BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10417

Length=818
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011082824.1|  PREDICTED: translation initiation factor IF-...    201   3e-55   
ref|XP_011082825.1|  PREDICTED: translation initiation factor IF-...    201   8e-55   Sesamum indicum [beniseed]
ref|XP_010275898.1|  PREDICTED: translation initiation factor IF-...    186   3e-49   
ref|XP_009790742.1|  PREDICTED: translation initiation factor IF-...    183   2e-48   Nicotiana sylvestris
ref|XP_004243227.1|  PREDICTED: translation initiation factor IF-...    181   1e-47   Solanum lycopersicum
ref|XP_009601340.1|  PREDICTED: translation initiation factor IF-...    180   2e-47   Nicotiana tomentosiformis
ref|XP_008444270.1|  PREDICTED: translation initiation factor IF-...    180   3e-47   Cucumis melo [Oriental melon]
gb|KCW67693.1|  hypothetical protein EUGRSUZ_F01437                     179   3e-47   Eucalyptus grandis [rose gum]
ref|XP_010060813.1|  PREDICTED: translation initiation factor IF-...    179   3e-47   
ref|XP_010060815.1|  PREDICTED: translation initiation factor IF-...    179   4e-47   Eucalyptus grandis [rose gum]
ref|XP_006366769.1|  PREDICTED: translation initiation factor IF-...    179   4e-47   Solanum tuberosum [potatoes]
ref|XP_004151183.1|  PREDICTED: translation initiation factor IF-...    179   5e-47   Cucumis sativus [cucumbers]
ref|XP_002532827.1|  mitochondrial translational initiation facto...    178   1e-46   Ricinus communis
ref|XP_003634785.2|  PREDICTED: translation initiation factor IF-...    177   2e-46   Vitis vinifera
emb|CAN76368.1|  hypothetical protein VITISV_024584                     175   1e-45   Vitis vinifera
emb|CDP06122.1|  unnamed protein product                                175   2e-45   Coffea canephora [robusta coffee]
ref|XP_010275065.1|  PREDICTED: translation initiation factor IF-...    169   1e-43   Nelumbo nucifera [Indian lotus]
ref|XP_007149252.1|  hypothetical protein PHAVU_005G054600g             169   2e-43   Phaseolus vulgaris [French bean]
ref|XP_010087150.1|  Translation initiation factor IF-2                 169   2e-43   
sp|P57997.1|IF2C_PHAVU  RecName: Full=Translation initiation fact...    168   2e-43   Phaseolus vulgaris [French bean]
ref|XP_004294190.1|  PREDICTED: translation initiation factor IF-...    167   9e-43   Fragaria vesca subsp. vesca
ref|XP_010060818.1|  PREDICTED: LOW QUALITY PROTEIN: translation ...    167   1e-42   
ref|XP_012089508.1|  PREDICTED: translation initiation factor IF-...    167   1e-42   Jatropha curcas
gb|KHN26792.1|  Translation initiation factor IF-2, chloroplastic       166   1e-42   Glycine soja [wild soybean]
ref|XP_010694841.1|  PREDICTED: translation initiation factor IF-...    166   1e-42   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG29391.1|  hypothetical protein F383_15975                         166   2e-42   Gossypium arboreum [tree cotton]
ref|XP_008226278.1|  PREDICTED: translation initiation factor IF-...    166   2e-42   Prunus mume [ume]
ref|XP_007022338.1|  Translation initiation factor IF-2 isoform 2       163   3e-42   
ref|XP_004488715.1|  PREDICTED: translation initiation factor IF-...    165   3e-42   Cicer arietinum [garbanzo]
ref|XP_007213706.1|  hypothetical protein PRUPE_ppa000701mg             164   8e-42   Prunus persica
ref|XP_007022339.1|  Translation initiation factor 2, small GTP-b...    163   1e-41   
ref|XP_007022337.1|  Translation initiation factor 2, small GTP-b...    164   1e-41   
gb|AES66251.2|  translation initiation factor IF-2                      162   3e-41   Medicago truncatula
ref|XP_003596000.1|  Translation initiation factor IF-2                 162   4e-41   
gb|KHN27759.1|  Translation initiation factor IF-2, chloroplastic       161   1e-40   Glycine soja [wild soybean]
gb|KJB13986.1|  hypothetical protein B456_002G104300                    157   3e-40   Gossypium raimondii
gb|KJB13985.1|  hypothetical protein B456_002G104300                    157   8e-40   Gossypium raimondii
gb|KJB13984.1|  hypothetical protein B456_002G104300                    157   2e-39   Gossypium raimondii
gb|EYU26257.1|  hypothetical protein MIMGU_mgv1a001022mg                156   3e-39   Erythranthe guttata [common monkey flower]
gb|KJB13983.1|  hypothetical protein B456_002G104300                    156   4e-39   Gossypium raimondii
ref|XP_009354814.1|  PREDICTED: LOW QUALITY PROTEIN: translation ...    156   5e-39   Pyrus x bretschneideri [bai li]
ref|XP_008383019.1|  PREDICTED: translation initiation factor IF-...    156   6e-39   
gb|EPS57840.1|  hypothetical protein M569_16977                         152   6e-39   Genlisea aurea
ref|XP_011036231.1|  PREDICTED: translation initiation factor IF-...    155   1e-38   Populus euphratica
ref|XP_006441000.1|  hypothetical protein CICLE_v10018663mg             153   2e-38   
gb|KDO44388.1|  hypothetical protein CISIN_1g0017452mg                  152   2e-38   Citrus sinensis [apfelsine]
ref|XP_009393319.1|  PREDICTED: translation initiation factor IF-...    154   3e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009344305.1|  PREDICTED: translation initiation factor IF-...    153   5e-38   Pyrus x bretschneideri [bai li]
ref|XP_011015700.1|  PREDICTED: translation initiation factor IF-...    152   7e-38   Populus euphratica
ref|XP_006441001.1|  hypothetical protein CICLE_v10018663mg             152   1e-37   Citrus clementina [clementine]
gb|KDO44387.1|  hypothetical protein CISIN_1g0017452mg                  152   2e-37   Citrus sinensis [apfelsine]
gb|KDO44386.1|  hypothetical protein CISIN_1g0017452mg                  151   2e-37   Citrus sinensis [apfelsine]
ref|XP_006478012.1|  PREDICTED: translation initiation factor IF-...    151   2e-37   Citrus sinensis [apfelsine]
ref|XP_011030772.1|  PREDICTED: translation initiation factor IF-...    151   2e-37   Populus euphratica
ref|XP_002300479.2|  translation initiation factor IF-2 family pr...    151   3e-37   
ref|XP_002317604.2|  translation initiation factor IF-2 family pr...    149   2e-36   
gb|KCW67687.1|  hypothetical protein EUGRSUZ_F01432                     148   2e-36   Eucalyptus grandis [rose gum]
ref|XP_009412025.1|  PREDICTED: translation initiation factor IF-...    147   4e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002890212.1|  hypothetical protein ARALYDRAFT_471925             147   7e-36   Arabidopsis lyrata subsp. lyrata
ref|XP_008787641.1|  PREDICTED: translation initiation factor IF-...    146   1e-35   
ref|XP_009149169.1|  PREDICTED: translation initiation factor IF-...    146   2e-35   Brassica rapa
ref|XP_008787640.1|  PREDICTED: translation initiation factor IF-...    145   2e-35   Phoenix dactylifera
ref|XP_010501498.1|  PREDICTED: translation initiation factor IF-...    145   4e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010537669.1|  PREDICTED: translation initiation factor IF-...    144   7e-35   Tarenaya hassleriana [spider flower]
ref|XP_010480510.1|  PREDICTED: translation initiation factor IF-...    144   8e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010459294.1|  PREDICTED: translation initiation factor IF-...    142   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010921939.1|  PREDICTED: translation initiation factor IF-...    142   3e-34   Elaeis guineensis
ref|XP_010921938.1|  PREDICTED: translation initiation factor IF-...    142   5e-34   
ref|XP_010921937.1|  PREDICTED: translation initiation factor IF-...    141   6e-34   Elaeis guineensis
ref|NP_173165.1|  translation initiation factor IF-2                    141   8e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AAK32930.1|AF367343_1  At1g17220/F20D23_8                            141   9e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AAD50011.1|AC007651_6  Similar to translation initiation facto...    141   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306659.1|  hypothetical protein CARUB_v10008177mg             139   4e-33   Capsella rubella
gb|KFK43916.1|  hypothetical protein AALP_AA1G191000                    138   9e-33   Arabis alpina [alpine rockcress]
ref|XP_010941522.1|  PREDICTED: translation initiation factor IF-...    138   1e-32   Elaeis guineensis
ref|XP_008775702.1|  PREDICTED: translation initiation factor IF-...    135   4e-32   Phoenix dactylifera
ref|XP_008775701.1|  PREDICTED: translation initiation factor IF-...    135   7e-32   Phoenix dactylifera
emb|CDY48480.1|  BnaC05g13400D                                          132   8e-31   Brassica napus [oilseed rape]
emb|CBI21817.3|  unnamed protein product                                132   8e-31   Vitis vinifera
ref|XP_006416727.1|  hypothetical protein EUTSA_v10006681mg             131   2e-30   
ref|XP_006836345.1|  PREDICTED: translation initiation factor IF-...    131   3e-30   Amborella trichopoda
ref|XP_009110419.1|  PREDICTED: translation initiation factor IF-...    130   4e-30   Brassica rapa
emb|CDX83919.1|  BnaC08g17260D                                          126   8e-29   
dbj|BAH20402.1|  AT1G17220                                              126   8e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CDX96781.1|  BnaA08g23240D                                          125   3e-28   
ref|XP_008649567.1|  PREDICTED: translation initiation factor IF-...    113   2e-24   
gb|EMT18648.1|  Translation initiation factor IF-2, chloroplastic       111   6e-24   
gb|EYU38218.1|  hypothetical protein MIMGU_mgv1a001521mg                110   1e-23   Erythranthe guttata [common monkey flower]
ref|XP_002441249.1|  hypothetical protein SORBIDRAFT_09g023130          110   2e-23   
ref|XP_006655617.1|  PREDICTED: translation initiation factor IF-...    108   1e-22   Oryza brachyantha
gb|AAT69592.1|  putative translation initiation factor IF-2, PF04760    107   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004954547.1|  PREDICTED: translation initiation factor IF-...    107   3e-22   Setaria italica
ref|XP_004954546.1|  PREDICTED: translation initiation factor IF-...    107   3e-22   
gb|EEE50593.1|  hypothetical protein OsJ_30772                          104   2e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79741.1|  hypothetical protein OsI_21094                          104   2e-21   Oryza sativa Indica Group [Indian rice]
emb|CDY26262.1|  BnaA06g11550D                                          100   4e-20   Brassica napus [oilseed rape]
ref|XP_010540116.1|  PREDICTED: LOW QUALITY PROTEIN: translation ...    100   6e-20   Tarenaya hassleriana [spider flower]
ref|XP_003573695.2|  PREDICTED: translation initiation factor IF-...  99.0    2e-19   Brachypodium distachyon [annual false brome]
gb|EMS63921.1|  Translation initiation factor IF-2, chloroplastic     76.6    2e-12   Triticum urartu
gb|AFG68322.1|  hypothetical protein 0_10956_02                       63.2    3e-09   Pinus taeda
ref|XP_002972916.1|  hypothetical protein SELMODRAFT_148692           65.9    9e-09   
ref|XP_002988013.1|  hypothetical protein SELMODRAFT_159162           65.9    9e-09   
emb|CDP20469.1|  unnamed protein product                              55.1    4e-06   Coffea canephora [robusta coffee]
emb|CDP11608.1|  unnamed protein product                              55.5    5e-06   Coffea canephora [robusta coffee]



>ref|XP_011082824.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
isoform X1 [Sesamum indicum]
Length=909

 Score =   201 bits (511),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 174/277 (63%), Positives = 202/277 (73%), Gaps = 22/277 (8%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaapl  188
            KNGKP+NS+    + S T KSVWRKGNPV TVQ  V++P K+E +T       SQP A  
Sbjct  171  KNGKPVNSVENSNRKSKTLKSVWRKGNPVSTVQKVVREPLKEEPRTDGGGVAGSQPVAAP  230

Query  189  rppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakE  368
            RPPQPPQ+V+P LQ +PSVAPPP          K+ VILKDV +A K   A    +  KE
Sbjct  231  RPPQPPQRVQPKLQTKPSVAPPPSI--------KKPVILKDVNSAAKSSVANETDSTVKE  282

Query  369  --RQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGG  542
              R+PIL+DKFASKKP+ DPL+++AVLAPPKP KSP+        +FKD+FRKKSG SGG
Sbjct  283  KERKPILIDKFASKKPMVDPLIAQAVLAPPKPGKSPAPG------KFKDDFRKKSGPSGG  336

Query  543  LRRRMVVDDDHDE--ASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILE  704
             RRRMV DDD  +   SELDVSI    TARKGRKWTKASRKAARLQAA++AAPVKVEI+E
Sbjct  337  PRRRMVDDDDIPDEDTSELDVSIPGAATARKGRKWTKASRKAARLQAARDAAPVKVEIME  396

Query  705  VDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQ  815
            V EDGML EELAYNL ISEGEI  YFY+KGI+PDGVQ
Sbjct  397  VGEDGMLTEELAYNLAISEGEIFGYFYSKGIRPDGVQ  433



>ref|XP_011082825.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
isoform X2 [Sesamum indicum]
Length=1008

 Score =   201 bits (510),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 174/277 (63%), Positives = 202/277 (73%), Gaps = 22/277 (8%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaapl  188
            KNGKP+NS+    + S T KSVWRKGNPV TVQ  V++P K+E +T       SQP A  
Sbjct  171  KNGKPVNSVENSNRKSKTLKSVWRKGNPVSTVQKVVREPLKEEPRTDGGGVAGSQPVAAP  230

Query  189  rppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakE  368
            RPPQPPQ+V+P LQ +PSVAPPP          K+ VILKDV +A K   A    +  KE
Sbjct  231  RPPQPPQRVQPKLQTKPSVAPPPSI--------KKPVILKDVNSAAKSSVANETDSTVKE  282

Query  369  --RQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGG  542
              R+PIL+DKFASKKP+ DPL+++AVLAPPKP KSP+        +FKD+FRKKSG SGG
Sbjct  283  KERKPILIDKFASKKPMVDPLIAQAVLAPPKPGKSPAPG------KFKDDFRKKSGPSGG  336

Query  543  LRRRMVVDDDHDE--ASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILE  704
             RRRMV DDD  +   SELDVSI    TARKGRKWTKASRKAARLQAA++AAPVKVEI+E
Sbjct  337  PRRRMVDDDDIPDEDTSELDVSIPGAATARKGRKWTKASRKAARLQAARDAAPVKVEIME  396

Query  705  VDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQ  815
            V EDGML EELAYNL ISEGEI  YFY+KGI+PDGVQ
Sbjct  397  VGEDGMLTEELAYNLAISEGEIFGYFYSKGIRPDGVQ  433



>ref|XP_010275898.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
[Nelumbo nucifera]
 ref|XP_010275899.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
[Nelumbo nucifera]
Length=1021

 Score =   186 bits (471),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 163/284 (57%), Positives = 203/284 (71%), Gaps = 30/284 (11%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQ---PP---KQELKTSSTEKTES  170
            +  +P+NS     + + T KSVWRKGNPV +VQ  VK+   PP   K +      EK E+
Sbjct  180  RTSRPVNSTG--SRKTKTLKSVWRKGNPVSSVQKVVKESSRPPMIEKVDRNLGDAEKVEA  237

Query  171  qpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapk--ppaat  344
            Q  APLR PQPP++V+P LQA+P+VAPPP          K+ VILKDVGAAP+      +
Sbjct  238  QSRAPLRSPQPPKQVQPKLQAKPAVAPPPVI--------KKPVILKDVGAAPRPPVTDDS  289

Query  345  gapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKK  524
                K +ER+PIL+DKFA KKPV DP++++AVLAP KPAKSP+        + KDE+RKK
Sbjct  290  APSQKTRERKPILIDKFAPKKPVVDPVIAQAVLAPTKPAKSPASG------KIKDEYRKK  343

Query  525  SGASGGLRRRMVVDDD--HDEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPV  686
            +GA+GG+RRR+V + +   +E SEL+VSI    T RKGRKWTKASRKAARLQAAK+AAPV
Sbjct  344  TGAAGGVRRRLVDETEIPDEETSELNVSIPGATTTRKGRKWTKASRKAARLQAAKDAAPV  403

Query  687  KVEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            +VEILEV E+GML E+LAYNL ISEGEIL Y Y+KGIKPDGVQT
Sbjct  404  RVEILEVGEEGMLTEDLAYNLAISEGEILGYLYSKGIKPDGVQT  447



>ref|XP_009790742.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Nicotiana sylvestris]
Length=1013

 Score =   183 bits (464),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 175/278 (63%), Positives = 197/278 (71%), Gaps = 21/278 (8%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPP-KQE-LKTSSTEKTESqpaa  182
            +N KP++S     + S T KSVW+KGNPV  +Q  VK PP KQE +  S   K+ESQ  A
Sbjct  177  RNSKPVDSDDSSNRKSKTLKSVWKKGNPVAAIQKVVKPPPPKQEPVADSGIRKSESQTVA  236

Query  183  plrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkp--paatgapa  356
            PL+PPQPPQKV+P LQARPSVAPPPP    P         LKDVGAA KP       +  
Sbjct  237  PLKPPQPPQKVQPQLQARPSVAPPPPVIKKPVI-------LKDVGAAAKPPPTDEIESAG  289

Query  357  kakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGAS  536
            K KER+ ILVDKFASKKP  DP++++AVLAP KP KS          RF++EFRKKSGAS
Sbjct  290  KTKERKTILVDKFASKKPAVDPMIAQAVLAPTKPGKSAPPG------RFREEFRKKSGAS  343

Query  537  GGLRRRMVVDDDHDE-ASELDVSI---TARKGRKWTKASrkaarlqaakeaaPVKVEILE  704
            GG RRRMV D   DE ASELDVSI    ARKGRKWTKASRKAARL+AAKE+APVKVEILE
Sbjct  344  GGQRRRMVDDGIPDEEASELDVSIPGAAARKGRKWTKASRKAARLRAAKESAPVKVEILE  403

Query  705  VDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            V E+GM  EELAYNL  SEGEIL   Y+KGIKPDGVQT
Sbjct  404  VGEEGMPTEELAYNLATSEGEILGLLYSKGIKPDGVQT  441



>ref|XP_004243227.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Solanum lycopersicum]
Length=1010

 Score =   181 bits (458),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 158/284 (56%), Positives = 184/284 (65%), Gaps = 27/284 (10%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaapl  188
            +N K ++S     + S T KSVW+KGNP+  VQ  VK PPKQE  T     +ESQ  AP+
Sbjct  168  RNSKTVDSDDSSNRKSKTLKSVWKKGNPIAAVQKVVKPPPKQEPMTDGGRNSESQSVAPI  227

Query  189  rppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkp-----------p  335
            +PPQPPQKV+P L ARPS          PPP++K+ VILKDVGAA K             
Sbjct  228  KPPQPPQKVQPQLLARPS-------VAPPPPIIKKPVILKDVGAAAKSPPSDGVESVGKT  280

Query  336  aatgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEF  515
                A  K KER+ ILVDKFASKK   DP++             P     + P +F++EF
Sbjct  281  KELEAAGKTKERKTILVDKFASKKSAVDPVI------AQAVLAPPKFGKSAPPGKFREEF  334

Query  516  RKKSGASGGLRRRMVVDDDHD-EASELDVSI--TARKGRKWTKASrkaarlqaakeaaPV  686
            RKKSG SGG RRRMV D   D EASELDVS+   ARKGRKWTKASRKAARL+AA+E+APV
Sbjct  335  RKKSGVSGGQRRRMVDDGIPDEEASELDVSLPGRARKGRKWTKASRKAARLKAAQESAPV  394

Query  687  KVEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            KVEILEV E+GM  EELAYNL  SEGEIL   Y+KGIKPDGVQT
Sbjct  395  KVEILEVGEEGMPTEELAYNLATSEGEILGLLYSKGIKPDGVQT  438



>ref|XP_009601340.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Nicotiana tomentosiformis]
Length=1013

 Score =   180 bits (457),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 175/278 (63%), Positives = 198/278 (71%), Gaps = 21/278 (8%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPP-KQE-LKTSSTEKTESqpaa  182
            +N KP++S     + S T KSVW+KGNPV  +Q  VK PP KQE +  S   K+ESQ  A
Sbjct  177  RNSKPVDSDDSSNRKSKTLKSVWKKGNPVAAIQKVVKPPPSKQEPVADSGIRKSESQTVA  236

Query  183  plrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkp--paatgapa  356
            PL+PPQPPQKV+P LQARPSVAPPPP    P         LKDVGAA KP       +  
Sbjct  237  PLKPPQPPQKVQPQLQARPSVAPPPPVIKKPVI-------LKDVGAAAKPPPTDGIESAG  289

Query  357  kakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGAS  536
            K KER+ ILVDKFASKKP  DP++++AVLAPPKP KSP         +F++EFRKK GAS
Sbjct  290  KTKERKTILVDKFASKKPAVDPMIAQAVLAPPKPGKSPPPG------KFREEFRKKGGAS  343

Query  537  GGLRRRMVVDDDHDE-ASELDVSI---TARKGRKWTKASrkaarlqaakeaaPVKVEILE  704
            GG RRRMV D   DE ASELDVSI    ARKGRKWTKASRKAARL+AAKE+APVKVEILE
Sbjct  344  GGQRRRMVDDGIPDEEASELDVSIPGAVARKGRKWTKASRKAARLRAAKESAPVKVEILE  403

Query  705  VDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            V E+GM  EELAYNL  SEGEIL   Y+KGIKPDGVQT
Sbjct  404  VGEEGMPTEELAYNLATSEGEILGLLYSKGIKPDGVQT  441



>ref|XP_008444270.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Cucumis melo]
 ref|XP_008444271.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Cucumis melo]
Length=1024

 Score =   180 bits (456),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 161/278 (58%), Positives = 190/278 (68%), Gaps = 25/278 (9%)
 Frame = +3

Query  12   NGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQP--PKQEL--KTSSTEKTESqpa  179
            N KP+NSMA   +   T KSVWRKG+ V +VQ  V +P  PK E+  K     + E Q  
Sbjct  189  NSKPVNSMA--NRKYKTLKSVWRKGDTVASVQKTVAEPSKPKGEVEAKPRGASRVEPQSR  246

Query  180  aplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppa-atgapa  356
            A  R PQPP K +P LQ +P          A PP++K+ V+LKDVGAA       T   A
Sbjct  247  AAFRSPQPPVKPQPKLQEKP--------LAATPPILKKPVVLKDVGAATVTADDETNTAA  298

Query  357  kakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGAS  536
            K KER+PIL+DK+ASKKPV DP +S+AVLAP KPAK P         +FKD++RKKS AS
Sbjct  299  KTKERKPILIDKYASKKPVVDPFISEAVLAPTKPAKVPPPG------KFKDDYRKKSVAS  352

Query  537  GGLRRRMVVDDDHDEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILE  704
            GG RRRMV DD  D     DVSI    TARKGRKW+KASRKAAR+QA+K+AAPVKVEILE
Sbjct  353  GGPRRRMVGDDKDDVEIPDDVSIPSVSTARKGRKWSKASRKAARIQASKDAAPVKVEILE  412

Query  705  VDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            V+E GML+EELAY+L ISEGEIL Y Y+KGIKPDGVQT
Sbjct  413  VEESGMLLEELAYSLAISEGEILGYLYSKGIKPDGVQT  450



>gb|KCW67693.1| hypothetical protein EUGRSUZ_F01437 [Eucalyptus grandis]
Length=996

 Score =   179 bits (455),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 156/283 (55%), Positives = 188/283 (66%), Gaps = 30/283 (11%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaapl  188
            +NGKP+NS  I  + + T KSVWRKG+ V  VQ  VK P          +  ESQ     
Sbjct  185  RNGKPVNSAGI--KKAKTLKSVWRKGDNVAAVQK-VKFPKDSPDSNKVIDDPESQKVEEH  241

Query  189  rppqppqKV-------EPMLQARPSvappppppvapppvvKRAVILKDVgaa--pkppaa  341
              P+   +        +P LQA+PSVAPPP          K+ VILKDVGAA        
Sbjct  242  VEPRASLRPAQPPLRPQPKLQAKPSVAPPPAL--------KKPVILKDVGAAPKSSTVDD  293

Query  342  tgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRK  521
              A  K KER+PIL+DKFA++KPV DPL+++AVLAP KP+K P+        +FKD++RK
Sbjct  294  VDASGKTKERKPILIDKFATRKPVVDPLIAQAVLAPTKPSKGPASG------KFKDDYRK  347

Query  522  KSGASGGLRRRMVVDDDHDEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVK  689
            K+ ++GGLRRR V DD  +EASEL+VSI    +ARKGRKW+KASRKAARLQAAKEAAPVK
Sbjct  348  KNASAGGLRRRKVNDDIDEEASELNVSIPGAASARKGRKWSKASRKAARLQAAKEAAPVK  407

Query  690  VEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            VEILEV E GMLIE+LAYNL  SEGEIL   Y+KGIKPDGVQT
Sbjct  408  VEILEVGEQGMLIEDLAYNLATSEGEILGLLYSKGIKPDGVQT  450



>ref|XP_010060813.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
 ref|XP_010060814.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW67692.1| hypothetical protein EUGRSUZ_F01437 [Eucalyptus grandis]
Length=1024

 Score =   179 bits (455),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 156/283 (55%), Positives = 188/283 (66%), Gaps = 30/283 (11%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaapl  188
            +NGKP+NS  I  + + T KSVWRKG+ V  VQ  VK P          +  ESQ     
Sbjct  185  RNGKPVNSAGI--KKAKTLKSVWRKGDNVAAVQK-VKFPKDSPDSNKVIDDPESQKVEEH  241

Query  189  rppqppqKV-------EPMLQARPSvappppppvapppvvKRAVILKDVgaa--pkppaa  341
              P+   +        +P LQA+PSVAPPP          K+ VILKDVGAA        
Sbjct  242  VEPRASLRPAQPPLRPQPKLQAKPSVAPPPAL--------KKPVILKDVGAAPKSSTVDD  293

Query  342  tgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRK  521
              A  K KER+PIL+DKFA++KPV DPL+++AVLAP KP+K P+        +FKD++RK
Sbjct  294  VDASGKTKERKPILIDKFATRKPVVDPLIAQAVLAPTKPSKGPASG------KFKDDYRK  347

Query  522  KSGASGGLRRRMVVDDDHDEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVK  689
            K+ ++GGLRRR V DD  +EASEL+VSI    +ARKGRKW+KASRKAARLQAAKEAAPVK
Sbjct  348  KNASAGGLRRRKVNDDIDEEASELNVSIPGAASARKGRKWSKASRKAARLQAAKEAAPVK  407

Query  690  VEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            VEILEV E GMLIE+LAYNL  SEGEIL   Y+KGIKPDGVQT
Sbjct  408  VEILEVGEQGMLIEDLAYNLATSEGEILGLLYSKGIKPDGVQT  450



>ref|XP_010060815.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
Length=1016

 Score =   179 bits (455),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 156/283 (55%), Positives = 188/283 (66%), Gaps = 30/283 (11%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaapl  188
            +NGKP+NS  I  + + T KSVWRKG+ V  VQ  VK P          +  ESQ     
Sbjct  177  RNGKPVNSAGI--KKAKTLKSVWRKGDNVAAVQK-VKFPKDSPDSNKVIDDPESQKVEEH  233

Query  189  rppqppqKV-------EPMLQARPSvappppppvapppvvKRAVILKDVgaa--pkppaa  341
              P+   +        +P LQA+PSVAPPP          K+ VILKDVGAA        
Sbjct  234  VEPRASLRPAQPPLRPQPKLQAKPSVAPPPAL--------KKPVILKDVGAAPKSSTVDD  285

Query  342  tgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRK  521
              A  K KER+PIL+DKFA++KPV DPL+++AVLAP KP+K P+        +FKD++RK
Sbjct  286  VDASGKTKERKPILIDKFATRKPVVDPLIAQAVLAPTKPSKGPASG------KFKDDYRK  339

Query  522  KSGASGGLRRRMVVDDDHDEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVK  689
            K+ ++GGLRRR V DD  +EASEL+VSI    +ARKGRKW+KASRKAARLQAAKEAAPVK
Sbjct  340  KNASAGGLRRRKVNDDIDEEASELNVSIPGAASARKGRKWSKASRKAARLQAAKEAAPVK  399

Query  690  VEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            VEILEV E GMLIE+LAYNL  SEGEIL   Y+KGIKPDGVQT
Sbjct  400  VEILEVGEQGMLIEDLAYNLATSEGEILGLLYSKGIKPDGVQT  442



>ref|XP_006366769.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
[Solanum tuberosum]
Length=1010

 Score =   179 bits (454),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 151/277 (55%), Positives = 180/277 (65%), Gaps = 13/277 (5%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaapl  188
            +N KP++S     + S T KSVW+KGNP+  VQ  VK PPKQE  T   + +ESQ  AP+
Sbjct  168  RNSKPVDSDDSSNRKSKTLKSVWKKGNPIAAVQKVVKLPPKQEPMTDGGKNSESQSVAPI  227

Query  189  rppqppqKVEPMLQARPSvappppppvapppvvKRAVILK----DVgaapkppaatgapa  356
            +PPQPPQKV+P L ARPSVAPPPP    P  +       K    D   +        +  
Sbjct  228  KPPQPPQKVQPQLLARPSVAPPPPVIKKPVILKDVGAAAKSSPSDGIESVGKTKELESAG  287

Query  357  kakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGAS  536
            K KER+ ILVDKFASKK   DP++             P     + P +F++EFRK+SG S
Sbjct  288  KTKERKTILVDKFASKKSAVDPMI------AQAVLAPPKFGKNAPPGKFREEFRKRSGVS  341

Query  537  GGLRRRMVVDDDHD-EASELDVSI--TARKGRKWTKASrkaarlqaakeaaPVKVEILEV  707
            GG RRRMV D   D EASE+DVS+   ARKGRKWTKASRKAARL+AA+E+APVKVEILEV
Sbjct  342  GGQRRRMVDDGIPDEEASEIDVSLPGRARKGRKWTKASRKAARLKAAQESAPVKVEILEV  401

Query  708  DEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
             E+GM  EELAYNL  SEGEIL   Y+KGIKPDGVQT
Sbjct  402  GEEGMPTEELAYNLATSEGEILGLLYSKGIKPDGVQT  438



>ref|XP_004151183.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Cucumis sativus]
 ref|XP_011654307.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Cucumis sativus]
 ref|XP_011654308.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Cucumis sativus]
 gb|KGN55576.1| hypothetical protein Csa_4G675260 [Cucumis sativus]
Length=1023

 Score =   179 bits (454),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 159/278 (57%), Positives = 190/278 (68%), Gaps = 25/278 (9%)
 Frame = +3

Query  12   NGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQP--PKQEL--KTSSTEKTESqpa  179
            N KP+NSMA   +   T KSVWRKG+ V +VQ  V +P  PK E+  K   T K E Q  
Sbjct  188  NSKPVNSMA--NRKYKTLKSVWRKGDTVASVQKIVAEPSKPKDEVEAKPRGTSKVEPQSR  245

Query  180  aplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppa-atgapa  356
            A  +PPQPP K +P LQ +P          A PP++K+ V+LKDVGAA       T   A
Sbjct  246  AAFQPPQPPVKPQPKLQEKP--------LAATPPILKKPVVLKDVGAATMTADDETNTAA  297

Query  357  kakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGAS  536
            K KER+PIL+DK+ASKKPV DP +S A+LAP KP K+P         +FKD++RK+S AS
Sbjct  298  KTKERKPILIDKYASKKPVVDPFISDAILAPTKPVKAPPPG------KFKDDYRKRSVAS  351

Query  537  GGLRRRMVVDDDHDEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILE  704
            GG RR+MV D   D     DVSI    TARKGRKW+KASRKAAR+QA+K+AAPVKVEILE
Sbjct  352  GGPRRKMVGDGKDDVEIPDDVSIPSVSTARKGRKWSKASRKAARIQASKDAAPVKVEILE  411

Query  705  VDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            V+E GML+EELAYNL ISEGEIL Y Y+KGIKPDGVQT
Sbjct  412  VEESGMLLEELAYNLAISEGEILGYLYSKGIKPDGVQT  449



>ref|XP_002532827.1| mitochondrial translational initiation factor, putative [Ricinus 
communis]
 gb|EEF29557.1| mitochondrial translational initiation factor, putative [Ricinus 
communis]
Length=1033

 Score =   178 bits (451),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 193/268 (72%), Gaps = 29/268 (11%)
 Frame = +3

Query  54   SSTSKSVWRKGNPVPTVQNAVKQPPK-------QELKTSSTEKTESqpaaplrppqppqK  212
            + T KSVWRKG+ V +VQ  VK+ PK       ++  T    K ESQ + PLRP QPP +
Sbjct  208  TKTLKSVWRKGDTVSSVQKVVKEAPKVINKLVKEDTITGEGTKLESQSSFPLRPVQPPLR  267

Query  213  VEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDK  392
             +P LQA+PSVAPPP          K+ VILKDVGAAP+PP +  A +K   RQPILVDK
Sbjct  268  PQPKLQAKPSVAPPPVM--------KKPVILKDVGAAPRPPVSGEADSKNNGRQPILVDK  319

Query  393  FASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDDD  572
            FA KKPV DPL+++AVLAP KP K P+        +FKD  RKKS + GG RRR+V +D+
Sbjct  320  FARKKPVVDPLIAQAVLAPTKPGKGPAPG------KFKD--RKKSISPGGPRRRLVNNDE  371

Query  573  ----HDEASELDVSI--TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEE  734
                 +E SEL+VSI  TARKGRKW+KASRKAARLQAAK+AAPVKVEILEV E+GMLIEE
Sbjct  372  LEIPDEETSELNVSIPGTARKGRKWSKASRKAARLQAAKDAAPVKVEILEVGENGMLIEE  431

Query  735  LAYNLTISEGEILSYFYTKGIKPDGVQT  818
            LAYNLTISEGEIL Y Y+KGIKPDGVQT
Sbjct  432  LAYNLTISEGEILGYLYSKGIKPDGVQT  459



>ref|XP_003634785.2| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Vitis vinifera]
 ref|XP_010645038.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Vitis vinifera]
Length=1015

 Score =   177 bits (449),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 160/282 (57%), Positives = 193/282 (68%), Gaps = 28/282 (10%)
 Frame = +3

Query  15   GKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSS-----TEKTESqpa  179
            G+ +N+ +   + S T KSVWRKGNPV TV+  VK        T         K E+QP 
Sbjct  174  GRTVNN-SNASKKSKTLKSVWRKGNPVATVEKVVKDASNNITNTEREGPEVGRKVETQPR  232

Query  180  aplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaa-pkppaatgapa  356
             PLRP QPP + +P LQA+PSVAPPPP         K+ VILKDVGAA            
Sbjct  233  IPLRPTQPPLRAQPKLQAKPSVAPPPPVL-------KKPVILKDVGAAPKSSGIDETDSG  285

Query  357  kakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGAS  536
            K +ER+PIL+DKFASK+PV DP++++AVLAPPKP K P         +FKD++RKK+ ++
Sbjct  286  KTRERKPILIDKFASKRPVVDPMIAQAVLAPPKPGKGPVPG------KFKDDYRKKNAST  339

Query  537  GGLRRRMVVDDDH----DEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKV  692
            GG RRRMV  +D     DE SEL+VSI    TARKGRKW+KASRKAARLQAAK+AAPVKV
Sbjct  340  GGSRRRMVAANDMEIPDDETSELNVSIPGAATARKGRKWSKASRKAARLQAAKDAAPVKV  399

Query  693  EILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            EILEV E+GML E+LAYNL ISEGEIL + Y+KGIKPDGVQT
Sbjct  400  EILEVGEEGMLTEDLAYNLAISEGEILGFLYSKGIKPDGVQT  441



>emb|CAN76368.1| hypothetical protein VITISV_024584 [Vitis vinifera]
Length=1005

 Score =   175 bits (444),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 158/277 (57%), Positives = 193/277 (70%), Gaps = 28/277 (10%)
 Frame = +3

Query  15   GKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrp  194
            G+ +N+ +   + S T KSVWRKGNPV TV+  VK         ++TE+    P  PLRP
Sbjct  174  GRTVNN-SNASKKSKTLKSVWRKGNPVATVEKVVKDASNN---ITNTER--EGPEIPLRP  227

Query  195  pqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaa-pkppaatgapakakER  371
             QPP + +P LQA+PSVAPPPP         K+ VILKDVGAA            K +ER
Sbjct  228  TQPPLRAQPKLQAKPSVAPPPPVL-------KKPVILKDVGAAPKSSGIDETDSGKTRER  280

Query  372  QPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRR  551
            +PIL+DKFASK+PV DP++++AVLAPPKP K P         +FKD++RKK+ ++GG RR
Sbjct  281  KPILIDKFASKRPVVDPMIAQAVLAPPKPGKGPVPG------KFKDDYRKKNASTGGSRR  334

Query  552  RMVVDDDH----DEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILEV  707
            RMV  +D     DE SEL+VSI    TARKGRKW+KASRKAARLQAAK+AAPVKVEILEV
Sbjct  335  RMVAANDMEIPDDETSELNVSIPGAATARKGRKWSKASRKAARLQAAKDAAPVKVEILEV  394

Query  708  DEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
             E+GML E+LAYNL ISEGEIL + Y+KGIKPDGVQT
Sbjct  395  GEEGMLTEDLAYNLAISEGEILGFLYSKGIKPDGVQT  431



>emb|CDP06122.1| unnamed protein product [Coffea canephora]
Length=1022

 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 160/281 (57%), Positives = 190/281 (68%), Gaps = 21/281 (7%)
 Frame = +3

Query  12   NGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplr  191
            +G  +NS +   + S T KSVWRKGNPV +VQ  V +P KQ  K     K  SQ  +PL 
Sbjct  177  DGNLVNSGSSSNKKSKTLKSVWRKGNPVGSVQKVV-EPAKQRPKNDVAGKIASQTVSPLG  235

Query  192  ppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaap--kppaatgapakak  365
             P+P Q V P LQA+PSVAPPP          ++ VILKDVGAA        TG+ ++ K
Sbjct  236  TPKPSQNVRPRLQAKPSVAPPPVA--------RKPVILKDVGAALKPSSANVTGSSSQTK  287

Query  366  ERQPILVDKFASKKPVADPLVskavla----ppkpakspskpgksapsRFKDEFRKKSGA  533
            ER+PIL+DKF+SKKPV DPL+++AVLA        A    K GK    + KDEFRK+ G 
Sbjct  288  ERKPILIDKFSSKKPVVDPLIAQAVLAPPKPGKGRAPGKLKDGKLKDEKSKDEFRKRVGP  347

Query  534  SGGLRRRMVVDDD--HDEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVE  695
            SGGLR+R+V  DD   +E  ELDVSI    TARKGRKWTKASRKAARLQAAK+AAPV+VE
Sbjct  348  SGGLRKRIVDADDISDEEIPELDVSIPGAATARKGRKWTKASRKAARLQAAKDAAPVRVE  407

Query  696  ILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            ILEV E+GML EELA+NL ISEGEI    Y+KGIKPDGVQT
Sbjct  408  ILEVGEEGMLTEELAHNLVISEGEIFRSLYSKGIKPDGVQT  448



>ref|XP_010275065.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
[Nelumbo nucifera]
Length=1020

 Score =   169 bits (429),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 158/284 (56%), Positives = 198/284 (70%), Gaps = 31/284 (11%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQP------PKQELKTSSTEKTES  170
            +  +P+NS  +  + + T KSVWRKGNPV +VQ  VK+P       K+++    TEK E 
Sbjct  180  RRNRPVNSTGV--RKTKTLKSVWRKGNPVASVQKVVKEPLKPSKLDKKDIAPEDTEKGER  237

Query  171  qpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatga  350
            Q  APLRPPQPPQ+V+P LQA+P++AP            K+ V+LKDVGAA KP      
Sbjct  238  QSRAPLRPPQPPQQVQPKLQAKPAIAPSVI---------KKPVVLKDVGAAQKPMVTDDT  288

Query  351  pa--kakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKK  524
             A  K KE++PIL+DKFA KKPV DP++++AVLAP KPAK  +        + KDE+RKK
Sbjct  289  AAGPKPKEQKPILIDKFAPKKPVIDPVIAQAVLAPTKPAKGLASG------KIKDEYRKK  342

Query  525  SGASGGLRRRMVVDDD--HDEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPV  686
            + A+GG RRR+    +   +E SEL+VSI    T RKGRKW+KASRKAARLQAAK+AAPV
Sbjct  343  TSAAGGARRRLFDQTEIPDEETSELNVSIPGAATVRKGRKWSKASRKAARLQAAKDAAPV  402

Query  687  KVEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            +VEILEV E+GM+ EELAYNL ISEGEIL Y Y+KGIKPDGVQT
Sbjct  403  RVEILEVGEEGMVTEELAYNLAISEGEILGYLYSKGIKPDGVQT  446



>ref|XP_007149252.1| hypothetical protein PHAVU_005G054600g [Phaseolus vulgaris]
 gb|ESW21246.1| hypothetical protein PHAVU_005G054600g [Phaseolus vulgaris]
Length=1019

 Score =   169 bits (427),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 139/279 (50%), Positives = 179/279 (64%), Gaps = 26/279 (9%)
 Frame = +3

Query  18   KPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrpp  197
            +P+NS A     S T KSVWRKG+ V +VQ  VK+ PK     +  EK++++    +   
Sbjct  181  RPVNSAA--SLKSKTLKSVWRKGDSVASVQKVVKEVPKPSYNKNEEEKSQTRGGEKVVSQ  238

Query  198  qpp----qKVEPMLQARPSvappppppvapppv--vKRAVILKDVgaapkppaatgapak  359
                    K +P+   +PS   P            VK+ V+L+D        AA  +   
Sbjct  239  TRAPQPPSKPQPLKPQQPSKPQPALLSKPSIAPPPVKKPVVLRD------KGAAETSVKS  292

Query  360  akERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASG  539
             +++ PIL+DKFASKKPV DPL+++AVLAPPKP K+PS        +FKD+FRKK   +G
Sbjct  293  KEKKSPILIDKFASKKPVVDPLIAQAVLAPPKPGKAPSPG------KFKDDFRKKGALAG  346

Query  540  GLRRRMVVDDDH--DEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEIL  701
            G RRR ++DD+    +ASEL+VSI    TARKGRKW+KASRKAARLQAA++AAPVKVEIL
Sbjct  347  GGRRRRILDDEDVIQDASELNVSIPGAATARKGRKWSKASRKAARLQAARDAAPVKVEIL  406

Query  702  EVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            EV + GML+EELAY L  SEGEIL Y Y+KGIKPDGVQT
Sbjct  407  EVGDSGMLVEELAYCLATSEGEILGYLYSKGIKPDGVQT  445



>ref|XP_010087150.1| Translation initiation factor IF-2 [Morus notabilis]
 gb|EXB27055.1| Translation initiation factor IF-2 [Morus notabilis]
Length=1017

 Score =   169 bits (427),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 148/275 (54%), Positives = 177/275 (64%), Gaps = 28/275 (10%)
 Frame = +3

Query  18   KPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPP--KQELKTSSTEKTESqpaaplr  191
            +P+NS     + + T KSVWRKG+ V  V+  VK P   K + +    E     P +   
Sbjct  190  EPLNSTT--NRKAKTLKSVWRKGDSV-AVRKVVKDPSNSKPDKRVEREEPKSQTPTSLRP  246

Query  192  ppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakER  371
             PQP  + +P LQA+PSVAPPP          K+ VILKDVGAAPK      +  K  ER
Sbjct  247  HPQPSLRPQPKLQAKPSVAPPPTL--------KKPVILKDVGAAPKSQGTDESVRKK-ER  297

Query  372  QPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRR  551
            +PIL+DKFASKKPV DPL+   +         P         +FKDE+RKK+  +GG RR
Sbjct  298  KPILIDKFASKKPVVDPLIEAVLAPTKPVKSPPPG-------KFKDEYRKKNVPAGGSRR  350

Query  552  RMVVDD----DHDEASELDVSI--TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDE  713
            RMV DD    D D +SEL+VSI   ARKGRKW+KASRKAARLQAA++AAPVKVEILEV E
Sbjct  351  RMVRDDVEIPDED-SSELNVSIPGAARKGRKWSKASRKAARLQAARDAAPVKVEILEVGE  409

Query  714  DGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
             GMLIEELAY+L ISEGEIL Y Y+KGIKPDGVQT
Sbjct  410  KGMLIEELAYDLAISEGEILGYLYSKGIKPDGVQT  444



>sp|P57997.1|IF2C_PHAVU RecName: Full=Translation initiation factor IF-2, chloroplastic; 
AltName: Full=PvIF2cp; Flags: Precursor [Phaseolus vulgaris]
 gb|AAK09431.1|AF324244_1 translation initiation factor 2 [Phaseolus vulgaris]
Length=1012

 Score =   168 bits (426),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 139/279 (50%), Positives = 179/279 (64%), Gaps = 26/279 (9%)
 Frame = +3

Query  18   KPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrpp  197
            +P+NS A     S T KSVWRKG+ V +VQ  VK+ PK     +  EK++++    +   
Sbjct  179  RPVNSAA--SLKSKTLKSVWRKGDSVASVQKVVKEVPKPSYNKNEEEKSQTRGGEKVVSQ  236

Query  198  qpp----qKVEPMLQARPSvappppppvapppv--vKRAVILKDVgaapkppaatgapak  359
                    K +P+   +PS   P            VK+ V+L+D        AA  +   
Sbjct  237  TRAPQPPSKPQPLKPQQPSKPQPALLSKPSIAPPPVKKPVVLRD------KGAAETSVKS  290

Query  360  akERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASG  539
             +++ PIL+DKFASKKPV DPL+++AVLAPPKP K+PS        +FKD+FRKK   +G
Sbjct  291  KEKKSPILIDKFASKKPVVDPLIAQAVLAPPKPGKAPSPG------KFKDDFRKKGALAG  344

Query  540  GLRRRMVVDDDH--DEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEIL  701
            G RRR ++DD+    +ASEL+VSI    TARKGRKW+KASRKAARLQAA++AAPVKVEIL
Sbjct  345  GGRRRRILDDEDVIQDASELNVSIPGAATARKGRKWSKASRKAARLQAARDAAPVKVEIL  404

Query  702  EVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            EV + GML+EELAY L  SEGEIL Y Y+KGIKPDGVQT
Sbjct  405  EVGDSGMLVEELAYCLATSEGEILGYLYSKGIKPDGVQT  443



>ref|XP_004294190.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Fragaria vesca subsp. vesca]
 ref|XP_011460872.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=1028

 Score =   167 bits (422),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 156/279 (56%), Positives = 188/279 (67%), Gaps = 26/279 (9%)
 Frame = +3

Query  12   NGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-------QELKTSSTEKTES  170
            N +P+NS A     + T KSVWRKG+ V  VQ  VK+ PK       +E KT    K ES
Sbjct  192  NARPVNSTA--STKAKTLKSVWRKGDTVAAVQKVVKEVPKVNNTVWREEPKTGGGVKVES  249

Query  171  qpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaa--pkppaat  344
               AP RPP PP + +P LQA+PS APPP          K+ V+LKD+GAA   +    T
Sbjct  250  PARAPFRPPAPPLRPQPTLQAKPSTAPPPTI--------KKPVVLKDLGAAPKSEVIDDT  301

Query  345  gapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKK  524
            G+P K KER+PIL+DKF++KK   D +V++AVLAP KPAK           RFKD FRKK
Sbjct  302  GSPTKTKERKPILIDKFSTKKTGVDSVVAQAVLAPSKPAKGSPPG------RFKDGFRKK  355

Query  525  SGASGGLRRRMVVDD-DHDEASELDVSITARKGRKWTKASrkaarlqaakeaaPVKVEIL  701
            +   GGLRRR   D+   DE+SEL+VS  ARKGRKW+KASRKAARLQAAK+AAPVKVEIL
Sbjct  356  NAQPGGLRRRKANDELTDDESSELNVSKAARKGRKWSKASRKAARLQAAKDAAPVKVEIL  415

Query  702  EVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            EV+EDGMLI+ELA+NL + E EIL   Y+KGIKPDGVQT
Sbjct  416  EVEEDGMLIDELAFNLAVMESEILGSLYSKGIKPDGVQT  454



>ref|XP_010060818.1| PREDICTED: LOW QUALITY PROTEIN: translation initiation factor 
IF-2, chloroplastic-like [Eucalyptus grandis]
Length=1036

 Score =   167 bits (422),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 153/286 (53%), Positives = 187/286 (65%), Gaps = 33/286 (12%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQP-----PKQELKTSSTEKTESq  173
            +NGKP+NS     + + T K VWRKG+ V  VQ  VK P       + +    ++K E  
Sbjct  185  RNGKPVNSAG--SKKAKTLKGVWRKGDNVAAVQK-VKFPMDSPDSNKVIDDPESQKVEEH  241

Query  174  paaplrppqpp--qKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatg  347
                          +++P LQA+PSVAPPP          K+ VILKDVGAAPK      
Sbjct  242  DEPRASLRPAQPPLRLQPKLQAKPSVAPPPAL--------KKPVILKDVGAAPKSSTVDD  293

Query  348  apa--kakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRK  521
              A  K KER+P L+DKFA+KKPV DPL+++AVLAP KP+K P+        +FKD++RK
Sbjct  294  VDAPGKTKERKPXLIDKFATKKPVVDPLIAQAVLAPTKPSKGPASG------KFKDDYRK  347

Query  522  KSGASGGLRRRMVVDDDH---DEASELDVSI----TARKGRKWTKASrkaarlqaakeaa  680
            K+ ++GG RRRMV DD     +EASEL+VSI    +ARKGRKW+KASRKAARLQAAKEAA
Sbjct  348  KNASAGGPRRRMVNDDIEIPDEEASELNVSIPGAASARKGRKWSKASRKAARLQAAKEAA  407

Query  681  PVKVEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            PVKVEILEV E  MLIE+LAYNL  SEGEIL   Y+KGIKPDGVQT
Sbjct  408  PVKVEILEVGEQVMLIEDLAYNLATSEGEILGLLYSKGIKPDGVQT  453



>ref|XP_012089508.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Jatropha curcas]
 gb|KDP23199.1| hypothetical protein JCGZ_00191 [Jatropha curcas]
Length=1042

 Score =   167 bits (422),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 160/277 (58%), Positives = 185/277 (67%), Gaps = 34/277 (12%)
 Frame = +3

Query  42   PQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELK-------TSSTEKTESqpaaplrppq  200
            P + + T KSVWRKG+ V  VQ  VK  PK + K       T   +K  SQP  PLRP Q
Sbjct  208  PTRKTKTLKSVWRKGDSVAFVQKVVKDAPKTDNKLLKEESITREEKKVNSQPDVPLRPLQ  267

Query  201  ppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaap---kppaatgapakakER  371
            PP + +P LQARPSVAPPP          K+ VILKD+GAAP       A     K   R
Sbjct  268  PPFRPQPKLQARPSVAPPPMM--------KKPVILKDLGAAPKPPVADEADLGATKNNAR  319

Query  372  QPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRR  551
            QPIL+DKFA KKPV DPL+++AVLAP KP K P+        +FKD  +K+S + GG RR
Sbjct  320  QPILIDKFARKKPVVDPLIAQAVLAPTKPVKGPALG------KFKD--KKRSVSPGGPRR  371

Query  552  RMVVDDD----HDEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILEV  707
            R+V DDD     +E SEL+VSI    TARKGRKW+KASRKAAR+QAAKEAAPVKVEILEV
Sbjct  372  RIVDDDDVEIPDEETSELNVSIPGAATARKGRKWSKASRKAARIQAAKEAAPVKVEILEV  431

Query  708  DEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
             E GMLIEELAYNL  SEGEIL Y Y+KGI+PDGVQT
Sbjct  432  GEKGMLIEELAYNLATSEGEILGYLYSKGIRPDGVQT  468



>gb|KHN26792.1| Translation initiation factor IF-2, chloroplastic [Glycine soja]
Length=1015

 Score =   166 bits (421),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 153/286 (53%), Positives = 194/286 (68%), Gaps = 38/286 (13%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK--------QELKTSSTEK-  161
            K  KP+NS A PQ+ S T KSVWRKG+ V +VQ  VK+ PK        +  +T   EK 
Sbjct  173  KADKPVNSAA-PQK-SKTLKSVWRKGDTVASVQKVVKEVPKPINDKNEGERTQTRGGEKV  230

Query  162  -TESqpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppa  338
             +++    P   PQPP + +PML ++PS+APPP          K+ V+LKD     +  A
Sbjct  231  VSQTHAPQPSLKPQPPSQPQPMLLSKPSIAPPPA---------KKPVVLKD-----RGAA  276

Query  339  atgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFR  518
             T +    +++ PIL+DKFASKKPV DPL+++AVLAPPKP K+P         +FKD+FR
Sbjct  277  ETTSVKSKEKKSPILIDKFASKKPVVDPLIAQAVLAPPKPGKAPPPG------KFKDDFR  330

Query  519  KKSGASGGLRRRMVVDDD-HDE-ASELDVSI----TARKGRKWTKASrkaarlqaakeaa  680
            KK   +GG RRR++ DD  HDE ASEL+VSI    TARKGRKW+KASR+AARLQAA++AA
Sbjct  331  KKGAMAGGPRRRILEDDAIHDEDASELNVSIPGAATARKGRKWSKASRRAARLQAARDAA  390

Query  681  PVKVEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            P+KVEILEV + GML+EELAY L  SEGEIL Y Y+KGIKPDGVQT
Sbjct  391  PIKVEILEVGDKGMLVEELAYCLATSEGEILGYLYSKGIKPDGVQT  436



>ref|XP_010694841.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=1008

 Score =   166 bits (421),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 148/281 (53%), Positives = 183/281 (65%), Gaps = 32/281 (11%)
 Frame = +3

Query  12   NGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQEL------KTSSTEKTESq  173
            NG+P+N  A  + N+   KSVWRKGNPV  VQ  V++PP  E       +T+  +K ++Q
Sbjct  174  NGRPVNISAKEKPNAG--KSVWRKGNPVSAVQKVVQEPPMIEKVERVGNRTTGEQKLDNQ  231

Query  174  paaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgap  353
                LRPP   QK E  LQARPSVAPP            +  +LKDVG +        A 
Sbjct  232  SPETLRPPSALQKPEIQLQARPSVAPPM----------PKKPVLKDVGMSSVADGKDQAV  281

Query  354  akakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGA  533
                ER+PILVDKFA+KK   DP++++AV+APPKPAK  S        +FKD+++KK  +
Sbjct  282  KSK-ERKPILVDKFATKKSAVDPIIAQAVIAPPKPAKFSSA-------KFKDDYKKKGLS  333

Query  534  SGGLRRRMVVDDD--HDEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVE  695
            +GG +RRMV +DD  H+E SEL VSI      RKGRKW+KASRKAAR QAA++AAPVKVE
Sbjct  334  AGGPKRRMVNNDDDVHEETSELGVSIPGSIAGRKGRKWSKASRKAARRQAARDAAPVKVE  393

Query  696  ILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            ILEV E GM  EELA NL ISEGEIL + YTKGIKPDG+QT
Sbjct  394  ILEVGEKGMSTEELADNLAISEGEILGFLYTKGIKPDGMQT  434



>gb|KHG29391.1| hypothetical protein F383_15975 [Gossypium arboreum]
Length=992

 Score =   166 bits (420),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 151/263 (57%), Positives = 184/263 (70%), Gaps = 26/263 (10%)
 Frame = +3

Query  60   TSKSVWRKGNPVPTVQNAVKQPPKQELKTSS--TEKTESqpaaplrppqppqKVEPMLQA  233
            T KSVWRKG+ V TVQ  VK+ PK   K      +      AAPLRPPQPP + +P LQA
Sbjct  172  TLKSVWRKGDTVGTVQKVVKESPKVNDKKGEGKVDSQGESAAAPLRPPQPPVRPQPKLQA  231

Query  234  RPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDKFASKKPV  413
            +P+VAPP           K+ VILKDVGA  K  + T   +K  ER+PIL+DKFASKKPV
Sbjct  232  KPAVAPPHVV--------KKPVILKDVGAGQKLESNTDGKSK--ERKPILIDKFASKKPV  281

Query  414  ADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDDD----HDE  581
             DP++++AVL+P KP K P+        +FKD++RKK+ ++GG RRR++ DDD     +E
Sbjct  282  VDPVIAQAVLSPTKPGKGPAPG------KFKDDYRKKNVSAGGPRRRIISDDDLEIPDEE  335

Query  582  ASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEELAYNL  749
             SEL+VSI    T+RKGRKW+KA RKAAR+QAAKEAAPVKVEILEV E GM +EELAYNL
Sbjct  336  TSELNVSIPGAATSRKGRKWSKARRKAARIQAAKEAAPVKVEILEVGEKGMSVEELAYNL  395

Query  750  TISEGEILSYFYTKGIKPDGVQT  818
             I EGEIL Y Y+KGIKPDGVQT
Sbjct  396  AIGEGEILGYLYSKGIKPDGVQT  418



>ref|XP_008226278.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Prunus mume]
Length=1029

 Score =   166 bits (419),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 162/282 (57%), Positives = 189/282 (67%), Gaps = 30/282 (11%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-------QELKTSSTEKTE  167
            +N KP+NS       S T KSVWRKG+ V TVQ  VK+ PK       +ELKT    K E
Sbjct  192  QNAKPVNSET--SSKSKTLKSVWRKGDTVSTVQKVVKESPKLNNTIPKEELKTGGGLKAE  249

Query  168  SqpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaa--pkppaa  341
            +QP A LRPPQPP + +P LQA+PS APPP          K+ V+LKDVGAA        
Sbjct  250  AQPHASLRPPQPPLRPQPKLQAKPSAAPPPTV--------KKPVVLKDVGAAPKSSGIDE  301

Query  342  tgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRK  521
            T +  + KER+PIL+DKFASKKP  D ++S+AVLAP KP K P         RFKD +RK
Sbjct  302  TDSSTQTKERKPILIDKFASKKPAVDSVISQAVLAPSKPGKGPPPG------RFKDGYRK  355

Query  522  KSGASGGLRRRMVVDDDHDE-ASELDVSI--TARKGRKWTKASrkaarlqaakeaaPVKV  692
            K+   G  RRR V D+  DE ASEL+VSI   ARKGRKW+KASRKAARLQAAKEAAPVKV
Sbjct  356  KNDPGG--RRRKVDDEIPDEEASELNVSIPGAARKGRKWSKASRKAARLQAAKEAAPVKV  413

Query  693  EILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            EILEV EDGMLI++LAY L I+E +IL   Y KGIKPDGVQT
Sbjct  414  EILEVGEDGMLIDDLAYYLAINESQILGSLYAKGIKPDGVQT  455



>ref|XP_007022338.1| Translation initiation factor IF-2 isoform 2 [Theobroma cacao]
 gb|EOY13863.1| Translation initiation factor IF-2 isoform 2 [Theobroma cacao]
Length=721

 Score =   163 bits (413),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 155/274 (57%), Positives = 181/274 (66%), Gaps = 35/274 (13%)
 Frame = +3

Query  60   TSKSVWRKGNPVPTVQNAVKQPPK---------QELKTSSTEKTESqpaaplrppqppqK  212
            T KSVWRKG+ V T+Q  VK+ PK                  K ESQ  +   P +PPQ 
Sbjct  172  TLKSVWRKGDSVGTLQKVVKESPKVSNNNNNNIGGGAGGGEGKVESQGESGGAPLRPPQP  231

Query  213  VEPM---LQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapa--kakERQP  377
                   LQA+PSVAPPP          K+ +ILKDVGAA K      A    K+KER+P
Sbjct  232  PLRPQPKLQAKPSVAPPPSV--------KKPIILKDVGAARKSEVVDEADLDEKSKERKP  283

Query  378  ILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRM  557
            IL+DKFASKK V DPL+++AVLAP KP K P+        +FKD++ KK+ ++GG RRR+
Sbjct  284  ILIDKFASKKRVVDPLIAQAVLAPTKPGKGPASG------KFKDDYHKKNVSAGGPRRRV  337

Query  558  VVDD---DHDEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDED  716
            V DD     +EASEL+VSI    TARKGRKW+KA RKAARLQAAKEAAPVKVEILEV E 
Sbjct  338  VNDDLEIPDEEASELNVSIPGAATARKGRKWSKARRKAARLQAAKEAAPVKVEILEVGEK  397

Query  717  GMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            GMLIEELAYNL ISEGEIL Y Y+KGIKPDGVQT
Sbjct  398  GMLIEELAYNLAISEGEILGYLYSKGIKPDGVQT  431



>ref|XP_004488715.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
[Cicer arietinum]
Length=1011

 Score =   165 bits (418),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 140/277 (51%), Positives = 180/277 (65%), Gaps = 36/277 (13%)
 Frame = +3

Query  12   NGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK----QELKTSSTEKTESqpa  179
            N KP+NS+   +  + T KS+WRKG+ V TVQ  VK+ PK    +E+  S      +  +
Sbjct  190  NDKPVNSLQ--KHKAKTLKSIWRKGDSVATVQKVVKEVPKPNIKREVGESQIGGGANVTS  247

Query  180  aplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapak  359
            +    PQPP + +P LQ+RP            PP VK+ +ILKD         A      
Sbjct  248  SQSGDPQPPSRPQPTLQSRP---------FIAPPPVKKPIILKD-----DRGQAETPVPS  293

Query  360  akERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASG  539
             +++ PIL+DKFASKKPV DP+++++VL+P K  K+P+        RF+D++RKK GASG
Sbjct  294  KEKKAPILIDKFASKKPVVDPVIARSVLSPSKSGKAPATG------RFRDDYRKK-GASG  346

Query  540  GL--RRRMVVDDDH--DEASELDVSITARKGRKWTKASrkaarlqaakeaaPVKVEILEV  707
            G   RRRMVV+DD   DE     +S TARKGRKW+KASRKAARLQAAK+AAPVKVEILEV
Sbjct  347  GEGPRRRMVVNDDGIPDE-----ISGTARKGRKWSKASRKAARLQAAKDAAPVKVEILEV  401

Query  708  DEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
             + GML+EELAYNL I EGEIL   Y+KG+KPDGVQT
Sbjct  402  SDKGMLVEELAYNLAIGEGEILGALYSKGVKPDGVQT  438



>ref|XP_007213706.1| hypothetical protein PRUPE_ppa000701mg [Prunus persica]
 gb|EMJ14905.1| hypothetical protein PRUPE_ppa000701mg [Prunus persica]
Length=1029

 Score =   164 bits (415),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 161/282 (57%), Positives = 189/282 (67%), Gaps = 30/282 (11%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-------QELKTSSTEKTE  167
            +N KP+NS    +  S T KSVWRKG+ V  VQ  VK+ PK       +ELKT    K +
Sbjct  192  RNAKPVNSETTSK--SKTLKSVWRKGDTVANVQKVVKESPKLNNTIPEEELKTGGGLKAD  249

Query  168  SqpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaa--pkppaa  341
            SQP A LRPPQPP + +P LQA+PS APPP          K+ V+LKDVGAA        
Sbjct  250  SQPHASLRPPQPPLRPQPKLQAKPSAAPPPMV--------KKPVVLKDVGAAPKSSGIDE  301

Query  342  tgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRK  521
            T +  + KER+PIL+DKFASKKP  D ++S+AVLAP KP K P         RFKD +RK
Sbjct  302  TDSSTQTKERKPILIDKFASKKPAVDSVISQAVLAPSKPGKGPPPG------RFKDGYRK  355

Query  522  KSGASGGLRRRMVVDDDHDE-ASELDVSI--TARKGRKWTKASrkaarlqaakeaaPVKV  692
            K+   G  RRR V D+  DE ASEL+VSI   ARKGRKW+KASRKAARLQAAKEAAPVKV
Sbjct  356  KNDPGG--RRRKVDDEIPDEEASELNVSIPGAARKGRKWSKASRKAARLQAAKEAAPVKV  413

Query  693  EILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            EILEV EDGMLI++LAY L I+E +IL   Y KGIKPDGVQT
Sbjct  414  EILEVGEDGMLIDDLAYYLAINESQILGSLYAKGIKPDGVQT  455



>ref|XP_007022339.1| Translation initiation factor 2, small GTP-binding protein isoform 
3, partial [Theobroma cacao]
 gb|EOY13864.1| Translation initiation factor 2, small GTP-binding protein isoform 
3, partial [Theobroma cacao]
Length=852

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 155/274 (57%), Positives = 181/274 (66%), Gaps = 35/274 (13%)
 Frame = +3

Query  60   TSKSVWRKGNPVPTVQNAVKQPPK---------QELKTSSTEKTESqpaaplrppqppqK  212
            T KSVWRKG+ V T+Q  VK+ PK                  K ESQ  +   P +PPQ 
Sbjct  129  TLKSVWRKGDSVGTLQKVVKESPKVSNNNNNNIGGGAGGGEGKVESQGESGGAPLRPPQP  188

Query  213  VEPM---LQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapa--kakERQP  377
                   LQA+PSVAPPP          K+ +ILKDVGAA K      A    K+KER+P
Sbjct  189  PLRPQPKLQAKPSVAPPPSV--------KKPIILKDVGAARKSEVVDEADLDEKSKERKP  240

Query  378  ILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRM  557
            IL+DKFASKK V DPL+++AVLAP KP K P+        +FKD++ KK+ ++GG RRR+
Sbjct  241  ILIDKFASKKRVVDPLIAQAVLAPTKPGKGPASG------KFKDDYHKKNVSAGGPRRRV  294

Query  558  VVDDDH---DEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDED  716
            V DD     +EASEL+VSI    TARKGRKW+KA RKAARLQAAKEAAPVKVEILEV E 
Sbjct  295  VNDDLEIPDEEASELNVSIPGAATARKGRKWSKARRKAARLQAAKEAAPVKVEILEVGEK  354

Query  717  GMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            GMLIEELAYNL ISEGEIL Y Y+KGIKPDGVQT
Sbjct  355  GMLIEELAYNLAISEGEILGYLYSKGIKPDGVQT  388



>ref|XP_007022337.1| Translation initiation factor 2, small GTP-binding protein isoform 
1 [Theobroma cacao]
 gb|EOY13862.1| Translation initiation factor 2, small GTP-binding protein isoform 
1 [Theobroma cacao]
Length=1016

 Score =   164 bits (414),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 155/274 (57%), Positives = 181/274 (66%), Gaps = 35/274 (13%)
 Frame = +3

Query  60   TSKSVWRKGNPVPTVQNAVKQPPK---------QELKTSSTEKTESqpaaplrppqppqK  212
            T KSVWRKG+ V T+Q  VK+ PK                  K ESQ  +   P +PPQ 
Sbjct  172  TLKSVWRKGDSVGTLQKVVKESPKVSNNNNNNIGGGAGGGEGKVESQGESGGAPLRPPQP  231

Query  213  VEPM---LQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapa--kakERQP  377
                   LQA+PSVAPPP          K+ +ILKDVGAA K      A    K+KER+P
Sbjct  232  PLRPQPKLQAKPSVAPPPSV--------KKPIILKDVGAARKSEVVDEADLDEKSKERKP  283

Query  378  ILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRM  557
            IL+DKFASKK V DPL+++AVLAP KP K P+        +FKD++ KK+ ++GG RRR+
Sbjct  284  ILIDKFASKKRVVDPLIAQAVLAPTKPGKGPASG------KFKDDYHKKNVSAGGPRRRV  337

Query  558  VVDDDH---DEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDED  716
            V DD     +EASEL+VSI    TARKGRKW+KA RKAARLQAAKEAAPVKVEILEV E 
Sbjct  338  VNDDLEIPDEEASELNVSIPGAATARKGRKWSKARRKAARLQAAKEAAPVKVEILEVGEK  397

Query  717  GMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            GMLIEELAYNL ISEGEIL Y Y+KGIKPDGVQT
Sbjct  398  GMLIEELAYNLAISEGEILGYLYSKGIKPDGVQT  431



>gb|AES66251.2| translation initiation factor IF-2 [Medicago truncatula]
Length=1021

 Score =   162 bits (411),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 139/281 (49%), Positives = 187/281 (67%), Gaps = 29/281 (10%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaapl  188
            K+ +P+NS+   +  + T KS+WRKG+ V TVQ  VK+ PK  +K+S   +++      +
Sbjct  187  KDDEPVNSLQ--KHKAKTLKSIWRKGDSVATVQKVVKEVPKPSVKSSEVGESQVGGGEKV  244

Query  189  rppqp----pqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapa  356
                       + +PMLQ+RPS+APPPPPPV      K+ VILKD     K    T    
Sbjct  245  MSQSSDPQPLSRPQPMLQSRPSIAPPPPPPV------KKPVILKD----DKGQGETPPVK  294

Query  357  kakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGAS  536
              + + PIL+DK ASKKP  DP++++ VLAP KP K+P +       R+KD++RKK  +S
Sbjct  295  SKERKGPILIDKHASKKPAVDPVIARTVLAPTKPGKAPPQG------RYKDDYRKKGASS  348

Query  537  G--GLRRRMVVDDD---HDEASELDVSI--TARKGRKWTKASrkaarlqaakeaaPVKVE  695
            G  G RRRMVV+ D    ++ SE +VSI  TARKGRKW+KASR+A RLQAA++AAPVKVE
Sbjct  349  GEGGPRRRMVVNKDGVPDEDTSERNVSIPGTARKGRKWSKASRRAVRLQAARDAAPVKVE  408

Query  696  ILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            ILEV ++GML+EELAYNL I+EG+IL   Y+KG+KPDGVQT
Sbjct  409  ILEVSDNGMLVEELAYNLAITEGDILGSLYSKGVKPDGVQT  449



>ref|XP_003596000.1| Translation initiation factor IF-2 [Medicago truncatula]
Length=1041

 Score =   162 bits (410),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 139/281 (49%), Positives = 187/281 (67%), Gaps = 29/281 (10%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaapl  188
            K+ +P+NS+   +  + T KS+WRKG+ V TVQ  VK+ PK  +K+S   +++      +
Sbjct  187  KDDEPVNSLQ--KHKAKTLKSIWRKGDSVATVQKVVKEVPKPSVKSSEVGESQVGGGEKV  244

Query  189  rppqp----pqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapa  356
                       + +PMLQ+RPS+APPPPPPV      K+ VILKD     K    T    
Sbjct  245  MSQSSDPQPLSRPQPMLQSRPSIAPPPPPPV------KKPVILKD----DKGQGETPPVK  294

Query  357  kakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGAS  536
              + + PIL+DK ASKKP  DP++++ VLAP KP K+P +       R+KD++RKK  +S
Sbjct  295  SKERKGPILIDKHASKKPAVDPVIARTVLAPTKPGKAPPQG------RYKDDYRKKGASS  348

Query  537  G--GLRRRMVVDDD---HDEASELDVSI--TARKGRKWTKASrkaarlqaakeaaPVKVE  695
            G  G RRRMVV+ D    ++ SE +VSI  TARKGRKW+KASR+A RLQAA++AAPVKVE
Sbjct  349  GEGGPRRRMVVNKDGVPDEDTSERNVSIPGTARKGRKWSKASRRAVRLQAARDAAPVKVE  408

Query  696  ILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            ILEV ++GML+EELAYNL I+EG+IL   Y+KG+KPDGVQT
Sbjct  409  ILEVSDNGMLVEELAYNLAITEGDILGSLYSKGVKPDGVQT  449



>gb|KHN27759.1| Translation initiation factor IF-2, chloroplastic [Glycine soja]
Length=1020

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 143/283 (51%), Positives = 182/283 (64%), Gaps = 38/283 (13%)
 Frame = +3

Query  18   KPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrpp  197
            K +NS A   Q S T KSVWRKG+ V +VQ  VK+ PK     +  EKT+++    +   
Sbjct  181  KLVNSAA--YQKSKTMKSVWRKGDTVASVQKVVKEVPKPNSNKNEGEKTQTRGGEEVVSQ  238

Query  198  qppqKVEPM----------LQARPSvappppppvapppvvKRAVILKDVgaapkppaatg  347
                ++             L ++PS+APPP          K+ V+L+D     K  + T 
Sbjct  239  TRAPQLPLKPQPPSQPQPALLSKPSIAPPPV---------KKPVVLRD-----KGVSETT  284

Query  348  apakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKS  527
            +    +++ PIL+DKFASKKPV DPL+++AVLAPPKP K P         +FKD+FRKK 
Sbjct  285  SVKPKEKKSPILIDKFASKKPVVDPLIAQAVLAPPKPGKGPPPG------KFKDDFRKKG  338

Query  528  GASGGLRRRMVVDD-DHDE-ASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVK  689
              +GG RRR++ DD  HDE ASEL+VSI    TARKGRKW+KASR+AARLQAA++AAPVK
Sbjct  339  ATTGGPRRRILEDDVIHDEDASELNVSIPGAATARKGRKWSKASRRAARLQAARDAAPVK  398

Query  690  VEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            VEILEV + GML+EELAY L  SEGEIL Y Y+KGIKPDGVQT
Sbjct  399  VEILEVGDKGMLVEELAYCLATSEGEILGYLYSKGIKPDGVQT  441



>gb|KJB13986.1| hypothetical protein B456_002G104300 [Gossypium raimondii]
Length=639

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 181/262 (69%), Gaps = 25/262 (10%)
 Frame = +3

Query  60   TSKSVWRKGNPVPTVQNAVKQPPKQELKTSS--TEKTESqpaaplrppqppqKVEPMLQA  233
            T KSVWRKG+ V  VQ  VK+ PK   K      E      AAPLRPPQPP + +P LQA
Sbjct  171  TLKSVWRKGDTVGIVQKVVKESPKVNDKKGEGKVESQGESAAAPLRPPQPPVRPQPKLQA  230

Query  234  RPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDKFASKKPV  413
            +P+VAPPP          K+ VILKDVGA  K  + T   +K  ER+PIL+DKFASKK V
Sbjct  231  KPAVAPPPVV--------KKPVILKDVGAGQKLESDTDGKSK--ERKPILIDKFASKKSV  280

Query  414  ADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDD---DHDEA  584
             DP++++AVLAP KP K P+        +FKD++RKK+ ++GG RRR++ DD     +E 
Sbjct  281  VDPVIAQAVLAPTKPGKGPAPG------KFKDDYRKKNVSAGGPRRRIISDDLEIPDEET  334

Query  585  SELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEELAYNLT  752
            SEL+VSI     +RKGRKW+KA RKAAR+QAAKEAAPVKVEILEV E GM +EELAYNL 
Sbjct  335  SELNVSIPGAANSRKGRKWSKARRKAARIQAAKEAAPVKVEILEVGEKGMSVEELAYNLA  394

Query  753  ISEGEILSYFYTKGIKPDGVQT  818
            I EGEIL Y Y+KGIKPDGVQT
Sbjct  395  IGEGEILGYLYSKGIKPDGVQT  416



>gb|KJB13985.1| hypothetical protein B456_002G104300 [Gossypium raimondii]
Length=800

 Score =   157 bits (397),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 181/262 (69%), Gaps = 25/262 (10%)
 Frame = +3

Query  60   TSKSVWRKGNPVPTVQNAVKQPPKQELKTSS--TEKTESqpaaplrppqppqKVEPMLQA  233
            T KSVWRKG+ V  VQ  VK+ PK   K      E      AAPLRPPQPP + +P LQA
Sbjct  171  TLKSVWRKGDTVGIVQKVVKESPKVNDKKGEGKVESQGESAAAPLRPPQPPVRPQPKLQA  230

Query  234  RPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDKFASKKPV  413
            +P+VAPPP          K+ VILKDVGA  K  + T   +K  ER+PIL+DKFASKK V
Sbjct  231  KPAVAPPPVV--------KKPVILKDVGAGQKLESDTDGKSK--ERKPILIDKFASKKSV  280

Query  414  ADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDD---DHDEA  584
             DP++++AVLAP KP K P+        +FKD++RKK+ ++GG RRR++ DD     +E 
Sbjct  281  VDPVIAQAVLAPTKPGKGPAPG------KFKDDYRKKNVSAGGPRRRIISDDLEIPDEET  334

Query  585  SELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEELAYNLT  752
            SEL+VSI     +RKGRKW+KA RKAAR+QAAKEAAPVKVEILEV E GM +EELAYNL 
Sbjct  335  SELNVSIPGAANSRKGRKWSKARRKAARIQAAKEAAPVKVEILEVGEKGMSVEELAYNLA  394

Query  753  ISEGEILSYFYTKGIKPDGVQT  818
            I EGEIL Y Y+KGIKPDGVQT
Sbjct  395  IGEGEILGYLYSKGIKPDGVQT  416



>gb|KJB13984.1| hypothetical protein B456_002G104300 [Gossypium raimondii]
Length=939

 Score =   157 bits (396),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 181/262 (69%), Gaps = 25/262 (10%)
 Frame = +3

Query  60   TSKSVWRKGNPVPTVQNAVKQPPKQELKTSS--TEKTESqpaaplrppqppqKVEPMLQA  233
            T KSVWRKG+ V  VQ  VK+ PK   K      E      AAPLRPPQPP + +P LQA
Sbjct  171  TLKSVWRKGDTVGIVQKVVKESPKVNDKKGEGKVESQGESAAAPLRPPQPPVRPQPKLQA  230

Query  234  RPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDKFASKKPV  413
            +P+VAPPP          K+ VILKDVGA  K  + T   +K  ER+PIL+DKFASKK V
Sbjct  231  KPAVAPPPVV--------KKPVILKDVGAGQKLESDTDGKSK--ERKPILIDKFASKKSV  280

Query  414  ADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDDDH---DEA  584
             DP++++AVLAP KP K P+        +FKD++RKK+ ++GG RRR++ DD     +E 
Sbjct  281  VDPVIAQAVLAPTKPGKGPAPG------KFKDDYRKKNVSAGGPRRRIISDDLEIPDEET  334

Query  585  SELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEELAYNLT  752
            SEL+VSI     +RKGRKW+KA RKAAR+QAAKEAAPVKVEILEV E GM +EELAYNL 
Sbjct  335  SELNVSIPGAANSRKGRKWSKARRKAARIQAAKEAAPVKVEILEVGEKGMSVEELAYNLA  394

Query  753  ISEGEILSYFYTKGIKPDGVQT  818
            I EGEIL Y Y+KGIKPDGVQT
Sbjct  395  IGEGEILGYLYSKGIKPDGVQT  416



>gb|EYU26257.1| hypothetical protein MIMGU_mgv1a001022mg [Erythranthe guttata]
Length=910

 Score =   156 bits (395),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 155/279 (56%), Positives = 186/279 (67%), Gaps = 37/279 (13%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNA-VKQPPKQELKTSSTEKTESqpaap  185
            KNG+PI S+      +  +KSVWRKGNPV  V+   VK+P KQ+  TS  +         
Sbjct  159  KNGQPIASVG----KAKNTKSVWRKGNPVAAVEKTIVKEPFKQD--TSKAQPVSPLRPPL  212

Query  186  lrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaap----kppaatgap  353
                    KV+PMLQARPSVAPPP PPV      K+ VILKDV A+          + A 
Sbjct  213  --------KVQPMLQARPSVAPPPLPPV------KKPVILKDVNASSKPPVAEETDSVAA  258

Query  354  akakER-QPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSG  530
             K KER + IL+DKFASKKP  DP V +AVLAPPKP + P+        +FKDEFRK+ G
Sbjct  259  PKTKERGKTILIDKFASKKPAVDPAVVQAVLAPPKPGRGPALG------KFKDEFRKRGG  312

Query  531  ASGGLRRRMVVDDDHDEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEI  698
             +GG RRR   D+D D  SELD SI     ARKGRKW+KASRKAARLQAA+++APVK+EI
Sbjct  313  PAGGFRRRKAADNDED-ISELDGSIPGGGGARKGRKWSKASRKAARLQAARDSAPVKMEI  371

Query  699  LEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQ  815
            +EV+EDGML +ELA+NL ISEGEIL YFY+KGIKPDGVQ
Sbjct  372  IEVEEDGMLTDELAFNLAISEGEILGYFYSKGIKPDGVQ  410



>gb|KJB13983.1| hypothetical protein B456_002G104300 [Gossypium raimondii]
Length=990

 Score =   156 bits (395),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 146/263 (56%), Positives = 177/263 (67%), Gaps = 27/263 (10%)
 Frame = +3

Query  60   TSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrppqppqKVEPM---LQ  230
            T KSVWRKG+ V  VQ  VK+ PK   K     K ESQ  +   P +PPQ        LQ
Sbjct  171  TLKSVWRKGDTVGIVQKVVKESPKVNDKKGEG-KVESQGESAAAPLRPPQPPVRPQPKLQ  229

Query  231  ARPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDKFASKKP  410
            A+P+VAPPP          K+ VILKDVGA  K  + T   +K  ER+PIL+DKFASKK 
Sbjct  230  AKPAVAPPPVV--------KKPVILKDVGAGQKLESDTDGKSK--ERKPILIDKFASKKS  279

Query  411  VADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDDDH---DE  581
            V DP++++AVLAP KP K P+        +FKD++RKK+ ++GG RRR++ DD     +E
Sbjct  280  VVDPVIAQAVLAPTKPGKGPAPG------KFKDDYRKKNVSAGGPRRRIISDDLEIPDEE  333

Query  582  ASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEELAYNL  749
             SEL+VSI     +RKGRKW+KA RKAAR+QAAKEAAPVKVEILEV E GM +EELAYNL
Sbjct  334  TSELNVSIPGAANSRKGRKWSKARRKAARIQAAKEAAPVKVEILEVGEKGMSVEELAYNL  393

Query  750  TISEGEILSYFYTKGIKPDGVQT  818
             I EGEIL Y Y+KGIKPDGVQT
Sbjct  394  AIGEGEILGYLYSKGIKPDGVQT  416



>ref|XP_009354814.1| PREDICTED: LOW QUALITY PROTEIN: translation initiation factor 
IF-2, chloroplastic [Pyrus x bretschneideri]
Length=1033

 Score =   156 bits (394),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 156/283 (55%), Positives = 188/283 (66%), Gaps = 31/283 (11%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-------QELKTSSTEKTE  167
            +N KP+++ A  +  S T KSVWRKG+ V TV+  VK+ PK       +E KT    K E
Sbjct  191  RNAKPVDTAATSK--SKTLKSVWRKGDTVATVKKVVKESPKVSNTIQNEETKTGGEVKVE  248

Query  168  SqpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaa--pkppaa  341
            SQP APLR P+PP + +P LQA+PS APPP          K+ V+LKDVGAA        
Sbjct  249  SQPRAPLRTPRPPLRPQPTLQAKPSTAPPPTV--------KKPVVLKDVGAAPKSSEIDE  300

Query  342  tgapakakERQ-PILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFR  518
              +  K KER+ PIL+DKFASKK V D ++S+AVLAP KP K PS        + K+ FR
Sbjct  301  ADSSTKTKERKGPILIDKFASKKAVVDSVISQAVLAPSKPGKGPSPG------KVKEGFR  354

Query  519  KKSGASGGLRRRMVVDDDHDE-ASELDVSI--TARKGRKWTKASrkaarlqaakeaaPVK  689
            KK  A  GLRRR V +D  DE  SEL+VSI   ARKGRKW KASRKAARLQA KEAAPVK
Sbjct  355  KKDAA--GLRRRKVAEDILDEDTSELNVSIPGAARKGRKWNKASRKAARLQAEKEAAPVK  412

Query  690  VEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            VEILEV EDGML+++LA++L  +E EIL Y Y+ GIKPDGVQT
Sbjct  413  VEILEVSEDGMLVDDLAFHLATTESEILGYLYSMGIKPDGVQT  455



>ref|XP_008383019.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Malus domestica]
Length=1031

 Score =   156 bits (394),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 154/283 (54%), Positives = 185/283 (65%), Gaps = 31/283 (11%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-------QELKTSSTEKTE  167
            +N  P++  A  +  S T KSVWRKG+ V TV+  VK+ PK       +E KT    + E
Sbjct  191  RNATPVDLAATSK--SKTLKSVWRKGDTVSTVKKVVKESPKVNNTIQKEETKTGGGVQVE  248

Query  168  SqpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatg  347
            SQP APLR PQPP + +P LQA+PS A PP          K+ V+LKDVGAA K      
Sbjct  249  SQPRAPLRTPQPPLRPQPTLQAKPSTALPPTV--------KKPVVLKDVGAAAKSSVIDE  300

Query  348  apakakERQ---PILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFR  518
                 K ++   PIL+DKFASKK   D ++S+AVLAP KP K PS        +FK+ FR
Sbjct  301  TDLSTKTKERKAPILIDKFASKKASVDSVISQAVLAPSKPGKGPSPG------KFKEGFR  354

Query  519  KKSGASGGLRRRMVVDDDHDE-ASELDVSI--TARKGRKWTKASrkaarlqaakeaaPVK  689
            KK  A  GLRRR V DD  DE  SEL+VSI   ARKGRKW+KASRKAARLQAAKEAAPVK
Sbjct  355  KKDAA--GLRRRKVADDILDEDTSELNVSIPGAARKGRKWSKASRKAARLQAAKEAAPVK  412

Query  690  VEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            VEILEV EDGML+++LA++L  +E EIL Y Y+ GIKPDGVQT
Sbjct  413  VEILEVGEDGMLVDDLAFHLATTESEILGYLYSMGIKPDGVQT  455



>gb|EPS57840.1| hypothetical protein M569_16977, partial [Genlisea aurea]
Length=452

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 148/283 (52%), Positives = 184/283 (65%), Gaps = 33/283 (12%)
 Frame = +3

Query  27   NSMAIPQQN--SSTSKSVWRKGNPVPTVQNAVKQPPKQE-------LKTSS--TEKTESq  173
            N  A+   N  S T KSVWRKG+PV +VQ  VK+ PKQE       LK+ S  ++   + 
Sbjct  110  NGTAVDNSNRKSKTLKSVWRKGSPVASVQKVVKERPKQEPGRDEEGLKSGSRLSKPLPAN  169

Query  174  paaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgap  353
             +    P  PP+K +P LQ++      P     P P ++++V+ KDV +AP         
Sbjct  170  QSTASSPVVPPRKPQPKLQSK------PSIAPPPSPPIQKSVVPKDVSSAPVDNENDLET  223

Query  354  akakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGA  533
                +R+PILVDKFASKKPV DP++++AVLAPPKP KSP         +FKDEFRKKSG 
Sbjct  224  KTQ-KRKPILVDKFASKKPVVDPVIAQAVLAPPKPGKSPLPG------KFKDEFRKKSGG  276

Query  534  SGGL--RRRMVVDDDHDE---ASELDVSI----TARKGRKWTKASrkaarlqaakeaaPV  686
                  RRR+  D+D      ASELDVSI    +ARKGRKW+KASRKAARLQAA++AAPV
Sbjct  277  GLSGGPRRRLADDEDDIVDEDASELDVSIPGAASARKGRKWSKASRKAARLQAARDAAPV  336

Query  687  KVEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQ  815
            KVEI+EVDEDGML EELAYNL  SEGEIL + Y+KGI+PDGVQ
Sbjct  337  KVEIMEVDEDGMLTEELAYNLATSEGEILGFLYSKGIRPDGVQ  379



>ref|XP_011036231.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
[Populus euphratica]
Length=1032

 Score =   155 bits (392),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 150/278 (54%), Positives = 184/278 (66%), Gaps = 30/278 (11%)
 Frame = +3

Query  24   INSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-------QELKTSSTEKTESqpaa  182
            +NS A  ++ + T +SVWRKG+ V +VQ  VK+ PK       +E KT    K ESQ   
Sbjct  200  VNSTAATRK-AKTLRSVWRKGDTVSSVQRIVKEVPKPSNKFIKEEPKTVEATKLESQSRV  258

Query  183  plrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapaka  362
            PL+PPQPP + +P LQA+PS AP P          K+ V+LKDVGAAPK P      + A
Sbjct  259  PLKPPQPPLRTQPKLQAKPSAAPSPII--------KKPVVLKDVGAAPKSPIKDETGSGA  310

Query  363  kER--QPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGAS  536
             +   QPIL+DKFA KKPV DPL+++AVLAP KP K P         ++KD  RKK  + 
Sbjct  311  AQSKGQPILIDKFARKKPVVDPLIAQAVLAPTKPGKGPGPV------KYKD--RKKGASP  362

Query  537  GGLRRRMVVDDDHDEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILE  704
            G  RRRM+ +D      EL+VSI    TARKGRKWTKASRKAA++QAA+EAAPVKVEILE
Sbjct  363  GTPRRRMMDNDVEIPDEELNVSIPGAATARKGRKWTKASRKAAKIQAAREAAPVKVEILE  422

Query  705  VDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            V E GM IEELAYNLT+ EGEIL   ++KG+KPDGVQT
Sbjct  423  VGEKGMSIEELAYNLTMGEGEILGLLFSKGVKPDGVQT  460



>ref|XP_006441000.1| hypothetical protein CICLE_v10018663mg [Citrus clementina]
 gb|ESR54240.1| hypothetical protein CICLE_v10018663mg [Citrus clementina]
Length=734

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 152/282 (54%), Positives = 185/282 (66%), Gaps = 32/282 (11%)
 Frame = +3

Query  3    EAKNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-----QELKTSSTEKTE  167
            + KNG+P+NS+    + S T KSVW+KG+ V ++Q  VK+ PK     +E K     K E
Sbjct  185  DTKNGRPMNSVG--AKKSKTLKSVWKKGDSVASIQKVVKETPKTKVKKEEPKMGGDMKME  242

Query  168  SqpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppa--a  341
            SQ   P RP QPP + +P LQ +PSVA  P          K+ V+LKDVGA  K      
Sbjct  243  SQLNIPPRPVQPPLRPQPKLQTKPSVASTPVI--------KKPVVLKDVGAGQKSSTIGE  294

Query  342  tgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRK  521
              +  K KER+PIL+DKFASKKP  DPL+S+AVLAP KP K P+        +FKD++RK
Sbjct  295  ADSAVKNKERKPILIDKFASKKPAVDPLISQAVLAPTKPGKGPAG-------KFKDDYRK  347

Query  522  KSGASGGLRRRMVVDDDHDE---ASELDVSITARKGRKWTKASrkaarlqaakeaaPVKV  692
            K    GG R+R+V DDD      ASEL +   ARKGRKWTKASRKAA+L+AAK+AAPVKV
Sbjct  348  K----GGPRKRIVDDDDEIPDEEASEL-IPGAARKGRKWTKASRKAAKLKAAKDAAPVKV  402

Query  693  EILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            EILEV E GMLIEELA NL I EGEIL   Y+KGIKP+GVQT
Sbjct  403  EILEVGEKGMLIEELARNLAIGEGEILGSLYSKGIKPEGVQT  444



>gb|KDO44388.1| hypothetical protein CISIN_1g0017452mg [Citrus sinensis]
Length=732

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 152/282 (54%), Positives = 185/282 (66%), Gaps = 32/282 (11%)
 Frame = +3

Query  3    EAKNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-----QELKTSSTEKTE  167
            + KNG+P+NS+    + S T KSVW+KG+ V ++Q  VK+ PK     +E K     K E
Sbjct  185  DTKNGRPMNSVG--AKKSKTLKSVWKKGDSVASIQKVVKETPKTKVKKEEPKMGGDMKME  242

Query  168  SqpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppa--a  341
            SQ   P RP QPP + +P LQ +PSVA  P          K+ V+LKDVGA  K      
Sbjct  243  SQLNIPPRPVQPPLRPQPKLQTKPSVASTPVI--------KKPVVLKDVGAGQKLSTIGE  294

Query  342  tgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRK  521
              +  K KER+PIL+DKFASKKP  DPL+S+AVLAP KP K P+        +FKD++RK
Sbjct  295  ADSAVKNKERKPILIDKFASKKPAVDPLISQAVLAPTKPGKGPAG-------KFKDDYRK  347

Query  522  KSGASGGLRRRMVVDDDHDE---ASELDVSITARKGRKWTKASrkaarlqaakeaaPVKV  692
            K    GG R+R+V DDD      ASEL +   ARKGRKWTKASRKAA+L+AAK+AAPVKV
Sbjct  348  K----GGPRKRIVDDDDEIPDEEASEL-IPGAARKGRKWTKASRKAAKLKAAKDAAPVKV  402

Query  693  EILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            EILEV E GMLIEELA NL I EGEIL   Y+KGIKP+GVQT
Sbjct  403  EILEVGEKGMLIEELARNLAIGEGEILGSLYSKGIKPEGVQT  444



>ref|XP_009393319.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=1006

 Score =   154 bits (388),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 134/283 (47%), Positives = 172/283 (61%), Gaps = 43/283 (15%)
 Frame = +3

Query  6    AKNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK---QELKTSSTEKTESqp  176
            +K+G+P N+  +  +NS T+KSVWR+GNPV +VQNAVK+P K   +E K SST    +  
Sbjct  181  SKSGRPANA-TLATRNSKTTKSVWRRGNPVASVQNAVKEPAKVKEEEEKNSSTTTVTNAL  239

Query  177  aa---plrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatg  347
             A       PQ P    P LQA+P VAPP  P    P V +                   
Sbjct  240  GAPPIAPLKPQMPSPARPKLQAKPPVAPPTIPAAKTPDVQR-------------------  280

Query  348  apakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKS  527
                  ER+PIL+DKF+SKKP  DP+ ++A+LA P        P      + KD+ RKKS
Sbjct  281  ------ERKPILIDKFSSKKPGIDPIAAEAILATPLKPAKGPPPT-----KAKDDRRKKS  329

Query  528  GASGGLRRRMVVDD--DHDEASELDVSITA----RKGRKWTKASrkaarlqaakeaaPVK  689
             ++G LRRRMV D     +EASEL+V I      RKGRKW+KASRKAARLQAAK A PVK
Sbjct  330  SSTGSLRRRMVDDGKISEEEASELNVPIPGVTEPRKGRKWSKASRKAARLQAAKAAEPVK  389

Query  690  VEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            VEILEV ++GML EELAYNL +S  +IL++ YT+G++P+ VQT
Sbjct  390  VEILEVGKEGMLTEELAYNLAVSGADILAFLYTRGVRPNAVQT  432



>ref|XP_009344305.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
[Pyrus x bretschneideri]
Length=1031

 Score =   153 bits (387),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 152/283 (54%), Positives = 185/283 (65%), Gaps = 31/283 (11%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-------QELKTSSTEKTE  167
            +N K ++S+A  +  S T KSVWRKG+ V TV+  VK+ PK       +E KT    + E
Sbjct  191  RNAKAVDSVATSK--SKTLKSVWRKGDTVSTVKKVVKESPKVNNTIQKEETKTGGGVQVE  248

Query  168  SqpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatg  347
            SQP APLR PQPP + +P LQA+PS AP P          K+ V+LKDVGAA K      
Sbjct  249  SQPRAPLRTPQPPLRPQPTLQAKPSTAPTPTV--------KKPVVLKDVGAAAKSSVIDE  300

Query  348  apakakERQ---PILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFR  518
                 K ++   PIL+DKFASKK   D ++S+ VLAP KP K PS        +FK+ FR
Sbjct  301  TDLSTKTKERKAPILIDKFASKKVAVDSVISQVVLAPSKPGKGPSPG------KFKEGFR  354

Query  519  KKSGASGGLRRRMVVDDDHDE-ASELDVSI--TARKGRKWTKASrkaarlqaakeaaPVK  689
            KK  A  GLRRR V +D  DE  SEL+VSI   ARKGRKW+KASRKAARLQAAKEAAPVK
Sbjct  355  KKDAA--GLRRRKVAEDILDEDTSELNVSIPGAARKGRKWSKASRKAARLQAAKEAAPVK  412

Query  690  VEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            VEILEV E GML+++LA++L  +E EIL Y Y+ GIKPDGVQT
Sbjct  413  VEILEVGEAGMLVDDLAFHLATTESEILGYLYSMGIKPDGVQT  455



>ref|XP_011015700.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like, 
partial [Populus euphratica]
Length=888

 Score =   152 bits (385),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 156/278 (56%), Positives = 185/278 (67%), Gaps = 30/278 (11%)
 Frame = +3

Query  24   INSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-------QELKTSSTEKTESqpaa  182
            +NS A     + T KSVWRKG+ V  +   VK+ PK       +E KT    K ESQ   
Sbjct  201  VNSSAT-NMKTKTLKSVWRKGDSVAALPKVVKEVPKASNRVIKREPKTVEGAKLESQSTV  259

Query  183  plrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapaka  362
            PL+PPQPP + +P LQ +PSVAPPP          K+ VILKDVGAAPK P      ++A
Sbjct  260  PLKPPQPPLRPQPKLQGKPSVAPPPMI--------KKPVILKDVGAAPKSPVKDETGSRA  311

Query  363  --kERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGAS  536
               + QPILVDKFA KKPV DP++++AVLAP KP K P+        +++D  RKKS + 
Sbjct  312  PKIKGQPILVDKFARKKPVVDPVIAQAVLAPIKPGKGPAPG------KYRD--RKKSISP  363

Query  537  GGLRRRMVVDDDHDEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILE  704
            G  RRRMV DD      EL+VSI    T RKGRKWTKASRKAA+LQAA++AAPVKVEILE
Sbjct  364  GTPRRRMVDDDVEIPDEELNVSIPGAATGRKGRKWTKASRKAAKLQAARDAAPVKVEILE  423

Query  705  VDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            V E GM IEELAYNLTISEGEIL + Y+KGIKPDGVQT
Sbjct  424  VGEKGMSIEELAYNLTISEGEILGFLYSKGIKPDGVQT  461



>ref|XP_006441001.1| hypothetical protein CICLE_v10018663mg [Citrus clementina]
 gb|ESR54241.1| hypothetical protein CICLE_v10018663mg [Citrus clementina]
Length=1018

 Score =   152 bits (383),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 152/282 (54%), Positives = 185/282 (66%), Gaps = 32/282 (11%)
 Frame = +3

Query  3    EAKNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-----QELKTSSTEKTE  167
            + KNG+P+NS+    + S T KSVW+KG+ V ++Q  VK+ PK     +E K     K E
Sbjct  185  DTKNGRPMNSVG--AKKSKTLKSVWKKGDSVASIQKVVKETPKTKVKKEEPKMGGDMKME  242

Query  168  SqpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppa--a  341
            SQ   P RP QPP + +P LQ +PSVA  P          K+ V+LKDVGA  K      
Sbjct  243  SQLNIPPRPVQPPLRPQPKLQTKPSVASTPVI--------KKPVVLKDVGAGQKSSTIGE  294

Query  342  tgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRK  521
              +  K KER+PIL+DKFASKKP  DPL+S+AVLAP KP K P+        +FKD++RK
Sbjct  295  ADSAVKNKERKPILIDKFASKKPAVDPLISQAVLAPTKPGKGPAG-------KFKDDYRK  347

Query  522  KSGASGGLRRRMVVDDDHDE---ASELDVSITARKGRKWTKASrkaarlqaakeaaPVKV  692
            K    GG R+R+V DDD      ASEL +   ARKGRKWTKASRKAA+L+AAK+AAPVKV
Sbjct  348  K----GGPRKRIVDDDDEIPDEEASEL-IPGAARKGRKWTKASRKAAKLKAAKDAAPVKV  402

Query  693  EILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            EILEV E GMLIEELA NL I EGEIL   Y+KGIKP+GVQT
Sbjct  403  EILEVGEKGMLIEELARNLAIGEGEILGSLYSKGIKPEGVQT  444



>gb|KDO44387.1| hypothetical protein CISIN_1g0017452mg [Citrus sinensis]
Length=996

 Score =   152 bits (383),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 152/282 (54%), Positives = 185/282 (66%), Gaps = 32/282 (11%)
 Frame = +3

Query  3    EAKNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-----QELKTSSTEKTE  167
            + KNG+P+NS+    + S T KSVW+KG+ V ++Q  VK+ PK     +E K     K E
Sbjct  185  DTKNGRPMNSVG--AKKSKTLKSVWKKGDSVASIQKVVKETPKTKVKKEEPKMGGDMKME  242

Query  168  SqpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppa--a  341
            SQ   P RP QPP + +P LQ +PSVA  P          K+ V+LKDVGA  K      
Sbjct  243  SQLNIPPRPVQPPLRPQPKLQTKPSVASTPVI--------KKPVVLKDVGAGQKLSTIGE  294

Query  342  tgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRK  521
              +  K KER+PIL+DKFASKKP  DPL+S+AVLAP KP K P+        +FKD++RK
Sbjct  295  ADSAVKNKERKPILIDKFASKKPAVDPLISQAVLAPTKPGKGPAG-------KFKDDYRK  347

Query  522  KSGASGGLRRRMVVDDDHDE---ASELDVSITARKGRKWTKASrkaarlqaakeaaPVKV  692
            K    GG R+R+V DDD      ASEL +   ARKGRKWTKASRKAA+L+AAK+AAPVKV
Sbjct  348  K----GGPRKRIVDDDDEIPDEEASEL-IPGAARKGRKWTKASRKAAKLKAAKDAAPVKV  402

Query  693  EILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            EILEV E GMLIEELA NL I EGEIL   Y+KGIKP+GVQT
Sbjct  403  EILEVGEKGMLIEELARNLAIGEGEILGSLYSKGIKPEGVQT  444



>gb|KDO44386.1| hypothetical protein CISIN_1g0017452mg [Citrus sinensis]
Length=1018

 Score =   151 bits (382),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 152/282 (54%), Positives = 185/282 (66%), Gaps = 32/282 (11%)
 Frame = +3

Query  3    EAKNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-----QELKTSSTEKTE  167
            + KNG+P+NS+    + S T KSVW+KG+ V ++Q  VK+ PK     +E K     K E
Sbjct  185  DTKNGRPMNSVG--AKKSKTLKSVWKKGDSVASIQKVVKETPKTKVKKEEPKMGGDMKME  242

Query  168  SqpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppa--a  341
            SQ   P RP QPP + +P LQ +PSVA  P          K+ V+LKDVGA  K      
Sbjct  243  SQLNIPPRPVQPPLRPQPKLQTKPSVASTPVI--------KKPVVLKDVGAGQKLSTIGE  294

Query  342  tgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRK  521
              +  K KER+PIL+DKFASKKP  DPL+S+AVLAP KP K P+        +FKD++RK
Sbjct  295  ADSAVKNKERKPILIDKFASKKPAVDPLISQAVLAPTKPGKGPAG-------KFKDDYRK  347

Query  522  KSGASGGLRRRMVVDDDHDE---ASELDVSITARKGRKWTKASrkaarlqaakeaaPVKV  692
            K    GG R+R+V DDD      ASEL +   ARKGRKWTKASRKAA+L+AAK+AAPVKV
Sbjct  348  K----GGPRKRIVDDDDEIPDEEASEL-IPGAARKGRKWTKASRKAAKLKAAKDAAPVKV  402

Query  693  EILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            EILEV E GMLIEELA NL I EGEIL   Y+KGIKP+GVQT
Sbjct  403  EILEVGEKGMLIEELARNLAIGEGEILGSLYSKGIKPEGVQT  444



>ref|XP_006478012.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
[Citrus sinensis]
Length=1018

 Score =   151 bits (382),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 152/282 (54%), Positives = 185/282 (66%), Gaps = 32/282 (11%)
 Frame = +3

Query  3    EAKNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-----QELKTSSTEKTE  167
            + KNG+P+NS+    + S T KSVW+KG+ V ++Q  VK+ PK     +E K     K E
Sbjct  185  DTKNGRPMNSVG--AKKSKTLKSVWKKGDSVASIQKVVKETPKTKVKKEEPKMGGDMKME  242

Query  168  SqpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppa--a  341
            SQ   P RP QPP + +P LQ +PSVA  P          K+ V+LKDVGA  K      
Sbjct  243  SQLNIPPRPVQPPLRPQPKLQTKPSVASTPVI--------KKPVVLKDVGAGQKLSTIGE  294

Query  342  tgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRK  521
              +  K KER+PIL+DKFASKKP  DPL+S+AVLAP KP K P+        +FKD++RK
Sbjct  295  ADSAVKNKERKPILIDKFASKKPAVDPLISQAVLAPTKPGKGPAG-------KFKDDYRK  347

Query  522  KSGASGGLRRRMVVDDDHDE---ASELDVSITARKGRKWTKASrkaarlqaakeaaPVKV  692
            K    GG R+R+V DDD      ASEL +   ARKGRKWTKASRKAA+L+AAK+AAPVKV
Sbjct  348  K----GGPRKRIVDDDDEIPDEEASEL-IPGAARKGRKWTKASRKAAKLKAAKDAAPVKV  402

Query  693  EILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            EILEV E GMLIEELA NL I EGEIL   Y+KGIKP+GVQT
Sbjct  403  EILEVGEKGMLIEELARNLAIGEGEILGSLYSKGIKPEGVQT  444



>ref|XP_011030772.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
[Populus euphratica]
Length=1035

 Score =   151 bits (382),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 156/278 (56%), Positives = 185/278 (67%), Gaps = 30/278 (11%)
 Frame = +3

Query  24   INSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-------QELKTSSTEKTESqpaa  182
            +NS A     + T KSVWRKG+ V  +   VK+ PK       +E KT    K ESQ   
Sbjct  201  VNSSAT-NMKTKTLKSVWRKGDSVAALPKVVKEVPKASNRVIKREPKTVEGAKLESQSTV  259

Query  183  plrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapaka  362
            PL+PPQPP + +P LQ +PSVAPPP          K+ VILKDVGAAPK P      ++A
Sbjct  260  PLKPPQPPLRPQPKLQGKPSVAPPPMI--------KKPVILKDVGAAPKSPVKDETGSRA  311

Query  363  --kERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGAS  536
               + QPILVDKFA KKPV DP++++AVLAP KP K P+        +++D  RKKS + 
Sbjct  312  PKIKGQPILVDKFARKKPVVDPVIAQAVLAPIKPGKGPAPG------KYRD--RKKSISP  363

Query  537  GGLRRRMVVDDDHDEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILE  704
            G  RRRMV DD      EL+VSI    T RKGRKWTKASRKAA+LQAA++AAPVKVEILE
Sbjct  364  GTPRRRMVDDDVEIPDEELNVSIPGAATGRKGRKWTKASRKAAKLQAARDAAPVKVEILE  423

Query  705  VDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            V E GM IEELAYNLTISEGEIL + Y+KGIKPDGVQT
Sbjct  424  VGEKGMSIEELAYNLTISEGEILGFLYSKGIKPDGVQT  461



>ref|XP_002300479.2| translation initiation factor IF-2 family protein [Populus trichocarpa]
 gb|EEE85284.2| translation initiation factor IF-2 family protein [Populus trichocarpa]
Length=1020

 Score =   151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 149/278 (54%), Positives = 185/278 (67%), Gaps = 30/278 (11%)
 Frame = +3

Query  24   INSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-------QELKTSSTEKTESqpaa  182
            +NS A  ++ + T +SVWRKG+ V +VQ  VK+ PK       +E KT    K ESQ   
Sbjct  193  VNSTAATRK-AKTLRSVWRKGDTVSSVQRIVKEVPKASNKFIKEEPKTVEGTKLESQSRV  251

Query  183  plrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapaka  362
            PL+PPQPP + +P LQA+PS AP P          K+ V+LKDVGAAPK P      + A
Sbjct  252  PLKPPQPPLRPQPKLQAKPSAAPSPII--------KKPVVLKDVGAAPKSPIKDETGSGA  303

Query  363  kER--QPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGAS  536
             +   QPIL+DKFA KKPV DP++++AVLAP KP K P+        ++KD  RKK  + 
Sbjct  304  AQSKGQPILIDKFARKKPVVDPVIAQAVLAPTKPGKGPAPG------KYKD--RKKGASP  355

Query  537  GGLRRRMVVDDDHDEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILE  704
            G  RRRM+ +D      EL+VSI    TARKGRKWTKASRKAA++QAA++AAPVKVEILE
Sbjct  356  GTPRRRMMDNDVEIPDEELNVSIPGAATARKGRKWTKASRKAAKIQAARDAAPVKVEILE  415

Query  705  VDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            V E GM IEELAYNLT+ EGEIL   ++KGIKPDGVQT
Sbjct  416  VGEKGMSIEELAYNLTMGEGEILGLLFSKGIKPDGVQT  453



>ref|XP_002317604.2| translation initiation factor IF-2 family protein [Populus trichocarpa]
 gb|EEE98216.2| translation initiation factor IF-2 family protein [Populus trichocarpa]
Length=1043

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 154/278 (55%), Positives = 183/278 (66%), Gaps = 30/278 (11%)
 Frame = +3

Query  24   INSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQ-------ELKTSSTEKTESqpaa  182
            +NS A     + T KSVWRKG+ V  +   VK+ PK        E KT    K ESQ   
Sbjct  201  VNSSA-ANMKTKTLKSVWRKGDSVAALPKVVKEVPKASNRVIKGEPKTVEGAKLESQSTV  259

Query  183  plrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapaka  362
            PL+PPQPP + +P LQ +PSVAPPP          K+ VILKDVGAAPK P      ++A
Sbjct  260  PLKPPQPPLRPQPKLQGKPSVAPPPMI--------KKPVILKDVGAAPKSPVKDETGSRA  311

Query  363  kER--QPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGAS  536
             +   QPILVDKFA KKPV DP++++AVLAP KP K P+        +++D  RKKS + 
Sbjct  312  PQSKGQPILVDKFARKKPVVDPVIAQAVLAPIKPGKGPAPG------KYRD--RKKSVSP  363

Query  537  GGLRRRMVVDDDHDEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILE  704
            G  RRRMV DD      EL+VSI    + RKGRKWTKASRKAA+LQAA++AAPVKVEILE
Sbjct  364  GTPRRRMVDDDVEIPDEELNVSIPGAASGRKGRKWTKASRKAAKLQAARDAAPVKVEILE  423

Query  705  VDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            V E GM IEELAYNLTI EGEIL + Y+KGIKPDGVQT
Sbjct  424  VGEKGMSIEELAYNLTIGEGEILGFLYSKGIKPDGVQT  461



>gb|KCW67687.1| hypothetical protein EUGRSUZ_F01432 [Eucalyptus grandis]
Length=989

 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 142/284 (50%), Positives = 177/284 (62%), Gaps = 37/284 (13%)
 Frame = +3

Query  9    KNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQP-----PKQELKTSSTEKTESq  173
            K G  +N       +++    VWRKG+ V  VQ  VK P       + +    ++K E  
Sbjct  167  KEGGNVNKSTPSGTSANPRNGVWRKGDNVAAVQK-VKFPMDSPDSNKVIDDPESQKVEEH  225

Query  174  paaplrppqpp--qKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatg  347
                          +++P LQA+PSVAPPP          K+ VILKDVGAAPK      
Sbjct  226  DEPRASLRPAQPPLRLQPKLQAKPSVAPPPAL--------KKPVILKDVGAAPKSSTV--  275

Query  348  apakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKS  527
                  + +  L+DKFA+KKPV DPL+++AVLAP KP+K P+        +FKD++RKK+
Sbjct  276  ------DDEANLIDKFATKKPVVDPLIAQAVLAPTKPSKGPASG------KFKDDYRKKN  323

Query  528  GASGGLRRRMVVDDDH---DEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPV  686
             ++GG RRRMV DD     +EASEL+VSI    +ARKGRKW+KASRKAARLQAAKEAAPV
Sbjct  324  ASAGGPRRRMVNDDIEIPDEEASELNVSIPGAASARKGRKWSKASRKAARLQAAKEAAPV  383

Query  687  KVEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            KVEILEV E  MLIE+LAYNL  SEGEIL   Y+KGIKPDGVQT
Sbjct  384  KVEILEVGEQVMLIEDLAYNLATSEGEILGLLYSKGIKPDGVQT  427



>ref|XP_009412025.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=1005

 Score =   147 bits (372),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 128/278 (46%), Positives = 157/278 (56%), Gaps = 43/278 (15%)
 Frame = +3

Query  21   PINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK------QELKTSSTEKTESqpaa  182
            P N+ + P++ S T KSVWRKGNPV +VQ  VK+ PK      +++   +  K       
Sbjct  185  PENATSSPRK-SKTLKSVWRKGNPVASVQRVVKELPKVREDRKKDIPIITETKISGAAQV  243

Query  183  plrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapaka  362
                PQ P    P LQA+P+  PP  P          AV   DV                
Sbjct  244  APLRPQMPLPARPKLQAKPAAVPPSTP----------AVKKSDVQK--------------  279

Query  363  kERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGG  542
             ER+PIL+DKFASKKPV DP+      A    A          PS+ KDE RKKS ++GG
Sbjct  280  -ERKPILIDKFASKKPVDDPI-----AAEAILATPLKPAKGPPPSKVKDERRKKSSSTGG  333

Query  543  LRRRMVVDDD--HDEASELDVSITA----RKGRKWTKASrkaarlqaakeaaPVKVEILE  704
            LRRRM  D +    EASELDV I      RKGRKW+KASRKAARLQAAK A PVKVEILE
Sbjct  334  LRRRMTNDGEISEQEASELDVPIPGVTEPRKGRKWSKASRKAARLQAAKAAEPVKVEILE  393

Query  705  VDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            V E+GML EELAYNL + E +IL++ ++KG+KP+ V  
Sbjct  394  VGEEGMLTEELAYNLAVGEADILAFLFSKGVKPETVHA  431



>ref|XP_002890212.1| hypothetical protein ARALYDRAFT_471925 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66471.1| hypothetical protein ARALYDRAFT_471925 [Arabidopsis lyrata subsp. 
lyrata]
Length=1027

 Score =   147 bits (371),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 139/286 (49%), Positives = 178/286 (62%), Gaps = 32/286 (11%)
 Frame = +3

Query  6    AKNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-------------QELKT  146
            ++NG   N+     + + T KSVWRKG+ V  VQ  VK+ PK             ++ + 
Sbjct  187  SRNGSYANASDGGTRKTKTMKSVWRKGDAVAAVQKVVKESPKIVNRGMQVEPRSKEDEEM  246

Query  147  SSTEKTESqpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaap  326
            ++   T+  P  P   PQPP + +PMLQ +P+VA PP          K++ ILKD+G A 
Sbjct  247  NAKAGTQLAPPQPPFRPQPPVRPQPMLQGKPTVAQPPV---------KKSPILKDLGMAA  297

Query  327  k--ppaatgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsR  500
            K        +  K+KER+PILVDKFASKK   DP+ S+AVLAP KP K P         +
Sbjct  298  KPLVSEEVDSSVKSKERKPILVDKFASKKKGVDPVASQAVLAPTKPGKGPPSN------K  351

Query  501  FKDEFRKKSGASGGLRRRMVVDDDHDEASELDVSITARKGRKWTKASrkaarlqaakeaa  680
            F+ E R K  AS   RRR+V +DD DE  +  +S + RKGRKW+KASRKA RLQAAK+AA
Sbjct  352  FRVEHRNKKNASASPRRRIVAEDDGDE--DTSISRSGRKGRKWSKASRKAVRLQAAKDAA  409

Query  681  PVKVEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            PVK EILEVDE+GM IE+LAYNL I EG+IL Y Y+KGI+PDGVQT
Sbjct  410  PVKAEILEVDEEGMSIEDLAYNLAIGEGDILGYLYSKGIRPDGVQT  455



>ref|XP_008787641.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
isoform X2 [Phoenix dactylifera]
Length=853

 Score =   146 bits (368),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 132/274 (48%), Positives = 168/274 (61%), Gaps = 26/274 (9%)
 Frame = +3

Query  18   KPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrpp  197
            +P+N+ + P + S T KSVWRKGNPV  VQ  VK+ P+ E +    +K  S      +P 
Sbjct  180  RPVNTTS-PTRKSKTLKSVWRKGNPVANVQKVVKEMPRVEKEKGQGQKGRSPVTEANKP-  237

Query  198  qppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQP  377
                      +A P+       P  P  V K  V       AP  P     PA  K+R+P
Sbjct  238  ----------EALPAAPLQNQMPSPPQVVPKLQVKPTVAPPAPPAPPVVKKPANLKDRKP  287

Query  378  ILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRM  557
            IL+D+FASKKP+ DP+ ++A+LAP KP K+P+        + K+E RKKS A+GGLRRR+
Sbjct  288  ILIDRFASKKPIVDPIAAEALLAPTKPVKAPAPS------KAKEERRKKSSAAGGLRRRL  341

Query  558  VVDDDH---DEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDED  716
            V DD     ++ASELDV I     ARKGRKW+KASRKAARL+AAK AAPVKVEILEV E+
Sbjct  342  V-DDAKIPVEDASELDVPIPGVTGARKGRKWSKASRKAARLEAAKAAAPVKVEILEVGEE  400

Query  717  GMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            GML E+LAY L +SE +I  Y Y+KGIK D V T
Sbjct  401  GMLTEDLAYKLAVSEADIFGYLYSKGIKSDTVHT  434



>ref|XP_009149169.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
[Brassica rapa]
Length=1025

 Score =   146 bits (368),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 148/259 (57%), Gaps = 17/259 (7%)
 Frame = +3

Query  60   TSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrppqppqKVEPMLQARP  239
            T KSVWRKG+ V  V+  VKQ PK E   S           P   PQP  +  PM+   P
Sbjct  206  TMKSVWRKGDAVAAVEKVVKQEPKIE---SRGPPQPPLRPQPPLRPQPQLQGRPMVA--P  260

Query  240  SvappppppvapppvvKRAVILKDVgaapk---ppaatgapakakERQPILVDKFASKKP  410
                 P              ILKDVG A K         +  K+KER+PILVDKFASKK 
Sbjct  261  PPVKKPILKDLGMSSKPSGPILKDVGMATKPPVSEEVVDSSNKSKERKPILVDKFASKKK  320

Query  411  VADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDDDHDE-AS  587
             ADP       A                S+F+ E R K  AS   RRRM   DD DE AS
Sbjct  321  SADP------AASQAVLAPTKPGKGPPSSKFRVEHRNKRNASANPRRRMAAQDDADEGAS  374

Query  588  ELDVSI--TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEELAYNLTISE  761
            EL+VSI  + RKGRKW+KASRKAARLQAA++AAPVK EILEV+E+GM IE+LAYNL I E
Sbjct  375  ELNVSIPGSGRKGRKWSKASRKAARLQAARDAAPVKAEILEVEEEGMSIEDLAYNLAIGE  434

Query  762  GEILSYFYTKGIKPDGVQT  818
            G+IL Y Y+KGI+PDGVQT
Sbjct  435  GDILGYLYSKGIRPDGVQT  453



>ref|XP_008787640.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
isoform X1 [Phoenix dactylifera]
Length=1008

 Score =   145 bits (367),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 128/274 (47%), Positives = 159/274 (58%), Gaps = 26/274 (9%)
 Frame = +3

Query  18   KPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrpp  197
            +P+N+ + P + S T KSVWRKGNPV  VQ  VK+ P+ E +    +K  S      +P 
Sbjct  180  RPVNTTS-PTRKSKTLKSVWRKGNPVANVQKVVKEMPRVEKEKGQGQKGRSPVTEANKP-  237

Query  198  qppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQP  377
                      +A P+       P  P  V K  V       AP  P     PA  K+R+P
Sbjct  238  ----------EALPAAPLQNQMPSPPQVVPKLQVKPTVAPPAPPAPPVVKKPANLKDRKP  287

Query  378  ILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRM  557
            IL+D+FASKKP+ DP+      A              APS+ K+E RKKS A+GGLRRR+
Sbjct  288  ILIDRFASKKPIVDPI------AAEALLAPTKPVKAPAPSKAKEERRKKSSAAGGLRRRL  341

Query  558  VVDDDH---DEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDED  716
            V DD     ++ASELDV I     ARKGRKW+KASRKAARL+AAK AAPVKVEILEV E+
Sbjct  342  V-DDAKIPVEDASELDVPIPGVTGARKGRKWSKASRKAARLEAAKAAAPVKVEILEVGEE  400

Query  717  GMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            GML E+LAY L +SE +I  Y Y+KGIK D V T
Sbjct  401  GMLTEDLAYKLAVSEADIFGYLYSKGIKSDTVHT  434



>ref|XP_010501498.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
[Camelina sativa]
Length=1079

 Score =   145 bits (365),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 140/280 (50%), Positives = 175/280 (63%), Gaps = 24/280 (9%)
 Frame = +3

Query  6    AKNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEK-------T  164
            ++NG   ++ A   + + T KSVWRKG+ V  VQ  VKQ PK E +T   E+       T
Sbjct  191  SRNGSYASAAA--TRKTKTMKSVWRKGDAVAAVQKVVKQSPKIEPRTKEDEEEVNAKAGT  248

Query  165  ESqpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapk--ppa  338
            +  P  P   PQPP + +PMLQ +P        P    P VK+  ILKD+G A K     
Sbjct  249  QLAPPQPPFRPQPPVRPQPMLQGKP-----MVAPSPVKPPVKKTPILKDLGMAAKPLVSE  303

Query  339  atgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFR  518
               +  K+KER+PILVDKFASKK   DP+ S+AVLAP KP K P         +F+ E R
Sbjct  304  EVDSSVKSKERKPILVDKFASKKKGVDPVASQAVLAPTKPGKGPPSN------KFRVEHR  357

Query  519  KKSGASGGLRRRMVVDDDHDEASELDVSITARKGRKWTKASrkaarlqaakeaaPVKVEI  698
             K  A    RRR+V +DD DE  +  +S + RKGRKW+KASRKA RLQAAK+AAPVK EI
Sbjct  358  NKKNAPASPRRRVVAEDDGDE--DTSISRSGRKGRKWSKASRKAVRLQAAKDAAPVKAEI  415

Query  699  LEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            LEV+E+GM IE+LAYNL I EG+IL Y Y+KGI+PDGVQT
Sbjct  416  LEVEEEGMSIEDLAYNLAIGEGDILGYLYSKGIRPDGVQT  455



>ref|XP_010537669.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
[Tarenaya hassleriana]
Length=1017

 Score =   144 bits (363),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 124/155 (80%), Gaps = 11/155 (7%)
 Frame = +3

Query  366  ERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGL  545
            ER+PIL+DKFASKKP  DPL+++ VLAP KP K P         +F+D++RKK+ AS G 
Sbjct  296  ERKPILIDKFASKKPAVDPLIAQTVLAPRKPGKGPPSG------KFRDDYRKKN-ASTGS  348

Query  546  RRRMVVDDD--HDEASELDVSI--TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDE  713
            RRRMV D+D   +E SEL+VSI   ARKGRKW+KASRKAARLQAAKEAAPV+ EILEV++
Sbjct  349  RRRMVNDEDIADEETSELNVSIPGAARKGRKWSKASRKAARLQAAKEAAPVRAEILEVED  408

Query  714  DGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
             GMLIE+LAYNL I EG+IL++ Y+KGI+PDGVQT
Sbjct  409  KGMLIEDLAYNLAIGEGDILAFLYSKGIRPDGVQT  443



>ref|XP_010480510.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
[Camelina sativa]
Length=997

 Score =   144 bits (363),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 139/280 (50%), Positives = 175/280 (63%), Gaps = 24/280 (9%)
 Frame = +3

Query  6    AKNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKT-------SSTEKT  164
            ++NG   ++ A   + + T KSVWRKG+ V  VQ  VKQ PK E +T       ++   T
Sbjct  194  SRNGSYASAAA--TKKTKTMKSVWRKGDAVAAVQKVVKQSPKIEPRTKEEEEEVNAKAGT  251

Query  165  ESqpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapk--ppa  338
            +  P  P   PQPP + +PMLQ +P        P    P VK+  ILKD+G A K     
Sbjct  252  QLAPPQPPFRPQPPLRPQPMLQGKP-----MVAPSPVKPPVKKTPILKDLGMAAKPLVSQ  306

Query  339  atgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFR  518
               +  K+KER+PILVDKFASKK   DP+ S+AVLAP KP K P         +F+ E R
Sbjct  307  EVDSSVKSKERKPILVDKFASKKKGVDPVASQAVLAPTKPGKGPPSN------KFRVEHR  360

Query  519  KKSGASGGLRRRMVVDDDHDEASELDVSITARKGRKWTKASrkaarlqaakeaaPVKVEI  698
             K  A    RRR+V +DD DE  +  +S + RKGRKW+KASRKA RLQAAK+AAPVK EI
Sbjct  361  NKKNAPASPRRRVVAEDDGDE--DTSISRSGRKGRKWSKASRKAVRLQAAKDAAPVKAEI  418

Query  699  LEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            LEV+E+GM IE+LAYNL I EG+IL Y Y+KGI+PDGVQT
Sbjct  419  LEVEEEGMSIEDLAYNLAIGEGDILGYLYSKGIRPDGVQT  458



>ref|XP_010459294.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Camelina sativa]
Length=1028

 Score =   142 bits (359),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 137/280 (49%), Positives = 175/280 (63%), Gaps = 24/280 (9%)
 Frame = +3

Query  6    AKNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKT-------SSTEKT  164
            ++NG   ++ A   + + T KSVWRKG+ V  VQ  VKQ PK E +T       ++   T
Sbjct  192  SRNGSYASAAA--TKKTKTMKSVWRKGDAVAAVQKVVKQSPKIEPRTKEEEEEVNAKAGT  249

Query  165  ESqpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaapk--ppa  338
            +  P  P   PQPP + +PMLQ +P        P    P VK+  ILKD+G A K     
Sbjct  250  QLAPPQPPSRPQPPVRPQPMLQGKP-----MVAPSPVKPPVKKTPILKDLGMAAKPLVSQ  304

Query  339  atgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFR  518
               +  K+KER+PILVDKFAS+K   DP+ S+AVLAP KP K P         +F+ E R
Sbjct  305  EVDSSVKSKERKPILVDKFASEKKGVDPVASQAVLAPTKPGKGPPSN------KFRVEHR  358

Query  519  KKSGASGGLRRRMVVDDDHDEASELDVSITARKGRKWTKASrkaarlqaakeaaPVKVEI  698
             K  A    RRR+V +DD DE  +  +S + RKGRKW+KASRKA R+QAAK+AAPVK EI
Sbjct  359  NKKNAPASPRRRVVAEDDGDE--DTSISRSGRKGRKWSKASRKAVRIQAAKDAAPVKAEI  416

Query  699  LEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            LEV+E+GM IE+LAYNL I EG+IL Y Y+KGI+PDGVQT
Sbjct  417  LEVEEEGMSIEDLAYNLAIGEGDILGYLYSKGIRPDGVQT  456



>ref|XP_010921939.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
isoform X3 [Elaeis guineensis]
Length=852

 Score =   142 bits (357),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 160/265 (60%), Gaps = 23/265 (9%)
 Frame = +3

Query  42   PQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrppqppqKVEP  221
            P + S  SKS+WRKGNPV  VQ  VK+ P+ E +    +K  S      +P      + P
Sbjct  186  PTRKSKMSKSIWRKGNPVANVQKVVKEIPRIEREKGQEQKGRSPVTEANKPEAL--PLAP  243

Query  222  MLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDKFAS  401
            +    PS +   P         K  V      +AP  P     PA  K+R+P+L+D+FAS
Sbjct  244  LQNQMPSPSQVIP---------KLQVKPSVAPSAPPAPPVAKKPANLKDRKPVLIDRFAS  294

Query  402  KKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDDD--H  575
            KKPV DP+ ++A+L P KP K P+        + K+E RKKS A+GG+RRR+V D D   
Sbjct  295  KKPVVDPIAAEALLVPTKPVKGPAPS------KAKEERRKKSSAAGGVRRRLVDDADIPD  348

Query  576  DEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEELAY  743
            ++ASELD  I     ARKGRKW+KASRKAARL+AAK AAPVKVEILEV E+GM   +LAY
Sbjct  349  EDASELDAPIPGVTGARKGRKWSKASRKAARLEAAKAAAPVKVEILEVGEEGMFTGDLAY  408

Query  744  NLTISEGEILSYFYTKGIKPDGVQT  818
             L +SE +IL Y Y+KGIKPD V T
Sbjct  409  KLAVSEADILGYLYSKGIKPDTVHT  433



>ref|XP_010921938.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=957

 Score =   142 bits (357),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 160/265 (60%), Gaps = 23/265 (9%)
 Frame = +3

Query  42   PQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrppqppqKVEP  221
            P + S  SKS+WRKGNPV  VQ  VK+ P+ E +    +K  S      +P      + P
Sbjct  186  PTRKSKMSKSIWRKGNPVANVQKVVKEIPRIEREKGQEQKGRSPVTEANKPEAL--PLAP  243

Query  222  MLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDKFAS  401
            +    PS +   P         K  V      +AP  P     PA  K+R+P+L+D+FAS
Sbjct  244  LQNQMPSPSQVIP---------KLQVKPSVAPSAPPAPPVAKKPANLKDRKPVLIDRFAS  294

Query  402  KKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDDD--H  575
            KKPV DP+ ++A+L P KP K P+        + K+E RKKS A+GG+RRR+V D D   
Sbjct  295  KKPVVDPIAAEALLVPTKPVKGPAPS------KAKEERRKKSSAAGGVRRRLVDDADIPD  348

Query  576  DEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEELAY  743
            ++ASELD  I     ARKGRKW+KASRKAARL+AAK AAPVKVEILEV E+GM   +LAY
Sbjct  349  EDASELDAPIPGVTGARKGRKWSKASRKAARLEAAKAAAPVKVEILEVGEEGMFTGDLAY  408

Query  744  NLTISEGEILSYFYTKGIKPDGVQT  818
             L +SE +IL Y Y+KGIKPD V T
Sbjct  409  KLAVSEADILGYLYSKGIKPDTVHT  433



>ref|XP_010921937.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=1007

 Score =   141 bits (356),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 153/265 (58%), Gaps = 23/265 (9%)
 Frame = +3

Query  42   PQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrppqppqKVEP  221
            P + S  SKS+WRKGNPV  VQ  VK+ P+ E +    +K  S      +P      + P
Sbjct  186  PTRKSKMSKSIWRKGNPVANVQKVVKEIPRIEREKGQEQKGRSPVTEANKPEAL--PLAP  243

Query  222  MLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDKFAS  401
            +    PS +   P         K  V      +AP  P     PA  K+R+P+L+D+FAS
Sbjct  244  LQNQMPSPSQVIP---------KLQVKPSVAPSAPPAPPVAKKPANLKDRKPVLIDRFAS  294

Query  402  KKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDDD--H  575
            KKPV DP+      A              APS+ K+E RKKS A+GG+RRR+V D D   
Sbjct  295  KKPVVDPI------AAEALLVPTKPVKGPAPSKAKEERRKKSSAAGGVRRRLVDDADIPD  348

Query  576  DEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEELAY  743
            ++ASELD  I     ARKGRKW+KASRKAARL+AAK AAPVKVEILEV E+GM   +LAY
Sbjct  349  EDASELDAPIPGVTGARKGRKWSKASRKAARLEAAKAAAPVKVEILEVGEEGMFTGDLAY  408

Query  744  NLTISEGEILSYFYTKGIKPDGVQT  818
             L +SE +IL Y Y+KGIKPD V T
Sbjct  409  KLAVSEADILGYLYSKGIKPDTVHT  433



>ref|NP_173165.1| translation initiation factor IF-2 [Arabidopsis thaliana]
 sp|Q9SHI1.2|IF2C_ARATH RecName: Full=Translation initiation factor IF-2, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AEE29560.1| translation initiation factor IF-2 [Arabidopsis thaliana]
Length=1026

 Score =   141 bits (355),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 126/286 (44%), Positives = 163/286 (57%), Gaps = 33/286 (12%)
 Frame = +3

Query  6    AKNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-------------QELKT  146
            ++NG   N+     + + T KSVWRKG+ V  VQ  VK+ PK             +E + 
Sbjct  187  SRNGSYANASDGGTRKTKTMKSVWRKGDAVAAVQKVVKESPKIFNRGVQTEPRTREEGEV  246

Query  147  SSTEKTESqpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaap  326
            ++   T   P  P   PQPP + +PMLQ +P             P VK++ ILKD+G A 
Sbjct  247  NAKAGTPLAPPQPPFRPQPPVRPQPMLQGKP----------MVAPPVKKSPILKDLGMAA  296

Query  327  k--ppaatgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsR  500
            K        +  K+KER+PILVDKFASKK   DP       A                ++
Sbjct  297  KPLVSEEVDSSVKSKERKPILVDKFASKKKGVDP------AASQAVLAPTKPGKGPPSNK  350

Query  501  FKDEFRKKSGASGGLRRRMVVDDDHDEASELDVSITARKGRKWTKASrkaarlqaakeaa  680
            F+ E R K  AS   RRR+V +DD D+  +  +S + RKGRKW+KASRKA RLQAAK+AA
Sbjct  351  FRVEHRNKKNASASPRRRIVAEDDGDD--DASISRSGRKGRKWSKASRKAVRLQAAKDAA  408

Query  681  PVKVEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            PVK EILEV+E+GM IE+LAYNL I EG+IL Y Y+KGI+PDGV T
Sbjct  409  PVKAEILEVEEEGMSIEDLAYNLAIGEGDILGYLYSKGIRPDGVHT  454



>gb|AAK32930.1|AF367343_1 At1g17220/F20D23_8 [Arabidopsis thaliana]
 gb|AAN46761.1| At1g17220/F20D23_8 [Arabidopsis thaliana]
Length=1026

 Score =   141 bits (355),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 126/286 (44%), Positives = 163/286 (57%), Gaps = 33/286 (12%)
 Frame = +3

Query  6    AKNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-------------QELKT  146
            ++NG   N+     + + T KSVWRKG+ V  VQ  VK+ PK             +E + 
Sbjct  187  SRNGSYANASDGGTRKTKTMKSVWRKGDAVAAVQKVVKESPKIFNRGVQTEPRTREEGEV  246

Query  147  SSTEKTESqpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaap  326
            ++   T   P  P   PQPP + +PMLQ +P             P VK++ ILKD+G A 
Sbjct  247  NAKAGTPLAPPQPPFRPQPPVRPQPMLQGKP----------MVAPPVKKSPILKDLGMAA  296

Query  327  k--ppaatgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsR  500
            K        +  K+KER+PILVDKFASKK   DP       A                ++
Sbjct  297  KPLVSEEVDSSVKSKERKPILVDKFASKKKGVDP------AASQAVLAPTKPGKGPPSNK  350

Query  501  FKDEFRKKSGASGGLRRRMVVDDDHDEASELDVSITARKGRKWTKASrkaarlqaakeaa  680
            F+ E R K  AS   RRR+V +DD D+  +  +S + RKGRKW+KASRKA RLQAAK+AA
Sbjct  351  FRVEHRNKKNASASPRRRIVAEDDGDD--DASISRSGRKGRKWSKASRKAVRLQAAKDAA  408

Query  681  PVKVEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            PVK EILEV+E+GM IE+LAYNL I EG+IL Y Y+KGI+PDGV T
Sbjct  409  PVKAEILEVEEEGMSIEDLAYNLAIGEGDILGYLYSKGIRPDGVHT  454



>gb|AAD50011.1|AC007651_6 Similar to translation initiation factor IF2 [Arabidopsis thaliana]
Length=1016

 Score =   141 bits (355),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 126/286 (44%), Positives = 163/286 (57%), Gaps = 33/286 (12%)
 Frame = +3

Query  6    AKNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-------------QELKT  146
            ++NG   N+     + + T KSVWRKG+ V  VQ  VK+ PK             +E + 
Sbjct  177  SRNGSYANASDGGTRKTKTMKSVWRKGDAVAAVQKVVKESPKIFNRGVQTEPRTREEGEV  236

Query  147  SSTEKTESqpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaap  326
            ++   T   P  P   PQPP + +PMLQ +P             P VK++ ILKD+G A 
Sbjct  237  NAKAGTPLAPPQPPFRPQPPVRPQPMLQGKP----------MVAPPVKKSPILKDLGMAA  286

Query  327  k--ppaatgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsR  500
            K        +  K+KER+PILVDKFASKK   DP       A                ++
Sbjct  287  KPLVSEEVDSSVKSKERKPILVDKFASKKKGVDP------AASQAVLAPTKPGKGPPSNK  340

Query  501  FKDEFRKKSGASGGLRRRMVVDDDHDEASELDVSITARKGRKWTKASrkaarlqaakeaa  680
            F+ E R K  AS   RRR+V +DD D+  +  +S + RKGRKW+KASRKA RLQAAK+AA
Sbjct  341  FRVEHRNKKNASASPRRRIVAEDDGDD--DASISRSGRKGRKWSKASRKAVRLQAAKDAA  398

Query  681  PVKVEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            PVK EILEV+E+GM IE+LAYNL I EG+IL Y Y+KGI+PDGV T
Sbjct  399  PVKAEILEVEEEGMSIEDLAYNLAIGEGDILGYLYSKGIRPDGVHT  444



>ref|XP_006306659.1| hypothetical protein CARUB_v10008177mg [Capsella rubella]
 gb|EOA39557.1| hypothetical protein CARUB_v10008177mg [Capsella rubella]
Length=1023

 Score =   139 bits (350),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 137/286 (48%), Positives = 176/286 (62%), Gaps = 34/286 (12%)
 Frame = +3

Query  6    AKNGKPINSMAIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPK-------------QELKT  146
            +KNG   ++ A   + + T KSVWRKG+ V  VQ  VK+ PK             +E + 
Sbjct  185  SKNGSYASAGA--TRKTKTMKSVWRKGDAVSAVQKVVKESPKIDNRGMQVEPRTKEEEEA  242

Query  147  SSTEKTESqpaaplrppqppqKVEPMLQARPSvappppppvapppvvKRAVILKDVgaap  326
            ++    +  P  P   PQPP + +PMLQ +P         +   P VK++ ILKD+G AP
Sbjct  243  NAKAGAQLAPPQPPFRPQPPVRPQPMLQGKP---------MVAQPPVKKSPILKDLGMAP  293

Query  327  k--ppaatgapakakERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsR  500
            K        +  K+KER+PILVDKFASKK   D + S+AVLAP KP K P         +
Sbjct  294  KPPVSQEVDSSIKSKERKPILVDKFASKKKAVDAVASQAVLAPTKPGKGPPSN------K  347

Query  501  FKDEFRKKSGASGGLRRRMVVDDDHDEASELDVSITARKGRKWTKASrkaarlqaakeaa  680
            F+ E R K  AS   RRR+V +DD DE  +  +S + RKGRKW+KASRKA RLQAAK+AA
Sbjct  348  FRVEHRNKKNASASPRRRIVAEDDGDE--DTSISRSGRKGRKWSKASRKAVRLQAAKDAA  405

Query  681  PVKVEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            PVK EILEV+E+GM IE+LAYNL I EG+IL Y Y+KGI+PDGVQT
Sbjct  406  PVKAEILEVEEEGMSIEDLAYNLAIGEGDILGYLYSKGIRPDGVQT  451



>gb|KFK43916.1| hypothetical protein AALP_AA1G191000 [Arabis alpina]
Length=1050

 Score =   138 bits (348),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 117/154 (76%), Gaps = 9/154 (6%)
 Frame = +3

Query  366  ERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGL  545
            ER+PILVDKFASKK  ADP+ S+ VLAP KP K P         +F+ E R K  AS   
Sbjct  331  ERKPILVDKFASKKKGADPVASQTVLAPTKPGKGPPSN------KFRVEHRNKKNASASP  384

Query  546  RRRMVVDDDHDE-ASELDVSI--TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDED  716
            RRR+V DDD DE  SEL+V+I  + RKGRKW+KASRKAARLQAAK+AAPVK EILEV+E+
Sbjct  385  RRRIVADDDGDEDTSELNVNIPGSGRKGRKWSKASRKAARLQAAKDAAPVKAEILEVEEE  444

Query  717  GMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            GM IE+LAYNL I EG+IL Y Y+KGI+PDGVQT
Sbjct  445  GMSIEDLAYNLAIGEGDILGYLYSKGIRPDGVQT  478



>ref|XP_010941522.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
[Elaeis guineensis]
Length=1009

 Score =   138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 124/274 (45%), Positives = 155/274 (57%), Gaps = 45/274 (16%)
 Frame = +3

Query  48   QNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEK-----TESqpaaplrppqppqK  212
            + S T KSVWRKG+PV  VQ  VK+ P+ E +    +K     TE++ +  L       +
Sbjct  190  RKSKTLKSVWRKGSPVANVQKVVKELPRVEKEERKEQKGPSLVTEAKKSGALPVAPLRPQ  249

Query  213  VE------PMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQ  374
            V       P LQ +P+VAPP PP        K+   +KD                   R+
Sbjct  250  VPSPPQAVPKLQVKPAVAPPTPPESPVV---KKPANIKD-------------------RK  287

Query  375  PILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRR  554
            PIL+DKFASKK V DP+      A                S+ K++ RKKS A+GGLRRR
Sbjct  288  PILIDKFASKKVVVDPI------AAEALLSPAKPVKGPLSSKAKEDRRKKSSAAGGLRRR  341

Query  555  MVVDDD--HDEASELDVSITA----RKGRKWTKASrkaarlqaakeaaPVKVEILEVDED  716
            +V D     ++ASELDV I      RKGRKW KASRKAARL+AAK AAPVKVEILEV E+
Sbjct  342  LVDDGGIPDEDASELDVPIAGVTEVRKGRKWRKASRKAARLEAAKAAAPVKVEILEVGEE  401

Query  717  GMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            GML E+LAYNL +SE +IL Y Y+KG+KPD V T
Sbjct  402  GMLTEDLAYNLAVSEADILGYLYSKGVKPDTVHT  435



>ref|XP_008775702.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
isoform X2 [Phoenix dactylifera]
Length=851

 Score =   135 bits (341),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 118/279 (42%), Positives = 155/279 (56%), Gaps = 38/279 (14%)
 Frame = +3

Query  18   KPINSMAIPQQNSSTSKSVWRKGNPV---PTVQNAVKQPPKQELKTSSTEKTESqpaapl  188
            +P+N+ A   + S T K VWRKGNPV   P VQ  ++   ++  +   +  TE++ +  L
Sbjct  180  RPVNTTA-QTRKSKTLKRVWRKGNPVADVPKVQELLRVEKEKGKEKGPSPVTEAKKSEAL  238

Query  189  rppqppqKVEPMLQARP---SvappppppvapppvvKRAVILKDVgaapkppaatgapak  359
                   +V    QA P   +     PP       VK+   +KD                
Sbjct  239  PAAPLRPQVSSPSQAVPKLQAKPAVVPPTPPVSSEVKKPANMKD----------------  282

Query  360  akERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASG  539
               R+PIL+DKF+SKKPV DP+                      PS+ K+E RKKS A+G
Sbjct  283  ---RKPILIDKFSSKKPVVDPI------PAEALLAPTKPVKGPPPSKAKEERRKKSSAAG  333

Query  540  GLRRRMVVDDD--HDEASELDVSITA----RKGRKWTKASrkaarlqaakeaaPVKVEIL  701
            GLRRR+V D +   ++ASELD+ I      RKGRKW KASRKAARL+AAK AAPVKVEIL
Sbjct  334  GLRRRLVDDGEIPDEDASELDLPIAGVTEVRKGRKWRKASRKAARLEAAKAAAPVKVEIL  393

Query  702  EVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            EV E+GML E+LAYNL +SE +IL Y Y++G+KPD V T
Sbjct  394  EVGEEGMLTEDLAYNLAVSEADILGYLYSRGVKPDTVHT  432



>ref|XP_008775701.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
isoform X1 [Phoenix dactylifera]
Length=1006

 Score =   135 bits (340),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 118/279 (42%), Positives = 155/279 (56%), Gaps = 38/279 (14%)
 Frame = +3

Query  18   KPINSMAIPQQNSSTSKSVWRKGNPV---PTVQNAVKQPPKQELKTSSTEKTESqpaapl  188
            +P+N+ A   + S T K VWRKGNPV   P VQ  ++   ++  +   +  TE++ +  L
Sbjct  180  RPVNTTA-QTRKSKTLKRVWRKGNPVADVPKVQELLRVEKEKGKEKGPSPVTEAKKSEAL  238

Query  189  rppqppqKVEPMLQARP---SvappppppvapppvvKRAVILKDVgaapkppaatgapak  359
                   +V    QA P   +     PP       VK+   +KD                
Sbjct  239  PAAPLRPQVSSPSQAVPKLQAKPAVVPPTPPVSSEVKKPANMKD----------------  282

Query  360  akERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASG  539
               R+PIL+DKF+SKKPV DP+                      PS+ K+E RKKS A+G
Sbjct  283  ---RKPILIDKFSSKKPVVDPI------PAEALLAPTKPVKGPPPSKAKEERRKKSSAAG  333

Query  540  GLRRRMVVDDD--HDEASELDVSITA----RKGRKWTKASrkaarlqaakeaaPVKVEIL  701
            GLRRR+V D +   ++ASELD+ I      RKGRKW KASRKAARL+AAK AAPVKVEIL
Sbjct  334  GLRRRLVDDGEIPDEDASELDLPIAGVTEVRKGRKWRKASRKAARLEAAKAAAPVKVEIL  393

Query  702  EVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            EV E+GML E+LAYNL +SE +IL Y Y++G+KPD V T
Sbjct  394  EVGEEGMLTEDLAYNLAVSEADILGYLYSRGVKPDTVHT  432



>emb|CDY48480.1| BnaC05g13400D [Brassica napus]
Length=963

 Score =   132 bits (332),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 114/256 (45%), Positives = 138/256 (54%), Gaps = 42/256 (16%)
 Frame = +3

Query  60   TSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrppqppqKVEPMLQARP  239
            T KSVWRKG+ V  V+  VK+ PK + +                      + +P LQ RP
Sbjct  175  TMKSVWRKGDAVAAVEKVVKEEPKIDSRGPPLRPQPPL------------RAQPQLQGRP  222

Query  240  SvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDKFASKKPVAD  419
                                 +      P       +  K+KER+PILVDKFASKK  AD
Sbjct  223  ---------------------MVAPPPPPASEEVVDSSNKSKERKPILVDKFASKKKSAD  261

Query  420  PLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDDDHDEA-SELD  596
            P       A                S+F+ E R K  AS   RRRM   DD DE  SEL+
Sbjct  262  P------AASQAVLAPTKPGKGPPSSKFRVEHRNKRNASANPRRRMAAQDDADEDASELN  315

Query  597  VSI--TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEELAYNLTISEGEI  770
            VSI  + RKGRKW+KASRKAARLQAA++AAPVK EILEV+E+GM IE+LAYNL I EG+I
Sbjct  316  VSIPGSGRKGRKWSKASRKAARLQAARDAAPVKAEILEVEEEGMSIEDLAYNLAIGEGDI  375

Query  771  LSYFYTKGIKPDGVQT  818
            L Y Y+KGI+PDGVQT
Sbjct  376  LGYLYSKGIRPDGVQT  391



>emb|CBI21817.3| unnamed protein product [Vitis vinifera]
Length=905

 Score =   132 bits (332),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 137/264 (52%), Gaps = 94/264 (36%)
 Frame = +3

Query  54   SSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSS-----TEKTESqpaaplrppqppqKVE  218
            S T KSVWRKGNPV TV+  VK        T         K E+QP  PLRP QPP + +
Sbjct  153  SKTLKSVWRKGNPVATVEKVVKDASNNITNTEREGPEVGRKVETQPRIPLRPTQPPLRAQ  212

Query  219  PMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDKFA  398
            P LQA+PS                                          R+PIL+DKFA
Sbjct  213  PKLQAKPS------------------------------------------RKPILIDKFA  230

Query  399  SKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDDDHD  578
            SK+PV DP++++A+                                             D
Sbjct  231  SKRPVVDPMIAQAIP-------------------------------------------DD  247

Query  579  EASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEELAYN  746
            E SEL+VSI    TARKGRKW+KASRKAARLQAAK+AAPVKVEILEV E+GML E+LAYN
Sbjct  248  ETSELNVSIPGAATARKGRKWSKASRKAARLQAAKDAAPVKVEILEVGEEGMLTEDLAYN  307

Query  747  LTISEGEILSYFYTKGIKPDGVQT  818
            L ISEGEIL + Y+KGIKPDGVQT
Sbjct  308  LAISEGEILGFLYSKGIKPDGVQT  331



>ref|XP_006416727.1| hypothetical protein EUTSA_v10006681mg [Eutrema salsugineum]
 gb|ESQ35080.1| hypothetical protein EUTSA_v10006681mg [Eutrema salsugineum]
Length=998

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 113/151 (75%), Gaps = 7/151 (5%)
 Frame = +3

Query  366  ERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGL  545
            ER+PILVDKFASKK   DP+ S+AVLAP KP K P         +F+ E R K  AS   
Sbjct  318  ERKPILVDKFASKKKSVDPVASQAVLAPTKPGKGPPSN------KFRVEHRNKKNASASP  371

Query  546  RRRMVVDDDHDEASELDVSITARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGML  725
            RRR+V +DD DE +   +  +ARKGRKW+KASRKAARLQAAK+AAPVK EILEV+E+GM 
Sbjct  372  RRRIVAEDDGDEDT-FSIPGSARKGRKWSKASRKAARLQAAKDAAPVKAEILEVEEEGMS  430

Query  726  IEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            IE+LAYNL I EG+IL Y Y+KGI+PDGVQT
Sbjct  431  IEDLAYNLAIGEGDILGYLYSKGIRPDGVQT  461



>ref|XP_006836345.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Amborella trichopoda]
 gb|ERM99198.1| hypothetical protein AMTR_s00092p00096920 [Amborella trichopoda]
Length=1070

 Score =   131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 130/176 (74%), Gaps = 11/176 (6%)
 Frame = +3

Query  288  KRAVILKDVgaapkppaatgapakakERQPILVDKFASKKPVADPLVskavlappkpaks  467
            ++ VILKDVGAA KP  +  +   ++ER+PIL+DKFASKK + DPL+++A+LAPPKPAK 
Sbjct  321  RKPVILKDVGAASKPTVSEESEDASRERKPILIDKFASKKAMTDPLLAQAILAPPKPAKG  380

Query  468  pskpgksapsRFKDEFRKKSGASGGLRRRMVVDDDH-----DEASELDVSITARKGRKWT  632
             +        + KDE RKK+G S G +RRM ++ D      DE +EL+V+I  RKGRKW+
Sbjct  381  GALS------KAKDERRKKAGPSLGPKRRMALEGDDEETQDDENTELNVNIPGRKGRKWS  434

Query  633  KASrkaarlqaakeaaPVKVEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIK  800
            KA RKAARL+AAK AAPVKVEILEV EDGM  E+LAYNL +SE EIL Y ++KGIK
Sbjct  435  KARRKAARLEAAKAAAPVKVEILEVGEDGMFTEDLAYNLAVSEAEILGYLFSKGIK  490



>ref|XP_009110419.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Brassica rapa]
Length=1021

 Score =   130 bits (327),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 122/266 (46%), Positives = 155/266 (58%), Gaps = 18/266 (7%)
 Frame = +3

Query  48   QNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrppqppqKVEPML  227
            + + T KSVWRKG+ V  VQ  VK+ PK + K     + +++    L PPQ P + +P L
Sbjct  191  RKTKTMKSVWRKGDAVAAVQKVVKESPKIDNKGM---QVDAKSGTQLSPPQQPLRAQPQL  247

Query  228  QARPSvap----pppppvapppvvKRAVILKDVgaap--kppaatgapakakERQPILVD  389
            Q +P VA      P              ILKDVG A          + +++KER+PILVD
Sbjct  248  QGKPMVAQPPVKKPILKDHGMATRPSGPILKDVGMASKPSVSEEVDSSSQSKERKPILVD  307

Query  390  KFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRM-VVD  566
            KFASKK   DP+                       ++ + E R K  AS   RRRM   D
Sbjct  308  KFASKKKGVDPVA------SQTVLAPTKPGKGPPSNKLRFEQRNKKNASANPRRRMAAED  361

Query  567  DDHDEASELDVSI--TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEELA  740
            D  ++ASEL+VSI    RKGRKW+KASRKA RLQAA++AAPVK EILEV+E+GM IE+LA
Sbjct  362  DADEDASELNVSIPGKGRKGRKWSKASRKAVRLQAARDAAPVKAEILEVEEEGMSIEDLA  421

Query  741  YNLTISEGEILSYFYTKGIKPDGVQT  818
            YNL I EG+IL Y Y+KGI+PDGVQT
Sbjct  422  YNLAIGEGDILGYLYSKGIRPDGVQT  447



>emb|CDX83919.1| BnaC08g17260D [Brassica napus]
Length=966

 Score =   126 bits (317),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 125/258 (48%), Positives = 150/258 (58%), Gaps = 47/258 (18%)
 Frame = +3

Query  60   TSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrppqppqKVEPMLQARP  239
            T KSVWRKG+ V  VQ  VK+ PK + K    +                 K    L + P
Sbjct  177  TMKSVWRKGDAVAAVQKVVKESPKIDNKGMQGD----------------AKSGTQLPSGP  220

Query  240  SvappppppvapppvvKRAVILKDVgaapk--ppaatgapakakERQPILVDKFASKKPV  413
                                ILKDVG A K        + +++KER+PILVDKFASKK  
Sbjct  221  --------------------ILKDVGMASKPSVSEEVDSSSQSKERKPILVDKFASKKKG  260

Query  414  ADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDDDHDEA-SE  590
             DP+ S+ VLAP KP K P         +F+ E R K  AS   RRRM  +DD DE  SE
Sbjct  261  VDPVASQTVLAPTKPGKGPPSN------KFRVEQRNKKNASANPRRRMAAEDDADEDASE  314

Query  591  LDVSI--TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEELAYNLTISEG  764
            L+VSI    RKGRKW+KASRKA RLQAA++AAPVK EILEV+E+GM IE+LAYNL I EG
Sbjct  315  LNVSIPGKGRKGRKWSKASRKAVRLQAARDAAPVKAEILEVEEEGMSIEDLAYNLAIGEG  374

Query  765  EILSYFYTKGIKPDGVQT  818
            +IL Y Y+KGI+PDGVQT
Sbjct  375  DILGYLYSKGIRPDGVQT  392



>dbj|BAH20402.1| AT1G17220 [Arabidopsis thaliana]
Length=796

 Score =   126 bits (316),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 101/151 (67%), Gaps = 8/151 (5%)
 Frame = +3

Query  366  ERQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGL  545
            ER+PILVDKFASKK   DP       A                ++F+ E R K  AS   
Sbjct  82   ERKPILVDKFASKKKGVDP------AASQAVLAPTKPGKGPPSNKFRVEHRNKKNASASP  135

Query  546  RRRMVVDDDHDEASELDVSITARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGML  725
            RRR+V +DD D+  +  +S + RKGRKW+KASRKA RLQAAK+AAPVK EILEV+E+GM 
Sbjct  136  RRRIVAEDDGDD--DASISRSGRKGRKWSKASRKAVRLQAAKDAAPVKAEILEVEEEGMS  193

Query  726  IEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            IE+LAYNL I EG+IL Y Y+KGI+PDGV T
Sbjct  194  IEDLAYNLAIGEGDILGYLYSKGIRPDGVHT  224



>emb|CDX96781.1| BnaA08g23240D [Brassica napus]
Length=986

 Score =   125 bits (313),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 125/267 (47%), Positives = 153/267 (57%), Gaps = 54/267 (20%)
 Frame = +3

Query  48   QNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrppqppqKVEPML  227
            + + T KSVWRKG+ V  VQ  VK+ PK + K                        +P+L
Sbjct  190  RKTKTMKSVWRKGDAVAAVQKVVKESPKIDNKGMQ---------------------KPIL  228

Query  228  Q-----ARPSvappppppvapppvvKRAVILKDVgaapk--ppaatgapakakERQPILV  386
            +      RPS                   ILKDVG A K        + +++KER+PILV
Sbjct  229  KDHGMATRPSGP-----------------ILKDVGMASKPSVSEEVDSSSQSKERKPILV  271

Query  387  DKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVD  566
            DKFASKK   DP+ S+ VLAP KP K P         + + E R K  AS   RRRM  +
Sbjct  272  DKFASKKKGVDPVASQTVLAPTKPGKGPPSN------KLRFEQRNKKNASANPRRRMAAE  325

Query  567  DDHDEA-SELDVSI--TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEEL  737
            DD DE  SEL+VSI    RKGRKW+KASRKA RLQAA++ APVK EILEV+E+GM IE+L
Sbjct  326  DDADEDASELNVSIPGKGRKGRKWSKASRKAVRLQAARDTAPVKAEILEVEEEGMSIEDL  385

Query  738  AYNLTISEGEILSYFYTKGIKPDGVQT  818
            AYNL I EG+IL Y Y+KGI+PDGVQT
Sbjct  386  AYNLAIGEGDILGYLYSKGIRPDGVQT  412



>ref|XP_008649567.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Zea mays]
 ref|XP_008649568.1| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Zea mays]
Length=969

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 99/258 (38%), Positives = 137/258 (53%), Gaps = 42/258 (16%)
 Frame = +3

Query  54   SSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrppqppqKVEPMLQA  233
            + T KSVWRKGNPVPTV+  +++ P+ E ++ S    +   ++         K  P+L +
Sbjct  177  TKTLKSVWRKGNPVPTVRKVIREQPRTETRSQSIPVAKPSVSSAS-------KPSPLLLS  229

Query  234  RPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDKFASKKPV  413
            +PSVA P            R  I  D                  ++ PIL+DKFASK+  
Sbjct  230  KPSVAQP-----------PRRPIKSDTSNE--------------KKGPILIDKFASKRAA  264

Query  414  ADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDDDHDEASEL  593
             DP+V + +L P KP + P         + + + RKK     G RRRM  DD   +    
Sbjct  265  VDPIVPEELLDPLKPVRGPPA-------KVRVDRRKKPDTQAGSRRRMSNDDGLVDEDTT  317

Query  594  DVSITA---RKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEELAYNLTISEG  764
            DV I+    RKGR+W+KA R+AARL+A +   PV+VEILEV E+GMLIE+LAY L I E 
Sbjct  318  DVPISGVPVRKGRRWSKAKRRAARLEAMQAEEPVRVEILEVGEEGMLIEDLAYELAIGES  377

Query  765  EILSYFYTKGIKPDGVQT  818
            EIL +   +G+  D VQT
Sbjct  378  EILRFLSVRGVMLDNVQT  395



>gb|EMT18648.1| Translation initiation factor IF-2, chloroplastic [Aegilops tauschii]
Length=686

 Score =   111 bits (278),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 102/257 (40%), Positives = 137/257 (53%), Gaps = 44/257 (17%)
 Frame = +3

Query  48   QNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrppqppqKVEPML  227
            + + T KSVWRKGNPVPTV   ++  P+ E +  S    +   ++P        K+ P L
Sbjct  177  KRTKTLKSVWRKGNPVPTVHKVIRDRPRTETRDQSISAAKPSVSSPS-------KLAPHL  229

Query  228  QARPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDKFASKK  407
            Q RPSVAPPP          +R V                A    +++ PIL+DKFASK+
Sbjct  230  QTRPSVAPPP----------RRPV---------------KADTSKEKKGPILIDKFASKR  264

Query  408  PVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDDDHDEAS  587
            P+ DP V++A++ P KP + P         + KD   KK     G RRRM  DD      
Sbjct  265  PMVDPAVAEALVDPVKPVRGPPA-------KAKDNRHKKFITPAGPRRRMSNDD-----R  312

Query  588  ELDVSITARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEELAYNLTISEGE  767
             +D     RKGR+W+KA R+AARL+A +   PV+VEILEV E+GM I+ELAY L + E E
Sbjct  313  SVDDDAPVRKGRRWSKAKRRAARLEALEAEEPVRVEILEVGEEGMDIDELAYQLAVGESE  372

Query  768  ILSYFYTKGIKPDGVQT  818
            IL +   +G   D VQT
Sbjct  373  ILHFLSVRGAMLDNVQT  389



>gb|EYU38218.1| hypothetical protein MIMGU_mgv1a001521mg [Erythranthe guttata]
Length=803

 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 110/161 (68%), Gaps = 18/161 (11%)
 Frame = +3

Query  369  RQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGAS----  536
            R+PIL+DKFASKKP+ DPL+++AVLAP KP             + K+++RKKS A     
Sbjct  76   RKPILIDKFASKKPLVDPLIAQAVLAPRKPGSRLPTR------KVKNDWRKKSKAGTASD  129

Query  537  GGLRRRMVVDDD---HDEASELDVSITARK-----GRKWTKASrkaarlqaakeaaPVKV  692
            G  +RR  V DD    ++ SE DVSI         GRKWTKASRKAAR QAA++AAPV+ 
Sbjct  130  GDPKRRRKVSDDGILDEDVSEFDVSIPGSSKARTGGRKWTKASRKAARRQAARDAAPVRA  189

Query  693  EILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQ  815
            E++E+DEDGML E+LAY L ISEG +  +F+ KGI+PDGVQ
Sbjct  190  EMVEIDEDGMLTEDLAYELAISEGALFGFFFEKGIRPDGVQ  230



>ref|XP_002441249.1| hypothetical protein SORBIDRAFT_09g023130 [Sorghum bicolor]
 gb|EES19679.1| hypothetical protein SORBIDRAFT_09g023130 [Sorghum bicolor]
Length=942

 Score =   110 bits (276),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 141/258 (55%), Gaps = 42/258 (16%)
 Frame = +3

Query  54   SSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrppqppqKVEPMLQA  233
            + T KSVWRKGNPVPTV+  +++ P+ E ++ S    +   ++P        K  P L +
Sbjct  183  TKTLKSVWRKGNPVPTVRKVIREQPRTESRSQSIPVAKPSVSSPS-------KPAPPLLS  235

Query  234  RPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDKFASKKPV  413
            +PSVAPPP          +R V                +    +++ PIL+DKFASK+  
Sbjct  236  KPSVAPPP----------RRPV---------------KSDTSKEKKGPILIDKFASKRAA  270

Query  414  ADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDD---DHDEA  584
             DP+V + +L P KP + P         + + + RKK     G RRRM  DD   D D A
Sbjct  271  VDPIVPEELLDPLKPVRGPPA-------KVRVDRRKKPDTQAGSRRRMPNDDGLVDEDTA  323

Query  585  SELDVSITARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEELAYNLTISEG  764
                  +  RKGR+W+KA R+AARL A +   PV+VEILEV E+GMLIE+LAY+L +SE 
Sbjct  324  DVPISGVAVRKGRRWSKAKRRAARLSAMQAEEPVRVEILEVGEEGMLIEDLAYDLAVSES  383

Query  765  EILSYFYTKGIKPDGVQT  818
            EIL +   +G+  D VQT
Sbjct  384  EILRFLSVRGVMLDNVQT  401



>ref|XP_006655617.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
[Oryza brachyantha]
Length=972

 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 139/266 (52%), Gaps = 44/266 (17%)
 Frame = +3

Query  36   AIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrppqppqKV  215
             +  + + T KSVWRKGNPV TV   V+  P+ E +  S+   +    AP        K 
Sbjct  172  GVNSRKTKTLKSVWRKGNPVSTVHKVVRDHPRPESRNQSSSTAKPSMPAPT-------KP  224

Query  216  EPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDKF  395
             P L  +PSVAPPP  PV       +A + KD                  ++ PIL+DKF
Sbjct  225  VPQLLTKPSVAPPPRRPV-------KADMSKD------------------KKGPILIDKF  259

Query  396  ASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDDDH  575
            AS KP+ DP+V+ A++ P KP + P         + KD+ RKK+    G RRRM  DD  
Sbjct  260  ASNKPIVDPVVAAALIEPVKPVRGPPA-------KIKDDRRKKTSTPAGPRRRMPNDDGI  312

Query  576  DEASELDVSITA---RKGRKWTKAS--rkaarlqaakeaaPVKVEILEVDEDGMLIEELA  740
             +    DV I+    RKGR+W+KA       +L+A++   PV+VEILEV E+GM IEELA
Sbjct  313  VDEDTADVPISGVPVRKGRRWSKAKRRAARLQLEASQVEEPVRVEILEVGEEGMEIEELA  372

Query  741  YNLTISEGEILSYFYTKGIKPDGVQT  818
            Y L I E EIL +   +G   D VQT
Sbjct  373  YQLAIGESEILRFLSVRGAMLDNVQT  398



>gb|AAT69592.1| putative translation initiation factor IF-2, PF04760 [Oryza sativa 
Japonica Group]
 dbj|BAG91135.1| unnamed protein product [Oryza sativa Japonica Group]
Length=541

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 99/259 (38%), Positives = 133/259 (51%), Gaps = 45/259 (17%)
 Frame = +3

Query  48   QNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrppqppqKVEPML  227
            + + T KSVWRKGNPV TV   V+  P+ E +  S+   +    AP        K  P L
Sbjct  165  RKTKTLKSVWRKGNPVSTVHKVVRDHPRSESRNQSSSTAKPSMPAPT-------KPVPPL  217

Query  228  QARPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDKFASKK  407
              +PSV  PPP         K                         ++ PIL+DKFAS K
Sbjct  218  LTKPSVVAPPPRRPVKADTSKE------------------------KKGPILIDKFASNK  253

Query  408  PVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDDDHDEAS  587
            P+ DP+V+ A++ P KP + P         + KD+ RKK+    G RRRM  +D      
Sbjct  254  PIVDPVVAAALIEPVKPVRGPPA-------KVKDDRRKKTSTPAGPRRRMPKND-----G  301

Query  588  ELDVSITARKGRKWTKASrkaa--rlqaakeaaPVKVEILEVDEDGMLIEELAYNLTISE  761
             +D     RKGR+W+KA R+AA  +L+A++   PV+VEILEV E+GM+IEELAY L I E
Sbjct  302  LVDEDTAVRKGRRWSKAKRRAARLQLEASQVEEPVRVEILEVGEEGMVIEELAYQLAIDE  361

Query  762  GEILSYFYTKGIKPDGVQT  818
             EIL +   +G   D VQT
Sbjct  362  SEILRFLSVRGAMLDNVQT  380



>ref|XP_004954547.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
isoform X2 [Setaria italica]
Length=975

 Score =   107 bits (267),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 105/258 (41%), Positives = 143/258 (55%), Gaps = 42/258 (16%)
 Frame = +3

Query  54   SSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrppqppqKVEPMLQA  233
            + T KSVWRKGNPVPTV+  +++ P+ E       + +S PAA      P + V P+L +
Sbjct  183  TKTLKSVWRKGNPVPTVRKVIREQPRTE------SRNQSVPAAKPPVSSPSKPVPPLL-S  235

Query  234  RPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDKFASKKPV  413
            +PSVAPPP          +R V                +     ++ PIL+DKFASK+  
Sbjct  236  KPSVAPPP----------RRPV---------------KSDTSKDKKGPILIDKFASKRAT  270

Query  414  ADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDDDHDEASEL  593
             DP+V + +L P KP + PS        + + + RKK     G RRRM  DD   +    
Sbjct  271  IDPVVPEELLDPLKPVRGPSA-------KVRVDRRKKPETQAGSRRRMTNDDGLVDEDTA  323

Query  594  DVSITA---RKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEELAYNLTISEG  764
            DV I+    RKGR+W+KA R+AARL+A +   PV+VEILEV E+GMLIE+LAY L +SE 
Sbjct  324  DVPISGVPVRKGRRWSKAKRRAARLEAMQAEEPVRVEILEVGEEGMLIEDLAYELAVSES  383

Query  765  EILSYFYTKGIKPDGVQT  818
            EIL +   +G   D VQT
Sbjct  384  EILRFLSVRGAMLDNVQT  401



>ref|XP_004954546.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like 
isoform X1 [Setaria italica]
Length=1003

 Score =   107 bits (266),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 105/258 (41%), Positives = 143/258 (55%), Gaps = 42/258 (16%)
 Frame = +3

Query  54   SSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrppqppqKVEPMLQA  233
            + T KSVWRKGNPVPTV+  +++ P+ E       + +S PAA      P + V P+L +
Sbjct  183  TKTLKSVWRKGNPVPTVRKVIREQPRTE------SRNQSVPAAKPPVSSPSKPVPPLL-S  235

Query  234  RPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDKFASKKPV  413
            +PSVAPPP          +R V                +     ++ PIL+DKFASK+  
Sbjct  236  KPSVAPPP----------RRPV---------------KSDTSKDKKGPILIDKFASKRAT  270

Query  414  ADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDDDHDEASEL  593
             DP+V + +L P KP + PS        + + + RKK     G RRRM  DD   +    
Sbjct  271  IDPVVPEELLDPLKPVRGPSA-------KVRVDRRKKPETQAGSRRRMTNDDGLVDEDTA  323

Query  594  DVSITA---RKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEELAYNLTISEG  764
            DV I+    RKGR+W+KA R+AARL+A +   PV+VEILEV E+GMLIE+LAY L +SE 
Sbjct  324  DVPISGVPVRKGRRWSKAKRRAARLEAMQAEEPVRVEILEVGEEGMLIEDLAYELAVSES  383

Query  765  EILSYFYTKGIKPDGVQT  818
            EIL +   +G   D VQT
Sbjct  384  EILRFLSVRGAMLDNVQT  401



>gb|EEE50593.1| hypothetical protein OsJ_30772 [Oryza sativa Japonica Group]
Length=954

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 128/257 (50%), Gaps = 45/257 (18%)
 Frame = +3

Query  54   SSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrppqppqKVEPMLQA  233
            + T KSVWRKGNPV TV   V+  P+ E +  S+   +    AP        K  P L  
Sbjct  167  TKTLKSVWRKGNPVSTVHKVVRDHPRSESRNQSSSTAKPSMPAPT-------KPVPPLLT  219

Query  234  RPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDKFASKKPV  413
            +PSV  PPP         K                         ++ PIL+DKFAS KP+
Sbjct  220  KPSVVAPPPRRPVKADTSKE------------------------KKGPILIDKFASNKPI  255

Query  414  ADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDDDHDEASEL  593
             DP+V+ A++ P KP + P         + KD+ RKK+    G RRRM  +D       +
Sbjct  256  VDPVVAAALIEPVKPVRGPPA-------KVKDDRRKKTSTPAGPRRRMPKND-----GLV  303

Query  594  DVSITARKGRKWTKAS--rkaarlqaakeaaPVKVEILEVDEDGMLIEELAYNLTISEGE  767
            D     RKGR+W+KA       +L+A++   PV+VEILEV E+GM+IEELAY L I E E
Sbjct  304  DEDTAVRKGRRWSKAKRRAARLQLEASQVEEPVRVEILEVGEEGMVIEELAYQLAIDESE  363

Query  768  ILSYFYTKGIKPDGVQT  818
            IL +   +G   D VQT
Sbjct  364  ILRFLSVRGAMLDNVQT  380



>gb|EEC79741.1| hypothetical protein OsI_21094 [Oryza sativa Indica Group]
Length=880

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 99/259 (38%), Positives = 134/259 (52%), Gaps = 46/259 (18%)
 Frame = +3

Query  48   QNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrppqppqKVEPML  227
            + + T KSVWRKGNPV TV   V+  P+ E +  S+   +    AP        K  P L
Sbjct  165  RKTKTLKSVWRKGNPVSTVHKVVRDHPRSESRNQSSSTAKPSMPAPT-------KPVPPL  217

Query  228  QARPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDKFASKK  407
              +PSVAPPP          +R V                A    +++ PIL+DKFAS K
Sbjct  218  LTKPSVAPPP----------RRPV---------------KADTSKEKKGPILIDKFASNK  252

Query  408  PVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDDDHDEAS  587
            P+ DP+V+ A++ P KP + P         + KD+ RKK+    G RRRM  +D      
Sbjct  253  PIVDPVVAAALIEPVKPVRGPPA-------KVKDDRRKKTSTPAGPRRRMPKND-----G  300

Query  588  ELDVSITARKGRKWTKAS--rkaarlqaakeaaPVKVEILEVDEDGMLIEELAYNLTISE  761
             +D     RKGR+W+KA       +L+A++   PV+VEILEV E+GM+IEELAY L I E
Sbjct  301  LVDEDTAVRKGRRWSKAKRRAARLQLEASQVEEPVRVEILEVGEEGMVIEELAYQLAIDE  360

Query  762  GEILSYFYTKGIKPDGVQT  818
             EIL +   +G   D VQT
Sbjct  361  SEILRFLSVRGAMLDNVQT  379



>emb|CDY26262.1| BnaA06g11550D [Brassica napus]
Length=663

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 2/80 (3%)
 Frame = +3

Query  585  SELDVSI--TARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEELAYNLTIS  758
            SEL+VSI  + RKGRKW+KASRKAARLQAA++AAPVK EILEV+E+GM IE+LAYNL I 
Sbjct  12   SELNVSIPGSGRKGRKWSKASRKAARLQAARDAAPVKAEILEVEEEGMSIEDLAYNLAIG  71

Query  759  EGEILSYFYTKGIKPDGVQT  818
            EG+IL Y Y+KGI+PDGVQT
Sbjct  72   EGDILGYLYSKGIRPDGVQT  91



>ref|XP_010540116.1| PREDICTED: LOW QUALITY PROTEIN: translation initiation factor 
IF-2, chloroplastic [Tarenaya hassleriana]
Length=748

 Score =   100 bits (248),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 105/140 (75%), Gaps = 13/140 (9%)
 Frame = +3

Query  369  RQPILVDKFASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLR  548
            R+PIL+DKFASKKP  DP +++AVLA  KP K P         +F+D++RKK+ AS G R
Sbjct  299  RKPILIDKFASKKPAVDPSIAQAVLATRKPGKGPPSG------KFRDDYRKKN-ASAGPR  351

Query  549  RRMVVDDDH----DEASELDVSI--TARKGRKWTKASrkaarlqaakeaaPVKVEILEVD  710
            RR+V  DD     +E SEL+VSI   ARKGRKW+KASRKAARLQAAKE AP++V+IL+V+
Sbjct  352  RRIVDHDDDDIADEETSELNVSIPGAARKGRKWSKASRKAARLQAAKETAPIRVKILDVE  411

Query  711  EDGMLIEELAYNLTISEGEI  770
            + GM IE+LAYNL I EG+I
Sbjct  412  DKGMSIEDLAYNLAIGEGDI  431



>ref|XP_003573695.2| PREDICTED: translation initiation factor IF-2, chloroplastic 
[Brachypodium distachyon]
Length=965

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 99/261 (38%), Positives = 133/261 (51%), Gaps = 43/261 (16%)
 Frame = +3

Query  36   AIPQQNSSTSKSVWRKGNPVPTVQNAVKQPPKQELKTSSTEKTESqpaaplrppqppqKV  215
             +  + + T KS+WRKGNPV +V   V+  P+ E +  S    +   ++P        K 
Sbjct  174  GVHSKRTKTLKSIWRKGNPVSSVHKVVRDRPRTETRGQSISAAKPSVSSPS-------KP  226

Query  216  EPMLQARPSvappppppvapppvvKRAVILKDVgaapkppaatgapakakERQPILVDKF  395
             P L  RPSVAPPP          +R V                A    +++ PIL+DKF
Sbjct  227  VPQLLTRPSVAPPP----------RRPV---------------KADTSQEKKGPILIDKF  261

Query  396  ASKKPVADPLVskavlappkpakspskpgksapsRFKDEFRKKSGASGGLRRRMVVDDDH  575
            ASK+P  DP V++A++ P KP + P         + KD  RKK  A    RRRM  DD  
Sbjct  262  ASKRPTVDPAVAEALVDPVKPVRGPPA-------KVKDNRRKKIIAPAAPRRRMPNDDRR  314

Query  576  DEASELDVSITARKGRKWTKASrkaarlqaakeaaPVKVEILEVDEDGMLIEELAYNLTI  755
                 +D     RKGR+W KA R+AARL+A +   PV+VEILEV  +GM I+ELAY L +
Sbjct  315  ----SVDDDAPVRKGRRWNKAKRRAARLEALEAEEPVRVEILEVGTEGMDIDELAYQLAV  370

Query  756  SEGEILSYFYTKGIKPDGVQT  818
             E EIL +   +G   D VQT
Sbjct  371  GESEILRFLSVRGAMLDNVQT  391



>gb|EMS63921.1| Translation initiation factor IF-2, chloroplastic [Triticum urartu]
Length=611

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 64/107 (60%), Gaps = 5/107 (5%)
 Frame = +3

Query  498  RFKDEFRKKSGASGGLRRRMVVDDDHDEASELDVSITARKGRKWTKASrkaarlqaakea  677
            + KD   KK     G RRRM  DD       +D     RKGR+W+KA R+AARL+A +  
Sbjct  222  KAKDNRHKKIITPAGPRRRMSNDD-----RSVDDDAPVRKGRRWSKAKRRAARLEALEAE  276

Query  678  aPVKVEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
             PV+VEILEV E+GM I+ELAY L + E EIL +   +G   D VQT
Sbjct  277  EPVRVEILEVGEEGMDIDELAYQLAVGESEILRFLSVRGAMLDNVQT  323



>gb|AFG68322.1| hypothetical protein 0_10956_02, partial [Pinus taeda]
 gb|AFG68323.1| hypothetical protein 0_10956_02, partial [Pinus taeda]
 gb|AFG68324.1| hypothetical protein 0_10956_02, partial [Pinus taeda]
 gb|AFG68325.1| hypothetical protein 0_10956_02, partial [Pinus taeda]
Length=124

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 66/99 (67%), Gaps = 7/99 (7%)
 Frame = +3

Query  543  LRRRMVVDDD---HDEASELDVSI----TARKGRKWTKASrkaarlqaakeaaPVKVEIL  701
            LRRR+   +D    DE  EL+V I     ARK RK++KASRKAAR QAA+EAAPVKVEIL
Sbjct  1    LRRRLASSEDAIVDDEVKELNVPIPGLSNARKSRKFSKASRKAARAQAAREAAPVKVEIL  60

Query  702  EVDEDGMLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            EV + GM + ELA NL ++E EI+   + KGI     QT
Sbjct  61   EVGKQGMPVPELASNLAVNEAEIVRTLFLKGIMTSVTQT  99



>ref|XP_002972916.1| hypothetical protein SELMODRAFT_148692 [Selaginella moellendorffii]
 gb|EFJ26137.1| hypothetical protein SELMODRAFT_148692 [Selaginella moellendorffii]
Length=777

 Score = 65.9 bits (159),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 71/106 (67%), Gaps = 6/106 (6%)
 Frame = +3

Query  498  RFKDEFRKKSGASGGLRRRMVVDDDH--DEASELDVSIT----ARKGRKWTKASrkaarl  659
            + +D+ RK+S    G +RR V  D++  D+A E+ +SI+    ARKGRK++KA RKA R 
Sbjct  92   KARDDKRKRSEVMDGAKRRTVARDENAMDDAEEIGISISGVSPARKGRKYSKARRKAERA  151

Query  660  qaakeaaPVKVEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGI  797
            +AAK +APVKVEILEV + GM + +LA  L I+E  ++   + KGI
Sbjct  152  EAAKASAPVKVEILEVGKQGMTVGDLASKLAINEAAVVKVLFMKGI  197



>ref|XP_002988013.1| hypothetical protein SELMODRAFT_159162 [Selaginella moellendorffii]
 gb|EFJ10805.1| hypothetical protein SELMODRAFT_159162 [Selaginella moellendorffii]
Length=776

 Score = 65.9 bits (159),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 71/106 (67%), Gaps = 6/106 (6%)
 Frame = +3

Query  498  RFKDEFRKKSGASGGLRRRMVVDDDH--DEASELDVSIT----ARKGRKWTKASrkaarl  659
            + +D+ RK+S    G +RR V  D++  D+A E+ +SI+    ARKGRK++KA RKA R 
Sbjct  91   KARDDKRKRSEVMDGAKRRTVARDENAMDDAEEIGISISGVSPARKGRKYSKARRKAERA  150

Query  660  qaakeaaPVKVEILEVDEDGMLIEELAYNLTISEGEILSYFYTKGI  797
            +AAK +APVKVEILEV + GM + +LA  L I+E  ++   + KGI
Sbjct  151  EAAKASAPVKVEILEVGKQGMTVGDLASKLAINEAAVVKVLFMKGI  196



>emb|CDP20469.1| unnamed protein product [Coffea canephora]
Length=150

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  720  MLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            ML EELA+NL ISEGEI    Y+KGIKPDGVQT
Sbjct  1    MLTEELAHNLVISEGEIFRSLYSKGIKPDGVQT  33



>emb|CDP11608.1| unnamed protein product [Coffea canephora]
Length=171

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  720  MLIEELAYNLTISEGEILSYFYTKGIKPDGVQT  818
            ML EELA+NL ISEGEI    Y+KGIKPDGVQT
Sbjct  1    MLTEELAHNLVISEGEIFRSLYSKGIKPDGVQT  33



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1724604950500