQI+YL + ++ L+ I+FGG FIRGH  TM+T
Sbjct  328   LSDDQEMQGHFKIEDMARSLLYAISNNIGQIAYLQSEKHNLRHIYFGGSFIRGHTQTMNT  387

Query  1293  ISFAVNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             +S+A+ FWSKGE +A FLRHEG+LGA+GAF+
Sbjct  388   LSYAIKFWSKGEKQAYFLRHEGYLGAVGAFL  418



>gb|KIA75919.1| Pantothenate kinase [Aspergillus ustus]
Length=420

 Score =   297 bits (760),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 173/375 (46%), Positives = 234/375 (62%), Gaps = 51/375 (14%)
 Frame = +3

Query  318   ILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPIL  497
             I LP+ +  +SH+A+DIGGSL KLVYF+R                            P  
Sbjct  56    IRLPHHTGVVSHVAVDIGGSLAKLVYFTR------------------------ELDSPDN  91

Query  498   GGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFAD  677
             GGRL+F+ FET +++ CL+FI   +    GL+           +   + ATGGGAYK+ D
Sbjct  92    GGRLNFINFETGRIDLCLEFIKQLKEEHQGLN-------GGTKDELCVVATGGGAYKYYD  144

Query  678   LFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNI  857
               KE L V I +EDEM CL+ G +F +  I +E FT+ E         + D++PYLLVNI
Sbjct  145   KLKETLNVDIMREDEMECLITGLDFFITEIPNEIFTYSETEPMQFAEARPDVYPYLLVNI  204

Query  858   GSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLV  1037
             GSGVSMIKV G  +FQRV GT++GGGT+WG+  +LT  ++FDD+L ++ RGDN  +DMLV
Sbjct  205   GSGVSMIKVSGPKQFQRVGGTHLGGGTFWGIMSMLTGARTFDDMLAMADRGDNSGVDMLV  264

Query  1038  GDIYGGMDYSKIGLSASTIASSFGKAI----SENKELED---------------YRPEDI  1160
             GDIY GMDY KIGL ++ IAS+FGK      +E  E +D               ++ ED+
Sbjct  265   GDIY-GMDYGKIGLKSTAIASTFGKVFRLKNAEQHESDDDIQPNGADRTNGDTMFKHEDM  323

Query  1161  SLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAM  1340
             S SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH  TM+T+S+A+ FWSKGE +A 
Sbjct  324   SRSLLYAISNNIGQIAYLQSEKHQVKHIYFGGSFIRGHRQTMNTLSYAIRFWSKGEKQAY  383

Query  1341  FLRHEGFLGALGAFM  1385
             FLRHEG++GA+GAF+
Sbjct  384   FLRHEGYIGAVGAFL  398



>gb|KIV81221.1| pantothenate kinase [Exophiala sideris]
Length=441

 Score =   298 bits (762),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 180/387 (47%), Positives = 244/387 (63%), Gaps = 61/387 (16%)
 Frame = +3

Query  300   EEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNR  479
             E KD  I LP+ +D +SH+ALDIGGSL KLVYFSR  G                      
Sbjct  66    EHKD--IRLPHHTDVVSHVALDIGGSLAKLVYFSREPGSTHG------------------  105

Query  480   RSYPILGGRLHFVKFETTKVNECLDFISS-KQLHCGGLDTPRWSSEAPQNENTIIKATGG  656
                   GGRL+FV FET +++ C+DFI   KQ         + +   PQ     + ATGG
Sbjct  106   ------GGRLNFVNFETDRIDLCIDFIQELKQTQS------KLNGSTPQQ--LCVMATGG  151

Query  657   GAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHK-EFVQIDQNDL  833
             GA+KF +  KE L V + +EDEM CL+ G +F +  I  E FT+ E    +FV+  + D+
Sbjct  152   GAFKFYNRMKEVLHVDVIQEDEMECLIIGLDFFITEIPGEIFTYSEDQPIQFVEA-RADV  210

Query  834   FPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGD  1013
             +PYLLVNIGSGVSM+KV G G+FQRV GT++GGGT+WG+  LLT  ++FD++L L+++GD
Sbjct  211   YPYLLVNIGSGVSMVKVSGPGEFQRVGGTSLGGGTFWGILSLLTGARTFDEMLTLAEKGD  270

Query  1014  NRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI---------SENKE-----------  1133
             N  +DMLVGDIY G  YSKIGL ++TIAS++GK           +E+ E           
Sbjct  271   NAGVDMLVGDIY-GTGYSKIGLKSTTIASTYGKVFRMKRLAERHAEDGEGLHNGDPRGDG  329

Query  1134  ---LEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFA  1304
                L  ++ ED++ SLL  IS NIGQI+YL + ++ L+ I+FGG FI+GH  TM+T+S+A
Sbjct  330   DDRLHGFKTEDMARSLLYAISNNIGQIAYLQSEKHNLRNIYFGGSFIQGHRQTMNTLSYA  389

Query  1305  VNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             + FWSKGE +A FLRHEG+LGA+GAF+
Sbjct  390   IKFWSKGEKQAYFLRHEGYLGAVGAFL  416



>gb|KIW16496.1| pantothenate kinase [Exophiala spinifera]
Length=441

 Score =   298 bits (762),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 178/381 (47%), Positives = 243/381 (64%), Gaps = 59/381 (15%)
 Frame = +3

Query  318   ILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPIL  497
             I LP+ +D +SH+A+DIGGSL KLVYFSR  G                            
Sbjct  70    IRLPHHTDVVSHVAVDIGGSLAKLVYFSREPGSTHG------------------------  105

Query  498   GGRLHFVKFETTKVNECLDFISS-KQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFA  674
             GGRL+FV FET +++ C+DFI   KQ H       + +  AP      + ATGGGA+KF 
Sbjct  106   GGRLNFVNFETDRLDLCIDFIQELKQTHS------KLNGSAPHQ--LCVMATGGGAFKFY  157

Query  675   DLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHK-EFVQIDQNDLFPYLLV  851
             +  +E L V + +EDEM CL+ G +F +  I  E FT+ E    +FV+  + D++PYLLV
Sbjct  158   NRMREVLHVDVIQEDEMECLIIGLDFFITEIPGEVFTYSEDEPIQFVEA-RADVYPYLLV  216

Query  852   NIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDM  1031
             NIGSGVSM+KV G G+FQRV GT++GGGT+WG+  LLT  ++FD++L L+++GDN  +DM
Sbjct  217   NIGSGVSMVKVSGPGEFQRVGGTSLGGGTFWGILSLLTGARTFDEMLALAEKGDNSGVDM  276

Query  1032  LVGDIYGGMDYSKIGLSASTIASSFGKAI---------SENKE--------------LED  1142
             LVGDIY G  YSKIGL A+TIAS+FGK           +E+ E              ++ 
Sbjct  277   LVGDIY-GTGYSKIGLKATTIASTFGKVFRMKRLAERNAEDGEGLSNGDPHDEDEGRVQG  335

Query  1143  YRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSK  1322
             ++ ED++ SLL  IS NIGQI+YL + ++ LK I+FGG FIRGH  TM+T+S+A+ FWSK
Sbjct  336   FKIEDMARSLLYAISNNIGQIAYLQSEKHNLKHIYFGGSFIRGHTQTMNTLSYAIKFWSK  395

Query  1323  GEAEAMFLRHEGFLGALGAFM  1385
             GE +A FLRHEG+LG++GAF+
Sbjct  396   GEKQAYFLRHEGYLGSVGAFL  416



>gb|KIV89403.1| pantothenate kinase [Exophiala mesophila]
Length=441

 Score =   297 bits (761),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 187/444 (42%), Positives = 260/444 (59%), Gaps = 75/444 (17%)
 Frame = +3

Query  165   DKNEKDNIAVLERGGVEKEKEISPMHRSTSRPQLDLSGAAI--------------QGNFE  302
             D N+ ++ A+++    E+     P+  S    ++++ GA I                ++E
Sbjct  9     DLNDFEDTAIIDGDPAERPPRQPPIPASV---KINVEGAFIVDDEVRAPNGTANEHVHWE  65

Query  303   EKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRR  482
              KD  I LP+ +D +SH+A+DIGGSL KLVYFSR  G              FG       
Sbjct  66    HKD--IRLPHHTDVVSHVAVDIGGSLAKLVYFSREPGS-------------FG-------  103

Query  483   SYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGA  662
                  GGRL+F+ FET +++ C+DFI     H   L   + +   PQ     + ATGGGA
Sbjct  104   -----GGRLNFLNFETDRIDLCIDFI-----HELKLTQSKLNGSTPQQ--LCVMATGGGA  151

Query  663   YKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPY  842
             +KF +  KE L V + +EDEM CL+ G +F +  I  E FT+ E         + D++PY
Sbjct  152   FKFYNRMKEVLHVDVVQEDEMECLIIGLDFFITEIPCEVFTYSEEEPMQFAEARADVYPY  211

Query  843   LLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRT  1022
             LLVNIGSGVSM+KV G   FQRV GT++GGGT+WG+  LLT  ++FD++L L+++GDN  
Sbjct  212   LLVNIGSGVSMVKVSGPRNFQRVGGTSLGGGTFWGILSLLTGARTFDEMLTLAEKGDNSG  271

Query  1023  IDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELED--------------------  1142
             +DMLVGDIY G  YSKIGL ++TIAS+FGK     +  E                     
Sbjct  272   VDMLVGDIY-GTGYSKIGLKSTTIASTFGKVFRMKRMAERNAEDGEGLFSRDPRDDDDDQ  330

Query  1143  ---YRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNF  1313
                ++ ED++ SLL  IS NIGQI+YL + ++ LK I+FGG FIRGH  TM+T+S+A+ F
Sbjct  331   DGGFKTEDMARSLLYAISNNIGQIAYLQSEKHNLKHIYFGGSFIRGHTQTMNTLSYAIKF  390

Query  1314  WSKGEAEAMFLRHEGFLGALGAFM  1385
             WSKGE +A FLRHEG+LGA+GAF+
Sbjct  391   WSKGEKQAYFLRHEGYLGAVGAFL  414



>gb|KIW25168.1| pantothenate kinase [Cladophialophora immunda]
Length=443

 Score =   297 bits (761),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 178/387 (46%), Positives = 240/387 (62%), Gaps = 57/387 (15%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP  +D +SH+ALDIGGSL KLVYFSR  G                    
Sbjct  66    HWEHKD--IRLPYHTDVVSHVALDIGGSLAKLVYFSREPGSTHG----------------  107

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATG  653
                     GGRL+F+ FET +++ C+DFI   +         + +   PQ     + ATG
Sbjct  108   --------GGRLNFLNFETDRIDLCIDFIQELKK-----TQSKLNGSTPQE--LCVMATG  152

Query  654   GGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDL  833
             GGAYKF +  KE L V + +EDEM CL+ G +F +  I  E FT+ E         + D+
Sbjct  153   GGAYKFYNRMKELLHVDVVQEDEMECLIIGLDFFITEIPREVFTYSEEEPMQFAEARADI  212

Query  834   FPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGD  1013
             +PYLLVNIGSGVSM+KV G  +FQRV GT++GGGT+WG+  LLT  ++FD++L L+++GD
Sbjct  213   YPYLLVNIGSGVSMVKVSGPREFQRVGGTSLGGGTFWGILSLLTGARTFDEMLRLAEKGD  272

Query  1014  NRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI---------SENKE-----------  1133
             N  +DMLVGDIYGG  YSKIGL ++TIAS+FGK           +E+ E           
Sbjct  273   NSGVDMLVGDIYGG-GYSKIGLKSTTIASTFGKVFRMKRMAERHAEDGEGLFNGDGHGED  331

Query  1134  ---LEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFA  1304
                L  ++ ED++ SLL  IS NIGQI+YL + ++ L+ I+FGG FIRGH  TM+T+S+A
Sbjct  332   HDMLRGFKIEDMARSLLYAISNNIGQIAYLQSEKHNLQHIYFGGSFIRGHTQTMNTLSYA  391

Query  1305  VNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             + FWSKGE +A FLRHEG+LGA+GAF+
Sbjct  392   IKFWSKGEKQAYFLRHEGYLGAVGAFL  418



>ref|XP_007737256.1| type II pantothenate kinase [Capronia epimyces CBS 606.96]
 gb|EXJ79468.1| type II pantothenate kinase [Capronia epimyces CBS 606.96]
Length=440

 Score =   297 bits (760),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 177/385 (46%), Positives = 237/385 (62%), Gaps = 58/385 (15%)
 Frame = +3

Query  300   EEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNR  479
             E KD  I LP+ +D +SH+A+DIGGSL KLVYFSR  G                      
Sbjct  66    EYKD--IRLPHHTDVVSHVAVDIGGSLAKLVYFSRETGSTHG------------------  105

Query  480   RSYPILGGRLHFVKFETTKVNECLDFISS-KQLHCGGLDTPRWSSEAPQNENTIIKATGG  656
                   GGRL+FV FET +++ C+DFI   KQ         + +   PQ     + ATGG
Sbjct  106   ------GGRLNFVNFETDRLDLCIDFIQELKQTQS------KLNGSTPQQ--LCVMATGG  151

Query  657   GAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLF  836
             GAYKF D  KE L V + +EDEM CL+ G +F +  I  E FT+ E         + D++
Sbjct  152   GAYKFYDRMKEVLHVDVIQEDEMECLIIGLDFFITEIPREVFTYSEEAPMQFAEARADVY  211

Query  837   PYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDN  1016
             PYLLVNIGSGVSM+KV G  +FQRV GT++GGGT+WG+  LLT  ++FD++L L++ GDN
Sbjct  212   PYLLVNIGSGVSMVKVSGRREFQRVGGTSLGGGTFWGILSLLTGARTFDEMLRLAENGDN  271

Query  1017  RTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI----------------------SENK  1130
               +DMLVGDIY G DY KIGL ++TIAS+FGK                         +N 
Sbjct  272   AGVDMLVGDIY-GTDYGKIGLKSTTIASTFGKVFRMKRLAERNAEDGEGLFNGDHGDDNH  330

Query  1131  ELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVN  1310
             +L  ++ ED++ SLL  IS NIGQI+YL + ++ L+ I+FGG FIRGH  TM+T+S+A+ 
Sbjct  331   QLGGFKTEDMARSLLYAISNNIGQIAYLQSEKHNLQHIYFGGSFIRGHIQTMNTLSYAIK  390

Query  1311  FWSKGEAEAMFLRHEGFLGALGAFM  1385
             FWS+G+ +A FLRHEG+LGA+GAF+
Sbjct  391   FWSQGQKQAYFLRHEGYLGAVGAFL  415



>gb|KGO55503.1| Type II pantothenate kinase [Penicillium expansum]
Length=459

 Score =   297 bits (761),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 176/396 (44%), Positives = 239/396 (60%), Gaps = 66/396 (17%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP+ +  +SH+A+DIGG+L KLVYF+R                       
Sbjct  56    HYENKD--IRLPHHTGVVSHVAVDIGGTLAKLVYFTREPDTADN----------------  97

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATG  653
                     GGRL+F+ FET +++ C++FI         L            E   + ATG
Sbjct  98    --------GGRLNFLNFETHRIDLCINFIRQ-------LKEEHEKRNGSTREGLCVVATG  142

Query  654   GGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQN--  827
             GGAYK+ D  KE L V+I +E+EM CL+ G +F +  I +E FT+ +   E +Q  +   
Sbjct  143   GGAYKYYDRLKEELNVNILREEEMECLIIGLDFFITEIPNEVFTYSDADAEPMQYAEARP  202

Query  828   DLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQR  1007
             D++PYLLVNIGSGVSMIKV G  +F+RV GT++GGGT+WG+  LLT  ++FDD+L ++ R
Sbjct  203   DVYPYLLVNIGSGVSMIKVSGPRQFERVGGTHLGGGTFWGIMSLLTGSRTFDDMLAMADR  262

Query  1008  GDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI---------------------SE  1124
             GDN  +DMLVGDIY GMDY+KIGL ++ IAS+FGK +                     SE
Sbjct  263   GDNSAVDMLVGDIY-GMDYTKIGLKSTAIASTFGKVLRLKNDAEQGAEDGEGLIRGDPSE  321

Query  1125  NKELEDY---------RPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHA  1277
               E  D           PED+S SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH 
Sbjct  322   TSETSDSGESNHGPKPNPEDMSRSLLYAISNNIGQIAYLQSEKHSVKHIYFGGSFIRGHR  381

Query  1278  YTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFM  1385
              TM+T+S+A+ FWSKGE +A FLRHEG+LGA+GAF+
Sbjct  382   QTMNTLSYAIRFWSKGEKQAYFLRHEGYLGAVGAFI  417



>gb|KGO77372.1| Type II pantothenate kinase [Penicillium italicum]
Length=456

 Score =   297 bits (760),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 174/393 (44%), Positives = 238/393 (61%), Gaps = 63/393 (16%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP+ +  +SH+A+DIGG+L KLVYF+R                       
Sbjct  56    HYENKD--IRLPHHTGVVSHVAVDIGGTLAKLVYFTREPDTADN----------------  97

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATG  653
                     GGRL+F+ FET +++ C++FI         L          + E   + ATG
Sbjct  98    --------GGRLNFLNFETHRIDLCINFIRQ-------LKEEHEKRNGSKREGLCVVATG  142

Query  654   GGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQN--  827
             GGAYK+ D  KE L V+I +E+EM CL+ G +F +  I +E FT+ +   E +Q  +   
Sbjct  143   GGAYKYYDRLKEELNVNILREEEMECLIIGLDFFITEIPNEVFTYSDADAEPMQYAEARP  202

Query  828   DLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQR  1007
             D++PYLLVNIGSGVSMIKV G  +F+RV GT++GGGT+WG+  LLT  ++FDD+L ++ R
Sbjct  203   DVYPYLLVNIGSGVSMIKVSGPRQFERVGGTHLGGGTFWGIMSLLTGSRTFDDMLAMADR  262

Query  1008  GDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELED---------------  1142
             GDN  +DMLVGDIY GMDYSKIGL ++ IAS+FGK +    + E                
Sbjct  263   GDNSAVDMLVGDIY-GMDYSKIGLKSTAIASTFGKVLRLKNDAEQGAEDGEGLIRGDPSG  321

Query  1143  ------------YRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTM  1286
                           PED+S SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH  TM
Sbjct  322   TSDSGEPNNGMKPNPEDMSRSLLYAISNNIGQIAYLQSEKHSVKHIYFGGSFIRGHRQTM  381

Query  1287  DTISFAVNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             +T+S+A+ FWSKGE +A FLRHEG+LGA+GAF+
Sbjct  382   NTLSYAIRFWSKGEKQAYFLRHEGYLGAVGAFI  414



>gb|KIW45725.1| pantothenate kinase [Exophiala oligosperma]
Length=441

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 177/381 (46%), Positives = 242/381 (64%), Gaps = 59/381 (15%)
 Frame = +3

Query  318   ILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPIL  497
             I LP+ +D +SH+A+DIGGSL KLVYFSR  G                            
Sbjct  70    IRLPHHTDVVSHVAVDIGGSLAKLVYFSREPGSTHG------------------------  105

Query  498   GGRLHFVKFETTKVNECLDFISS-KQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFA  674
             GGRL+FV FET +++ C+DFI   KQ H       + +  AP      + ATGGGA+KF 
Sbjct  106   GGRLNFVNFETDRLDLCIDFIQELKQTHS------KLNGSAPHQ--LCVMATGGGAFKFY  157

Query  675   DLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHK-EFVQIDQNDLFPYLLV  851
             +  +E L V + +EDEM CL+ G +F +  I  E FT+ E    +FV+  + D++PYLLV
Sbjct  158   NRMREVLHVDVIQEDEMECLIIGLDFFITEIPGEVFTYSEDEPIQFVEA-RADVYPYLLV  216

Query  852   NIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDM  1031
             NIGSGVSM+KV G G+FQRV GT++GGGT+WG+  LLT  ++FD++L L+++GDN  +DM
Sbjct  217   NIGSGVSMVKVSGPGEFQRVGGTSLGGGTFWGILSLLTGARTFDEMLALAEKGDNSGVDM  276

Query  1032  LVGDIYGGMDYSKIGLSASTIASSFGKAI---------SENKE--------------LED  1142
             LVGDIY G  Y KIGL A+TIAS+FGK           +E+ E              ++ 
Sbjct  277   LVGDIY-GTGYGKIGLKATTIASTFGKVFRMKRLAERNAEDGEGLSNGDPHDEDEGRVQG  335

Query  1143  YRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSK  1322
             ++ ED++ SLL  IS NIGQI+YL + ++ LK I+FGG FIRGH  TM+T+S+A+ FWSK
Sbjct  336   FKIEDMARSLLYAISNNIGQIAYLQSEKHNLKHIYFGGSFIRGHTQTMNTLSYAIKFWSK  395

Query  1323  GEAEAMFLRHEGFLGALGAFM  1385
             GE +A FLRHEG+LG++GAF+
Sbjct  396   GEKQAYFLRHEGYLGSVGAFL  416



>dbj|GAA84286.1| pantothenate kinase [Aspergillus kawachii IFO 4308]
Length=439

 Score =   296 bits (758),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 177/380 (47%), Positives = 237/380 (62%), Gaps = 59/380 (16%)
 Frame = +3

Query  318   ILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPIL  497
             I LP+ +  +SH+A+DIGGSL KLVYF+R                   V N         
Sbjct  57    IRLPHHTGLVSHVAVDIGGSLAKLVYFTRELDS---------------VDN---------  92

Query  498   GGRLHFVKFETTKVNECLDFISS-KQLH--CGGLDTPRWSSEAPQNENTIIKATGGGAYK  668
             GGRL+F+ FET++++ C+DFI   K+ H   GG          P  +   + ATGGGA+K
Sbjct  93    GGRLNFINFETSRIDLCIDFIKQLKEEHEKLGG----------PSGDALCVMATGGGAFK  142

Query  669   FADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLL  848
             + D  KE L V I +EDEM CL+ G +F +  I +E FT+ E         + D++PYLL
Sbjct  143   YYDKLKEALNVDIIREDEMECLITGLDFFITEIPNEVFTYSETEPMQFAEARPDVYPYLL  202

Query  849   VNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTID  1028
             VNIGSGVSMIKV G  +FQRV GT++GGGT+WG+  LLT  ++FDD+L ++ RGDN  +D
Sbjct  203   VNIGSGVSMIKVSGPKQFQRVGGTHLGGGTFWGIMSLLTGARTFDDMLAMADRGDNSGVD  262

Query  1029  MLVGDIYGGMDYSKIGLSASTIASSFGKAI-----SENKELE----------------DY  1145
             MLVGDIY GMDYSKIGL  + IAS+FGK       +E  +LE                 +
Sbjct  263   MLVGDIY-GMDYSKIGLKNTAIASTFGKVFRMKNQTEPNDLEGERSSNGEAGRTNGEPKF  321

Query  1146  RPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKG  1325
             + ED+S SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH  TM+T+S+A+ FWSKG
Sbjct  322   QHEDMSRSLLYAISNNIGQIAYLQSEKHQVKHIYFGGSFIRGHRQTMNTLSYAIKFWSKG  381

Query  1326  EAEAMFLRHEGFLGALGAFM  1385
             E +A FLRHEG++GA+G F+
Sbjct  382   EKQAYFLRHEGYIGAVGVFL  401



>dbj|GAM27496.1| hypothetical protein SAMD00019534_106720, partial [Acytostelium 
subglobosum LB1]
Length=389

 Score =   295 bits (754),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 175/365 (48%), Positives = 240/365 (66%), Gaps = 36/365 (10%)
 Frame = +3

Query  330   NQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPIL----  497
             N    I+H ALDIGGSL KLVY+                     V  GN     I     
Sbjct  38    NTHHHINHFALDIGGSLAKLVYY-------------VDNNNNNSVITGNNDIEVIKEQTG  84

Query  498   GGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFAD  677
              G LHF+KFETT + +CL+FI   +LH          +  P++    ++ TGGGAYK+A+
Sbjct  85    SGMLHFIKFETTNIEDCLNFIIDNKLHL--------ENGKPRD----VRVTGGGAYKYAE  132

Query  678   LFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIE-----GHKEFVQIDQNDLFPY  842
             LF+ RLG ++ KEDEM  L+ G N+LL++I +E+F++         K++ +  ++  FPY
Sbjct  133   LFEMRLGCNLIKEDEMLTLIIGTNYLLRSIPNESFSYSPVLNSPMPKQYAETTEHQ-FPY  191

Query  843   LLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRT  1022
             LLV +GSGVS+IKVD +  FQRV GT++GGGT+WGL  LLT   +FD++++L+ RG+NR 
Sbjct  192   LLVQVGSGVSVIKVDSETSFQRVDGTSLGGGTFWGLCSLLTGSTNFDEMVDLTIRGNNRN  251

Query  1023  IDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDYRPEDISLSLLRMISYNIGQ  1202
             +D+ VGDIYG  DYSKIGLSA  IASSFGK I +      +R EDI+ SLL+MIS NIGQ
Sbjct  252   VDLAVGDIYG-TDYSKIGLSAEAIASSFGKVIHQKDNNGSFRKEDIAHSLLKMISNNIGQ  310

Query  1203  ISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAF  1382
             I+YLN+  + L +I+FGGFFIR +  TM  IS A++FWSKG+ +AMFL+H+G+LGALGAF
Sbjct  311   IAYLNSKIHCLHKIYFGGFFIRDNPVTMQRISCAIDFWSKGKTKAMFLQHDGYLGALGAF  370

Query  1383  MSYEK  1397
             +S ++
Sbjct  371   VSAKQ  375



>gb|EAS34989.2| pantothenate kinase [Coccidioides immitis RS]
Length=650

 Score =   302 bits (774),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 181/391 (46%), Positives = 246/391 (63%), Gaps = 57/391 (15%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP+ +D +SH+A+DIGGSL KLVYFS   G   +                
Sbjct  259   HYEHKD--IRLPHHTDVVSHVAVDIGGSLAKLVYFSPELGSSAD----------------  300

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATG  653
                     GGRL+F+ FET +++ C+DF+  KQL     +  + +  AP      I ATG
Sbjct  301   --------GGRLNFLNFETERIDLCIDFL--KQLK---ENHRKLNGSAPG--PLCIMATG  345

Query  654   GGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHK-EFVQIDQND  830
             GGAYK+ D  KE LGV I +EDEM CL+ G +F +  I +E FT+ E    EF +  + D
Sbjct  346   GGAYKYYDRLKEELGVDIIREDEMECLIIGLDFFITEIPNEVFTYSETSPMEFAEA-RPD  404

Query  831   LFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRG  1010
             ++PYLLVNIGSGVSM+KV    +F+RV GT++GGGT+WGL  LLT  ++FD++L +++ G
Sbjct  405   VYPYLLVNIGSGVSMVKVSAPRRFERVGGTSLGGGTFWGLMSLLTGARTFDEMLAMAELG  464

Query  1011  DNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAIS---------------------EN  1127
             DN  +DMLVGDIY G DY+KIGL +STIAS+FGK                          
Sbjct  465   DNSGVDMLVGDIY-GTDYTKIGLKSSTIASTFGKVFKMQRLAERSAQGSECLCESDSESE  523

Query  1128  KELEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAV  1307
             +++  +R EDIS SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH  TM+T+S+A+
Sbjct  524   RDVSQFRREDISRSLLFAISNNIGQIAYLQSEKHQIKHIYFGGSFIRGHRQTMNTLSYAI  583

Query  1308  NFWSKGEAEAMFLRHEGFLGALGAFMSYEKH  1400
              FWSKGE +A FLRHEG+LGA+GAF+  +  
Sbjct  584   RFWSKGEKQAYFLRHEGYLGAVGAFLKRQPQ  614



>gb|EKV19005.1| Pantothenate kinase, putative [Penicillium digitatum PHI26]
 gb|EKV21143.1| Pantothenate kinase, putative [Penicillium digitatum Pd1]
Length=455

 Score =   296 bits (758),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 178/396 (45%), Positives = 243/396 (61%), Gaps = 69/396 (17%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP+ +  +SH+A+DIGG+L KLVYF+R                   V N 
Sbjct  55    HYENKD--IRLPHHTGVVSHVAVDIGGTLAKLVYFTREPDT---------------VDN-  96

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISS-KQLH--CGGLDTPRWSSEAPQNENTIIK  644
                     GGRL+F+ FET +++ C++FI   K+ H  C G             E   + 
Sbjct  97    --------GGRLNFLNFETHRIDLCINFIRQLKEEHEKCNG----------STREGLCVV  138

Query  645   ATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQ  824
             ATGGGAYK+ D  KE L V+I +E+EM CL+ G +F +  I +E FT+ +   E +Q  +
Sbjct  139   ATGGGAYKYYDRLKEELSVNILREEEMECLIIGLDFFITEIPNEVFTYSDADAEPMQYAE  198

Query  825   N--DLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLEL  998
                D++PYLLVNIGSGVSMIKV G  +F+RV GT++GGGT+WG+  LLT  ++FDD+L +
Sbjct  199   ARPDVYPYLLVNIGSGVSMIKVSGPRQFERVGGTHLGGGTFWGIMSLLTGSRTFDDMLAM  258

Query  999   SQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELED------------  1142
             + RGDN  +DMLVGDIY GMDY+KIGL ++ IAS+FGK +    + E             
Sbjct  259   ADRGDNSAVDMLVGDIY-GMDYTKIGLKSTAIASTFGKVLRLKNDAEQGAEDGEGLIRGD  317

Query  1143  ---------------YRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHA  1277
                              PED+S SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH 
Sbjct  318   PSETSDSGESIHGRKPNPEDMSRSLLYAISNNIGQIAYLQSEKHSVKHIYFGGSFIRGHR  377

Query  1278  YTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFM  1385
              TM+T+S+A+ FWSKGE +A FLRHEG+LGA+GAF+
Sbjct  378   QTMNTLSYAIRFWSKGEKQAYFLRHEGYLGAVGAFI  413



>gb|KIW74037.1| pantothenate kinase [Capronia semiimmersa]
Length=442

 Score =   295 bits (756),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 177/390 (45%), Positives = 238/390 (61%), Gaps = 63/390 (16%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP  +D +SH+A+DIGG+L KLVYFSR  G                    
Sbjct  65    HWEHKD--IRLPYHTDVVSHVAVDIGGTLAKLVYFSRETGSTHG----------------  106

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFIS---SKQLHCGGLDTPRWSSEAPQNENTIIK  644
                     GGRL+F+ FET +++ C+DFI     KQL   G  TP         +   + 
Sbjct  107   --------GGRLNFLNFETDRIDLCIDFIQELKKKQLKLNG-STP---------QELCVM  148

Query  645   ATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQ  824
             ATGGGAYKF +  KE L V + +EDEM CL+ G +F +  I  E FT+ E         +
Sbjct  149   ATGGGAYKFYNRMKEVLHVDVVQEDEMECLIIGLDFFITEIPREVFTYSEEEPMQFAEAR  208

Query  825   NDLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQ  1004
             +D++PYLLVNIGSGVSM+KV G  +FQRV GT++GGGT+WG+  LLT  ++FD++L L++
Sbjct  209   SDIYPYLLVNIGSGVSMVKVSGPREFQRVGGTSLGGGTFWGILSLLTGARTFDEMLRLAE  268

Query  1005  RGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELE---------------  1139
              GDN  +DMLVGDIYG   YSKIGL ++TIAS+FGK     +  E               
Sbjct  269   EGDNAGVDMLVGDIYGS-GYSKIGLKSTTIASTFGKVFRMKRLAERHAEDGEGLFNGDNL  327

Query  1140  --------DYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTI  1295
                      ++ ED++ SLL  IS NIGQI+YL + ++ L+ I+FGG FIRGH  TM+T+
Sbjct  328   GGDHEMQGQFKIEDMARSLLYAISNNIGQIAYLQSEKHNLRHIYFGGSFIRGHTQTMNTL  387

Query  1296  SFAVNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             S+A+ FWSKGE +A FLRHEG+LGA+GAF+
Sbjct  388   SYAIKFWSKGEKQAYFLRHEGYLGAVGAFL  417



>gb|EYE96107.1| putative pantothenate kinase [Aspergillus ruber CBS 135680]
Length=449

 Score =   295 bits (756),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 180/404 (45%), Positives = 255/404 (63%), Gaps = 61/404 (15%)
 Frame = +3

Query  243   RSTSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqv  422
             RS SR  ++  G     ++E +D  I LP+ +  +SH+A+DIGGSL KLVYF+R      
Sbjct  56    RSRSRSPIEAEGV----HYESQD--IRLPHHTGVVSHVAVDIGGSLAKLVYFTRELDSAD  109

Query  423   edkrkrkvkerFGVSNGNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPR  602
                                      GGRL+F+ FET +++ C+DFI  +QL+    +   
Sbjct  110   N------------------------GGRLNFINFETHRIDLCIDFI--RQLN----EEHE  139

Query  603   WSSEAPQNENTIIKATGGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAF  782
               + + Q+E  ++ ATGGGAY + D  KE L V++++E+EM CL+ G +F +  I +E F
Sbjct  140   KLNGSSQDELCVV-ATGGGAYLYYDKLKEALNVNVKREEEMQCLITGLDFFITEIPNEVF  198

Query  783   THIEGHKEFVQIDQN--DLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGR  956
             T+ +   E ++  +   D++PYLLVNIGSGVSMIKV G  +FQRV GT++GGGT+WG+  
Sbjct  199   TYSDTDPEPMKFAEARPDVYPYLLVNIGSGVSMIKVSGPKEFQRVGGTHLGGGTFWGILS  258

Query  957   LLTKCKSFDDLLELSQRGDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI----SE  1124
             LLT  ++FDD+L ++  GDN  +DMLVGDIY GMDYSKIGL ++ IAS+FGK      + 
Sbjct  259   LLTGARTFDDMLAMADSGDNSGVDMLVGDIY-GMDYSKIGLKSTAIASTFGKVFRMKNAA  317

Query  1125  NKELED-----------------YRPEDISLSLLRMISYNIGQISYLNALRYGLKriffg  1253
              ++ ED                 +R ED+S SLL  IS NIGQI+YL + ++ +K I+FG
Sbjct  318   ERDAEDGEGLSPRDPEHPEDDVKFRHEDMSRSLLYAISNNIGQIAYLQSEKHEVKHIYFG  377

Query  1254  gffirgHAYTMDTISFAVNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             G FIRGH  TM+T+S+A+ FWSKGE +A FLRHEG+LGA+GAF+
Sbjct  378   GSFIRGHRQTMNTLSYAIRFWSKGEKQAYFLRHEGYLGAVGAFL  421



>emb|CAK47768.1| unnamed protein product [Aspergillus niger]
 gb|EHA23546.1| hypothetical protein ASPNIDRAFT_37546 [Aspergillus niger ATCC 
1015]
Length=439

 Score =   295 bits (755),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 175/380 (46%), Positives = 233/380 (61%), Gaps = 59/380 (16%)
 Frame = +3

Query  318   ILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPIL  497
             I LP+ +  +SH+A+DIGGSL KLVYF+R                   V N         
Sbjct  57    IRLPHHTGLVSHVAVDIGGSLAKLVYFTRELDS---------------VDN---------  92

Query  498   GGRLHFVKFETTKVNECLDFISS-KQLH--CGGLDTPRWSSEAPQNENTIIKATGGGAYK  668
             GGRL+F+ FET++++ C+DFI   K+ H   GG          P  +   + ATGGGA+K
Sbjct  93    GGRLNFINFETSRIDLCIDFIKQLKEEHEKLGG----------PSGDALCVMATGGGAFK  142

Query  669   FADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLL  848
             + D  KE L V I +EDEM CL+ G +F +  I +E FT+ E         + D++PYLL
Sbjct  143   YYDKLKEALNVDIIREDEMECLITGLDFFITEIPNEVFTYSETEPMQFAEARPDVYPYLL  202

Query  849   VNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTID  1028
             VNIGSGVSMIKV G  +FQRV GT++GGGT+WG+  LLT  ++FDD+L ++ RGDN  +D
Sbjct  203   VNIGSGVSMIKVSGPKQFQRVGGTHLGGGTFWGIMSLLTGARTFDDMLAMADRGDNSGVD  262

Query  1029  MLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELE---------------------DY  1145
             MLVGDIY GMDYSKIGL  + IAS+FGK      + E                      +
Sbjct  263   MLVGDIY-GMDYSKIGLKNTAIASTFGKVFRMKNQTEPSDMEGEGSSHGEAGQTNGEPKF  321

Query  1146  RPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKG  1325
               ED+S SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH  TM+T+S+A+ FWSKG
Sbjct  322   HHEDMSRSLLYAISNNIGQIAYLQSEKHQVKHIYFGGSFIRGHRQTMNTLSYAIKFWSKG  381

Query  1326  EAEAMFLRHEGFLGALGAFM  1385
             E +A FLRHEG++GA+G F+
Sbjct  382   EKQAYFLRHEGYIGAVGVFL  401



>gb|KGO48561.1| Type II pantothenate kinase [Penicillium expansum]
 gb|KGO59208.1| Type II pantothenate kinase [Penicillium expansum]
Length=456

 Score =   295 bits (755),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 173/393 (44%), Positives = 237/393 (60%), Gaps = 63/393 (16%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP+ +  +SH+A+DIGG+L KLVYF+R                       
Sbjct  56    HYENKD--IRLPHHTGVVSHVAVDIGGTLAKLVYFTREPDTADN----------------  97

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATG  653
                     GGRL+F+ FET +++ C++FI         L            E   + ATG
Sbjct  98    --------GGRLNFLNFETHRIDLCINFIRQ-------LKEEHEKRNGSTREGLCVVATG  142

Query  654   GGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQN--  827
             GGAYK+ D  KE L V+I +E+EM CL+ G +F +  I +E FT+ +   E +Q  +   
Sbjct  143   GGAYKYYDRLKEELNVNILREEEMECLIIGLDFFITEIPNEVFTYSDADAEPMQYAEARP  202

Query  828   DLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQR  1007
             D++PYLLVNIGSGVSMIKV G  +F+RV GT++GGGT+WG+  LLT  ++FDD+L ++ R
Sbjct  203   DVYPYLLVNIGSGVSMIKVSGPRQFERVGGTHLGGGTFWGIMSLLTGSRTFDDMLAMADR  262

Query  1008  GDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELED---------------  1142
             GDN  +DMLVGDIY GMDY+KIGL ++ IAS+FGK +    + E                
Sbjct  263   GDNSAVDMLVGDIY-GMDYTKIGLKSTAIASTFGKVLRLKNDAEQGAEDGEGLIRGDPSE  321

Query  1143  ------------YRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTM  1286
                           PED+S SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH  TM
Sbjct  322   TSDSGESNHGPKPNPEDMSRSLLYAISNNIGQIAYLQSEKHSVKHIYFGGSFIRGHRQTM  381

Query  1287  DTISFAVNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             +T+S+A+ FWSKGE +A FLRHEG+LGA+GAF+
Sbjct  382   NTLSYAIRFWSKGEKQAYFLRHEGYLGAVGAFI  414



>emb|CDM31843.1| Pantothenate kinase [Penicillium roqueforti FM164]
Length=453

 Score =   295 bits (755),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 173/393 (44%), Positives = 238/393 (61%), Gaps = 60/393 (15%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP+ +  +SH+A+DIGG+L KLVYF+R                       
Sbjct  56    HYENKD--IRLPHHTGVVSHVAVDIGGTLAKLVYFTRELETADN----------------  97

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATG  653
                     GGRL+F+ FET +++ C++FI         L            E   + ATG
Sbjct  98    --------GGRLNFLNFETHRIDLCINFIRH-------LKEEHEKRNGSTREGLCVVATG  142

Query  654   GGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQN--  827
             GGAYK+ D  KE L V+I +E+EM CL+ G +F +  I +E FT+ +   E +Q  +   
Sbjct  143   GGAYKYYDRLKEELNVNILREEEMECLIIGLDFFITEIPNEVFTYSDTDAEPLQYAEARP  202

Query  828   DLFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQR  1007
             D++PYLLVNIGSGVSMIKV G  +F+RV GT++GGGT+WG+  LLT  ++FDD+L ++ R
Sbjct  203   DVYPYLLVNIGSGVSMIKVSGPRQFERVGGTHLGGGTFWGIMSLLTGSRTFDDMLAMADR  262

Query  1008  GDNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAISENKELEDY--------------  1145
             GDN  +DMLVGDIY GMDY+KIGL ++ IAS+FGK +    + E                
Sbjct  263   GDNSAVDMLVGDIY-GMDYTKIGLKSTAIASTFGKVLRLKNDAEQVAEDGEGLIRDDPSE  321

Query  1146  ----------RPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTI  1295
                       +PED+S SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH  TM+T+
Sbjct  322   ASESNHGIKPKPEDMSRSLLYAISNNIGQIAYLQSEKHSVKHIYFGGSFIRGHRQTMNTL  381

Query  1296  SFAVNFWSKGEAEAMFLRHEGFLGALGAFMSYE  1394
             S+A+ FWSKGE  A FLRHEG+LGA+GAF+  +
Sbjct  382   SYAIRFWSKGEKHAYFLRHEGYLGAVGAFIQRQ  414



>ref|XP_007743113.1| type II pantothenate kinase [Cladophialophora psammophila CBS 
110553]
 gb|EXJ73166.1| type II pantothenate kinase [Cladophialophora psammophila CBS 
110553]
Length=443

 Score =   294 bits (753),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 177/387 (46%), Positives = 239/387 (62%), Gaps = 57/387 (15%)
 Frame = +3

Query  294   NFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNG  473
             ++E KD  I LP+ +D +SH+A+DIGGSL KLVYFSR  G                    
Sbjct  66    HWEHKD--IRLPHHTDVVSHVAVDIGGSLAKLVYFSREPGSTHG----------------  107

Query  474   NRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATG  653
                     GGRL+FV FET +++ C+DFI   +         + +   PQ     + ATG
Sbjct  108   --------GGRLNFVNFETDRIDLCIDFIQELKK-----TQSKLNGSTPQE--LCVMATG  152

Query  654   GGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDL  833
             GGAYKF +  KE L V + +EDEM CL+ G +F +  I  E FT+ E         + D+
Sbjct  153   GGAYKFYNRMKELLHVDVVQEDEMECLIIGLDFFITEIPREVFTYSEEEPMQFAEARADI  212

Query  834   FPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGD  1013
             +PYLLVNIGSGVSM+KV G  +FQRV GT++GGGT+WG+  LLT  ++FD++L L++ GD
Sbjct  213   YPYLLVNIGSGVSMVKVSGPREFQRVGGTSLGGGTFWGILSLLTGARTFDEMLRLAELGD  272

Query  1014  NRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI---------SENKE-----------  1133
             N  +DMLVGDIYGG  YSKIGL ++TIAS+FGK           +E+ E           
Sbjct  273   NSGVDMLVGDIYGG-GYSKIGLKSTTIASTFGKVFRMKRMAERHAEDGEGLFNGDGHGED  331

Query  1134  ---LEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFA  1304
                L  ++ ED++ SLL  IS NIGQI+YL + ++ L+ I+FGG FIRGH  TM+T+S+A
Sbjct  332   HDMLRGFKIEDMARSLLYAISNNIGQIAYLQSEKHNLQHIYFGGSFIRGHTQTMNTLSYA  391

Query  1305  VNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             + FWSKG  +A FLRHEG+LGA+GAF+
Sbjct  392   IKFWSKGGKQAYFLRHEGYLGAVGAFL  418



>gb|KJK67803.1| Fumble [Aspergillus parasiticus SU-1]
Length=426

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 166/375 (44%), Positives = 235/375 (63%), Gaps = 51/375 (14%)
 Frame = +3

Query  318   ILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSNGNRRSYPIL  497
             I LP+ +  +SH+A+DIGGSL KL+YF+R                   V N         
Sbjct  57    IRLPHHTGVVSHVAVDIGGSLAKLIYFTRELDS---------------VDN---------  92

Query  498   GGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKATGGGAYKFAD  677
             GGRL+F+ F+T +++ C++FI         L      +  P ++   + ATGGGA+K+ D
Sbjct  93    GGRLNFINFDTHRIDLCINFIKE-------LKEEYQKAHGPSSDELCVVATGGGAFKYYD  145

Query  678   LFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQNDLFPYLLVNI  857
               KE L V+I +EDEM CL+ G +F +  I +E FT+ E         + D++PYLLVNI
Sbjct  146   KLKETLKVNIIREDEMECLITGLDFFITEIPNEVFTYSETEPMQFAEARPDVYPYLLVNI  205

Query  858   GSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRGDNRTIDMLV  1037
             GSGVSMIKV G  ++QRV GT++GGGT+WG+  LLT  ++FDD+L ++  GDN  +DMLV
Sbjct  206   GSGVSMIKVSGPRQYQRVGGTHLGGGTFWGIMSLLTGARTFDDMLAMADSGDNSGVDMLV  265

Query  1038  GDIYGGMDYSKIGLSASTIASSFGKAISENKELED-------------------YRPEDI  1160
             GDIY GMDY++IGL ++ IAS+FGK      ++ +                   ++PED+
Sbjct  266   GDIY-GMDYNRIGLKSTAIASTFGKVFRLKNDVHEEDGEDKPHGEDGQTNGEVTFKPEDM  324

Query  1161  SLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISFAVNFWSKGEAEAM  1340
             S SLL  IS NIGQI+YL + ++ +K I+FGG FIRGH  TM+T+S+A+ FWSKGE +A 
Sbjct  325   SRSLLYAISNNIGQIAYLQSEKHQVKHIYFGGSFIRGHRQTMNTLSYAIRFWSKGEKQAY  384

Query  1341  FLRHEGFLGALGAFM  1385
             FLRHEG++GA+GAF+
Sbjct  385   FLRHEGYIGAVGAFL  399



>gb|KIW96525.1| pantothenate kinase [Cladophialophora bantiana CBS 173.52]
Length=443

 Score =   294 bits (753),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 186/448 (42%), Positives = 257/448 (57%), Gaps = 76/448 (17%)
 Frame = +3

Query  159   IDDKNEKDNIAVLERGGVEKEKEISPMHRSTSRPQLDLSGAAI----------------Q  290
             + D    D+ A+ E     +   + P   S    ++++ GA I                 
Sbjct  8     VTDNEHHDSSAIAEGDASSRHPRVPPTPASV---KINVEGAFIVDDETSVRNGTASEHEH  64

Query  291   GNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEGrqvedkrkrkvkerFGVSN  470
              ++E KD  I LP+ +D +SH+A+DIGGSL KLVYFSR  G                   
Sbjct  65    VHWEHKD--IRLPHHTDVVSHVAVDIGGSLAKLVYFSREPGSTHG---------------  107

Query  471   GNRRSYPILGGRLHFVKFETTKVNECLDFISSKQLHCGGLDTPRWSSEAPQNENTIIKAT  650
                      GGRL+FV FET +++ C+DFI   +         + +   PQ     + AT
Sbjct  108   ---------GGRLNFVNFETDRIDLCIDFIQELKK-----TQSKLNGSTPQE--LCVMAT  151

Query  651   GGGAYKFADLFKERLGVSIEKEDEMNCLVAGANFLLKAIRHEAFTHIEGHKEFVQIDQND  830
             GGGAYKF +  KE L V + +EDEM CL+ G +F +  I  E FT+ E         + D
Sbjct  152   GGGAYKFYNRMKELLHVDVVQEDEMECLIIGLDFFITEIPREVFTYSEEEPMQFAEARAD  211

Query  831   LFPYLLVNIGSGVSMIKVDGDGKFQRVSGTNVGGGTYWGLGRLLTKCKSFDDLLELSQRG  1010
             ++PYLLVNIGSGVSM+KV G  +FQRV GT++GGGT+WG+  LLT  ++FD++L L++ G
Sbjct  212   IYPYLLVNIGSGVSMVKVSGPREFQRVGGTSLGGGTFWGILSLLTGARTFDEMLRLAELG  271

Query  1011  DNRTIDMLVGDIYGGMDYSKIGLSASTIASSFGKAI---------SENKE----------  1133
             DN  +DMLVGDIYGG  YSKIGL ++TIAS+FGK           +E+ E          
Sbjct  272   DNSGVDMLVGDIYGG-GYSKIGLKSTTIASTFGKVFRMKRMAERHAEDGEGLFSGDGHGE  330

Query  1134  ----LEDYRPEDISLSLLRMISYNIGQISYLNALRYGLKriffggffirgHAYTMDTISF  1301
                 L  ++ ED++ SLL  IS NIGQI+YL + ++ L+ I+FGG FIRGH  TM+T+S+
Sbjct  331   DHDMLRGFKIEDMARSLLYAISNNIGQIAYLQSEKHNLQHIYFGGSFIRGHTQTMNTLSY  390

Query  1302  AVNFWSKGEAEAMFLRHEGFLGALGAFM  1385
             A+ FWSKG  +A FLRHEG+LGA+GAF+
Sbjct  391   AIKFWSKGGKQAYFLRHEGYLGAVGAFL  418



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4215356451812