BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10385

Length=695
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010664801.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    243   9e-76   
ref|XP_002280127.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    244   4e-74   Vitis vinifera
ref|XP_009613531.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    241   3e-73   Nicotiana tomentosiformis
ref|XP_009613532.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    241   4e-73   Nicotiana tomentosiformis
ref|XP_009783027.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    240   5e-73   Nicotiana sylvestris
ref|XP_009783025.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    240   5e-73   Nicotiana sylvestris
ref|XP_011083530.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    236   3e-71   Sesamum indicum [beniseed]
ref|XP_012073811.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    234   7e-71   Jatropha curcas
gb|EYU38824.1|  hypothetical protein MIMGU_mgv1a006549mg                231   1e-69   Erythranthe guttata [common monkey flower]
ref|XP_008364932.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    230   3e-69   
ref|XP_009783029.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    229   5e-69   Nicotiana sylvestris
ref|XP_010104442.1|  tRNA (adenine(58)-N(1))-methyltransferase no...    230   5e-69   Morus notabilis
ref|XP_007222100.1|  hypothetical protein PRUPE_ppa005656mg             230   6e-69   Prunus persica
ref|XP_002510522.1|  translation initiation factor, putative            231   7e-69   
gb|KHF97948.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...    229   8e-69   Gossypium arboreum [tree cotton]
gb|KJB58105.1|  hypothetical protein B456_009G195100                    230   1e-68   Gossypium raimondii
ref|XP_008221276.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    228   2e-68   Prunus mume [ume]
ref|XP_008357132.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    228   3e-68   
ref|XP_004291368.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    228   3e-68   Fragaria vesca subsp. vesca
ref|XP_008221275.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    228   3e-68   Prunus mume [ume]
ref|XP_010320424.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    228   4e-68   Solanum lycopersicum
ref|XP_004238352.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    228   4e-68   Solanum lycopersicum
ref|XP_008387940.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    227   6e-68   Malus domestica [apple tree]
gb|EPS62305.1|  hypothetical protein M569_12486                         226   1e-67   Genlisea aurea
ref|XP_007017787.1|  Eukaryotic initiation factor 3 gamma subunit...    225   5e-67   
ref|XP_006342041.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    224   8e-67   Solanum tuberosum [potatoes]
ref|XP_006342040.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    224   8e-67   Solanum tuberosum [potatoes]
ref|XP_004499247.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    223   3e-66   Cicer arietinum [garbanzo]
ref|XP_008444799.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    222   5e-66   Cucumis melo [Oriental melon]
ref|XP_009335116.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    222   5e-66   Pyrus x bretschneideri [bai li]
ref|XP_008444796.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    222   6e-66   
ref|XP_006435169.1|  hypothetical protein CICLE_v10001119mg             220   1e-65   
ref|XP_006435170.1|  hypothetical protein CICLE_v10001119mg             220   5e-65   Citrus clementina [clementine]
ref|XP_010530285.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    219   5e-65   Tarenaya hassleriana [spider flower]
ref|XP_010268702.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    219   8e-65   Nelumbo nucifera [Indian lotus]
ref|XP_006473647.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    219   9e-65   Citrus sinensis [apfelsine]
ref|XP_011649655.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    218   1e-64   Cucumis sativus [cucumbers]
ref|XP_004152653.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    218   1e-64   Cucumis sativus [cucumbers]
gb|KJB58106.1|  hypothetical protein B456_009G195100                    218   2e-64   Gossypium raimondii
ref|XP_002307715.1|  eukaryotic initiation factor 3 gamma subunit...    217   3e-64   
ref|XP_011649657.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    217   6e-64   Cucumis sativus [cucumbers]
emb|CDP07406.1|  unnamed protein product                                217   7e-64   Coffea canephora [robusta coffee]
ref|XP_006386177.1|  hypothetical protein POPTR_0002s02490g             216   1e-63   
ref|XP_010061043.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    213   2e-62   Eucalyptus grandis [rose gum]
ref|XP_011029000.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    211   7e-62   Populus euphratica
ref|XP_011028999.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    211   8e-62   Populus euphratica
ref|XP_010681362.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    209   4e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003589467.1|  tRNA (adenine-N(1)-)-methyltransferase non-c...    209   4e-61   Medicago truncatula
ref|XP_010681361.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    209   9e-61   
ref|XP_010681359.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    209   1e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681360.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    209   1e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002300711.2|  hypothetical protein POPTR_0002s02490g             207   2e-60   
gb|KFK37363.1|  hypothetical protein AALP_AA4G246900                    205   1e-59   Arabis alpina [alpine rockcress]
ref|XP_006294219.1|  hypothetical protein CARUB_v10023215mg             205   2e-59   Capsella rubella
ref|XP_009381995.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    205   5e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010934213.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    204   5e-59   Elaeis guineensis
ref|XP_010506525.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    199   7e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010934212.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    204   8e-59   
ref|XP_006601347.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    202   3e-58   Glycine max [soybeans]
ref|XP_006852744.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    202   6e-58   Amborella trichopoda
ref|NP_566054.1|  eukaryotic initiation factor 3 gamma subunit fa...    201   6e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508122.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    199   3e-57   Camelina sativa [gold-of-pleasure]
ref|XP_002882030.1|  eukaryotic initiation factor 3 gamma subunit...    199   4e-57   
ref|XP_007160671.1|  hypothetical protein PHAVU_001G007200g             199   6e-57   Phaseolus vulgaris [French bean]
emb|CDY27364.1|  BnaC04g50410D                                          197   1e-56   Brassica napus [oilseed rape]
emb|CDY37059.1|  BnaA04g26370D                                          197   1e-56   Brassica napus [oilseed rape]
ref|XP_006397754.1|  hypothetical protein EUTSA_v10001448mg             197   2e-56   Eutrema salsugineum [saltwater cress]
ref|XP_008785125.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    197   2e-56   Phoenix dactylifera
ref|XP_009142359.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    196   3e-56   Brassica rapa
ref|XP_010518199.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    195   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_006596555.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    194   3e-55   Glycine max [soybeans]
gb|KHN39432.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...    193   8e-55   Glycine soja [wild soybean]
ref|XP_007017789.1|  Eukaryotic initiation factor 3 gamma subunit...    190   4e-54   
ref|XP_006596554.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    191   6e-54   Glycine max [soybeans]
emb|CDY53893.1|  BnaA03g56950D                                          187   2e-52   Brassica napus [oilseed rape]
emb|CDX95661.1|  BnaC03g25420D                                          186   3e-52   
ref|XP_009133748.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    183   3e-51   Brassica rapa
ref|XP_006596556.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    180   5e-50   
ref|XP_004976509.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    179   2e-49   Setaria italica
emb|CAH65746.1|  OSIGBa0127D24.9                                        174   1e-47   Oryza sativa [red rice]
ref|NP_001052037.1|  Os04g0112300                                       174   2e-47   
gb|EEC76653.1|  hypothetical protein OsI_14608                          174   3e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_003580561.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    173   3e-47   Brachypodium distachyon [annual false brome]
ref|XP_008674619.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    173   5e-47   Zea mays [maize]
gb|KDO84842.1|  hypothetical protein CISIN_1g0129782mg                  166   5e-47   Citrus sinensis [apfelsine]
gb|KDO84841.1|  hypothetical protein CISIN_1g0129782mg                  167   3e-46   Citrus sinensis [apfelsine]
dbj|BAK01496.1|  predicted protein                                      169   1e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006652081.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    169   2e-45   Oryza brachyantha
ref|XP_008674620.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    168   2e-45   Zea mays [maize]
gb|KDO84840.1|  hypothetical protein CISIN_1g0129782mg                  167   3e-45   Citrus sinensis [apfelsine]
emb|CBH32650.1|  tRNA (guanine-N(1)-)-methyltransferase,putative,...    166   1e-44   Triticum aestivum [Canadian hard winter wheat]
gb|KCW67945.1|  hypothetical protein EUGRSUZ_F01642                     162   5e-43   Eucalyptus grandis [rose gum]
ref|XP_002459020.1|  hypothetical protein SORBIDRAFT_03g044640          162   5e-43   
emb|CCG48005.1|  tRNA (guanine-N(1)-)-methyltransferase,putative,...    161   8e-43   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010268703.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    156   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_003565472.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    150   4e-39   Brachypodium distachyon [annual false brome]
ref|XP_001777605.1|  predicted protein                                  147   5e-38   
gb|EMT11539.1|  tRNA (adenine-N(1)-)-methyltransferase non-cataly...    147   3e-37   
ref|XP_002969483.1|  hypothetical protein SELMODRAFT_410184             140   6e-35   
ref|XP_002961249.1|  hypothetical protein SELMODRAFT_402980             139   8e-35   
ref|XP_002862254.1|  predicted protein                                  129   9e-34   
gb|EMS51436.1|  tRNA (adenine-N(1)-)-methyltransferase non-cataly...    115   5e-26   Triticum urartu
ref|XP_010061044.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    109   2e-24   Eucalyptus grandis [rose gum]
ref|XP_006596557.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    108   3e-24   
ref|XP_008444798.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    103   2e-22   
ref|XP_011395630.1|  tRNA (adenine(58)-N(1))-methyltransferase no...    102   5e-22   Auxenochlorella protothecoides
ref|XP_011029001.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...    100   3e-21   Populus euphratica
gb|EMS63230.1|  tRNA (adenine-N(1)-)-methyltransferase non-cataly...  97.4    4e-20   Triticum urartu
gb|EMT06299.1|  tRNA (adenine-N(1)-)-methyltransferase non-cataly...  93.6    1e-18   
ref|XP_001694078.1|  predicted protein                                92.0    2e-18   Chlamydomonas reinhardtii
ref|XP_004338247.1|  eukaryotic initiation factor 3 gamma subunit...  90.1    3e-17   Acanthamoeba castellanii str. Neff
ref|XP_640865.1|  tRNA-methyltransferase subunit                      88.6    1e-16   Dictyostelium discoideum AX4
ref|XP_005650969.1|  Gcd10p-domain-containing protein                 87.8    2e-16   Coccomyxa subellipsoidea C-169
ref|XP_002955797.1|  hypothetical protein VOLCADRAFT_119181           88.6    2e-16   Volvox carteri f. nagariensis
ref|XP_002902421.1|  tRNA (adenine-N(1)-)-methyltransferase non-c...  84.3    2e-15   Phytophthora infestans T30-4
ref|XP_002679179.1|  predicted protein                                83.6    3e-15   Naegleria gruberi strain NEG-M
ref|XP_009514362.1|  hypothetical protein PHYSODRAFT_474013           82.8    6e-15   Phytophthora sojae
ref|XP_005853789.1|  hypothetical protein NGA_2025000                 80.1    2e-14   Nannochloropsis gaditana CCMP526
gb|EMT06057.1|  tRNA (adenine-N(1)-)-methyltransferase non-cataly...  80.9    3e-14   
gb|ETO59693.1|  hypothetical protein F444_22014                       81.3    3e-14   Phytophthora parasitica P1976
gb|ETI30962.1|  hypothetical protein F443_21994                       81.3    3e-14   Phytophthora parasitica P1569
emb|CAX73263.1|  translation initiation factor eIF-3 subunit P62      80.9    3e-14   Schistosoma japonicum
gb|ETK71349.1|  hypothetical protein L915_21397                       81.3    3e-14   Phytophthora parasitica
ref|XP_008915171.1|  hypothetical protein PPTG_18823                  81.3    3e-14   Phytophthora parasitica INRA-310
ref|XP_003289283.1|  hypothetical protein DICPUDRAFT_35506            80.9    4e-14   Dictyostelium purpureum
gb|EWM23698.1|  trna (adenine-n -)-methyltransferase non-catalyti...  80.5    5e-14   Nannochloropsis gaditana
ref|XP_005837772.1|  hypothetical protein GUITHDRAFT_41344            77.0    1e-13   Guillardia theta CCMP2712
ref|XP_002506666.1|  predicted protein                                78.6    2e-13   Micromonas commoda
emb|CBN75132.1|  conserved unknown protein                            78.2    3e-13   Ectocarpus siliculosus
emb|CCA25085.1|  tRNA (adenineN(1))methyltransferase noncatalytic...  77.0    6e-13   Albugo laibachii Nc14
ref|XP_007514261.1|  predicted protein                                77.4    7e-13   Bathycoccus prasinos
ref|XP_783506.2|  PREDICTED: tRNA (adenine(58)-N(1))-methyltransf...  76.6    1e-12   Strongylocentrotus purpuratus [purple urchin]
emb|CDW89783.1|  trna (adenine-n)-methyltransferase non-catalytic...  73.9    5e-12   Stylonychia lemnae
gb|KIY99610.1|  tRNA (adenine-N(1)-)-methyltransferasenon-catalyt...  71.2    5e-12   Monoraphidium neglectum
ref|XP_004902638.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  74.3    7e-12   
gb|EHB14239.1|  tRNA (adenine-N(1)-)-methyltransferase non-cataly...  74.3    7e-12   Heterocephalus glaber [naked mole rat]
ref|XP_004902637.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  74.3    8e-12   
ref|XP_004902636.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  74.3    8e-12   
ref|XP_005789795.1|  hypothetical protein EMIHUDRAFT_109824           73.6    9e-12   Emiliania huxleyi CCMP1516
dbj|GAM24157.1|  hypothetical protein SAMD00019534_073320             73.6    1e-11   Acytostelium subglobosum LB1
gb|ELT95756.1|  hypothetical protein CAPTEDRAFT_113381                73.2    1e-11   Capitella teleta
ref|XP_002185121.1|  predicted protein                                72.8    1e-11   Phaeodactylum tricornutum CCAP 1055/1
emb|CBK24326.2|  unnamed protein product                              72.8    2e-11   Blastocystis hominis
ref|XP_005844191.1|  hypothetical protein CHLNCDRAFT_139358           72.0    2e-11   Chlorella variabilis
emb|CDX73407.1|  BnaC08g25960D                                        66.6    3e-11   
ref|XP_004697902.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  72.4    3e-11   Echinops telfairi [lesser hedgehog tenrec]
emb|CCI39622.1|  unnamed protein product                              72.4    4e-11   Albugo candida
ref|XP_004634391.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  71.2    6e-11   
ref|XP_001417818.1|  predicted protein                                70.9    8e-11   Ostreococcus lucimarinus CCE9901
ref|XP_005380909.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  70.5    1e-10   Chinchilla lanigera
ref|XP_010605815.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  70.5    1e-10   Fukomys damarensis [Damara mole rat]
ref|XP_010605816.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  70.5    1e-10   Fukomys damarensis [Damara mole rat]
ref|XP_005717779.1|  unnamed protein product                          70.1    1e-10   Chondrus crispus [carageen]
ref|XP_003079466.1|  tRNA(1-methyladenosine) methyltransferase, s...  70.1    1e-10   Ostreococcus tauri
ref|XP_004315757.1|  PREDICTED: LOW QUALITY PROTEIN: tRNA (adenin...  69.7    2e-10   
ref|XP_004227530.2|  PREDICTED: LOW QUALITY PROTEIN: tRNA (adenin...  69.7    2e-10   Ciona intestinalis [sea vase]
gb|EJY66280.1|  Gcd10p domain containing protein                      69.3    2e-10   Oxytricha trifallax
ref|XP_004083383.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  69.3    2e-10   Oryzias latipes [Japanese rice fish]
ref|XP_008062499.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  69.3    2e-10   Carlito syrichta
ref|XP_008139293.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  69.3    3e-10   Eptesicus fuscus
ref|XP_010377219.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.9    3e-10   Rhinopithecus roxellana
ref|XP_006626064.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.9    3e-10   Lepisosteus oculatus
ref|XP_006096503.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.9    3e-10   Myotis lucifugus
ref|XP_007539628.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.9    3e-10   Erinaceus europaeus [common hedgehog]
ref|XP_003495308.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.9    4e-10   Cricetulus griseus [Chinese hamsters]
ref|XP_004343480.1|  hypothetical protein CAOG_07606                  68.9    4e-10   Capsaspora owczarzaki ATCC 30864
ref|XP_005068726.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.9    4e-10   Mesocricetus auratus [Syrian golden hamster]
dbj|BAA86467.1|  KIAA1153 protein                                     68.6    4e-10   Homo sapiens [man]
gb|EAX10407.1|  CGI-09 protein, isoform CRA_b                         68.6    4e-10   Homo sapiens [man]
ref|XP_006758132.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.9    4e-10   Myotis davidii
ref|XP_005874808.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.9    4e-10   
ref|XP_011403590.1|  PREDICTED: uncharacterized protein LOC100636746  69.3    4e-10   
ref|XP_003476643.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.9    4e-10   Cavia porcellus [guinea pig]
gb|KJE97147.1|  hypothetical protein CAOG_007606                      68.9    4e-10   Capsaspora owczarzaki ATCC 30864
ref|XP_005991159.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    4e-10   
ref|XP_002168557.2|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    4e-10   Hydra vulgaris
emb|CCD75289.1|  translation initiation factor eif3-related           68.6    4e-10   Schistosoma mansoni
ref|XP_005991157.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    4e-10   Latimeria chalumnae
ref|XP_008536611.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    4e-10   Equus przewalskii [Przewalski horse]
ref|XP_006984037.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    4e-10   Peromyscus maniculatus bairdii
ref|XP_005991160.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    4e-10   
gb|EPQ12972.1|  tRNA (adenine-N(1)-)-methyltransferase non-cataly...  68.9    5e-10   Myotis brandtii
ref|XP_011739503.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    5e-10   Macaca nemestrina [pigtail macaque]
ref|XP_010377221.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    5e-10   Rhinopithecus roxellana
ref|XP_011796403.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    5e-10   Colobus angolensis palliatus
ref|XP_011823462.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    5e-10   Mandrillus leucophaeus
ref|XP_008016889.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    5e-10   Chlorocebus sabaeus
ref|XP_003905098.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    5e-10   Papio anubis [baboon]
ref|XP_001494320.2|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    5e-10   
ref|XP_011907511.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    5e-10   Cercocebus atys
ref|XP_003252189.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    5e-10   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_004061830.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    5e-10   Gorilla gorilla gorilla [lowland gorilla]
ref|NP_001248589.1|  tRNA methyltransferase 6 homolog                 68.6    5e-10   Macaca mulatta [rhesus macaque]
ref|XP_006894293.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    5e-10   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_002829989.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    5e-10   Pongo abelii [orang utan]
ref|XP_001166710.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    5e-10   Pan troglodytes
ref|XP_003821398.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    5e-10   Pan paniscus [bonobo]
ref|NP_057023.2|  tRNA (adenine(58)-N(1))-methyltransferase non-c...  68.6    5e-10   Homo sapiens [man]
ref|XP_009037160.1|  hypothetical protein AURANDRAFT_64086            68.9    5e-10   Aureococcus anophagefferens
ref|XP_007469191.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    5e-10   Lipotes vexillifer [baiji]
ref|XP_006870481.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.2    6e-10   Chrysochloris asiatica
ref|XP_007073306.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    6e-10   Panthera tigris altaica
ref|XP_003983793.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    6e-10   Felis catus [cat]
ref|XP_007636936.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.6    6e-10   
gb|AAD27718.1|AF132943_1  CGI-09 protein                              67.8    6e-10   Homo sapiens [man]
ref|XP_005380908.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.2    6e-10   Chinchilla lanigera
ref|XP_010992814.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.2    6e-10   Camelus dromedarius [camel]
ref|XP_010834750.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.2    6e-10   Bison bison bison
ref|XP_006047802.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.2    6e-10   Bubalus bubalis [domestic water buffalo]
ref|XP_006187142.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.2    6e-10   Camelus ferus
gb|EJY69889.1|  Gcd10p domain containing protein                      67.8    6e-10   Oxytricha trifallax
ref|XP_011368359.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.2    6e-10   Pteropus vampyrus
ref|NP_001033129.1|  tRNA (adenine(58)-N(1))-methyltransferase no...  68.2    6e-10   Bos taurus [bovine]
ref|XP_005891117.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.2    6e-10   Bos mutus
ref|XP_006921672.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.2    7e-10   Pteropus alecto
ref|XP_005343166.1|  PREDICTED: LOW QUALITY PROTEIN: tRNA methylt...  68.2    7e-10   Ictidomys tridecemlineatus
ref|XP_004355316.1|  tRNA-methyltransferase subunit                   68.2    7e-10   Cavenderia fasciculata
gb|EPY79157.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  68.2    7e-10   Camelus ferus
ref|XP_004276498.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.2    7e-10   Orcinus orca [Orca]
ref|XP_003933267.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.2    7e-10   Saimiri boliviensis boliviensis
ref|XP_006735548.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.2    7e-10   Leptonychotes weddellii
ref|XP_007191781.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.2    8e-10   Balaenoptera acutorostrata scammoni
ref|XP_005094820.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.2    8e-10   Aplysia californica
ref|XP_007123240.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  68.2    8e-10   Physeter catodon
ref|XP_010668507.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  65.1    8e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008701544.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  67.8    8e-10   Ursus maritimus [white bear]
ref|XP_002925063.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  67.8    8e-10   Ailuropoda melanoleuca
ref|XP_004398269.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  67.8    8e-10   Odobenus rosmarus divergens
ref|XP_004433828.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  67.8    8e-10   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_005688232.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  67.8    8e-10   
ref|XP_011995492.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  67.8    8e-10   
ref|XP_006207427.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  67.8    8e-10   Vicugna pacos
ref|XP_005974382.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  67.8    9e-10   Pantholops hodgsonii [Tibetan antelope]
ref|XP_004014397.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  67.8    9e-10   Ovis aries [domestic sheep]
ref|XP_008571044.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  67.8    9e-10   Galeopterus variegatus [Malayan flying lemur]
ref|XP_007950664.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  67.8    1e-09   Orycteropus afer afer
ref|XP_004751586.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  67.4    1e-09   Mustela putorius furo [black ferret]
ref|XP_011415154.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  67.4    1e-09   Crassostrea gigas
ref|XP_005365613.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  67.4    1e-09   Microtus ochrogaster [prairie voles]
ref|XP_004593448.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  67.0    2e-09   Ochotona princeps [southern American pika]
ref|XP_001927431.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  66.6    2e-09   
ref|XP_002710888.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  66.6    2e-09   Oryctolagus cuniculus [domestic rabbit]
ref|NP_001101249.1|  tRNA (adenine(58)-N(1))-methyltransferase no...  66.6    2e-09   Rattus norvegicus [brown rat]
ref|XP_004687003.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  66.6    2e-09   Condylura cristata
ref|XP_004383106.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  66.6    2e-09   Trichechus manatus latirostris
emb|CDQ80939.1|  unnamed protein product                              66.2    3e-09   Oncorhynchus mykiss
ref|XP_003411629.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  66.2    3e-09   Loxodonta africana [African bush elephant]
ref|XP_005672738.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  66.2    3e-09   
ref|XP_007424782.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  66.2    3e-09   
ref|XP_005147482.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  66.2    3e-09   Melopsittacus undulatus
ref|XP_003758257.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  65.9    4e-09   
gb|ERE71813.1|  tRNA (adenine-N(1)-)-methyltransferase non-cataly...  65.9    4e-09   Cricetulus griseus [Chinese hamsters]
ref|XP_004991864.1|  hypothetical protein PTSG_06482                  63.9    4e-09   Salpingoeca rosetta
ref|XP_011230334.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  65.9    4e-09   
gb|EFX87167.1|  hypothetical protein DAPPUDRAFT_312712                65.5    5e-09   Daphnia pulex
ref|XP_001382135.2|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  65.5    5e-09   Monodelphis domestica
ref|NP_001085466.1|  MGC80147 protein                                 65.5    5e-09   Xenopus laevis [clawed frog]
ref|XP_003743880.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  65.5    5e-09   Galendromus occidentalis
ref|XP_003403129.1|  PREDICTED: tRNA (adenine-N(1)-)-methyltransf...  65.1    6e-09   
ref|XP_004610995.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  65.1    6e-09   Sorex araneus [Eurasian shrew]
ref|XP_008113375.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  65.1    7e-09   Anolis carolinensis [Carolina anole]
ref|NP_001032469.1|  tRNA (adenine(58)-N(1))-methyltransferase no...  65.1    7e-09   Danio rerio [leopard danio]
ref|XP_010880491.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  65.1    7e-09   Esox lucius
dbj|BAE39347.1|  unnamed protein product                              65.1    7e-09   Mus musculus [mouse]
ref|XP_007424783.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  65.1    7e-09   Python bivittatus
ref|NP_780322.2|  tRNA (adenine(58)-N(1))-methyltransferase non-c...  65.1    7e-09   Mus musculus [mouse]
gb|KDO24610.1|  hypothetical protein SPRG_10142                       65.1    7e-09   Saprolegnia parasitica CBS 223.65
ref|XP_004451566.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  65.1    7e-09   Dasypus novemcinctus
ref|XP_001610903.1|  initiation factor 3 gamma subunit containing...  65.1    8e-09   Babesia bovis T2Bo
ref|XP_006819505.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  65.1    8e-09   Saccoglossus kowalevskii
dbj|BAC98110.1|  mKIAA1153 protein                                    65.1    8e-09   Mus musculus [mouse]
ref|XP_003882593.1|  conserved hypothetical protein                   64.7    1e-08   Neospora caninum Liverpool
ref|XP_003788074.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  64.3    1e-08   Otolemur garnettii
ref|XP_011555662.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  64.3    1e-08   Plutella xylostella [cabbage moth]
ref|XP_008113380.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  64.3    1e-08   Anolis carolinensis [Carolina anole]
ref|XP_008610122.1|  hypothetical protein SDRG_06135                  64.3    1e-08   Saprolegnia diclina VS20
ref|XP_008821062.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  64.3    1e-08   Nannospalax galili
ref|XP_004661505.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  63.9    2e-08   Jaculus jaculus
emb|CDS27117.1|  tRNA (adenine N(1)) methyltransferase                63.9    2e-08   Hymenolepis microstoma
ref|XP_010311395.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  63.5    2e-08   
ref|XP_004186096.1|  hypothetical protein EIN_308160                  63.5    2e-08   
gb|KFG57412.1|  eukaryotic initiation factor 3, gamma subunit pro...  63.5    2e-08   
ref|XP_002371384.1|  hypothetical protein, conserved                  63.5    2e-08   
gb|KFH00202.1|  eukaryotic initiation factor 3, gamma subunit pro...  63.5    2e-08   
gb|ESS32861.1|  eukaryotic initiation factor 3, gamma subunit pro...  63.5    2e-08   
ref|NP_001090141.1|  tRNA methyltransferase 6                         63.5    2e-08   
gb|EPT30339.1|  eukaryotic initiation factor 3, gamma subunit pro...  63.9    2e-08   
ref|XP_007229761.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  63.5    2e-08   
gb|KFG28573.1|  eukaryotic initiation factor 3, gamma subunit pro...  63.5    2e-08   
ref|XP_001861489.1|  tRNA methyltransferase                           63.2    2e-08   
ref|XP_008874185.1|  hypothetical protein H310_09801                  63.5    2e-08   
gb|KFG41255.1|  eukaryotic initiation factor 3, gamma subunit pro...  63.5    3e-08   
gb|EPR61800.1|  eukaryotic initiation factor 3, gamma subunit pro...  63.5    3e-08   
ref|XP_008887612.1|  eukaryotic initiation factor 3, gamma subuni...  63.5    3e-08   
dbj|BAE38495.1|  unnamed protein product                              63.5    3e-08   
ref|XP_009325373.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  63.2    3e-08   
ref|XP_009280868.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  63.2    3e-08   
gb|KFQ20641.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  63.2    3e-08   
ref|XP_005489466.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  63.2    3e-08   
gb|KFQ42723.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  63.2    3e-08   
ref|XP_010014072.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  63.2    3e-08   
ref|XP_003971633.1|  PREDICTED: LOW QUALITY PROTEIN: tRNA (adenin...  63.2    3e-08   
ref|XP_004928755.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  62.8    3e-08   
ref|XP_009832617.1|  hypothetical protein H257_08446                  62.8    3e-08   
gb|KFG36476.1|  eukaryotic initiation factor 3, gamma subunit pro...  63.2    4e-08   
ref|XP_011264922.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  62.4    5e-08   
ref|XP_009166430.1|  hypothetical protein T265_03631                  59.3    5e-08   
ref|XP_008286178.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  62.4    5e-08   
ref|XP_007670334.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  62.4    5e-08   
ref|XP_011055677.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  62.4    5e-08   
ref|XP_009900045.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  62.4    6e-08   
ref|XP_008311454.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  62.4    6e-08   
gb|KFH06155.1|  eukaryotic initiation factor 3, gamma subunit pro...  62.0    6e-08   
ref|XP_007896470.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  62.4    6e-08   
ref|XP_011301509.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  62.4    6e-08   
gb|KFO03941.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  62.0    6e-08   
gb|KGL99234.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  62.0    6e-08   
ref|NP_001005034.1|  tRNA methyltransferase 6                         62.0    7e-08   
gb|KDO84843.1|  hypothetical protein CISIN_1g0129781mg                57.0    8e-08   
gb|KFV61733.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  62.0    8e-08   
ref|XP_005232480.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  61.6    8e-08   
gb|KGB35859.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  61.6    9e-08   
ref|XP_009014121.1|  hypothetical protein HELRODRAFT_170048           61.6    9e-08   
gb|KFO89682.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  61.6    9e-08   
ref|XP_005439220.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  61.6    1e-07   
gb|KGL72486.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  61.6    1e-07   
ref|XP_012054015.1|  PREDICTED: LOW QUALITY PROTEIN: tRNA (adenin...  61.6    1e-07   
gb|KFP97798.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  61.6    1e-07   
ref|XP_006015495.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  61.6    1e-07   
gb|KGK36742.1|  hypothetical protein JL09_g4117                       59.3    1e-07   
ref|XP_006162891.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  61.2    1e-07   
gb|KFM09734.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  61.2    1e-07   
ref|XP_011264932.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  61.2    1e-07   
gb|KFW97170.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  61.2    1e-07   
gb|EOB01651.1|  tRNA (adenine-N(1)-)-methyltransferase non-cataly...  60.8    2e-07   
ref|XP_011212326.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  60.8    2e-07   
ref|XP_005019211.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  60.8    2e-07   
ref|XP_006264961.1|  PREDICTED: LOW QUALITY PROTEIN: tRNA (adenin...  60.8    2e-07   
gb|KFQ32726.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  60.5    2e-07   
ref|XP_010731538.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  60.5    2e-07   
emb|CDY25988.1|  BnaC09g19990D                                        58.9    2e-07   
gb|ELV13417.1|  tRNA (adenine-N(1)-)-methyltransferase non-cataly...  60.8    2e-07   
ref|XP_011137360.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  60.5    2e-07   
gb|ETN70013.1|  eukaryotic initiation factor 3, gamma subunit         58.2    3e-07   
emb|CDR94435.1|  hypothetical protein, conserved                      60.1    3e-07   
ref|XP_008396535.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  60.1    3e-07   
gb|EUB56579.1|  tRNA (adenine-N(1)-)-methyltransferase non-cataly...  60.1    3e-07   
emb|CDS21575.1|  tRNA adenine N1 methyltransferase                    60.1    3e-07   
ref|XP_002610723.1|  hypothetical protein BRAFLDRAFT_202589           60.1    3e-07   
gb|KDR09856.1|  tRNA (adenine-N(1)-)-methyltransferase non-cataly...  60.1    3e-07   
ref|XP_008215083.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  60.1    3e-07   
ref|XP_001952015.2|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  59.7    4e-07   
ref|XP_008855305.1|  eukaryotic initiation factor 3, gamma subuni...  59.7    4e-07   
ref|XP_001734925.1|  hypothetical protein                             59.7    4e-07   
ref|XP_653075.1|  hypothetical protein                                59.7    4e-07   
ref|XP_009497748.1|  hypothetical protein H696_05654                  60.1    4e-07   
gb|KFR10876.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  59.7    4e-07   
ref|XP_005449818.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  59.7    4e-07   
ref|XP_001993504.1|  GH13028                                          59.7    5e-07   
emb|CDI97296.1|  tRNA (adenine N(1)) methyltransferase                59.7    5e-07   
ref|XP_011182152.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  59.7    5e-07   
ref|XP_002427966.1|  conserved hypothetical protein                   58.9    6e-07   
ref|XP_005805701.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  59.3    6e-07   
ref|XP_007476775.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  58.9    8e-07   
ref|XP_007566716.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  58.9    8e-07   
ref|XP_002408097.1|  tRNA (adenine-N(1)-)-methyltransferase non-c...  58.9    8e-07   
ref|XP_006793191.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  58.9    8e-07   
dbj|BAK00745.1|  predicted protein                                    58.5    9e-07   
ref|XP_005917772.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  58.5    9e-07   
ref|XP_005724985.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  58.5    1e-06   
ref|XP_004542216.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  58.5    1e-06   
ref|XP_002003935.1|  GI18178                                          58.5    1e-06   
gb|KKA74939.1|  hypothetical protein PRIPAC_6928                      57.8    2e-06   
ref|XP_010771996.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  57.8    2e-06   
ref|XP_010209881.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  57.4    2e-06   
gb|ETO59694.1|  hypothetical protein, variant                         57.4    2e-06   
ref|XP_008915172.1|  hypothetical protein, variant                    57.4    2e-06   
gb|ETK71350.1|  hypothetical protein, variant                         57.4    2e-06   
gb|ETI30963.1|  hypothetical protein, variant                         57.4    2e-06   
ref|XP_005724984.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  57.4    2e-06   
ref|XP_004542215.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  57.4    3e-06   
ref|XP_003061317.1|  predicted protein                                57.4    3e-06   
ref|XP_005917771.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  57.4    3e-06   
ref|XP_004534451.1|  PREDICTED: LOW QUALITY PROTEIN: tRNA (adenin...  57.4    3e-06   
ref|NP_001026212.2|  tRNA (adenine-N(1)-)-methyltransferase non-c...  57.4    3e-06   
gb|EFZ15435.1|  hypothetical protein SINV_09451                       57.0    3e-06   
gb|KFV04506.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  57.0    3e-06   
ref|XP_011163996.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  57.0    3e-06   
ref|XP_011598124.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  57.0    3e-06   
ref|XP_009979059.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  57.0    3e-06   
ref|XP_003440847.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  57.0    4e-06   
ref|XP_010573026.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  57.0    4e-06   
ref|XP_009991763.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  57.0    4e-06   
ref|XP_009641274.1|  PREDICTED: LOW QUALITY PROTEIN: tRNA (adenin...  57.0    4e-06   
ref|XP_010284513.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  57.0    4e-06   
ref|XP_008478414.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  56.2    6e-06   
ref|XP_009933113.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  56.2    6e-06   
emb|CAF96114.1|  unnamed protein product                              53.9    7e-06   
ref|XP_007068852.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  55.8    9e-06   
ref|XP_002199564.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  55.5    1e-05   
ref|XP_005214621.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  55.5    1e-05   
ref|XP_008921049.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  55.5    1e-05   
ref|XP_005525551.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  55.5    1e-05   
ref|XP_002136782.1|  GA28174                                          55.5    1e-05   
ref|XP_010207149.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  55.5    1e-05   
ref|XP_005287492.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  55.5    1e-05   
gb|KFP34556.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  55.5    1e-05   
dbj|GAC92508.1|  tRNA (adenine-N(1)-)-methyltransferase non-catal...  55.5    1e-05   
ref|XP_008194930.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  55.1    1e-05   
gb|KFQ99607.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  55.1    1e-05   
ref|XP_008557148.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  55.1    2e-05   
ref|XP_009465882.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  55.1    2e-05   
gb|KFB46574.1|  AGAP009904-PA-like protein                            55.1    2e-05   
ref|XP_002115899.1|  hypothetical protein TRIADDRAFT_59791            55.1    2e-05   
ref|XP_001657122.1|  AAEL003654-PA                                    55.1    2e-05   
gb|EFA79060.1|  phosphoribosyl pyrophosphate synthetase               55.1    2e-05   
ref|XP_009685169.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  54.7    2e-05   
gb|EMC88846.1|  tRNA (adenine-N(1)-)-methyltransferase non-cataly...  54.7    2e-05   
ref|XP_011330817.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  54.7    2e-05   
gb|KFV87469.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  54.7    2e-05   
ref|XP_002088164.1|  GE18430                                          54.7    2e-05   
ref|XP_005503821.1|  PREDICTED: LOW QUALITY PROTEIN: tRNA (adenin...  54.7    2e-05   
ref|XP_011330815.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  54.7    2e-05   
gb|KFV90037.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  54.7    2e-05   
ref|XP_008503229.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  54.7    2e-05   
gb|KFU86468.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  54.7    2e-05   
gb|KFV00185.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  54.7    2e-05   
gb|ETN67326.1|  tRNA methyltransferase                                54.7    2e-05   
ref|XP_005042913.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  54.7    2e-05   
gb|KFO96942.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  54.7    2e-05   
ref|XP_011643135.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  54.7    2e-05   
gb|KFP82989.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  54.7    2e-05   
gb|KFO54717.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  54.3    2e-05   
ref|XP_010409328.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  54.3    2e-05   
ref|XP_006136063.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  54.3    3e-05   
gb|KIH55220.1|  eukaryotic initiation factor 3, gamma subunit         54.3    3e-05   
emb|CCF50529.1|  related to GCD10-translation initiation factor e...  54.3    3e-05   
gb|KFO72986.1|  tRNA (adenine(58)-N(1))-methyltransferase non-cat...  53.9    4e-05   
ref|XP_001743722.1|  hypothetical protein                             53.5    4e-05   
gb|ETO22961.1|  hypothetical protein RFI_14223                        53.5    5e-05   
gb|ADD38549.1|  tRNA MTase subunit TRM6                               53.5    5e-05   
ref|XP_002051169.1|  GJ14638                                          53.5    5e-05   
emb|CDI76080.1|  hypothetical protein, conserved                      53.1    5e-05   
ref|XP_500727.1|  YALI0B10582p                                        53.5    5e-05   
dbj|GAA41322.2|  tRNA (adenine-N(1)-)-methyltransferase non-catal...  52.8    6e-05   
ref|XP_009078315.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  53.1    6e-05   
ref|XP_003203833.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  53.1    6e-05   
ref|XP_006136064.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  53.1    7e-05   
emb|CAG01490.1|  unnamed protein product                              53.1    7e-05   
ref|XP_011495778.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  53.1    7e-05   
ref|XP_009061634.1|  hypothetical protein LOTGIDRAFT_234974           53.1    8e-05   
gb|KDE04895.1|  hypothetical protein MVLG_04653                       52.8    8e-05   
emb|CDI54493.1|  related to GCD10-translation initiation factor e...  52.8    9e-05   
ref|XP_002065204.1|  GK14794                                          52.8    1e-04   
dbj|GAK66071.1|  eukaryotic translation initiation factor 3 62 kd...  52.8    1e-04   
emb|CCE42575.1|  hypothetical protein CPAR2_202180                    52.4    1e-04   
ref|XP_011871015.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  52.4    1e-04   
ref|XP_001357296.2|  GA21902                                          52.4    1e-04   
ref|XP_002018957.1|  GL26092                                          52.4    1e-04   
ref|XP_766308.1|  hypothetical protein                                50.8    1e-04   
ref|XP_001962958.1|  GF15697                                          52.0    1e-04   
ref|XP_003869207.1|  Gcd10 protein                                    52.0    2e-04   
ref|XP_011778275.1|  hypothetical protein, conserved                  52.0    2e-04   
ref|XP_823126.1|  hypothetical protein                                52.0    2e-04   
ref|XP_007373838.1|  hypothetical protein SPAPADRAFT_59679            52.0    2e-04   
ref|XP_953988.1|  hypothetical protein                                51.6    2e-04   
ref|XP_011684876.1|  PREDICTED: tRNA (adenine(58)-N(1))-methyltra...  51.6    2e-04   
gb|EPY21200.1|  tRNA (adenine-N(1)-)-methyltransferase non-cataly...  51.6    2e-04   
emb|CEG78028.1|  hypothetical protein RMATCC62417_12692               49.7    3e-04   
ref|XP_001970034.1|  GG23610                                          51.6    3e-04   
ref|XP_001628486.1|  predicted protein                                51.2    3e-04   
ref|XP_007763614.1|  Gcd10p-domain-containing protein                 51.2    3e-04   
ref|XP_002078391.1|  GD22565                                          51.2    3e-04   
ref|XP_002035948.1|  GM14132                                          51.2    3e-04   
ref|XP_003376396.1|  hypothetical protein Tsp_00570                   50.8    4e-04   
emb|CDJ52234.1|  hypothetical protein, conserved                      50.8    4e-04   
ref|NP_995638.1|  CG9596, isoform B                                   50.8    4e-04   
ref|XP_001442484.1|  hypothetical protein                             50.4    4e-04   
gb|KIK49495.1|  hypothetical protein CY34DRAFT_796912                 50.8    4e-04   
gb|ETS64161.1|  hypothetical protein PaG_01397                        50.8    4e-04   
ref|XP_011390334.1|  hypothetical protein UMAG_10661                  50.8    5e-04   
dbj|GAC74192.1|  tRNA(1-methyladenosine) methyltransferase, subun...  50.8    5e-04   
emb|CEJ02829.1|  hypothetical protein RMCBS344292_16823               50.4    5e-04   
ref|XP_003680516.1|  hypothetical protein TDEL_0C04160                50.4    6e-04   
emb|CEG64158.1|  hypothetical protein RMATCC62417_01187               50.4    6e-04   
ref|XP_319025.4|  AGAP009904-PA                                       50.4    6e-04   
gb|EPZ34931.1|  Eukaryotic initiation factor 3, gamma subunit dom...  50.1    8e-04   



>ref|XP_010664801.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X2 [Vitis vinifera]
Length=303

 Score =   243 bits (620),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = +3

Query  159  IPENSYQNKSF-NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCP  335
            + +NS QN S  NPR+TWEGCSVLLDINDGDRLVFARL+ ++ LKIGNKN SLQPLIGCP
Sbjct  1    MSQNSLQNDSIQNPRVTWEGCSVLLDINDGDRLVFARLSASATLKIGNKNCSLQPLIGCP  60

Query  336  YGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDI  515
            +GSLFQV+ G  GP L+RV+P+ EGN+L+   D Q  D  KDNRA+VDNN AQSLTGEDI
Sbjct  61   FGSLFQVDNGPRGPYLSRVTPSAEGNDLQETQDCQLKDEPKDNRAIVDNNKAQSLTGEDI  120

Query  516  DDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            D+MRRQGA+GD+IV+ALI+NSAT+EKKT FSQEKY+LKKQKKY+P+VLLRRP+ RSICEA
Sbjct  121  DEMRRQGATGDEIVEALISNSATYEKKTSFSQEKYRLKKQKKYSPRVLLRRPFCRSICEA  180



>ref|XP_002280127.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X1 [Vitis vinifera]
 emb|CBI19850.3| unnamed protein product [Vitis vinifera]
Length=464

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = +3

Query  159  IPENSYQNKSF-NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCP  335
            + +NS QN S  NPR+TWEGCSVLLDINDGDRLVFARL+ ++ LKIGNKN SLQPLIGCP
Sbjct  1    MSQNSLQNDSIQNPRVTWEGCSVLLDINDGDRLVFARLSASATLKIGNKNCSLQPLIGCP  60

Query  336  YGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDI  515
            +GSLFQV+ G  GP L+RV+P+ EGN+L+   D Q  D  KDNRA+VDNN AQSLTGEDI
Sbjct  61   FGSLFQVDNGPRGPYLSRVTPSAEGNDLQETQDCQLKDEPKDNRAIVDNNKAQSLTGEDI  120

Query  516  DDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            D+MRRQGA+GD+IV+ALI+NSAT+EKKT FSQEKY+LKKQKKY+P+VLLRRP+ RSICEA
Sbjct  121  DEMRRQGATGDEIVEALISNSATYEKKTSFSQEKYRLKKQKKYSPRVLLRRPFCRSICEA  180



>ref|XP_009613531.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X1 [Nicotiana tomentosiformis]
Length=449

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 155/185 (84%), Gaps = 4/185 (2%)
 Frame = +3

Query  141  MSVNEAIPENSYQNKSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQP  320
            MS+N+A+ E+S QN++ N R+TWEGC+VLLDINDGDRLVFARLT AS LKIGNK   LQP
Sbjct  1    MSINKAVEEDSNQNQNQNSRLTWEGCNVLLDINDGDRLVFARLTAASTLKIGNKKCCLQP  60

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSL  500
            LIGCP+GSLF VE G+ GP L+R  P  EGNNL    + +  D SKDNRA+VDNNTAQSL
Sbjct  61   LIGCPFGSLFLVESGKEGPFLSRFVPNAEGNNL----EEKDVDGSKDNRAIVDNNTAQSL  116

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYAR  680
            T EDID+MRRQGA GD+IV ALIANSATFEKKT FSQEKY++KKQKKYAP+VL+RRP AR
Sbjct  117  TSEDIDEMRRQGAKGDEIVDALIANSATFEKKTLFSQEKYRIKKQKKYAPRVLVRRPSAR  176

Query  681  SICEA  695
            SICEA
Sbjct  177  SICEA  181



>ref|XP_009613532.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X2 [Nicotiana tomentosiformis]
Length=448

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 155/185 (84%), Gaps = 4/185 (2%)
 Frame = +3

Query  141  MSVNEAIPENSYQNKSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQP  320
            MS+N+A+ E+S QN++ N R+TWEGC+VLLDINDGDRLVFARLT AS LKIGNK   LQP
Sbjct  1    MSINKAVEEDSNQNQNQNSRLTWEGCNVLLDINDGDRLVFARLTAASTLKIGNKKCCLQP  60

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSL  500
            LIGCP+GSLF VE G+ GP L+R  P  EGNNL    + +  D SKDNRA+VDNNTAQSL
Sbjct  61   LIGCPFGSLFLVESGKEGPFLSRFVPNAEGNNL----EEKDVDGSKDNRAIVDNNTAQSL  116

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYAR  680
            T EDID+MRRQGA GD+IV ALIANSATFEKKT FSQEKY++KKQKKYAP+VL+RRP AR
Sbjct  117  TSEDIDEMRRQGAKGDEIVDALIANSATFEKKTLFSQEKYRIKKQKKYAPRVLVRRPSAR  176

Query  681  SICEA  695
            SICEA
Sbjct  177  SICEA  181



>ref|XP_009783027.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X3 [Nicotiana sylvestris]
Length=446

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 156/185 (84%), Gaps = 6/185 (3%)
 Frame = +3

Query  141  MSVNEAIPENSYQNKSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQP  320
            MS+N+A+ E+S QN+  N R+TWEGC+VLLDINDGDRLVFARLT AS LKIGNK   LQP
Sbjct  1    MSINKAVEEDSNQNQ--NSRLTWEGCNVLLDINDGDRLVFARLTAASTLKIGNKKCCLQP  58

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSL  500
            LIGCP+GSLF VE G+ GPIL+R  P  EGNNL    + +  D SKDNRA+VDNNTAQSL
Sbjct  59   LIGCPFGSLFLVESGKEGPILSRFVPNAEGNNL----EKKDVDGSKDNRAIVDNNTAQSL  114

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYAR  680
            T EDID+MRRQGA GD+IV+ALIANSATFEKKT FSQEKY++KKQKKYAP+VL+RRP AR
Sbjct  115  TSEDIDEMRRQGAKGDEIVEALIANSATFEKKTLFSQEKYRIKKQKKYAPRVLVRRPTAR  174

Query  681  SICEA  695
            SICEA
Sbjct  175  SICEA  179



>ref|XP_009783025.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X1 [Nicotiana sylvestris]
 ref|XP_009783026.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X2 [Nicotiana sylvestris]
Length=447

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 156/185 (84%), Gaps = 6/185 (3%)
 Frame = +3

Query  141  MSVNEAIPENSYQNKSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQP  320
            MS+N+A+ E+S QN+  N R+TWEGC+VLLDINDGDRLVFARLT AS LKIGNK   LQP
Sbjct  1    MSINKAVEEDSNQNQ--NSRLTWEGCNVLLDINDGDRLVFARLTAASTLKIGNKKCCLQP  58

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSL  500
            LIGCP+GSLF VE G+ GPIL+R  P  EGNNL    + +  D SKDNRA+VDNNTAQSL
Sbjct  59   LIGCPFGSLFLVESGKEGPILSRFVPNAEGNNL----EKKDVDGSKDNRAIVDNNTAQSL  114

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYAR  680
            T EDID+MRRQGA GD+IV+ALIANSATFEKKT FSQEKY++KKQKKYAP+VL+RRP AR
Sbjct  115  TSEDIDEMRRQGAKGDEIVEALIANSATFEKKTLFSQEKYRIKKQKKYAPRVLVRRPTAR  174

Query  681  SICEA  695
            SICEA
Sbjct  175  SICEA  179



>ref|XP_011083530.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 [Sesamum indicum]
Length=457

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  180  NKSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVE  359
            ++S N RITW+GCSVLLDINDGDR++FARLT  S++KIGN + SLQPLIGCP+GS FQVE
Sbjct  11   SRSQNRRITWDGCSVLLDINDGDRVLFARLTAGSKIKIGNNSCSLQPLIGCPFGSSFQVE  70

Query  360  GGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGA  539
             G  GP LARV P+ EGNNL  + DSQ  + S+DNRA+VDNNTAQ+LTGEDIDDMRR+G 
Sbjct  71   VGGDGPFLARVIPSTEGNNLVEKMDSQIMEESRDNRAIVDNNTAQTLTGEDIDDMRRKGV  130

Query  540  SGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            +GD+IV+ALIANSATFEKKT FSQEKY++KKQKKYAP+VLLRRP+ARSICEA
Sbjct  131  TGDEIVEALIANSATFEKKTAFSQEKYRIKKQKKYAPRVLLRRPFARSICEA  182



>ref|XP_012073811.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 [Jatropha curcas]
 gb|KDP36934.1| hypothetical protein JCGZ_08225 [Jatropha curcas]
Length=445

 Score =   234 bits (598),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 153/179 (85%), Gaps = 1/179 (1%)
 Frame = +3

Query  159  IPENSYQNKSF-NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCP  335
            + +N+ ++ S  NPR+TWEGCSVLLDINDGDRLVF+RLTP S LKIGNKN SL+PLIGCP
Sbjct  1    MSQNNLESDSLQNPRVTWEGCSVLLDINDGDRLVFSRLTPGSNLKIGNKNLSLRPLIGCP  60

Query  336  YGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDI  515
            +GSLFQ+E G+ GP L+R  P+ +GNN + +SD +  D S+DNRAL+DNN AQSLTG+DI
Sbjct  61   FGSLFQIENGKEGPCLSRFIPSKQGNNAEEKSDCEMIDESRDNRALIDNNKAQSLTGDDI  120

Query  516  DDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            D MRRQGA G++I+ ALIANSATFEKKT FSQEKY+LKKQKKYAP+VLLRRP+ RSICE
Sbjct  121  DAMRRQGAKGEEIIDALIANSATFEKKTLFSQEKYRLKKQKKYAPRVLLRRPFTRSICE  179



>gb|EYU38824.1| hypothetical protein MIMGU_mgv1a006549mg [Erythranthe guttata]
Length=439

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPRITWEGCSVLLDINDGDR++F+RL   +++KIGNKN SLQPLIGCP+GS FQV+ GE 
Sbjct  15   NPRITWEGCSVLLDINDGDRVLFSRLNGGAKIKIGNKNCSLQPLIGCPFGSSFQVDVGED  74

Query  372  GPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDD  551
            GP L+RV P  EGNNL  + D +  +  +DNRALVDNNTAQ+LTGEDID+MRR+G +GD+
Sbjct  75   GPFLSRVGPASEGNNLGEKMDCEVMEECRDNRALVDNNTAQTLTGEDIDEMRRKGVTGDE  134

Query  552  IVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            IV+ALIANSATF+KKT FSQEKY++KKQKKYAP++L+RRP+ARSICEA
Sbjct  135  IVEALIANSATFDKKTAFSQEKYRIKKQKKYAPRILVRRPFARSICEA  182



>ref|XP_008364932.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6-like [Malus domestica]
Length=451

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 154/185 (83%), Gaps = 3/185 (2%)
 Frame = +3

Query  141  MSVNEAIPENSYQNKSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQP  320
            M ++E+ P+    + S NPR TW+GCSVLLDINDGDRLVF+RL+  ++LKIGNKN SLQP
Sbjct  1    MEISESKPQ---IDSSENPRSTWDGCSVLLDINDGDRLVFSRLSAGAKLKIGNKNCSLQP  57

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSL  500
            LIGCP+GS F+VE G  GP LAR +P+ E NN++ + D Q+ D  +DNRALVDNN AQSL
Sbjct  58   LIGCPFGSFFRVENGAEGPYLARYTPSTEVNNVQEKGDGQSIDEFRDNRALVDNNKAQSL  117

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYAR  680
            TGEDI+ MR+QGA+GD+IV+ALIANSATFEKKT FSQEKY+LKKQKKYAP VL+RRP+ R
Sbjct  118  TGEDINAMRQQGATGDEIVEALIANSATFEKKTVFSQEKYRLKKQKKYAPIVLMRRPFTR  177

Query  681  SICEA  695
            SICEA
Sbjct  178  SICEA  182



>ref|XP_009783029.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X4 [Nicotiana sylvestris]
Length=433

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 151/180 (84%), Gaps = 6/180 (3%)
 Frame = +3

Query  141  MSVNEAIPENSYQNKSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQP  320
            MS+N+A+ E+S QN+  N R+TWEGC+VLLDINDGDRLVFARLT AS LKIGNK   LQP
Sbjct  1    MSINKAVEEDSNQNQ--NSRLTWEGCNVLLDINDGDRLVFARLTAASTLKIGNKKCCLQP  58

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSL  500
            LIGCP+GSLF VE G+ GPIL+R  P  EGNNL    + +  D SKDNRA+VDNNTAQSL
Sbjct  59   LIGCPFGSLFLVESGKEGPILSRFVPNAEGNNL----EKKDVDGSKDNRAIVDNNTAQSL  114

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYAR  680
            T EDID+MRRQGA GD+IV+ALIANSATFEKKT FSQEKY++KKQKKYAP+VL+RRP AR
Sbjct  115  TSEDIDEMRRQGAKGDEIVEALIANSATFEKKTLFSQEKYRIKKQKKYAPRVLVRRPTAR  174



>ref|XP_010104442.1| tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit 
trm6 [Morus notabilis]
 gb|EXC00975.1| tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit 
trm6 [Morus notabilis]
Length=448

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR+TWEGCSVLLDINDGDRLVFARL+ A++LKIGNKN SLQPLIGC +GS+F+VE G G
Sbjct  13   NPRMTWEGCSVLLDINDGDRLVFARLSAAAKLKIGNKNCSLQPLIGCSFGSVFRVETGIG  72

Query  372  GPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDD  551
            GP L+R +P+ EGNN K  +  Q+ + S+DNRALVD+N AQSLTGEDID MRR+GA+GD+
Sbjct  73   GPYLSRFNPSSEGNNDKENNGFQSKEESRDNRALVDDNKAQSLTGEDIDAMRREGATGDE  132

Query  552  IVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            IV+ALIANSATFEKKT FSQEKY++KKQKKYAPKVLLRRP ARSICEA
Sbjct  133  IVEALIANSATFEKKTLFSQEKYRIKKQKKYAPKVLLRRPLARSICEA  180



>ref|XP_007222100.1| hypothetical protein PRUPE_ppa005656mg [Prunus persica]
 gb|EMJ23299.1| hypothetical protein PRUPE_ppa005656mg [Prunus persica]
Length=449

 Score =   230 bits (586),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 149/178 (84%), Gaps = 1/178 (1%)
 Frame = +3

Query  165  ENSYQNKSF-NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYG  341
            EN  Q+  F +PR TWEGCSVLLDINDGDRLVFARL+  + LKIGNKN SLQPL+GCP+G
Sbjct  3    ENKAQSDLFESPRSTWEGCSVLLDINDGDRLVFARLSSGATLKIGNKNCSLQPLLGCPFG  62

Query  342  SLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDD  521
            S F+VE G  GP L+R +P+ EGNN+  + D Q+ D  +DNRALVDNN AQSLTGEDI++
Sbjct  63   SFFRVENGTQGPYLSRYTPSTEGNNVLEKGDGQSIDELRDNRALVDNNKAQSLTGEDINE  122

Query  522  MRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            MRR GA+GD+IV+ALIANSATFEKKT FSQEKY+LKKQKKYAP VLLRRP+ RSICEA
Sbjct  123  MRRLGATGDEIVEALIANSATFEKKTVFSQEKYRLKKQKKYAPIVLLRRPFTRSICEA  180



>ref|XP_002510522.1| translation initiation factor, putative [Ricinus communis]
 gb|EEF52709.1| translation initiation factor, putative [Ricinus communis]
Length=514

 Score =   231 bits (590),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR+TWEG SVLLDINDGDRLVFARLTP S LKIGNKNYSL+PLIGC +GSLFQ++ G  
Sbjct  13   NPRVTWEGYSVLLDINDGDRLVFARLTPGSTLKIGNKNYSLRPLIGCTFGSLFQIDNGPE  72

Query  372  GPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDD  551
            GP L+R  P  EGNN++ + D +  + SKDNRA++DNN AQ+LTGEDID+MRRQGA GD+
Sbjct  73   GPCLSRFVPATEGNNVEEKGDCEIIEESKDNRAILDNNLAQTLTGEDIDEMRRQGAKGDE  132

Query  552  IVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            I++ALIANS TFEKKT FSQEKY++KKQKKYAP+VLLRRP+ RSICEA
Sbjct  133  IIEALIANSTTFEKKTSFSQEKYRIKKQKKYAPRVLLRRPFTRSICEA  180



>gb|KHF97948.1| tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit 
trm6 [Gossypium arboreum]
Length=453

 Score =   229 bits (585),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  186  SFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGG  365
            + NPR+TWEGCSVLLDINDGDRLVFARL+  S LKIGNK +SLQPLIGCP+GSLFQVE G
Sbjct  11   TVNPRVTWEGCSVLLDINDGDRLVFARLSAGSTLKIGNKTFSLQPLIGCPFGSLFQVESG  70

Query  366  EGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASG  545
            +  P L+R  P  E NN++ E   Q  + S+DNRA++DNN AQSLTG+DID MRRQGA+G
Sbjct  71   KEKPYLSRFIPPTEENNVQDEGGCQLQEESRDNRAIIDNNQAQSLTGDDIDAMRRQGATG  130

Query  546  DDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            ++IV+ALIANSATF+KKTQFSQEKY+LKKQKKYAP+VLLRRP++RSICEA
Sbjct  131  NEIVEALIANSATFDKKTQFSQEKYRLKKQKKYAPRVLLRRPFSRSICEA  180



>gb|KJB58105.1| hypothetical protein B456_009G195100 [Gossypium raimondii]
Length=489

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 166/213 (78%), Gaps = 6/213 (3%)
 Frame = +3

Query  72   QLRISRVELNQDHFFFPL*IKIKMSVNEAIPENSYQNK-----SFNPRITWEGCSVLLDI  236
            +L++ ++ + +  FF  L   I+ ++      N  +NK     + NPR+TWEGCSVLLDI
Sbjct  5    ELKLFQILVRKVQFFLTL-CGIRANILFNKGSNMSENKPESGPTVNPRVTWEGCSVLLDI  63

Query  237  NDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILARVSPTIEGNN  416
            NDGDRL+FARL+  S LKIGNK +SLQPLIGCP+GSLFQVE G+  P L+R  P  E NN
Sbjct  64   NDGDRLLFARLSAGSTLKIGNKTFSLQPLIGCPFGSLFQVESGKEKPYLSRFIPPTEENN  123

Query  417  LKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKK  596
            ++ E   Q  + S+DNRA++DNN AQSLTG+DID MRRQGA+G++IV+ALIANSATF+KK
Sbjct  124  VQDEGGCQLQEESRDNRAIIDNNQAQSLTGDDIDAMRRQGATGNEIVEALIANSATFDKK  183

Query  597  TQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            TQFSQEKY+LKKQKKYAP+VLLRRP++RSICEA
Sbjct  184  TQFSQEKYRLKKQKKYAPRVLLRRPFSRSICEA  216



>ref|XP_008221276.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X2 [Prunus mume]
Length=434

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 148/178 (83%), Gaps = 1/178 (1%)
 Frame = +3

Query  165  ENSYQNKSF-NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYG  341
            EN  Q+  F +PR TWEGCSVLLDINDGDRLVFARL+  + LKIGNKN SLQPL+GCP+G
Sbjct  3    ENKPQSDLFESPRSTWEGCSVLLDINDGDRLVFARLSAGATLKIGNKNCSLQPLLGCPFG  62

Query  342  SLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDD  521
            S F+VE G  GP L+R +P+ EGNN+  + D Q+ D  +DNRALVDNN AQSLTGEDI++
Sbjct  63   SFFRVENGAQGPYLSRYTPSTEGNNVLEKGDGQSIDELRDNRALVDNNKAQSLTGEDINE  122

Query  522  MRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            MRR GA+GD+IV ALIANSATFEKKT FSQEKY+LKKQKKYAP VLLRRP+ RSICEA
Sbjct  123  MRRLGATGDEIVDALIANSATFEKKTVFSQEKYRLKKQKKYAPIVLLRRPFTRSICEA  180



>ref|XP_008357132.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6-like [Malus domestica]
Length=451

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 153/185 (83%), Gaps = 3/185 (2%)
 Frame = +3

Query  141  MSVNEAIPENSYQNKSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQP  320
            M ++E+ P+    + S  PR TW+GCSVLLDINDGDRLVF+RL+  ++LKIGNKN SLQP
Sbjct  1    MEISESKPQ---IDSSEXPRSTWDGCSVLLDINDGDRLVFSRLSAGAKLKIGNKNCSLQP  57

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSL  500
            LIGCP+GS F+VE G  GP LAR +P+ E NN++ + D Q+ D  +DNRALVDNN AQSL
Sbjct  58   LIGCPFGSFFRVENGAEGPYLARYTPSTEVNNVQEKGDGQSIDEFRDNRALVDNNKAQSL  117

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYAR  680
            TGEDI+ MR+QGA+GD+IV+ALIANSATFEKKT FSQEKY+LKKQKKYAP VL+RRP+ R
Sbjct  118  TGEDINAMRQQGATGDEIVEALIANSATFEKKTVFSQEKYRLKKQKKYAPIVLMRRPFTR  177

Query  681  SICEA  695
            SICEA
Sbjct  178  SICEA  182



>ref|XP_004291368.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 [Fragaria vesca subsp. vesca]
Length=451

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR+TW+GCSVLLDINDGDRLVF+RL+  ++LKIGNKN SLQPLIGCP+GS F+VE GE 
Sbjct  13   NPRVTWDGCSVLLDINDGDRLVFSRLSGGAKLKIGNKNCSLQPLIGCPFGSFFRVENGED  72

Query  372  GPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDD  551
            GP L+R +P+ EGN+++ + D ++ D  +DNRALVDNN AQSLTG+ I++MRRQGA+GD+
Sbjct  73   GPYLSRYTPSNEGNSVQEQGDCESKDELRDNRALVDNNKAQSLTGDAINEMRRQGATGDE  132

Query  552  IVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            IV+ALIANSATFEKKT FSQEKY+LKKQKKYAP VLLRRP+ RSICEA
Sbjct  133  IVEALIANSATFEKKTVFSQEKYRLKKQKKYAPIVLLRRPFTRSICEA  180



>ref|XP_008221275.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X1 [Prunus mume]
Length=449

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 148/178 (83%), Gaps = 1/178 (1%)
 Frame = +3

Query  165  ENSYQNKSF-NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYG  341
            EN  Q+  F +PR TWEGCSVLLDINDGDRLVFARL+  + LKIGNKN SLQPL+GCP+G
Sbjct  3    ENKPQSDLFESPRSTWEGCSVLLDINDGDRLVFARLSAGATLKIGNKNCSLQPLLGCPFG  62

Query  342  SLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDD  521
            S F+VE G  GP L+R +P+ EGNN+  + D Q+ D  +DNRALVDNN AQSLTGEDI++
Sbjct  63   SFFRVENGAQGPYLSRYTPSTEGNNVLEKGDGQSIDELRDNRALVDNNKAQSLTGEDINE  122

Query  522  MRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            MRR GA+GD+IV ALIANSATFEKKT FSQEKY+LKKQKKYAP VLLRRP+ RSICEA
Sbjct  123  MRRLGATGDEIVDALIANSATFEKKTVFSQEKYRLKKQKKYAPIVLLRRPFTRSICEA  180



>ref|XP_010320424.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X1 [Solanum lycopersicum]
Length=447

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 152/185 (82%), Gaps = 6/185 (3%)
 Frame = +3

Query  141  MSVNEAIPENSYQNKSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQP  320
            MS+ EA+ E+S QN   N R+T+EGC+VLLDINDGDRLVF+RLT AS LKIGNK  SLQP
Sbjct  1    MSIEEAVDEDSKQNH--NSRLTYEGCNVLLDINDGDRLVFSRLTAASTLKIGNKKCSLQP  58

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSL  500
            LIGCP+GSLFQVE G+ G  L R     EGN L    + +  D SKDNRALVDNNTAQSL
Sbjct  59   LIGCPFGSLFQVEPGKEGTFLTRFVENAEGNGL----EEKDVDGSKDNRALVDNNTAQSL  114

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYAR  680
            T EDID+MR+QGA GD+IV+ALIANSATFEKKT FSQ+KY++KKQKKYAP+VLLRRP+AR
Sbjct  115  TSEDIDEMRKQGAKGDEIVEALIANSATFEKKTLFSQDKYRVKKQKKYAPRVLLRRPFAR  174

Query  681  SICEA  695
            SICEA
Sbjct  175  SICEA  179



>ref|XP_004238352.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X2 [Solanum lycopersicum]
Length=446

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 152/185 (82%), Gaps = 6/185 (3%)
 Frame = +3

Query  141  MSVNEAIPENSYQNKSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQP  320
            MS+ EA+ E+S QN   N R+T+EGC+VLLDINDGDRLVF+RLT AS LKIGNK  SLQP
Sbjct  1    MSIEEAVDEDSKQNH--NSRLTYEGCNVLLDINDGDRLVFSRLTAASTLKIGNKKCSLQP  58

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSL  500
            LIGCP+GSLFQVE G+ G  L R     EGN L    + +  D SKDNRALVDNNTAQSL
Sbjct  59   LIGCPFGSLFQVEPGKEGTFLTRFVENAEGNGL----EEKDVDGSKDNRALVDNNTAQSL  114

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYAR  680
            T EDID+MR+QGA GD+IV+ALIANSATFEKKT FSQ+KY++KKQKKYAP+VLLRRP+AR
Sbjct  115  TSEDIDEMRKQGAKGDEIVEALIANSATFEKKTLFSQDKYRVKKQKKYAPRVLLRRPFAR  174

Query  681  SICEA  695
            SICEA
Sbjct  175  SICEA  179



>ref|XP_008387940.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 [Malus domestica]
Length=451

 Score =   227 bits (579),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 152/185 (82%), Gaps = 3/185 (2%)
 Frame = +3

Query  141  MSVNEAIPENSYQNKSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQP  320
            M ++E+ P+      S NPR TW+GCSVLLDINDGDRLVFARL+  +++KIGN N SLQP
Sbjct  1    MEISESEPQIEL---SENPRATWDGCSVLLDINDGDRLVFARLSAGAKVKIGNTNCSLQP  57

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSL  500
            LIGCP+GS F+VE G  GP LAR +P+ EGNN+  + + Q+ D  +DNRALVDNN AQSL
Sbjct  58   LIGCPFGSFFRVENGAEGPYLARYTPSTEGNNVLEKGEIQSVDEFRDNRALVDNNKAQSL  117

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYAR  680
            TGE+I+ MR+QGA+GD+IV+ALIANSATFEKKT FSQEKY+L+KQKKYAP VL+RRPY R
Sbjct  118  TGEEINAMRQQGATGDEIVEALIANSATFEKKTVFSQEKYRLRKQKKYAPIVLMRRPYTR  177

Query  681  SICEA  695
            SICEA
Sbjct  178  SICEA  182



>gb|EPS62305.1| hypothetical protein M569_12486, partial [Genlisea aurea]
Length=423

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 155/180 (86%), Gaps = 3/180 (2%)
 Frame = +3

Query  165  ENS--YQNKSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPY  338
            ENS  Y + + N RITWEGCSVLLD+NDGDRLVF+RLT  S++KIGNKN SLQPLIGCP+
Sbjct  4    ENSEEYLSVNRNTRITWEGCSVLLDVNDGDRLVFSRLTGGSKIKIGNKNCSLQPLIGCPF  63

Query  339  GSLFQVEGGEGGPILARVSPTIE-GNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDI  515
            GS FQVE GE GP L+R++ ++E G ++ A++D    +  +DNRA+VDNNTAQSLTGEDI
Sbjct  64   GSTFQVEDGEDGPHLSRMTSSVEGGESVDAKNDHSPMEECRDNRAIVDNNTAQSLTGEDI  123

Query  516  DDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            DDMRR+GASG +IV+ALI+NSATFEKKT +SQEKY++KKQKKYAPKVLLRRP+ARSICEA
Sbjct  124  DDMRRKGASGYEIVEALISNSATFEKKTAYSQEKYRIKKQKKYAPKVLLRRPFARSICEA  183



>ref|XP_007017787.1| Eukaryotic initiation factor 3 gamma subunit family protein [Theobroma 
cacao]
 gb|EOY15012.1| Eukaryotic initiation factor 3 gamma subunit family protein [Theobroma 
cacao]
Length=451

 Score =   225 bits (573),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 148/180 (82%), Gaps = 1/180 (1%)
 Frame = +3

Query  159  IPENSYQNKSF-NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCP  335
            + EN  Q+ S  NPR+TWEGCSVLLDINDGDRLVFARL+  S LK GNK  SLQPLIGCP
Sbjct  1    MSENKPQSDSIQNPRVTWEGCSVLLDINDGDRLVFARLSAGSTLKFGNKTCSLQPLIGCP  60

Query  336  YGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDI  515
            +GSLFQVE G+  P L+R  P+ E  N + E   Q  + S+DNRA++DNN AQ LTGEDI
Sbjct  61   FGSLFQVESGKEKPYLSRYIPSTEEGNAQDEGGCQLKEESRDNRAIIDNNQAQCLTGEDI  120

Query  516  DDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            D M+RQGA+G++IV+ALIANSATFEKKTQFSQEKY+LKKQKKYAPKVLLRRP++RSICEA
Sbjct  121  DAMKRQGATGNEIVEALIANSATFEKKTQFSQEKYRLKKQKKYAPKVLLRRPFSRSICEA  180



>ref|XP_006342041.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6-like isoform X2 [Solanum tuberosum]
Length=446

 Score =   224 bits (571),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 150/185 (81%), Gaps = 6/185 (3%)
 Frame = +3

Query  141  MSVNEAIPENSYQNKSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQP  320
            MS+ +A+ E+  QN   N R+T+EGC+VLLDINDGDRLVF+RLT AS LKIGNK  SLQP
Sbjct  1    MSIEKAVDEDLKQNH--NSRLTYEGCNVLLDINDGDRLVFSRLTAASTLKIGNKKCSLQP  58

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSL  500
            LIGCP+GSLFQVE G+ G  L R     EGN L    + +  D SKDNRALVDNNTAQSL
Sbjct  59   LIGCPFGSLFQVESGKEGTFLTRFVENAEGNGL----EEKDVDGSKDNRALVDNNTAQSL  114

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYAR  680
            T EDID+MR QGA GD+IV+ALIANSATFEKKT FSQEKY++KKQKKYAP+VLLRRP+AR
Sbjct  115  TSEDIDEMRNQGAKGDEIVEALIANSATFEKKTLFSQEKYRVKKQKKYAPRVLLRRPFAR  174

Query  681  SICEA  695
            SICEA
Sbjct  175  SICEA  179



>ref|XP_006342040.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6-like isoform X1 [Solanum tuberosum]
Length=447

 Score =   224 bits (571),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 150/185 (81%), Gaps = 6/185 (3%)
 Frame = +3

Query  141  MSVNEAIPENSYQNKSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQP  320
            MS+ +A+ E+  QN   N R+T+EGC+VLLDINDGDRLVF+RLT AS LKIGNK  SLQP
Sbjct  1    MSIEKAVDEDLKQNH--NSRLTYEGCNVLLDINDGDRLVFSRLTAASTLKIGNKKCSLQP  58

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSL  500
            LIGCP+GSLFQVE G+ G  L R     EGN L    + +  D SKDNRALVDNNTAQSL
Sbjct  59   LIGCPFGSLFQVESGKEGTFLTRFVENAEGNGL----EEKDVDGSKDNRALVDNNTAQSL  114

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYAR  680
            T EDID+MR QGA GD+IV+ALIANSATFEKKT FSQEKY++KKQKKYAP+VLLRRP+AR
Sbjct  115  TSEDIDEMRNQGAKGDEIVEALIANSATFEKKTLFSQEKYRVKKQKKYAPRVLLRRPFAR  174

Query  681  SICEA  695
            SICEA
Sbjct  175  SICEA  179



>ref|XP_004499247.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6-like [Cicer arietinum]
Length=439

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  177  QNKSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQV  356
            +NK  + RITWEGCSVLLDINDGDRLVFARL+PA++LKIGNKN SL+PLIGCP+G++FQ+
Sbjct  4    ENKEASSRITWEGCSVLLDINDGDRLVFARLSPAAKLKIGNKNCSLKPLIGCPFGTVFQL  63

Query  357  EGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQG  536
            +    GP L+ + P    NN +   D Q     +DNR+L+DNNTAQSLTGEDI+DMRRQG
Sbjct  64   DSSSDGPFLSPLQPKGNVNNTEEIKDGQLNGEVRDNRSLIDNNTAQSLTGEDIEDMRRQG  123

Query  537  ASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            A GD+I++ALIANSATFEKKT FSQEKY+LKKQKKYAPKVL+RRP ARSICEA
Sbjct  124  AKGDEIIEALIANSATFEKKTSFSQEKYRLKKQKKYAPKVLMRRPVARSICEA  176



>ref|XP_008444799.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X3 [Cucumis melo]
Length=448

 Score =   222 bits (566),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 147/173 (85%), Gaps = 5/173 (3%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR+TWEGCSVLLD+NDGDRLVFARL+PAS LKIGNK++SL+PLIGCP+GSLFQ+E GE 
Sbjct  14   NPRLTWEGCSVLLDVNDGDRLVFARLSPASTLKIGNKSFSLKPLIGCPFGSLFQIENGEN  73

Query  372  GPILARVSPTI-EGNNLKAESDSQTTDVSK----DNRALVDNNTAQSLTGEDIDDMRRQG  536
            GP LARV P+  EG N +   + +   V+K    DNRALVDNN AQSL+ EDID MR QG
Sbjct  74   GPQLARVMPSREEGINCQETEEMKEEQVTKDELRDNRALVDNNKAQSLSSEDIDAMRSQG  133

Query  537  ASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            A+GD+IV+ALIANSATF+KKT FSQEKY+L+KQKKYAP+VLLRRP+ RSICEA
Sbjct  134  ATGDEIVEALIANSATFDKKTVFSQEKYRLRKQKKYAPRVLLRRPFTRSICEA  186



>ref|XP_009335116.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 [Pyrus x bretschneideri]
Length=451

 Score =   222 bits (566),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 151/185 (82%), Gaps = 3/185 (2%)
 Frame = +3

Query  141  MSVNEAIPENSYQNKSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQP  320
            M ++E+ P+      S NPR TW+GCSVLLDINDGDRLVFARL+  +++KIGNKN SLQP
Sbjct  1    MEISESKPQIEL---SENPRATWDGCSVLLDINDGDRLVFARLSAGAKVKIGNKNCSLQP  57

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSL  500
            LIGCP+GS F+VE G  GP LAR + + EGNN+  + + Q+ D  +DNRALVDNN AQSL
Sbjct  58   LIGCPFGSFFRVENGAEGPYLARYTLSTEGNNVPEKGEIQSVDEFRDNRALVDNNKAQSL  117

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYAR  680
            TGEDI+ +R+QGA+GD+IV+ALIANSATFE KT FSQEKY+LKKQKKYAP VL+RRP+ R
Sbjct  118  TGEDINAIRQQGATGDEIVEALIANSATFEMKTVFSQEKYRLKKQKKYAPIVLMRRPFTR  177

Query  681  SICEA  695
            SICEA
Sbjct  178  SICEA  182



>ref|XP_008444796.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X1 [Cucumis melo]
 ref|XP_008444797.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X1 [Cucumis melo]
Length=452

 Score =   222 bits (566),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 147/173 (85%), Gaps = 5/173 (3%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR+TWEGCSVLLD+NDGDRLVFARL+PAS LKIGNK++SL+PLIGCP+GSLFQ+E GE 
Sbjct  14   NPRLTWEGCSVLLDVNDGDRLVFARLSPASTLKIGNKSFSLKPLIGCPFGSLFQIENGEN  73

Query  372  GPILARVSPTI-EGNNLKAESDSQTTDVSK----DNRALVDNNTAQSLTGEDIDDMRRQG  536
            GP LARV P+  EG N +   + +   V+K    DNRALVDNN AQSL+ EDID MR QG
Sbjct  74   GPQLARVMPSREEGINCQETEEMKEEQVTKDELRDNRALVDNNKAQSLSSEDIDAMRSQG  133

Query  537  ASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            A+GD+IV+ALIANSATF+KKT FSQEKY+L+KQKKYAP+VLLRRP+ RSICEA
Sbjct  134  ATGDEIVEALIANSATFDKKTVFSQEKYRLRKQKKYAPRVLLRRPFTRSICEA  186



>ref|XP_006435169.1| hypothetical protein CICLE_v10001119mg [Citrus clementina]
 gb|ESR48409.1| hypothetical protein CICLE_v10001119mg [Citrus clementina]
Length=401

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 148/166 (89%), Gaps = 1/166 (1%)
 Frame = +3

Query  198  RITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGP  377
            ++TWEGCSVLLDINDGDRLVFARLT  S LKIGNKN SLQPLIGCP+GSLFQV+ G+ GP
Sbjct  15   QLTWEGCSVLLDINDGDRLVFARLTSGSTLKIGNKNCSLQPLIGCPFGSLFQVDNGKEGP  74

Query  378  ILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIV  557
             L+RV P+ E ++++ + D+Q +   +DNRA+VD+N AQSL+GEDID+MRRQGA+G++IV
Sbjct  75   NLSRVIPSTE-DDVQEKEDAQISGEFRDNRAIVDDNKAQSLSGEDIDEMRRQGATGEEIV  133

Query  558  KALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            +ALIANSATFEKKT FSQEKYKLKKQKKYAPKVLLRRP+ARSICEA
Sbjct  134  EALIANSATFEKKTSFSQEKYKLKKQKKYAPKVLLRRPFARSICEA  179



>ref|XP_006435170.1| hypothetical protein CICLE_v10001119mg [Citrus clementina]
 gb|ESR48410.1| hypothetical protein CICLE_v10001119mg [Citrus clementina]
Length=452

 Score =   220 bits (560),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 148/166 (89%), Gaps = 1/166 (1%)
 Frame = +3

Query  198  RITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGP  377
            ++TWEGCSVLLDINDGDRLVFARLT  S LKIGNKN SLQPLIGCP+GSLFQV+ G+ GP
Sbjct  15   QLTWEGCSVLLDINDGDRLVFARLTSGSTLKIGNKNCSLQPLIGCPFGSLFQVDNGKEGP  74

Query  378  ILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIV  557
             L+RV P+ E ++++ + D+Q +   +DNRA+VD+N AQSL+GEDID+MRRQGA+G++IV
Sbjct  75   NLSRVIPSTE-DDVQEKEDAQISGEFRDNRAIVDDNKAQSLSGEDIDEMRRQGATGEEIV  133

Query  558  KALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            +ALIANSATFEKKT FSQEKYKLKKQKKYAPKVLLRRP+ARSICEA
Sbjct  134  EALIANSATFEKKTSFSQEKYKLKKQKKYAPKVLLRRPFARSICEA  179



>ref|XP_010530285.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 [Tarenaya hassleriana]
Length=447

 Score =   219 bits (559),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR+TW+GCSVLLDINDGDRLVFARL+  ++LKIGNKNYSLQPLIG P+GSLFQVE    
Sbjct  15   NPRVTWDGCSVLLDINDGDRLVFARLSGGAKLKIGNKNYSLQPLIGAPFGSLFQVENETK  74

Query  372  GPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDD  551
            G  L+RV PT E +N + E D    D S+DNR +VDNN AQSLTGE+I+ MRRQGA GD+
Sbjct  75   GSCLSRVIPTKEESNNQNEGDGLLIDESRDNREIVDNNQAQSLTGEEIEAMRRQGAKGDE  134

Query  552  IVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            IV+ALIANS TFEKK Q SQEKY+LKKQKKYAPKVL+RRP+ARSICEA
Sbjct  135  IVEALIANSKTFEKKFQLSQEKYRLKKQKKYAPKVLIRRPFARSICEA  182



>ref|XP_010268702.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X1 [Nelumbo nucifera]
Length=441

 Score =   219 bits (557),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR+T EG SVLLD+NDGDRLVFARL+ A+ +KIGNK  SL P+IGCP+GSLFQVE G  
Sbjct  13   NPRVTCEGSSVLLDVNDGDRLVFARLSTAATIKIGNKKCSLGPMIGCPFGSLFQVESGPK  72

Query  372  GPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDD  551
            GP L+RV  T EG+N + + +SQ  D  KDNRA++D+NTAQSL+GEDID MRRQGA+GD+
Sbjct  73   GPYLSRVVSTSEGSNTQRKDNSQLKDELKDNRAIIDDNTAQSLSGEDIDAMRRQGAAGDE  132

Query  552  IVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            IV+ALIANS+TFEKKT FSQEKY+L+KQKKYAP+VL+RRP+ARSICEA
Sbjct  133  IVEALIANSSTFEKKTLFSQEKYRLRKQKKYAPRVLMRRPFARSICEA  180



>ref|XP_006473647.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6-like [Citrus sinensis]
Length=452

 Score =   219 bits (558),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            N ++TWEGCSVLLDINDGDRLVFARLT  S LKIGNKN SLQPLIGCP+GSLFQV+ G+ 
Sbjct  13   NAQVTWEGCSVLLDINDGDRLVFARLTSGSTLKIGNKNCSLQPLIGCPFGSLFQVDNGKE  72

Query  372  GPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDD  551
            GP L+RV P+ E ++++ + D+Q +   +DNRA+VD+N AQ L+GEDID+MRRQGA+G++
Sbjct  73   GPNLSRVIPSPE-DDVQEKEDAQISGEFRDNRAIVDDNKAQCLSGEDIDEMRRQGATGEE  131

Query  552  IVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            IV+ALIANSATFEKKT FSQEKYKLKKQKKYAPKVLLRRP+ARSICEA
Sbjct  132  IVEALIANSATFEKKTSFSQEKYKLKKQKKYAPKVLLRRPFARSICEA  179



>ref|XP_011649655.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X1 [Cucumis sativus]
 ref|XP_011649656.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X1 [Cucumis sativus]
 gb|KGN62671.1| hypothetical protein Csa_2G367740 [Cucumis sativus]
Length=452

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 144/174 (83%), Gaps = 6/174 (3%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR+TWEGCSVLLD+NDGDRLVFARL+PAS LKIGNK++SL+PLIGCP+GSLFQ+E G  
Sbjct  13   NPRLTWEGCSVLLDVNDGDRLVFARLSPASTLKIGNKSFSLKPLIGCPFGSLFQIENGGN  72

Query  372  GPILARVSPTIEGNNLKAESDSQ------TTDVSKDNRALVDNNTAQSLTGEDIDDMRRQ  533
            GP LARV P+ E   +  +   +      T D  +DNRA+VDNN AQSL+ EDID MR Q
Sbjct  73   GPELARVMPSREEEGISCQETEEMKEEQVTKDELRDNRAIVDNNKAQSLSSEDIDAMRSQ  132

Query  534  GASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            GA+GD+IV+ALIANSATF+KKT FSQEKY+LKKQKKYAP+VLLRRP+ RSICEA
Sbjct  133  GATGDEIVEALIANSATFDKKTVFSQEKYRLKKQKKYAPRVLLRRPFTRSICEA  186



>ref|XP_004152653.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X4 [Cucumis sativus]
Length=448

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 144/174 (83%), Gaps = 6/174 (3%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR+TWEGCSVLLD+NDGDRLVFARL+PAS LKIGNK++SL+PLIGCP+GSLFQ+E G  
Sbjct  13   NPRLTWEGCSVLLDVNDGDRLVFARLSPASTLKIGNKSFSLKPLIGCPFGSLFQIENGGN  72

Query  372  GPILARVSPTIEGNNLKAESDSQ------TTDVSKDNRALVDNNTAQSLTGEDIDDMRRQ  533
            GP LARV P+ E   +  +   +      T D  +DNRA+VDNN AQSL+ EDID MR Q
Sbjct  73   GPELARVMPSREEEGISCQETEEMKEEQVTKDELRDNRAIVDNNKAQSLSSEDIDAMRSQ  132

Query  534  GASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            GA+GD+IV+ALIANSATF+KKT FSQEKY+LKKQKKYAP+VLLRRP+ RSICEA
Sbjct  133  GATGDEIVEALIANSATFDKKTVFSQEKYRLKKQKKYAPRVLLRRPFTRSICEA  186



>gb|KJB58106.1| hypothetical protein B456_009G195100 [Gossypium raimondii]
Length=439

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = +3

Query  186  SFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGG  365
            + NPR+TWEGCSVLLDINDGDRL+FARL+  S LKIGNK +SLQPLIGCP+GSLFQVE G
Sbjct  11   TVNPRVTWEGCSVLLDINDGDRLLFARLSAGSTLKIGNKTFSLQPLIGCPFGSLFQVESG  70

Query  366  EGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASG  545
            +  P L+R  P  E NN++ E   Q  + S+DNRA++DNN AQSLTG+DID MRRQGA+G
Sbjct  71   KEKPYLSRFIPPTEENNVQDEGGCQLQEESRDNRAIIDNNQAQSLTGDDIDAMRRQGATG  130

Query  546  DDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYAR  680
            ++IV+ALIANSATF+KKTQFSQEKY+LKKQKKYAP+VLLRRP++R
Sbjct  131  NEIVEALIANSATFDKKTQFSQEKYRLKKQKKYAPRVLLRRPFSR  175



>ref|XP_002307715.1| eukaryotic initiation factor 3 gamma subunit family protein [Populus 
trichocarpa]
 gb|EEE94711.1| eukaryotic initiation factor 3 gamma subunit family protein [Populus 
trichocarpa]
Length=434

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 142/178 (80%), Gaps = 6/178 (3%)
 Frame = +3

Query  165  ENSYQNKSF-NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYG  341
            +N+ Q+ S  NPR+TWEGCSVLLDINDGDRLVFARLT  S LKIG K YSL+PLIGCP+G
Sbjct  3    QNNIQSDSVQNPRVTWEGCSVLLDINDGDRLVFARLTAGSTLKIGKKKYSLRPLIGCPFG  62

Query  342  SLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDD  521
            S FQ+E G  GP L+R  P+ E          Q  D  KDNRA+VDNN AQ+LT EDID+
Sbjct  63   SSFQIENGTEGPYLSRFIPSTE-----EREGCQIVDECKDNRAIVDNNEAQTLTSEDIDE  117

Query  522  MRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            MRRQGA GD+I++ALIANSATFEKKT FSQEKY++KKQKKYAP+VLLRRP ARSICEA
Sbjct  118  MRRQGAKGDEIIEALIANSATFEKKTAFSQEKYRIKKQKKYAPRVLLRRPSARSICEA  175



>ref|XP_011649657.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X2 [Cucumis sativus]
 ref|XP_011649658.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X3 [Cucumis sativus]
Length=451

 Score =   217 bits (552),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 144/173 (83%), Gaps = 5/173 (3%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR+TWEGCSVLLD+NDGDRLVFARL+PAS LKIGNK++SL+PLIGCP+GSLFQ+E G  
Sbjct  13   NPRLTWEGCSVLLDVNDGDRLVFARLSPASTLKIGNKSFSLKPLIGCPFGSLFQIENGGN  72

Query  372  GPILARVSPTIEGNNLKAESDSQ-----TTDVSKDNRALVDNNTAQSLTGEDIDDMRRQG  536
            GP LARV P+ E      E++       T D  +DNRA+VDNN AQSL+ EDID MR QG
Sbjct  73   GPELARVMPSREEGISCQETEEMKEEQVTKDELRDNRAIVDNNKAQSLSSEDIDAMRSQG  132

Query  537  ASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            A+GD+IV+ALIANSATF+KKT FSQEKY+LKKQKKYAP+VLLRRP+ RSICEA
Sbjct  133  ATGDEIVEALIANSATFDKKTVFSQEKYRLKKQKKYAPRVLLRRPFTRSICEA  185



>emb|CDP07406.1| unnamed protein product [Coffea canephora]
Length=453

 Score =   217 bits (552),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 152/186 (82%), Gaps = 5/186 (3%)
 Frame = +3

Query  141  MSVNEAIPENSYQNKSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQP  320
            MS+N+ I E + +N   N R+TWEGCS+LLDINDG+R+VF RLT  + LK+GNK  SLQP
Sbjct  1    MSINK-IQEITSKN---NARLTWEGCSILLDINDGERMVFERLTAGATLKVGNKKCSLQP  56

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEG-NNLKAESDSQTTDVSKDNRALVDNNTAQS  497
            LI CP+GSLFQVE G  GP L+R+  T EG N+L+ E +S T   SKDNR L+DNNTAQS
Sbjct  57   LINCPFGSLFQVENGTDGPFLSRIFSTSEGSNDLQEEKESPTVYGSKDNRELMDNNTAQS  116

Query  498  LTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYA  677
            LTGEDID++RR+GASG +I++ALI NSATFEKKT FSQEKY+LKKQKKY+P+VLLRRP A
Sbjct  117  LTGEDIDELRRKGASGVEIIEALITNSATFEKKTSFSQEKYRLKKQKKYSPRVLLRRPTA  176

Query  678  RSICEA  695
            RSICEA
Sbjct  177  RSICEA  182



>ref|XP_006386177.1| hypothetical protein POPTR_0002s02490g [Populus trichocarpa]
 gb|ERP63974.1| hypothetical protein POPTR_0002s02490g [Populus trichocarpa]
Length=443

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 145/179 (81%), Gaps = 2/179 (1%)
 Frame = +3

Query  165  ENSYQNKSF-NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYG  341
            +NS Q+ S  NPR+TWEGCSVLLDINDGDRLVFARLT  S LKIGNKN+SL+PLIGCP+G
Sbjct  50   QNSIQSNSIQNPRVTWEGCSVLLDINDGDRLVFARLTAGSTLKIGNKNFSLRPLIGCPFG  109

Query  342  SLFQVEGGEGGPILARVSPTIE-GNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDID  518
            S FQ+E G  G  L R  P+ E  NN + +  SQ  D  +DNRA+VDNN AQ+LT  DID
Sbjct  110  SSFQIENGTEGLCLCRFVPSTEVDNNDQEKGGSQIMDECRDNRAIVDNNEAQTLTSGDID  169

Query  519  DMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            +MRRQG  GD+I++ALIANSAT+EKKT FSQEKY++KKQKKYAP+VLLRRP ARSICEA
Sbjct  170  EMRRQGVKGDEIIEALIANSATYEKKTTFSQEKYRIKKQKKYAPRVLLRRPSARSICEA  228



>ref|XP_010061043.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X1 [Eucalyptus grandis]
Length=443

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  198  RITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGP  377
            R+TWEGCSVLLDINDGDRLVF+RLT  S LKIG KNYSL+PLIGCP+GSLFQVE G  G 
Sbjct  15   RVTWEGCSVLLDINDGDRLVFSRLTENSTLKIGKKNYSLRPLIGCPFGSLFQVEYGAEGS  74

Query  378  ILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIV  557
             L+R+  + E +N++   D Q  +  +DNR LVDNN AQSL+GEDI+++RRQGA+GD I+
Sbjct  75   KLSRLLESAEVSNIQENGDYQLVEEHRDNRELVDNNKAQSLSGEDIEELRRQGATGDKII  134

Query  558  KALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            +ALIANSATFEKKT FSQEKY+LKKQKKYAP+VLLRRP ARSICE
Sbjct  135  EALIANSATFEKKTAFSQEKYRLKKQKKYAPRVLLRRPVARSICE  179



>ref|XP_011029000.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X2 [Populus euphratica]
Length=442

 Score =   211 bits (537),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 146/181 (81%), Gaps = 2/181 (1%)
 Frame = +3

Query  159  IPENSYQNKSF-NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCP  335
            + +N+ Q+ S  NPR+TWEGCSVLLDINDGDRLVFARLT  S LKIG+KN+SL+PLIGCP
Sbjct  1    MSQNNIQSNSIQNPRVTWEGCSVLLDINDGDRLVFARLTAGSTLKIGSKNFSLRPLIGCP  60

Query  336  YGSLFQVEGGEGGPILARVSPTIE-GNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGED  512
            +GS FQ+E G  G  L R  P+ E  NN + +  SQ  +  +DNRA+VDNN AQ+LT  D
Sbjct  61   FGSSFQIENGTEGLCLCRFVPSTEVDNNDQEKGGSQIMEECRDNRAIVDNNEAQTLTSGD  120

Query  513  IDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            ID+MRRQG  GD+I++ALIANSAT+EKKT FSQEKY++KKQKKYAP+VLLRRP ARSICE
Sbjct  121  IDEMRRQGVKGDEIIEALIANSATYEKKTTFSQEKYRIKKQKKYAPRVLLRRPSARSICE  180

Query  693  A  695
            A
Sbjct  181  A  181



>ref|XP_011028999.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X1 [Populus euphratica]
Length=443

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 146/181 (81%), Gaps = 2/181 (1%)
 Frame = +3

Query  159  IPENSYQNKSF-NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCP  335
            + +N+ Q+ S  NPR+TWEGCSVLLDINDGDRLVFARLT  S LKIG+KN+SL+PLIGCP
Sbjct  1    MSQNNIQSNSIQNPRVTWEGCSVLLDINDGDRLVFARLTAGSTLKIGSKNFSLRPLIGCP  60

Query  336  YGSLFQVEGGEGGPILARVSPTIE-GNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGED  512
            +GS FQ+E G  G  L R  P+ E  NN + +  SQ  +  +DNRA+VDNN AQ+LT  D
Sbjct  61   FGSSFQIENGTEGLCLCRFVPSTEVDNNDQEKGGSQIMEECRDNRAIVDNNEAQTLTSGD  120

Query  513  IDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            ID+MRRQG  GD+I++ALIANSAT+EKKT FSQEKY++KKQKKYAP+VLLRRP ARSICE
Sbjct  121  IDEMRRQGVKGDEIIEALIANSATYEKKTTFSQEKYRIKKQKKYAPRVLLRRPSARSICE  180

Query  693  A  695
            A
Sbjct  181  A  181



>ref|XP_010681362.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X4 [Beta vulgaris subsp. vulgaris]
Length=442

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 142/170 (84%), Gaps = 6/170 (4%)
 Frame = +3

Query  198  RITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGP  377
            R+TWEGCSVLLDINDG+RLVFARL+ A+ LKIG  N+SLQPL+GCP+GSLF+VE G+  P
Sbjct  9    RLTWEGCSVLLDINDGERLVFARLSAAATLKIGKTNFSLQPLVGCPFGSLFRVENGKDKP  68

Query  378  ILARVSPTI----EGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASG  545
             L+R  PT     EGN++  E  + T +  KDNRALVDNNTAQSLTG+DID+MR QGA+G
Sbjct  69   YLSRALPTEERGGEGNDI--EEKNVTGEEPKDNRALVDNNTAQSLTGDDIDEMRSQGATG  126

Query  546  DDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            D IV+ALIANS TFEKKT FSQEKY+L+KQKKYAPKVL+RRP+ RSIC+A
Sbjct  127  DQIVEALIANSTTFEKKTSFSQEKYRLRKQKKYAPKVLVRRPFVRSICDA  176



>ref|XP_003589467.1| tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit 
trm6 [Medicago truncatula]
 gb|AES59718.1| tRNA (guanine-N(1))-methyltransferase, putative [Medicago truncatula]
Length=457

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 144/176 (82%), Gaps = 10/176 (6%)
 Frame = +3

Query  198  RITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVE-GGEGG  374
            R+TWEGCSVLLDINDGDRLVFARL+PA++LKIGNKN SLQPLIGCP+G++FQ++   +G 
Sbjct  10   RVTWEGCSVLLDINDGDRLVFARLSPAAKLKIGNKNCSLQPLIGCPFGTVFQLDTSSDGA  69

Query  375  PILARVSPTIEGNN--------LKAES-DSQTTDVSKDNRALVDNNTAQSLTGEDIDDMR  527
            P L+   P    NN         +AES D   T   +DNR+L+DNNTAQSLTGEDI+DMR
Sbjct  70   PFLSPFQPKGNINNTEDIKDGRFQAESKDGPLTGELRDNRSLIDNNTAQSLTGEDIEDMR  129

Query  528  RQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            RQGA GD+I++ALIANSATF+KKT FSQEKY+LKKQKKYAPKVL+RRP ARSICEA
Sbjct  130  RQGAKGDEIIEALIANSATFDKKTSFSQEKYRLKKQKKYAPKVLIRRPVARSICEA  185



>ref|XP_010681361.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X3 [Beta vulgaris subsp. vulgaris]
Length=473

 Score =   209 bits (532),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 142/170 (84%), Gaps = 6/170 (4%)
 Frame = +3

Query  198  RITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGP  377
            R+TWEGCSVLLDINDG+RLVFARL+ A+ LKIG  N+SLQPL+GCP+GSLF+VE G+  P
Sbjct  9    RLTWEGCSVLLDINDGERLVFARLSAAATLKIGKTNFSLQPLVGCPFGSLFRVENGKDKP  68

Query  378  ILARVSPTI----EGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASG  545
             L+R  PT     EGN++  E  + T +  KDNRALVDNNTAQSLTG+DID+MR QGA+G
Sbjct  69   YLSRALPTEERGGEGNDI--EEKNVTGEEPKDNRALVDNNTAQSLTGDDIDEMRSQGATG  126

Query  546  DDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            D IV+ALIANS TFEKKT FSQEKY+L+KQKKYAPKVL+RRP+ RSIC+A
Sbjct  127  DQIVEALIANSTTFEKKTSFSQEKYRLRKQKKYAPKVLVRRPFVRSICDA  176



>ref|XP_010681359.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=475

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 142/170 (84%), Gaps = 6/170 (4%)
 Frame = +3

Query  198  RITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGP  377
            R+TWEGCSVLLDINDG+RLVFARL+ A+ LKIG  N+SLQPL+GCP+GSLF+VE G+  P
Sbjct  9    RLTWEGCSVLLDINDGERLVFARLSAAATLKIGKTNFSLQPLVGCPFGSLFRVENGKDKP  68

Query  378  ILARVSPTI----EGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASG  545
             L+R  PT     EGN++  E  + T +  KDNRALVDNNTAQSLTG+DID+MR QGA+G
Sbjct  69   YLSRALPTEERGGEGNDI--EEKNVTGEEPKDNRALVDNNTAQSLTGDDIDEMRSQGATG  126

Query  546  DDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            D IV+ALIANS TFEKKT FSQEKY+L+KQKKYAPKVL+RRP+ RSIC+A
Sbjct  127  DQIVEALIANSTTFEKKTSFSQEKYRLRKQKKYAPKVLVRRPFVRSICDA  176



>ref|XP_010681360.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=474

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 142/170 (84%), Gaps = 6/170 (4%)
 Frame = +3

Query  198  RITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGP  377
            R+TWEGCSVLLDINDG+RLVFARL+ A+ LKIG  N+SLQPL+GCP+GSLF+VE G+  P
Sbjct  9    RLTWEGCSVLLDINDGERLVFARLSAAATLKIGKTNFSLQPLVGCPFGSLFRVENGKDKP  68

Query  378  ILARVSPTI----EGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASG  545
             L+R  PT     EGN++  E  + T +  KDNRALVDNNTAQSLTG+DID+MR QGA+G
Sbjct  69   YLSRALPTEERGGEGNDI--EEKNVTGEEPKDNRALVDNNTAQSLTGDDIDEMRSQGATG  126

Query  546  DDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            D IV+ALIANS TFEKKT FSQEKY+L+KQKKYAPKVL+RRP+ RSIC+A
Sbjct  127  DQIVEALIANSTTFEKKTSFSQEKYRLRKQKKYAPKVLVRRPFVRSICDA  176



>ref|XP_002300711.2| hypothetical protein POPTR_0002s02490g [Populus trichocarpa]
 gb|EEE79984.2| hypothetical protein POPTR_0002s02490g [Populus trichocarpa]
Length=434

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 141/178 (79%), Gaps = 9/178 (5%)
 Frame = +3

Query  165  ENSYQNKSF-NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYG  341
            +NS Q+ S  NPR+TWEGCSVLLDINDGDRLVFARLT  S LKIGNKN+SL+PLIGCP+G
Sbjct  50   QNSIQSNSIQNPRVTWEGCSVLLDINDGDRLVFARLTAGSTLKIGNKNFSLRPLIGCPFG  109

Query  342  SLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDD  521
            S FQ+E G  G  L         NN + +  SQ  D  +DNRA+VDNN AQ+LT  DID+
Sbjct  110  SSFQIENGTEGLCLY--------NNDQEKGGSQIMDECRDNRAIVDNNEAQTLTSGDIDE  161

Query  522  MRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            MRRQG  GD+I++ALIANSAT+EKKT FSQEKY++KKQKKYAP+VLLRRP ARSICEA
Sbjct  162  MRRQGVKGDEIIEALIANSATYEKKTTFSQEKYRIKKQKKYAPRVLLRRPSARSICEA  219



>gb|KFK37363.1| hypothetical protein AALP_AA4G246900 [Arabis alpina]
Length=435

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 140/169 (83%), Gaps = 7/169 (4%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR  +EGCSVLLD+NDGDRLVFARL+  + LKIGNKNYSL+PLIG P+GSLFQVE GE 
Sbjct  9    NPRFAFEGCSVLLDVNDGDRLVFARLSGGAILKIGNKNYSLKPLIGAPFGSLFQVENGED  68

Query  372  GPILARVSPTIEGNNLKAESDS-QTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGD  548
            G  L+RV P      +K ES+S    D S+DNR LVDNN AQ+LTGE+I+ MRR+GA GD
Sbjct  69   GSFLSRVLP------IKQESNSVNVIDDSRDNRELVDNNEAQTLTGEEIEAMRREGAKGD  122

Query  549  DIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            +I++ALIANS TF+KK QFSQEKYKLKKQKKYAPK+L+RRP+ARSICEA
Sbjct  123  EIIEALIANSKTFDKKGQFSQEKYKLKKQKKYAPKLLIRRPFARSICEA  171



>ref|XP_006294219.1| hypothetical protein CARUB_v10023215mg [Capsella rubella]
 gb|EOA27117.1| hypothetical protein CARUB_v10023215mg [Capsella rubella]
Length=446

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 140/169 (83%), Gaps = 7/169 (4%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR+ WEGCSVLLD+NDGDRLVFARL+  + LKIGNKNYSL+PLIG P+GSLFQVE GE 
Sbjct  21   NPRLAWEGCSVLLDVNDGDRLVFARLSGGAILKIGNKNYSLKPLIGAPFGSLFQVESGED  80

Query  372  GPILARVSPTIEGNNLKAESD-SQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGD  548
            G  L+R+ P      +K E+D +   D S+DNR LVDNN AQ+LTGE+I+ MRR+GA GD
Sbjct  81   GSFLSRILP------IKKENDHNNVMDDSRDNRELVDNNEAQNLTGEEIEAMRREGAKGD  134

Query  549  DIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            +I++ALIANS TF+KK Q SQEKYKLKKQKKYAPK+LLRRP++RSICEA
Sbjct  135  EIIEALIANSKTFDKKFQLSQEKYKLKKQKKYAPKLLLRRPFSRSICEA  183



>ref|XP_009381995.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 [Musa acuminata subsp. malaccensis]
Length=497

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 139/169 (82%), Gaps = 3/169 (2%)
 Frame = +3

Query  195  PRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGG  374
            PR TWEGCSVLLDINDGDRLVFARL+PA+ LKIGNK  SL PL+GCP+G+LF+VE G GG
Sbjct  25   PRETWEGCSVLLDINDGDRLVFARLSPAATLKIGNKKCSLGPLMGCPFGALFRVENGPGG  84

Query  375  PILARVSPTIEG---NNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASG  545
            P LAR SP+      N+++      TT+ ++DNR L+DNNTAQ+L+  DID MR++GA+G
Sbjct  85   PYLARCSPSTSAASNNSMQESEKGNTTENNRDNRLLIDNNTAQNLSSNDIDTMRKEGATG  144

Query  546  DDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            D+I++ALIANS+TF KKT +SQEKYK KKQKKYAPKVLLRRP ARSICE
Sbjct  145  DEIIEALIANSSTFGKKTVYSQEKYKRKKQKKYAPKVLLRRPSARSICE  193



>ref|XP_010934213.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X2 [Elaeis guineensis]
Length=470

 Score =   204 bits (520),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 137/170 (81%), Gaps = 3/170 (2%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR TWEGCSVLLDINDGDRLVFARL+PA+ LKIGNK   L PLIGCPYGSLF+V+ G  
Sbjct  18   NPRTTWEGCSVLLDINDGDRLVFARLSPAASLKIGNKKCFLSPLIGCPYGSLFRVDTGPD  77

Query  372  GPILARVSPT---IEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGAS  542
            GP L R+S +      N ++   D Q+ D  KDNR+L+DNNTAQSL+  DID M+R+GA+
Sbjct  78   GPHLTRISSSSAPSHDNCMQESDDGQSIDELKDNRSLIDNNTAQSLSSNDIDAMKREGAT  137

Query  543  GDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            GD+IV+ALIANS+TF KKT FSQEKYKLKKQKK+APKVLLRRP  RSICE
Sbjct  138  GDEIVEALIANSSTFGKKTAFSQEKYKLKKQKKHAPKVLLRRPSTRSICE  187



>ref|XP_010506525.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6-like [Camelina sativa]
Length=288

 Score =   199 bits (506),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 137/168 (82%), Gaps = 5/168 (3%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR+  EGCSVLLD+NDGDRLVFARL+  + LKIGNK YSL+PLIG P+GSLFQVE GE 
Sbjct  22   NPRLASEGCSVLLDVNDGDRLVFARLSGGAILKIGNKKYSLKPLIGAPFGSLFQVESGED  81

Query  372  GPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDD  551
            G  L+R+ P  + NN+     S   + S+DNR LVDNN AQ+LTGE+I+ MRR+GA GD+
Sbjct  82   GSFLSRILPLKQENNI-----SSVMEDSRDNRELVDNNEAQNLTGEEIEAMRREGAKGDE  136

Query  552  IVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            I++ALIANS TF+ KTQ SQEKYKLKKQKKYAPK+LLRRP++RSICEA
Sbjct  137  IIEALIANSKTFDMKTQLSQEKYKLKKQKKYAPKLLLRRPFSRSICEA  184



>ref|XP_010934212.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X1 [Elaeis guineensis]
Length=505

 Score =   204 bits (520),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 137/170 (81%), Gaps = 3/170 (2%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR TWEGCSVLLDINDGDRLVFARL+PA+ LKIGNK   L PLIGCPYGSLF+V+ G  
Sbjct  18   NPRTTWEGCSVLLDINDGDRLVFARLSPAASLKIGNKKCFLSPLIGCPYGSLFRVDTGPD  77

Query  372  GPILARVSPT---IEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGAS  542
            GP L R+S +      N ++   D Q+ D  KDNR+L+DNNTAQSL+  DID M+R+GA+
Sbjct  78   GPHLTRISSSSAPSHDNCMQESDDGQSIDELKDNRSLIDNNTAQSLSSNDIDAMKREGAT  137

Query  543  GDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            GD+IV+ALIANS+TF KKT FSQEKYKLKKQKK+APKVLLRRP  RSICE
Sbjct  138  GDEIVEALIANSSTFGKKTAFSQEKYKLKKQKKHAPKVLLRRPSTRSICE  187



>ref|XP_006601347.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6-like [Glycine max]
 gb|KHN12646.1| tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit 
trm6 [Glycine soja]
Length=457

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 126/194 (65%), Positives = 148/194 (76%), Gaps = 30/194 (15%)
 Frame = +3

Query  183  KSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEG  362
            +S + R+TWEGCSVLLDINDGDRLVFARL+PA++LKIGNKN SLQPLIGCP+G++FQV+ 
Sbjct  3    ESSSSRVTWEGCSVLLDINDGDRLVFARLSPAAKLKIGNKNCSLQPLIGCPFGTVFQVD-  61

Query  363  GEGGPILARVSPT-IEGNNLKAESDSQTT--------------DV--------SKDNRAL  473
               GP L   SP  + GNN +   D Q +              +V        S+DNRAL
Sbjct  62   ---GPFL---SPAQVNGNNAEEVRDGQVSVESRDKVNNDNNPEEVRDGRANVDSRDNRAL  115

Query  474  VDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapk  653
            VDNNTAQSLTGEDI+ MRRQGA G++I++ALIANSATFEKKT FSQEKY+LKKQKKYAPK
Sbjct  116  VDNNTAQSLTGEDIEAMRRQGAGGNEIIEALIANSATFEKKTSFSQEKYRLKKQKKYAPK  175

Query  654  vllRRPYARSICEA  695
            VL+RRP ARSICEA
Sbjct  176  VLMRRPVARSICEA  189



>ref|XP_006852744.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 [Amborella trichopoda]
 gb|ERN14211.1| hypothetical protein AMTR_s00033p00106440 [Amborella trichopoda]
Length=482

 Score =   202 bits (513),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 140/171 (82%), Gaps = 3/171 (2%)
 Frame = +3

Query  183  KSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEG  362
            K  + R+TWEGCSV+LDIN+GDR+VFARL P+S LKIG K  SL PLIGCP+GSLFQ+E 
Sbjct  7    KIVDSRVTWEGCSVILDINNGDRIVFARLNPSSTLKIGKKVCSLSPLIGCPFGSLFQLEC  66

Query  363  GEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGAS  542
            G  GP L+RVS ++ G    ++S+ Q    +KDNRALVD+NTAQ+L+G+DID MRR+GA+
Sbjct  67   GVNGPYLSRVSRSLTG---ASKSEDQNDCKTKDNRALVDSNTAQTLSGDDIDVMRREGAT  123

Query  543  GDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            G+ I++ALIANS+TF+ KT FSQEKY L+KQKKYAP VLLRRP+ RSICEA
Sbjct  124  GEQIIEALIANSSTFQTKTAFSQEKYILRKQKKYAPTVLLRRPFTRSICEA  174



>ref|NP_566054.1| eukaryotic initiation factor 3 gamma subunit family protein [Arabidopsis 
thaliana]
 gb|AAC28552.1| expressed protein [Arabidopsis thaliana]
 gb|AAL38275.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91144.1| unknown protein [Arabidopsis thaliana]
 gb|AEC10593.1| eukaryotic initiation factor 3 gamma subunit family protein [Arabidopsis 
thaliana]
Length=446

 Score =   201 bits (511),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 138/169 (82%), Gaps = 7/169 (4%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR   EGCSVLLDINDGDRLVFARL+  + LKIGNKNYSL+PLIG P+GSLFQVE GE 
Sbjct  20   NPRFACEGCSVLLDINDGDRLVFARLSSGAILKIGNKNYSLKPLIGAPFGSLFQVETGED  79

Query  372  GPILARVSPTIEGNNLKAESDS-QTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGD  548
            G  L+R+ P      +K ES+S    D S+DNR +VDNN AQ+LTGE+I+ MRR+GA GD
Sbjct  80   GSFLSRILP------IKQESNSNNVMDDSRDNREIVDNNEAQNLTGEEIEAMRREGAKGD  133

Query  549  DIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            +I++ALIANS TF+KK Q SQEKYKLKKQKKYAPK+LLRRP+ARSICEA
Sbjct  134  EIIEALIANSKTFDKKFQLSQEKYKLKKQKKYAPKLLLRRPFARSICEA  182



>ref|XP_010508122.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6-like [Camelina sativa]
Length=448

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 136/168 (81%), Gaps = 5/168 (3%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR+  EG SVLLD+NDGDRLVFARL+  + LKIGNKNYSL+PLIG P+GSLFQVE GE 
Sbjct  23   NPRLASEGYSVLLDVNDGDRLVFARLSGGAILKIGNKNYSLKPLIGAPFGSLFQVESGED  82

Query  372  GPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDD  551
            G  L+R+ P  + NN      +   D S+DNR LVDNN AQ+LTGE+I+ MRR+GA GD+
Sbjct  83   GSFLSRILPVKQENN-----SNNVMDDSRDNRELVDNNEAQNLTGEEIEAMRREGAKGDE  137

Query  552  IVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            I++ALIANS TF+KKTQ SQEKY LKKQKKYAPK+LLRRP++RSICEA
Sbjct  138  IIEALIANSKTFDKKTQLSQEKYLLKKQKKYAPKLLLRRPFSRSICEA  185



>ref|XP_002882030.1| eukaryotic initiation factor 3 gamma subunit family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH58289.1| eukaryotic initiation factor 3 gamma subunit family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=446

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 136/168 (81%), Gaps = 5/168 (3%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR   EGCSVLLD+NDGDRLVFARL+  + LKIGNKNYSL+PLIG P+GSLFQVE GE 
Sbjct  20   NPRFACEGCSVLLDVNDGDRLVFARLSGGAILKIGNKNYSLKPLIGAPFGSLFQVETGED  79

Query  372  GPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDD  551
            G  L+R+ P  + NN      +   D S+DNR +VDNN AQ+LTGE+I+ MRR+GA GD+
Sbjct  80   GSFLSRIFPIKQENN-----SNNVMDDSRDNREIVDNNEAQNLTGEEIEAMRREGAKGDE  134

Query  552  IVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            I++ALIANS TF+KK Q SQEKYKLKKQKKYAPK+LLRRP+ARSICEA
Sbjct  135  IIEALIANSKTFDKKFQLSQEKYKLKKQKKYAPKLLLRRPFARSICEA  182



>ref|XP_007160671.1| hypothetical protein PHAVU_001G007200g [Phaseolus vulgaris]
 gb|ESW32665.1| hypothetical protein PHAVU_001G007200g [Phaseolus vulgaris]
Length=470

 Score =   199 bits (505),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 140/185 (76%), Gaps = 19/185 (10%)
 Frame = +3

Query  198  RITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGP  377
            R+TWEGCSVLLDINDGDRLVFARL+PA++LKIGNKN SLQPLIG  +G++FQV+    GP
Sbjct  12   RVTWEGCSVLLDINDGDRLVFARLSPAAKLKIGNKNCSLQPLIGRAFGTVFQVDNAPEGP  71

Query  378  ILA-------------------RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSL  500
             L+                    +   +  NN++   D +    S+DNRALVDNNTAQSL
Sbjct  72   CLSPAQVNVNNAEEIGDGQGSHELRDKVNVNNVEEVRDGEVNVESRDNRALVDNNTAQSL  131

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYAR  680
            TGEDI+ MRRQGA G++I++ALIANSATFEKKT FSQEKY+LKKQKKYAPKVL+RRP AR
Sbjct  132  TGEDIEAMRRQGARGNEIIEALIANSATFEKKTSFSQEKYRLKKQKKYAPKVLMRRPVAR  191

Query  681  SICEA  695
            SICEA
Sbjct  192  SICEA  196



>emb|CDY27364.1| BnaC04g50410D [Brassica napus]
Length=442

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 144/182 (79%), Gaps = 9/182 (5%)
 Frame = +3

Query  159  IPENSYQNKSF--NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGC  332
            + EN+  NK+   NPR   EGCSVLLD+NDGDRLVFARL+  + LKIGNKNYSL+PLIG 
Sbjct  11   MSENNNNNKAQDPNPRFASEGCSVLLDVNDGDRLVFARLSGGAVLKIGNKNYSLKPLIGA  70

Query  333  PYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDS-QTTDVSKDNRALVDNNTAQSLTGE  509
            P+GSLFQVE GE G  L+R+ P      +K ES S    D ++DNR L+DNN AQ+LTGE
Sbjct  71   PFGSLFQVETGEDGSFLSRILP------VKKESSSNNVIDDARDNRELIDNNEAQNLTGE  124

Query  510  DIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSIC  689
            +I+ MRR+GA GD+I++ALIANS TF++K Q SQEKYKLKKQKKYAPK+LLRRP+ARSIC
Sbjct  125  EIEAMRREGAKGDEIIEALIANSKTFDQKFQLSQEKYKLKKQKKYAPKLLLRRPFARSIC  184

Query  690  EA  695
            EA
Sbjct  185  EA  186



>emb|CDY37059.1| BnaA04g26370D [Brassica napus]
Length=439

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 138/169 (82%), Gaps = 7/169 (4%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR+  EGCSVLLD+NDGDRLVFARL+  + LKIGNKNYSL+PLIG P+GS+FQVE GE 
Sbjct  22   NPRVAGEGCSVLLDVNDGDRLVFARLSGGAVLKIGNKNYSLKPLIGAPFGSIFQVETGED  81

Query  372  GPILARVSPTIEGNNLKAESDS-QTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGD  548
            G  L+R+ P      +K ES S    D ++DNR L+DNN AQ+LTGE+I+ MRR+GA GD
Sbjct  82   GSFLSRILP------IKKESSSNNVIDDARDNRELIDNNEAQNLTGEEIEAMRREGAKGD  135

Query  549  DIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            +I++ALIANS TF++K Q SQEKYKLKKQKKYAPK+LLRRP+ARSICEA
Sbjct  136  EIIEALIANSKTFDQKFQLSQEKYKLKKQKKYAPKLLLRRPFARSICEA  184



>ref|XP_006397754.1| hypothetical protein EUTSA_v10001448mg [Eutrema salsugineum]
 gb|ESQ39207.1| hypothetical protein EUTSA_v10001448mg [Eutrema salsugineum]
Length=445

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 134/168 (80%), Gaps = 5/168 (3%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            +PR   EGCSVLLD+NDGDRLVFARL+  + LKIGNKNYSL+P+IG P+GSLFQVE G+ 
Sbjct  20   DPRFACEGCSVLLDVNDGDRLVFARLSGGAILKIGNKNYSLKPMIGAPFGSLFQVESGDE  79

Query  372  GPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDD  551
            G  L+R+ P  + N       +   D S+DNR LVDNN AQ+LTGE+I+ MRR+GA GD+
Sbjct  80   GSFLSRILPVKQENK-----SNNVIDDSRDNRELVDNNEAQNLTGEEIEAMRREGAKGDE  134

Query  552  IVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            I++ALIANS TFEKK Q SQEKY LKKQKKYAPKVLLRRP+ARSICEA
Sbjct  135  IIEALIANSKTFEKKFQLSQEKYLLKKQKKYAPKVLLRRPFARSICEA  182



>ref|XP_008785125.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 [Phoenix dactylifera]
Length=470

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 135/170 (79%), Gaps = 3/170 (2%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR TWEGCSVLLDINDGDRLVFARL+ A+ LKIGNK   L PLIGCP+GSLF+V+ G  
Sbjct  18   NPRTTWEGCSVLLDINDGDRLVFARLSAAATLKIGNKKCFLSPLIGCPFGSLFRVDTGPN  77

Query  372  GPILARV---SPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGAS  542
            GP L R+   S     N ++   D Q+ D  KDNR+L+DNNTAQ+L+ +DID MRR+GA+
Sbjct  78   GPHLTRIASSSAPSHDNCMQESDDGQSIDELKDNRSLIDNNTAQNLSSDDIDAMRREGAT  137

Query  543  GDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            GD+IV+ALIANS+TF  KT FSQEKYKLKKQKK+APKVLLRRP  RSICE
Sbjct  138  GDEIVEALIANSSTFGTKTAFSQEKYKLKKQKKHAPKVLLRRPSTRSICE  187



>ref|XP_009142359.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 [Brassica rapa]
Length=440

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 147/186 (79%), Gaps = 10/186 (5%)
 Frame = +3

Query  150  NEAI-PENSYQNKSF--NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQP  320
            N+A+  EN+  NK+   NPR   EGCSVLLD+NDGDRLVFARL+  + LKIGNKNYSL+P
Sbjct  6    NQAVMSENNNNNKAQDPNPRFASEGCSVLLDVNDGDRLVFARLSGGAVLKIGNKNYSLKP  65

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDS-QTTDVSKDNRALVDNNTAQS  497
            LIG P+GS+FQVE GE G  L+R+ P      +K ES S    D ++DNR L+DNN AQ+
Sbjct  66   LIGAPFGSIFQVETGEDGSFLSRILP------IKKESSSNNVIDDARDNRELIDNNEAQN  119

Query  498  LTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYA  677
            LTGE+I+ MRR+GA GD+I++ALIANS TF++K Q SQEKYKLKKQKKYAPK+LLRRP+A
Sbjct  120  LTGEEIEAMRREGAKGDEIIEALIANSKTFDQKFQLSQEKYKLKKQKKYAPKLLLRRPFA  179

Query  678  RSICEA  695
            RSICEA
Sbjct  180  RSICEA  185



>ref|XP_010518199.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6-like [Camelina sativa]
Length=446

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 138/168 (82%), Gaps = 5/168 (3%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR+  EG SVLLD+NDGDRLVFARL+  + LKIGNKNYSL+PLIG P+GSLFQVE GE 
Sbjct  21   NPRLASEGYSVLLDVNDGDRLVFARLSGGAILKIGNKNYSLKPLIGAPFGSLFQVESGED  80

Query  372  GPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDD  551
            G  L+R+ P  + NN    S++   D S+DNR LVDNN AQ+LTGE+I+ MRR+GA GD+
Sbjct  81   GSFLSRILPVKQENN----SNNVMQD-SRDNRELVDNNEAQNLTGEEIEAMRREGAKGDE  135

Query  552  IVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            I++ALIANS TF+ KTQ SQEKYKLKKQKKYAPK+LLRRP++RSICEA
Sbjct  136  IIEALIANSKTFDMKTQLSQEKYKLKKQKKYAPKLLLRRPFSRSICEA  183



>ref|XP_006596555.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6-like isoform X2 [Glycine max]
Length=453

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 136/181 (75%), Gaps = 15/181 (8%)
 Frame = +3

Query  198  RITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGP  377
            R+TWEGCSVLLDINDGDRLVFARL+P+++LKIGNKN SLQPLIG P+G+ FQV+G    P
Sbjct  7    RVTWEGCSVLLDINDGDRLVFARLSPSAKLKIGNKNCSLQPLIGRPFGTAFQVDGPYLSP  66

Query  378  ---------------ILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGED  512
                           +  +    +E N  + E D Q    S+DNR LVDNNTAQ LTGED
Sbjct  67   AQVNGNNAEELRDVQVSVKSRDKVEDNYPEEERDVQANVDSRDNRELVDNNTAQRLTGED  126

Query  513  IDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            I+ MRRQGA G++I++ALIANS TFEKKT FSQEKY+LKKQKKYAPKVL+RRP ARSICE
Sbjct  127  IEAMRRQGAGGNEIIEALIANSVTFEKKTSFSQEKYRLKKQKKYAPKVLMRRPVARSICE  186

Query  693  A  695
            A
Sbjct  187  A  187



>gb|KHN39432.1| tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit 
trm6 [Glycine soja]
Length=457

 Score =   193 bits (490),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 136/185 (74%), Gaps = 19/185 (10%)
 Frame = +3

Query  198  RITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGP  377
            R+TWEGCSVLLDINDGDRLVFARL+P+++LKIGNKN SLQPLIG P+G+ FQV+G    P
Sbjct  7    RVTWEGCSVLLDINDGDRLVFARLSPSAKLKIGNKNCSLQPLIGRPFGTAFQVDGPYLSP  66

Query  378  -------------------ILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSL  500
                               +  +    +E N  + E D Q    S+DNR LVDNNTAQ L
Sbjct  67   AQGTHAFNGNNAEELRDVQVSVKSRHKVEDNYPEEERDVQANVDSRDNRELVDNNTAQRL  126

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYAR  680
            TGEDI+ MRRQGA G++I++ALIANS TFEKKT FSQEKY+LKKQKKYAPKVL+RRP AR
Sbjct  127  TGEDIEAMRRQGAGGNEIIEALIANSVTFEKKTSFSQEKYRLKKQKKYAPKVLMRRPVAR  186

Query  681  SICEA  695
            SICEA
Sbjct  187  SICEA  191



>ref|XP_007017789.1| Eukaryotic initiation factor 3 gamma subunit family protein [Theobroma 
cacao]
 gb|EOY15014.1| Eukaryotic initiation factor 3 gamma subunit family protein [Theobroma 
cacao]
Length=417

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 131/163 (80%), Gaps = 10/163 (6%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR+TWEGCSVLLDINDGDRLVFARL+  S LKIGNK  SLQPLIGCP+GSLFQVE G+ 
Sbjct  13   NPRVTWEGCSVLLDINDGDRLVFARLSAGSTLKIGNKTCSLQPLIGCPFGSLFQVESGKE  72

Query  372  GPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDD  551
             P L+R  P+ E +N + E   Q  + S+DNRA++DNN AQSLT          GA+G++
Sbjct  73   KPYLSRYIPSTEDSNDQDEGGCQLKEESRDNRAIIDNNQAQSLT----------GATGNE  122

Query  552  IVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYAR  680
            IV+ALIANSATFEKKTQFSQEKY+LKKQKKYAP+VLLRRP++R
Sbjct  123  IVEALIANSATFEKKTQFSQEKYRLKKQKKYAPRVLLRRPFSR  165



>ref|XP_006596554.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6-like isoform X1 [Glycine max]
Length=461

 Score =   191 bits (484),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 136/189 (72%), Gaps = 23/189 (12%)
 Frame = +3

Query  198  RITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGP  377
            R+TWEGCSVLLDINDGDRLVFARL+P+++LKIGNKN SLQPLIG P+G+ FQV+G    P
Sbjct  7    RVTWEGCSVLLDINDGDRLVFARLSPSAKLKIGNKNCSLQPLIGRPFGTAFQVDGPYLSP  66

Query  378  -----------------------ILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNT  488
                                   +  +    +E N  + E D Q    S+DNR LVDNNT
Sbjct  67   AQGCLSICDLVNGNNAEELRDVQVSVKSRDKVEDNYPEEERDVQANVDSRDNRELVDNNT  126

Query  489  AQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRR  668
            AQ LTGEDI+ MRRQGA G++I++ALIANS TFEKKT FSQEKY+LKKQKKYAPKVL+RR
Sbjct  127  AQRLTGEDIEAMRRQGAGGNEIIEALIANSVTFEKKTSFSQEKYRLKKQKKYAPKVLMRR  186

Query  669  PYARSICEA  695
            P ARSICEA
Sbjct  187  PVARSICEA  195



>emb|CDY53893.1| BnaA03g56950D [Brassica napus]
Length=439

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 134/170 (79%), Gaps = 8/170 (5%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR   EGCSVLLD+NDGDRLVFARL+  +  KIGN NYSL+PLIG P+GSLFQVE GE 
Sbjct  23   NPRFASEGCSVLLDVNDGDRLVFARLSGGAIFKIGNTNYSLKPLIGAPFGSLFQVETGED  82

Query  372  GPILARVSPTIEGNNLKAESDSQTT--DVSKDNRALVDNNTAQSLTGEDIDDMRRQGASG  545
            G  L+R+ P      +K ES S     D ++DNR L+D+N +Q+LT E+I+ MRR+GA G
Sbjct  83   GSFLSRILP------VKKESTSVNVVDDDARDNRELIDDNESQNLTCEEIEAMRREGAKG  136

Query  546  DDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            D+I++ALIANS TF+KK Q SQEKYKLKKQKKYAPKVLLRRP+ARSICEA
Sbjct  137  DEIIEALIANSKTFDKKFQLSQEKYKLKKQKKYAPKVLLRRPFARSICEA  186



>emb|CDX95661.1| BnaC03g25420D [Brassica napus]
Length=433

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 133/170 (78%), Gaps = 8/170 (5%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR   EGCSVLLD+NDGDRLVFARL+  +  KIGN NYSL+PLIG P+GSLFQVE GE 
Sbjct  17   NPRFASEGCSVLLDVNDGDRLVFARLSGGAIFKIGNTNYSLKPLIGAPFGSLFQVETGED  76

Query  372  GPILARVSPTIEGNNLKAESDSQTT--DVSKDNRALVDNNTAQSLTGEDIDDMRRQGASG  545
            G  L+R+ P      +K ES S     D ++DNR L+D+N +QSLT E+I+ MRR+GA G
Sbjct  77   GSFLSRILP------VKKESTSVNVIDDDARDNRELIDDNESQSLTCEEIEAMRREGAKG  130

Query  546  DDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            D+I++ALIANS TF+ K Q SQEKYKLKKQKKYAPKVLLRRP+ARSICEA
Sbjct  131  DEIIEALIANSKTFDNKFQLSQEKYKLKKQKKYAPKVLLRRPFARSICEA  180



>ref|XP_009133748.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6-like [Brassica rapa]
Length=438

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 133/170 (78%), Gaps = 8/170 (5%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR   EGCSVLLD+NDGDRLVFARL+  +  KIGN NYSL+PLIG P+GSLFQVE GE 
Sbjct  23   NPRFASEGCSVLLDVNDGDRLVFARLSGGAIFKIGNTNYSLKPLIGAPFGSLFQVETGED  82

Query  372  GPILARVSPTIEGNNLKAESDSQTT--DVSKDNRALVDNNTAQSLTGEDIDDMRRQGASG  545
            G  L+R+ P      +K ES S     D ++DNR L+D+N +Q+LT E+I+ MRR+GA G
Sbjct  83   GSFLSRILP------VKKESTSVNVVDDDARDNRELIDDNESQNLTCEEIEAMRREGAKG  136

Query  546  DDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            D+I++ALIANS TF+KK Q SQEKYKLKKQKKYAPKVLLRR +ARSICEA
Sbjct  137  DEIIEALIANSKTFDKKFQLSQEKYKLKKQKKYAPKVLLRRAFARSICEA  186



>ref|XP_006596556.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6-like isoform X3 [Glycine max]
Length=447

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 131/184 (71%), Gaps = 23/184 (13%)
 Frame = +3

Query  198  RITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGP  377
            R+TWEGCSVLLDINDGDRLVFARL+P+++LKIGNKN SLQPLIG P+G+ FQV+G    P
Sbjct  7    RVTWEGCSVLLDINDGDRLVFARLSPSAKLKIGNKNCSLQPLIGRPFGTAFQVDGPYLSP  66

Query  378  -----------------------ILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNT  488
                                   +  +    +E N  + E D Q    S+DNR LVDNNT
Sbjct  67   AQGCLSICDLVNGNNAEELRDVQVSVKSRDKVEDNYPEEERDVQANVDSRDNRELVDNNT  126

Query  489  AQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRR  668
            AQ LTGEDI+ MRRQGA G++I++ALIANS TFEKKT FSQEKY+LKKQKKYAPKVL+RR
Sbjct  127  AQRLTGEDIEAMRRQGAGGNEIIEALIANSVTFEKKTSFSQEKYRLKKQKKYAPKVLMRR  186

Query  669  PYAR  680
            P AR
Sbjct  187  PVAR  190



>ref|XP_004976509.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6-like [Setaria italica]
Length=471

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 133/166 (80%), Gaps = 1/166 (1%)
 Frame = +3

Query  195  PRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGG  374
            PR  WEGCSVLLDINDGDRL F RLTPA+ +KIGNK  SLQPL+G P+GSLF+V      
Sbjct  11   PREAWEGCSVLLDINDGDRLAFFRLTPAATVKIGNKTCSLQPLVGRPFGSLFRVGADGLV  70

Query  375  PILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDI  554
            P  A  +P+ E ++++  +D Q  D ++DNR+LVDNNTAQ+L+ +DI+ M+R GA+GD+I
Sbjct  71   PCAAGDAPSRE-DSMEDGADGQVQDETRDNRSLVDNNTAQNLSSDDIEAMKRDGATGDEI  129

Query  555  VKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            V+ALIANS+TF KKT FSQEKYKLKKQKKYAPKVLLRRP  RSICE
Sbjct  130  VEALIANSSTFGKKTAFSQEKYKLKKQKKYAPKVLLRRPSTRSICE  175



>emb|CAH65746.1| OSIGBa0127D24.9 [Oryza sativa Indica Group]
Length=475

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 129/166 (78%), Gaps = 2/166 (1%)
 Frame = +3

Query  195  PRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGG  374
            PR  WEGCSVLLDINDGDRL F RLTPA+ +K+GN+  SLQPL+G P+GSLF V  G  G
Sbjct  5    PREAWEGCSVLLDINDGDRLAFFRLTPAATVKVGNRTCSLQPLVGRPFGSLFSV--GPSG  62

Query  375  PILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDI  554
             +    +P+   +  +  +D  + D ++DNR+LVDNNTAQ+L+ +DI+ M+R G SGD+I
Sbjct  63   LVPCADAPSSRDDTTQDAADGPSQDETRDNRSLVDNNTAQNLSSDDIEAMKRDGVSGDEI  122

Query  555  VKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            V+ALIANS+TF KKT FSQEKYKLKKQKKYAPKVLLRRP  RSICE
Sbjct  123  VEALIANSSTFGKKTLFSQEKYKLKKQKKYAPKVLLRRPSTRSICE  168



>ref|NP_001052037.1| Os04g0112300 [Oryza sativa Japonica Group]
 emb|CAE01640.2| OSJNBb0021I10.2 [Oryza sativa Japonica Group]
 emb|CAE03197.2| OSJNBb0060M15.9 [Oryza sativa Japonica Group]
 dbj|BAF13951.1| Os04g0112300 [Oryza sativa Japonica Group]
 dbj|BAG93312.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00682.1| unnamed protein product [Oryza sativa Japonica Group]
Length=475

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 129/166 (78%), Gaps = 2/166 (1%)
 Frame = +3

Query  195  PRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGG  374
            PR  WEGCSVLLDINDGDRL F RLTPA+ +K+GN+  SLQPL+G P+GSLF V  G  G
Sbjct  5    PREAWEGCSVLLDINDGDRLAFFRLTPAATVKVGNRTCSLQPLVGRPFGSLFSV--GPSG  62

Query  375  PILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDI  554
             +    +P+   +  +  +D  + D ++DNR+LVDNNTAQ+L+ +DI+ M+R G SGD+I
Sbjct  63   LVPCADAPSSRDDTTQDAADGPSQDETRDNRSLVDNNTAQNLSSDDIEAMKRDGVSGDEI  122

Query  555  VKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            V+ALIANS+TF KKT FSQEKYKLKKQKKYAPKVLLRRP  RSICE
Sbjct  123  VEALIANSSTFGKKTLFSQEKYKLKKQKKYAPKVLLRRPSTRSICE  168



>gb|EEC76653.1| hypothetical protein OsI_14608 [Oryza sativa Indica Group]
 gb|EEE60394.1| hypothetical protein OsJ_13552 [Oryza sativa Japonica Group]
Length=514

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 129/166 (78%), Gaps = 2/166 (1%)
 Frame = +3

Query  195  PRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGG  374
            PR  WEGCSVLLDINDGDRL F RLTPA+ +K+GN+  SLQPL+G P+GSLF V  G  G
Sbjct  5    PREAWEGCSVLLDINDGDRLAFFRLTPAATVKVGNRTCSLQPLVGRPFGSLFSV--GPSG  62

Query  375  PILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDI  554
             +    +P+   +  +  +D  + D ++DNR+LVDNNTAQ+L+ +DI+ M+R G SGD+I
Sbjct  63   LVPCADAPSSRDDTTQDAADGPSQDETRDNRSLVDNNTAQNLSSDDIEAMKRDGVSGDEI  122

Query  555  VKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            V+ALIANS+TF KKT FSQEKYKLKKQKKYAPKVLLRRP  RSICE
Sbjct  123  VEALIANSSTFGKKTLFSQEKYKLKKQKKYAPKVLLRRPSTRSICE  168



>ref|XP_003580561.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 [Brachypodium distachyon]
Length=475

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 124/166 (75%), Gaps = 5/166 (3%)
 Frame = +3

Query  195  PRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGG  374
            PR  WEGCSVLLDINDGDRL F RL P + +KIGN +YSLQPL+G P+GSLF+V      
Sbjct  13   PREAWEGCSVLLDINDGDRLAFFRLNPGATVKIGNTSYSLQPLVGRPFGSLFRVGPSGLV  72

Query  375  PILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDI  554
            P  A   P       +  +D Q  D ++DNR+LVDNNTAQ+L+ EDI+ M+R GASGD I
Sbjct  73   PCAAEAPP-----QAQVVADGQVQDETRDNRSLVDNNTAQNLSSEDIEAMKRDGASGDAI  127

Query  555  VKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            V+ALIANS+TF  KT FSQEKYKLKKQKKYAPKVLLRRP  RSICE
Sbjct  128  VEALIANSSTFGNKTVFSQEKYKLKKQKKYAPKVLLRRPSTRSICE  173



>ref|XP_008674619.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X1 [Zea mays]
 tpg|DAA56013.1| TPA: hypothetical protein ZEAMMB73_887805 [Zea mays]
Length=477

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 131/166 (79%), Gaps = 3/166 (2%)
 Frame = +3

Query  198  RITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGP  377
            R  WEGCSVLLDINDGDRL F RLTP + +KIGNK  SL+PL+G P+GSLF++  G GG 
Sbjct  10   REAWEGCSVLLDINDGDRLAFFRLTPGATVKIGNKTCSLKPLVGRPFGSLFRL--GAGGL  67

Query  378  I-LARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDI  554
            +  A    T   +N   +++ QT D ++DNR+LVDNNTAQ+L+ +DI+ M+R GA+GD+I
Sbjct  68   VPCAAADATSRDHNTPDDANGQTQDETRDNRSLVDNNTAQNLSSDDIEAMKRDGATGDEI  127

Query  555  VKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            V+ALIANS+TF  KT FSQEKYKLKKQKKYAPKVLLRRP ARSICE
Sbjct  128  VEALIANSSTFGNKTVFSQEKYKLKKQKKYAPKVLLRRPSARSICE  173



>gb|KDO84842.1| hypothetical protein CISIN_1g0129782mg, partial [Citrus sinensis]
Length=210

 Score =   166 bits (420),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = +3

Query  285  LKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDN  464
            LKIGNKN SLQPLIGCP+GSLFQV+ G+ GP L+RV P+ E ++++ + D+Q +   +DN
Sbjct  2    LKIGNKNCSLQPLIGCPFGSLFQVDNGKEGPNLSRVIPSTE-DDVQEKEDAQISGEFRDN  60

Query  465  RALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkky  644
            RA+VD+N AQ L+GEDID+MRRQGA+G++IV+ALIANSATFEKKT FSQEKYKLKKQKKY
Sbjct  61   RAIVDDNKAQCLSGEDIDEMRRQGATGEEIVEALIANSATFEKKTSFSQEKYKLKKQKKY  120

Query  645  apkvllRRPYARSICEA  695
            APKVLLRRP+ARSICEA
Sbjct  121  APKVLLRRPFARSICEA  137



>gb|KDO84841.1| hypothetical protein CISIN_1g0129782mg, partial [Citrus sinensis]
Length=313

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = +3

Query  285  LKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDN  464
            LKIGNKN SLQPLIGCP+GSLFQV+ G+ GP L+RV P+ E ++++ + D+Q +   +DN
Sbjct  2    LKIGNKNCSLQPLIGCPFGSLFQVDNGKEGPNLSRVIPSTE-DDVQEKEDAQISGEFRDN  60

Query  465  RALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkky  644
            RA+VD+N AQ L+GEDID+MRRQGA+G++IV+ALIANSATFEKKT FSQEKYKLKKQKKY
Sbjct  61   RAIVDDNKAQCLSGEDIDEMRRQGATGEEIVEALIANSATFEKKTSFSQEKYKLKKQKKY  120

Query  645  apkvllRRPYARSICEA  695
            APKVLLRRP+ARSICEA
Sbjct  121  APKVLLRRPFARSICEA  137



>dbj|BAK01496.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=513

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = +3

Query  195  PRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGG  374
            PR  WEGCSVLLDINDGDRL F RLTP + +KIG+K+ SLQPL+G P+GSLF++ G +G 
Sbjct  11   PREAWEGCSVLLDINDGDRLAFFRLTPGATVKIGDKSCSLQPLLGRPFGSLFRL-GPDGL  69

Query  375  PILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDI  554
                  +P     + K     Q  D ++DNR+LVDNNTAQ+L+ EDID M+R GASG+ I
Sbjct  70   LPCNTAAPDAPSQDDKPRDAGQAQDETRDNRSLVDNNTAQTLSSEDIDAMKRDGASGNAI  129

Query  555  VKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            V+ALIANS+TF  KT FSQEKYKLKKQKKYAPKVLLRRP +RSICE
Sbjct  130  VEALIANSSTFGNKTVFSQEKYKLKKQKKYAPKVLLRRPSSRSICE  175



>ref|XP_006652081.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6-like [Oryza brachyantha]
Length=476

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 128/166 (77%), Gaps = 3/166 (2%)
 Frame = +3

Query  195  PRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGG  374
            PR  WEGCSVLLDINDGDRL F RLT A+ +KIGN+  SLQPL+G P+GSLF V  G  G
Sbjct  7    PREAWEGCSVLLDINDGDRLAFFRLTAAATVKIGNRTCSLQPLVGRPFGSLFSV--GPSG  64

Query  375  PILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDI  554
             +    +P+   + ++  +D    D ++DNR+LVDNNTAQ+L+ +DI+ M+R G SGD+I
Sbjct  65   LVPCADAPS-RDDRMQDAADGPVQDETRDNRSLVDNNTAQNLSSDDIEAMKRDGVSGDEI  123

Query  555  VKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            V+ALIANS+TF KKT FSQEKYKLKKQKKYAPKVLLRRP  RSICE
Sbjct  124  VEALIANSSTFGKKTVFSQEKYKLKKQKKYAPKVLLRRPSTRSICE  169



>ref|XP_008674620.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X2 [Zea mays]
Length=472

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 129/165 (78%), Gaps = 6/165 (4%)
 Frame = +3

Query  198  RITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGP  377
            R  WEGCSVLLDINDGDRL F RLTP + +KIGNK  SL+PL+G P+GSLF++  G   P
Sbjct  10   REAWEGCSVLLDINDGDRLAFFRLTPGATVKIGNKTCSLKPLVGRPFGSLFRLGAGGLVP  69

Query  378  ILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIV  557
              A  + +      + +++ QT D ++DNR+LVDNNTAQ+L+ +DI+ M+R GA+GD+IV
Sbjct  70   CAAADATS------RDDANGQTQDETRDNRSLVDNNTAQNLSSDDIEAMKRDGATGDEIV  123

Query  558  KALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            +ALIANS+TF  KT FSQEKYKLKKQKKYAPKVLLRRP ARSICE
Sbjct  124  EALIANSSTFGNKTVFSQEKYKLKKQKKYAPKVLLRRPSARSICE  168



>gb|KDO84840.1| hypothetical protein CISIN_1g0129782mg, partial [Citrus sinensis]
Length=410

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = +3

Query  285  LKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDN  464
            LKIGNKN SLQPLIGCP+GSLFQV+ G+ GP L+RV P+ E ++++ + D+Q +   +DN
Sbjct  2    LKIGNKNCSLQPLIGCPFGSLFQVDNGKEGPNLSRVIPSTE-DDVQEKEDAQISGEFRDN  60

Query  465  RALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkky  644
            RA+VD+N AQ L+GEDID+MRRQGA+G++IV+ALIANSATFEKKT FSQEKYKLKKQKKY
Sbjct  61   RAIVDDNKAQCLSGEDIDEMRRQGATGEEIVEALIANSATFEKKTSFSQEKYKLKKQKKY  120

Query  645  apkvllRRPYARSICEA  695
            APKVLLRRP+ARSICEA
Sbjct  121  APKVLLRRPFARSICEA  137



>emb|CBH32650.1| tRNA (guanine-N(1)-)-methyltransferase,putative, expressed [Triticum 
aestivum]
 emb|CDM80424.1| unnamed protein product [Triticum aestivum]
Length=480

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = +3

Query  195  PRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGG  374
            PR  WEGCSVLLDINDGDRL F RLTP + +KIG+K+ SLQPL+G P+GSLF+V      
Sbjct  14   PREAWEGCSVLLDINDGDRLAFFRLTPGATVKIGDKSCSLQPLLGRPFGSLFRVGPDGLV  73

Query  375  PILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDI  554
            P  A  + + +       +  Q  D ++DNR+LVDNNTAQ+L+ EDI+ M+R+GASGD I
Sbjct  74   PCAATDASSQDDKPRGGGAGGQAQDETRDNRSLVDNNTAQTLSSEDIEAMKREGASGDAI  133

Query  555  VKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            V+ALIANS+TF  KT FSQEKYKLKKQKKYAPKVLLRRP +RSICE
Sbjct  134  VEALIANSSTFGNKTVFSQEKYKLKKQKKYAPKVLLRRPTSRSICE  179



>gb|KCW67945.1| hypothetical protein EUGRSUZ_F01642 [Eucalyptus grandis]
Length=524

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  252  LVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAES  431
            +VF  L     LKIG KNYSL+PLIGCP+GSLFQVE G  G  L+R+  + E +N++   
Sbjct  114  VVFGVLGLCRTLKIGKKNYSLRPLIGCPFGSLFQVEYGAEGSKLSRLLESAEVSNIQENG  173

Query  432  DSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQ  611
            D Q  +  +DNR LVDNN AQSL+GEDI+++RRQGA+GD I++ALIANSATFEKKT FSQ
Sbjct  174  DYQLVEEHRDNRELVDNNKAQSLSGEDIEELRRQGATGDKIIEALIANSATFEKKTAFSQ  233

Query  612  EkyklkkqkkyapkvllRRPYARSICE  692
            EKY+LKKQKKYAP+VLLRRP ARSICE
Sbjct  234  EKYRLKKQKKYAPRVLLRRPVARSICE  260



>ref|XP_002459020.1| hypothetical protein SORBIDRAFT_03g044640 [Sorghum bicolor]
 gb|EES04140.1| hypothetical protein SORBIDRAFT_03g044640 [Sorghum bicolor]
Length=489

 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 105/139 (76%), Gaps = 1/139 (1%)
 Frame = +3

Query  198  RITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGP  377
            R  WEGCSVLLDINDGDRL F RLTP + +KIGNK  SLQPL+G P+GSLF++ G +G  
Sbjct  11   REAWEGCSVLLDINDGDRLAFFRLTPGATVKIGNKTCSLQPLVGRPFGSLFRL-GADGLV  69

Query  378  ILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIV  557
              A    T   +N +  +D QT D ++DNR+LVDNNTAQ+L+ +DI+ M+R GA+GD+IV
Sbjct  70   PCAAGDATSRDHNTRDGADGQTQDETRDNRSLVDNNTAQNLSSDDIEAMKRDGATGDEIV  129

Query  558  KALIANSATFEKKTQFSQE  614
            +ALIANS+TF  KT FSQE
Sbjct  130  EALIANSSTFGNKTVFSQE  148



>emb|CCG48005.1| tRNA (guanine-N(1)-)-methyltransferase,putative,expressed [Triticum 
aestivum]
Length=481

 Score =   161 bits (408),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 127/168 (76%), Gaps = 3/168 (2%)
 Frame = +3

Query  195  PRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGG  374
            PR  WEGCSVLLDINDGDRL F RLTP + +KIG+K+ SLQPL+G P+GSLF+V G  G 
Sbjct  14   PREAWEGCSVLLDINDGDRLAFFRLTPGATVKIGDKSCSLQPLLGRPFGSLFRV-GPSGL  72

Query  375  PILARVSPTIEGNNLKAESDSQTTDV--SKDNRALVDNNTAQSLTGEDIDDMRRQGASGD  548
               A    + + +  +    +       ++DNR+LVDNNTAQ+L+ EDI+ M+R+GASGD
Sbjct  73   VPCAATDASSQDDKPRGGGGADGQAQDETRDNRSLVDNNTAQTLSSEDIEAMKREGASGD  132

Query  549  DIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
             IV+ALIANS+TF  KT FSQEKYKLKKQKKYAPKVLLRRP +RSICE
Sbjct  133  AIVEALIANSSTFGNKTVFSQEKYKLKKQKKYAPKVLLRRPSSRSICE  180



>ref|XP_010268703.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X2 [Nelumbo nucifera]
Length=386

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +3

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSL  500
            +IGCP+GSLFQVE G  GP L+RV  T EG+N + + +SQ  D  KDNRA++D+NTAQSL
Sbjct  1    MIGCPFGSLFQVESGPKGPYLSRVVSTSEGSNTQRKDNSQLKDELKDNRAIIDDNTAQSL  60

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYAR  680
            +GEDID MRRQGA+GD+IV+ALIANS+TFEKKT FSQEKY+L+KQKKYAP+VL+RRP+AR
Sbjct  61   SGEDIDAMRRQGAAGDEIVEALIANSSTFEKKTLFSQEKYRLRKQKKYAPRVLMRRPFAR  120

Query  681  SICEA  695
            SICEA
Sbjct  121  SICEA  125



>ref|XP_003565472.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6-like [Brachypodium distachyon]
Length=433

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 122/167 (73%), Gaps = 6/167 (4%)
 Frame = +3

Query  207  WEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQV-----EGGEG  371
            W+GCSV+LDINDGDR++F+RLTP + + IG +  SLQPL+G P+GS F+V     EGG+ 
Sbjct  13   WKGCSVILDINDGDRVIFSRLTPRATVDIGGRKCSLQPLVGRPFGSTFRVEPCDSEGGDY  72

Query  372  GPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDD  551
              +L   +      +     D +  +  +DNR+LVDNNTAQ+L+ +DI+ M+R G SGD 
Sbjct  73   SGVLVSYATDAPSRDDDPTQDGKEHE-RRDNRSLVDNNTAQTLSSDDIEAMKRNGLSGDA  131

Query  552  IVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            IV+ALIANS+TF KKT  SQEKY LKKQKKYAPK+LLRRP ARSICE
Sbjct  132  IVEALIANSSTFGKKTMQSQEKYILKKQKKYAPKLLLRRPSARSICE  178



>ref|XP_001777605.1| predicted protein [Physcomitrella patens]
 gb|EDQ57648.1| predicted protein [Physcomitrella patens]
Length=422

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = +3

Query  213  GCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILARV  392
            GC+VLLDIN+GD++ FA L   + +KIGN    L  L+G P+GS+F+V+ G  G    RV
Sbjct  5    GCAVLLDINNGDKMTFAHLNKNASVKIGNTKCWLDALVGHPFGSVFEVQSGAKGGSFVRV  64

Query  393  SPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIA  572
            SP+ E ++ +     +     KDNR+L+DNNTAQ+L+ EDI  MR +G SG  I++AL+A
Sbjct  65   SPSGEKDDGEEAPGDEVK--GKDNRSLIDNNTAQTLSAEDISKMRTEGVSGRAIMEALVA  122

Query  573  NSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            NSATF  KT FSQEKY  KKQKKYAP+V++RRP ARS+CEA
Sbjct  123  NSATFHTKTAFSQEKYLRKKQKKYAPRVVVRRPSARSVCEA  163



>gb|EMT11539.1| tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit 
TRM6 [Aegilops tauschii]
Length=569

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 126/187 (67%), Gaps = 23/187 (12%)
 Frame = +3

Query  198  RITWEGCSVLLDINDGDRLVFARLTPASRL--------------------KIGNKNYSLQ  317
            R  WEGCSVLLDINDGDRL F RLTP + +                    KIG+K+ SLQ
Sbjct  15   REAWEGCSVLLDINDGDRLAFFRLTPGASVPSLPFPSLFSFLLRNPSWTVKIGDKSCSLQ  74

Query  318  PLIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDV--SKDNRALVDNNTA  491
            PL+G P+GSLF+V G  G    A    + + +  +    +       ++DNR+LVDNNTA
Sbjct  75   PLLGRPFGSLFRV-GPSGLVPCAATDASSQDDKPRGGGGADGQAQDETRDNRSLVDNNTA  133

Query  492  QSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRP  671
            Q+L+ EDI+ M+R+GASGD IV+ALIANS+TF  KT FSQEKYKLKKQKKYAPKVLLRRP
Sbjct  134  QTLSSEDIEAMKREGASGDAIVEALIANSSTFGNKTVFSQEKYKLKKQKKYAPKVLLRRP  193

Query  672  YARSICE  692
             +RSICE
Sbjct  194  SSRSICE  200



>ref|XP_002969483.1| hypothetical protein SELMODRAFT_410184 [Selaginella moellendorffii]
 gb|EFJ29571.1| hypothetical protein SELMODRAFT_410184 [Selaginella moellendorffii]
Length=477

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 118/164 (72%), Gaps = 7/164 (4%)
 Frame = +3

Query  213  GCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILARV  392
            G  VLLDIN+G+  VF+RLTPA+ +K+G   YSL P+IGCP+GS F+ +       L R 
Sbjct  7    GSCVLLDINNGEHFVFSRLTPAATVKLGKAKYSLAPVIGCPFGSQFEPKSSS----LERS  62

Query  393  SPTIEGNNLKA---ESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKA  563
            S   +G +  A   E + +    +KDNR L+D+NTAQ+L+ E+I  M+R+G+SG +IV A
Sbjct  63   SRAGDGKDNNAGEEEEEEEENAATKDNRNLIDDNTAQTLSAEEIHSMKREGSSGQEIVNA  122

Query  564  LIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            LIANSA+FE KT FSQEKYK KKQKKYAP+V++R P A+S+CEA
Sbjct  123  LIANSASFESKTTFSQEKYKRKKQKKYAPRVIIRCPTAKSVCEA  166



>ref|XP_002961249.1| hypothetical protein SELMODRAFT_402980 [Selaginella moellendorffii]
 gb|EFJ38788.1| hypothetical protein SELMODRAFT_402980 [Selaginella moellendorffii]
Length=477

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 119/169 (70%), Gaps = 7/169 (4%)
 Frame = +3

Query  198  RITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGP  377
             +   G  VLLDIN+G+  VF+RLTPA+ +K+G   YSL P+IGCP+GS F+ +      
Sbjct  2    EVVKAGSCVLLDINNGEHFVFSRLTPAATVKLGKAKYSLAPVIGCPFGSQFEPKSSS---  58

Query  378  ILARVSPTIEGNNLKA---ESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGD  548
             L R S   +G +  A   E + +    +KDNR L+D+NTAQ+L+ E+I  M+R+G+SG 
Sbjct  59   -LERSSRAGDGKDNNAGEEEEEEEENAATKDNRNLIDDNTAQTLSAEEIHSMKREGSSGQ  117

Query  549  DIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            +IV ALIANSA+FE KT FSQEKYK KKQKKYAP+V++R P A+S+CEA
Sbjct  118  EIVNALIANSASFESKTTFSQEKYKRKKQKKYAPRVIIRCPTAKSVCEA  166



>ref|XP_002862254.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38512.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=127

 Score =   129 bits (324),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 79/108 (73%), Gaps = 5/108 (5%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEG  371
            NPR   EGCSVLLD+NDGDRLVFARL+  + LKI NKNYSL+PLIG P+GSLFQVE GE 
Sbjct  20   NPRFACEGCSVLLDVNDGDRLVFARLSGGAILKIENKNYSLKPLIGAPFGSLFQVETGED  79

Query  372  GPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDI  515
            G  L+R+ P  + N     S +   D S+DNR +VD N AQ+LTGE++
Sbjct  80   GSFLSRIFPIKQEN-----SSNNVMDDSRDNREIVDTNEAQNLTGEEM  122



>gb|EMS51436.1| tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit 
TRM6 [Triticum urartu]
Length=600

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 105/166 (63%), Gaps = 14/166 (8%)
 Frame = +3

Query  195  PRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGG  374
            PR  WEGCSVLLDINDGDRL F RLTP +    G                L      +  
Sbjct  14   PRAAWEGCSVLLDINDGDRLAFFRLTPGA--SDGEDRGQELLAAAAARPPLRLPLPDDDK  71

Query  375  PILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDI  554
            P         +G   + ++  +T D    NR+LVDNNTAQ+L+ EDI+ M+R+GASGD I
Sbjct  72   P--------RDGGAAEGQAQEETRD----NRSLVDNNTAQTLSSEDIEAMKREGASGDAI  119

Query  555  VKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            V+ALIANS+TF  KT FSQEKYKLKKQKKYAPKVLLRRP  RSICE
Sbjct  120  VEALIANSSTFGNKTVFSQEKYKLKKQKKYAPKVLLRRPSTRSICE  165



>ref|XP_010061044.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X2 [Eucalyptus grandis]
Length=418

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +3

Query  402  IEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSA  581
            I+ +N++   D Q  +  +DNR LVDNN AQSL+GEDI+++RRQGA+GD I++ALIANSA
Sbjct  58   IQVSNIQENGDYQLVEEHRDNRELVDNNKAQSLSGEDIEELRRQGATGDKIIEALIANSA  117

Query  582  TFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            TFEKKT FSQEKY+LKKQKKYAP+VLLRRP ARSICE
Sbjct  118  TFEKKTAFSQEKYRLKKQKKYAPRVLLRRPVARSICE  154



>ref|XP_006596557.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6-like isoform X4 [Glycine max]
Length=416

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  402  IEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSA  581
            +E N  + E D Q    S+DNR LVDNNTAQ LTGEDI+ MRRQGA G++I++ALIANS 
Sbjct  53   VEDNYPEEERDVQANVDSRDNRELVDNNTAQRLTGEDIEAMRRQGAGGNEIIEALIANSV  112

Query  582  TFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            TFEKKT FSQEKY+LKKQKKYAPKVL+RRP ARSICEA
Sbjct  113  TFEKKTSFSQEKYRLKKQKKYAPKVLMRRPVARSICEA  150



>ref|XP_008444798.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X2 [Cucumis melo]
Length=373

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  441  TTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEky  620
            T D  +DNRALVDNN AQSL+ EDID MR QGA+GD+IV+ALIANSATF+KKT FSQEKY
Sbjct  23   TKDELRDNRALVDNNKAQSLSSEDIDAMRSQGATGDEIVEALIANSATFDKKTVFSQEKY  82

Query  621  klkkqkkyapkvllRRPYARSICEA  695
            +L+KQKKYAP+VLLRRP+ RSICEA
Sbjct  83   RLRKQKKYAPRVLLRRPFTRSICEA  107



>ref|XP_011395630.1| tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit 
TRM6 [Auxenochlorella protothecoides]
 gb|KFM22765.1| tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit 
TRM6 [Auxenochlorella protothecoides]
Length=376

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 83/138 (60%), Gaps = 8/138 (6%)
 Frame = +3

Query  201  ITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPI  380
            I  EG  ++LD+N GDR VF  +   +++K+G    S+QPLIGCPYGS F V     G  
Sbjct  18   IIREGSRIILDVN-GDRHVFVVVKGRNKVKLGQAFCSIQPLIGCPYGSTFGV--APDGKT  74

Query  381  LARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTA-QSLTGEDIDDMRRQGASGDDIV  557
            L ++ P +  + L    +    +V+K+N  L+D   A Q LT E I D+R QG  G  IV
Sbjct  75   LQQIPPAVAADWL----EEAALEVTKNNSQLIDAGDANQQLTSERIADLRSQGVHGSAIV  130

Query  558  KALIANSATFEKKTQFSQ  611
            +AL A+SATF+ KT+FSQ
Sbjct  131  EALAAHSATFDAKTEFSQ  148



>ref|XP_011029001.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6 isoform X3 [Populus euphratica]
Length=346

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  456  KDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkq  635
            +DNRA+VDNN AQ+LT  DID+MRRQG  GD+I++ALIANSAT+EKKT FSQEKY++KKQ
Sbjct  5    RDNRAIVDNNEAQTLTSGDIDEMRRQGVKGDEIIEALIANSATYEKKTTFSQEKYRIKKQ  64

Query  636  kkyapkvllRRPYARSICEA  695
            KKYAP+VLLRRP ARSICEA
Sbjct  65   KKYAPRVLLRRPSARSICEA  84



>gb|EMS63230.1| tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit 
trm6 [Triticum urartu]
Length=397

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +3

Query  429  SDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFS  608
            +D Q  D ++DNR+LVDNNTAQ+L+ EDI+ M+R+GASGD IV+ALIANS+TF  KT FS
Sbjct  16   ADDQAQDETRDNRSLVDNNTAQTLSSEDIEAMKREGASGDAIVEALIANSSTFGNKTVFS  75

Query  609  QEkyklkkqkkyapkvllRRPYARSICE  692
            QEKYKLKKQKKYAPKVLLRRP +RSICE
Sbjct  76   QEKYKLKKQKKYAPKVLLRRPSSRSICE  103



>gb|EMT06299.1| tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit 
trm6 [Aegilops tauschii]
Length=423

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  447  DVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkykl  626
            D ++DNR+LVDNNTAQ+L+ EDI+ M+R+GASGD IV+ALIANS+TF  KT FSQEKYKL
Sbjct  27   DETRDNRSLVDNNTAQTLSSEDIEAMKREGASGDAIVEALIANSSTFGNKTVFSQEKYKL  86

Query  627  kkqkkyapkvllRRPYARSICE  692
            KKQKKYAPKVLLRRP  RSICE
Sbjct  87   KKQKKYAPKVLLRRPSTRSICE  108



>ref|XP_001694078.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03014.1| predicted protein [Chlamydomonas reinhardtii]
Length=343

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 101/173 (58%), Gaps = 23/173 (13%)
 Frame = +3

Query  201  ITWEGCSVLLDINDGDRLVFA-RLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGP  377
            +  +G  ++LD+N G++L F  +L     +++G    S  PLIG P+G+LF+V       
Sbjct  6    VICDGDHLVLDVN-GEKLSFVQKLKANGTMRVGKYTVSTAPLIGAPFGALFEV-------  57

Query  378  ILARVSPTIEGNNLK------AESDSQTTDVSKDNRALVDNNTA-QSLTGEDIDDMRRQG  536
                   T +G +L+      A+  ++ TD  +DN  L D NT  Q LT E I+++++ G
Sbjct  58   -------TADGKSLQRVLLPPADEITRITDTERDNSNLFDRNTENQKLTQEQIEELKKSG  110

Query  537  ASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
             +G +IV  L +NSATFEKKT+F+Q+KYK +K KKY   +  R+P AR I EA
Sbjct  111  KAGSEIVDLLCSNSATFEKKTEFAQDKYKRRKAKKYITYLTPRKPTARMISEA  163



>ref|XP_004338247.1| eukaryotic initiation factor 3 gamma subunit family protein [Acanthamoeba 
castellanii str. Neff]
 gb|ELR16234.1| eukaryotic initiation factor 3 gamma subunit family protein [Acanthamoeba 
castellanii str. Neff]
Length=496

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 82/132 (62%), Gaps = 3/132 (2%)
 Frame = +3

Query  213  GCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILARV  392
            G +V+L +N+ D+ +FA++ P   + +  K Y L+ LIG PY S+++        +  + 
Sbjct  36   GDNVILCLNE-DKFIFAQVQPTGTVNVNKKRYPLKTLIGAPYRSIWEAPRNGRDFLPLKE  94

Query  393  SPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIA  572
             P I+  ++   + ++  D++ DNR LVDNN  Q LT ++I  M+  GASG+ I+KALI 
Sbjct  95   KPRIQ--DISDVNPTEDADITTDNRDLVDNNLNQKLTQQEIVAMQDTGASGETIIKALIQ  152

Query  573  NSATFEKKTQFS  608
            NSA+++ KT+FS
Sbjct  153  NSASYQSKTEFS  164



>ref|XP_640865.1| tRNA-methyltransferase subunit [Dictyostelium discoideum AX4]
 sp|Q54UB1.1|TRM6_DICDI RecName: Full=tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit trm6; AltName: Full=tRNA(m1A58)-methyltransferase 
subunit trm6; Short=tRNA(m1A58)MTase subunit trm6 [Dictyostelium 
discoideum]
 gb|EAL66884.1| tRNA-methyltransferase subunit [Dictyostelium discoideum AX4]
Length=521

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 94/165 (57%), Gaps = 4/165 (2%)
 Frame = +3

Query  201  ITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPI  380
            I  EG  V+LDIN+G++    ++   S++KIG K   +  +IG  Y S FQV   +    
Sbjct  34   IIKEGDHVILDINNGEKFSVIKVKLGSKVKIGKKQILINSIIGESYYSSFQVSNEKNT--  91

Query  381  LARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVK  560
            L R++     + L    +    D   DNR L  NNTAQ LT EDI++M+++G   + I+K
Sbjct  92   LERITQKEIDDRLNNLVELNQNDA--DNRNLDQNNTAQKLTQEDINEMKQKGTDSNTIIK  149

Query  561  ALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
             ++ NS +F+ KT FSQ KY  KK KKY+  V + +P  +S+ EA
Sbjct  150  TIVENSESFKTKTSFSQIKYLKKKIKKYSTIVKIIKPTLKSLTEA  194



>ref|XP_005650969.1| Gcd10p-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26425.1| Gcd10p-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=472

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 94/174 (54%), Gaps = 19/174 (11%)
 Frame = +3

Query  201  ITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPI  380
            I  EG + +LDIN+  ++ F  + P S++KIG    SL+PLIG  YG  F          
Sbjct  5    IIREGDNAVLDINNSHKM-FVTVKPGSKVKIGKAMCSLEPLIGQYYGIQF---------A  54

Query  381  LARVSPTIEGNNLKAESDSQTTD--------VSKDNRALVDNNTA-QSLTGEDIDDMRRQ  533
            LA    T+E    K E D  T          + K+N  L+D   A Q+L   DI+ MR  
Sbjct  55   LAADGQTLEFKRPKMERDDGTQKDEWHANGTMDKNNSELLDRGDAHQNLKPADIEAMREA  114

Query  534  GASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            G  G+ IV+AL+ANS T+E KTQF+Q KY+ +K  KY  +  L RP ARS+ EA
Sbjct  115  GMGGEAIVEALLANSETYESKTQFAQAKYRKRKADKYMAQATLVRPTARSVAEA  168



>ref|XP_002955797.1| hypothetical protein VOLCADRAFT_119181 [Volvox carteri f. nagariensis]
 gb|EFJ43222.1| hypothetical protein VOLCADRAFT_119181 [Volvox carteri f. nagariensis]
Length=701

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 97/169 (57%), Gaps = 21/169 (12%)
 Frame = +3

Query  210  EGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            EG  ++LD+N     +  +L    ++++G       PLIG PYG+LF+V           
Sbjct  9    EGDHLVLDVNGEKLSIVQKLKATGKIRVGKFLVPAAPLIGAPYGALFEV-----------  57

Query  390  VSPTIEGNNLK------AESDSQTTDVSKDNRALVDNNTA-QSLTGEDIDDMRRQGASGD  548
               T +G +L+      A+  ++  +  K+N  L D NT  Q LT E I+++++ G +G 
Sbjct  58   ---TNDGRSLQRVLLPPADEITRIAETEKNNSDLFDRNTENQKLTQEQIEELKKSGKAGA  114

Query  549  DIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            +I++AL +NSATF+ KT+FSQ+KYK +K KKY   + +R P AR +CEA
Sbjct  115  EIIQALCSNSATFQNKTEFSQDKYKKRKAKKYLTYLTVREPCARILCEA  163



>ref|XP_002902421.1| tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit 
trm6, putative [Phytophthora infestans T30-4]
 gb|EEY56347.1| tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit 
trm6, putative [Phytophthora infestans T30-4]
Length=422

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 82/139 (59%), Gaps = 8/139 (6%)
 Frame = +3

Query  195  PRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGG  374
            P + +EG +V+   +DG R+ F  +     +++G K  SL+P+IG  YG++F+    E  
Sbjct  20   PYVIYEGDTVICQTSDG-RMFFQTIAKDESVRVGKKVASLKPVIGSFYGAIFE----EQN  74

Query  375  PILARVSPTIEGNNLKAES-DSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDD  551
              L +V+  +  + +  E+ DS   D   DNR   D N+AQ+L   DI ++R  GASG +
Sbjct  75   KKLVKVTGGLFPDPVAPETGDSFVPD--GDNRHYADTNSAQTLKQTDIGELRESGASGQE  132

Query  552  IVKALIANSATFEKKTQFS  608
            I++ L+ NS+T+E KT+FS
Sbjct  133  IIQKLVENSSTWETKTEFS  151



>ref|XP_002679179.1| predicted protein [Naegleria gruberi]
 gb|EFC46435.1| predicted protein, partial [Naegleria gruberi]
Length=387

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 103/187 (55%), Gaps = 13/187 (7%)
 Frame = +3

Query  144  SVNEAIPENSYQNKSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNK-NYSLQP  320
            S +E +P+     +S  P I  EG ++L+ +N G  ++   + P + LKIG K  + L+ 
Sbjct  5    STSEQVPQQLAVVESGIPLIK-EGDTILVKLNSGSMILQQHIKPETNLKIGKKQTFPLKL  63

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTD---VSKDNRALVDNNTA  491
            LIG PY + ++        I    S  I G++   + + Q  +   V  + + L+DNN +
Sbjct  64   LIGQPYYAFYE--------IFEEASAVIPGDDEAPQEEMQDEEGETVDANTKRLIDNNKS  115

Query  492  QSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRP  671
            Q+LT ++I ++++QG  G +I+  LI  S +F+ +TQFSQ+KY  +K+KKY     +  P
Sbjct  116  QTLTQDEILELKKQGVEGKEIISKLIEGSKSFQVRTQFSQQKYLKRKKKKYLTYFKVIDP  175

Query  672  YARSICE  692
             A  IC+
Sbjct  176  SAYDICD  182



>ref|XP_009514362.1| hypothetical protein PHYSODRAFT_474013 [Phytophthora sojae]
 gb|EGZ27087.1| hypothetical protein PHYSODRAFT_474013 [Phytophthora sojae]
Length=415

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 81/138 (59%), Gaps = 6/138 (4%)
 Frame = +3

Query  195  PRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGG  374
            P + +EG +V+   +DG R+ F  +T    +++G K  SL+P+IG  YG++F+    E  
Sbjct  16   PYVIYEGDTVICQTSDG-RMFFQAVTKDESIRVGKKVASLKPVIGSFYGAIFE----EQN  70

Query  375  PILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDI  554
              L +V+  +  + +  E+         DNR   D N+AQ+L   DI ++R +GA+G +I
Sbjct  71   KKLVKVTGGLFPDPVAPETGEGFVP-DGDNRHYADTNSAQTLKQTDIGELREKGATGKEI  129

Query  555  VKALIANSATFEKKTQFS  608
            ++ L+ NS+T+E KT+FS
Sbjct  130  IQKLVENSSTWETKTEFS  147



>ref|XP_005853789.1| hypothetical protein NGA_2025000, partial [Nannochloropsis gaditana 
CCMP526]
 gb|EKU22569.1| hypothetical protein NGA_2025000, partial [Nannochloropsis gaditana 
CCMP526]
Length=280

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 78/147 (53%), Gaps = 10/147 (7%)
 Frame = +3

Query  201  ITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPI  380
            +  EG  V+L + DG R  FA       +++G    SL  LIG PYGS+ +V      P+
Sbjct  24   VIQEGAWVILQMGDG-RNFFACAQQKGMMRLGRVTISLSGLIGVPYGSVLEVHPDRLVPL  82

Query  381  LARVSPT-------IEGNNLK--AESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQ  533
                          ++GN+         +   VS DNR   D NTAQ L+ E++++++R 
Sbjct  83   PGTTELYEDLSVGDMDGNDFARGGAPLGEYDGVSLDNRDFADTNTAQRLSMEEVEELKRS  142

Query  534  GASGDDIVKALIANSATFEKKTQFSQE  614
            GASG  I++AL +NS T+EKKT F+++
Sbjct  143  GASGQAIIQALASNSDTWEKKTAFAKQ  169



>gb|EMT06057.1| tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit 
TRM6 [Aegilops tauschii]
Length=391

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +3

Query  432  DSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQ  611
            D +  D ++DNR+LVDNNT Q+L+ +DI+  +R+GASGD IV+ALIAN +TF  KT FSQ
Sbjct  111  DKKPQDETRDNRSLVDNNTVQTLSSKDIEATKREGASGDAIVEALIANGSTFGNKTVFSQ  170

Query  612  EkyklkkqkkyapkvllRRPYARSI  686
            EKYKLK+Q KYAPKVLLRRP  RS+
Sbjct  171  EKYKLKEQNKYAPKVLLRRPSTRSL  195



>gb|ETO59693.1| hypothetical protein F444_22014 [Phytophthora parasitica P1976]
Length=475

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 82/139 (59%), Gaps = 8/139 (6%)
 Frame = +3

Query  195  PRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGG  374
            P + +EG +V+   +DG R+ F  +     +++G K  +L+P+IG  YG++F+    E  
Sbjct  23   PYVIYEGDTVICQTSDG-RMFFQAVAKDESIRVGKKVANLKPVIGSFYGAIFE----EQN  77

Query  375  PILARVSPTIEGNNLKAES-DSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDD  551
              L +V+  +  + +  E+ D    D   DNR   D N+AQ+L   DI ++R +GASG +
Sbjct  78   KKLVKVTGGLFPDPVAPETGDGFVPD--GDNRHYADTNSAQTLKQTDIGELREKGASGKE  135

Query  552  IVKALIANSATFEKKTQFS  608
            I++ L+ NS+T+E KT+FS
Sbjct  136  IIQKLVENSSTWETKTEFS  154



>gb|ETI30962.1| hypothetical protein F443_21994 [Phytophthora parasitica P1569]
Length=475

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 82/139 (59%), Gaps = 8/139 (6%)
 Frame = +3

Query  195  PRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGG  374
            P + +EG +V+   +DG R+ F  +     +++G K  +L+P+IG  YG++F+    E  
Sbjct  23   PYVIYEGDTVICQTSDG-RMFFQAVAKDESIRVGKKVANLKPVIGSFYGAIFE----EQN  77

Query  375  PILARVSPTIEGNNLKAES-DSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDD  551
              L +V+  +  + +  E+ D    D   DNR   D N+AQ+L   DI ++R +GASG +
Sbjct  78   KKLVKVTGGLFPDPVAPETGDGFVPD--GDNRHYADTNSAQTLKQTDIGELREKGASGKE  135

Query  552  IVKALIANSATFEKKTQFS  608
            I++ L+ NS+T+E KT+FS
Sbjct  136  IIQKLVENSSTWETKTEFS  154



>emb|CAX73263.1| translation initiation factor eIF-3 subunit P62 [Schistosoma 
japonicum]
Length=439

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 86/165 (52%), Gaps = 13/165 (8%)
 Frame = +3

Query  210  EGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            EG  VL  I +  R  F +++   ++    + +SL+  I  P+GS F + G +   +  +
Sbjct  5    EGTYVL--IRNEHRYKFLKISSEKKVNFNGRTFSLKNAIDVPFGSTFSILGDQVHAVKYK  62

Query  390  VSPTIEGNNLKAESDSQTTDVS----KDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIV  557
                   +    ES S   +V     KDNR +  +   Q L+G  I+++RR G SG DI+
Sbjct  63   -------SIFDTESSSHENNVDEIELKDNRNIKGSPANQKLSGSSIEELRRNGVSGQDIL  115

Query  558  KALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
              LI  SATFE+KTQFSQ+KY  KK+ ++     + RP+AR   E
Sbjct  116  DQLIEGSATFEQKTQFSQQKYLKKKKNRHLSLFSIERPHARMFFE  160



>gb|ETK71349.1| hypothetical protein L915_21397 [Phytophthora parasitica]
 gb|ETL24791.1| hypothetical protein L916_21266 [Phytophthora parasitica]
 gb|ETL78013.1| hypothetical protein L917_21114 [Phytophthora parasitica]
 gb|ETM31278.1| hypothetical protein L914_21128 [Phytophthora parasitica]
 gb|ETP00765.1| hypothetical protein F441_21883 [Phytophthora parasitica CJ01A1]
 gb|ETP28916.1| hypothetical protein F442_21857 [Phytophthora parasitica P10297]
Length=475

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 82/139 (59%), Gaps = 8/139 (6%)
 Frame = +3

Query  195  PRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGG  374
            P + +EG +V+   +DG R+ F  +     +++G K  +L+P+IG  YG++F+    E  
Sbjct  23   PYVIYEGDTVICQTSDG-RMFFQAVAKDESIRVGKKVANLKPVIGSFYGAIFE----EQN  77

Query  375  PILARVSPTIEGNNLKAES-DSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDD  551
              L +V+  +  + +  E+ D    D   DNR   D N+AQ+L   DI ++R +GASG +
Sbjct  78   KKLVKVTGGLFPDPVAPETGDGFVPD--GDNRHYADTNSAQTLKQTDIGELREKGASGKE  135

Query  552  IVKALIANSATFEKKTQFS  608
            I++ L+ NS+T+E KT+FS
Sbjct  136  IIQKLVENSSTWETKTEFS  154



>ref|XP_008915171.1| hypothetical protein PPTG_18823 [Phytophthora parasitica INRA-310]
 gb|ETM99552.1| hypothetical protein PPTG_18823 [Phytophthora parasitica INRA-310]
Length=475

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 82/139 (59%), Gaps = 8/139 (6%)
 Frame = +3

Query  195  PRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGG  374
            P + +EG +V+   +DG R+ F  +     +++G K  +L+P+IG  YG++F+    E  
Sbjct  23   PYVIYEGDTVICQTSDG-RMFFQAVAKDESIRVGKKVANLKPVIGSFYGAVFE----EQN  77

Query  375  PILARVSPTIEGNNLKAES-DSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDD  551
              L +V+  +  + +  E+ D    D   DNR   D N+AQ+L   DI ++R +GASG +
Sbjct  78   KKLVKVTGGLFPDPVAPETGDGFVPD--GDNRHYADTNSAQTLKQTDIGELREKGASGKE  135

Query  552  IVKALIANSATFEKKTQFS  608
            I++ L+ NS+T+E KT+FS
Sbjct  136  IIQKLVENSSTWETKTEFS  154



>ref|XP_003289283.1| hypothetical protein DICPUDRAFT_35506 [Dictyostelium purpureum]
 gb|EGC34179.1| hypothetical protein DICPUDRAFT_35506 [Dictyostelium purpureum]
Length=503

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 92/179 (51%), Gaps = 24/179 (13%)
 Frame = +3

Query  189  FNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGE  368
            FN     EG +V+LDIN+G++    ++    + +IG K  ++  +IG P+ S FQV    
Sbjct  27   FNFNSINEGENVILDINNGEKFSIVKVKRGLKTRIGKKQINISEIIGKPWFSSFQVVN--  84

Query  369  GGPILARVSPTIEGNNLKAESDSQTTDV----------SKDNRALVDNNTAQSLTGEDID  518
                        E N LK  +  +  D             DNR L  NNTAQ LT E+I 
Sbjct  85   ------------ETNTLKIVTQKELDDALNNLVELNQNDADNRNLDQNNTAQKLTQEEIT  132

Query  519  DMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
             M+  G   + I+K ++ NS++F+ KT +SQ KY  KK KKY+  V + +P ++S+ EA
Sbjct  133  KMKESGTDSNTIIKTIVENSSSFQTKTAYSQIKYLKKKIKKYSTIVKVIKPTSKSLTEA  191



>gb|EWM23698.1| trna (adenine-n -)-methyltransferase non-catalytic subunit trm6 
[Nannochloropsis gaditana]
Length=511

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 77/144 (53%), Gaps = 10/144 (7%)
 Frame = +3

Query  210  EGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            EG  V+L + DG R  FA       +++G    SL  LIG PYGS+ +V      P+   
Sbjct  27   EGAWVILQMGDG-RNFFACAQQKGMMRLGRVTISLSGLIGVPYGSVLEVHPDRLVPLPGT  85

Query  390  VSPT-------IEGNNLK--AESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGAS  542
                       ++GN+         +   VS DNR   D NTAQ L+ E++++++R GAS
Sbjct  86   TELYEDLSVGDMDGNDFARGGAPLGEYDGVSLDNRDFADTNTAQRLSMEEVEELKRSGAS  145

Query  543  GDDIVKALIANSATFEKKTQFSQE  614
            G  I++AL +NS T+EKKT F+++
Sbjct  146  GQAIIQALASNSDTWEKKTAFAKQ  169



>ref|XP_005837772.1| hypothetical protein GUITHDRAFT_41344, partial [Guillardia theta 
CCMP2712]
 gb|EKX50792.1| hypothetical protein GUITHDRAFT_41344, partial [Guillardia theta 
CCMP2712]
Length=241

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 89/157 (57%), Gaps = 16/157 (10%)
 Frame = +3

Query  252  LVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAES  431
            L+  R  P  ++KI   N   + LIG PYG++F+V  GE   +L  +  +  GN      
Sbjct  1    LMVERPRPGEKIKIARANIRHEDLIGFPYGTVFEVNKGERSALLEEILAS--GN-----P  53

Query  432  DSQTTDVSKD--NRALVDNN-------TAQSLTGEDIDDMRRQGASGDDIVKALIANSAT  584
             S   +VSKD  NR L+D N       ++Q L  + I +++  G +G +++K+LI NS T
Sbjct  54   GSSINEVSKDRDNRVLLDKNALTNGKESSQKLGADQIKELKNSGMNGREVIKSLIENSDT  113

Query  585  FEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            F+ KT+FSQ K+  KK  K++P+ +  +P + ++C+A
Sbjct  114  FKHKTEFSQAKWLKKKAAKHSPQFVTIKPTSLTLCQA  150



>ref|XP_002506666.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67924.1| predicted protein [Micromonas sp. RCC299]
Length=499

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 94/165 (57%), Gaps = 10/165 (6%)
 Frame = +3

Query  213  GCSVLLDINDGDRLVFARLTPASRLKIG-NKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            G +VLL++N GD+  F +L       IG +K+ SL PLIG P+GS ++V+  +G    A+
Sbjct  28   GDTVLLEMN-GDKWAFIKLKRDGTAVIGKHKDVSLAPLIGAPFGSTYEVDQ-DGVLYPAQ  85

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDN---NTAQSLTGEDIDDMRRQGASGDDIVK  560
              P        A  D+        N A V++   N+AQ +   DI  ++R+G  G  +V+
Sbjct  86   PDPP----EWTAGDDAINAIDDDRNNADVNDMRDNSAQRMDQHDIARLKREGVGGRSLVE  141

Query  561  ALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            AL A+SATF KKT ++QEKY  KK +K+  +   RRP  R++CEA
Sbjct  142  ALAASSATFAKKTAYAQEKYVKKKLRKHLVRCRARRPTPRAVCEA  186



>emb|CBN75132.1| conserved unknown protein [Ectocarpus siliculosus]
Length=456

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 94/170 (55%), Gaps = 13/170 (8%)
 Frame = +3

Query  210  EGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            +G ++L+D +DG R  F ++    R+ IG  +  +  L+  PYG++F+++G      L R
Sbjct  31   DGDTILVDHSDG-RTFFVKVESGKRVNIGKTSCKMSYLLNAPYGAVFELDGNR----LVR  85

Query  390  V-SPTIEGNNLKAESDSQTTDVS-------KDNRALVDNNTAQSLTGEDIDDMRRQGASG  545
            V    +E          + T  +       +DNR   D NTAQ LT EDI  M+ +G  G
Sbjct  86   VDGELVEAEEEPPGVVEEVTAAALASDVRPQDNRGFTDTNTAQKLTEEDIHKMKNEGKGG  145

Query  546  DDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
              I++AL+ NS T+  KTQ+SQ K+  +KQ+KY P+V + R   R++C+A
Sbjct  146  RAIIQALMDNSDTWGNKTQYSQAKWLKRKQQKYRPRVRVVRVTGRTMCDA  195



>emb|CCA25085.1| tRNA (adenineN(1))methyltransferase noncatalytic subunit trm6 
putative [Albugo laibachii Nc14]
Length=449

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 96/164 (59%), Gaps = 6/164 (4%)
 Frame = +3

Query  201  ITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPI  380
            I  +G +V+ + +DG R+ F  +     ++I     SL P+IG  YGS F+ +  +    
Sbjct  26   IIHDGDTVICEASDG-RMFFQLVAAKECIRISKTLTSLTPVIGAAYGSTFEYQNQK----  80

Query  381  LARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVK  560
            L +VS  +  + +  E       +  DNR   D N+AQ L+ E I ++R QGA+G +I++
Sbjct  81   LVKVSGGLFPDPVTPEFGEAIVPLC-DNRHYTDTNSAQKLSSESIAELRSQGATGKEIIE  139

Query  561  ALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            AL+ NSAT++ +T+FS++KY  KKQ KY P+V + +  A S+C+
Sbjct  140  ALVENSATWKDRTEFSKQKYLRKKQTKYMPRVHILKCTAESLCK  183



>ref|XP_007514261.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15698.1| predicted protein [Bathycoccus prasinos]
Length=507

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 96/169 (57%), Gaps = 9/169 (5%)
 Frame = +3

Query  198  RITWEGCSVLLDINDGDRLVFARLTPASRLKIG-NKNYSLQPLI-GCPYGSLFQVEGGEG  371
            +I  E   VLL +N+  R  F  L P     +G +KN  L PL+   P+GSLF+V+  + 
Sbjct  33   KIMKENDVVLLHMNNS-RWQFVNLKPKKTCAVGKHKNVKLDPLLNSIPFGSLFEVD--QK  89

Query  372  GPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVD-NNTAQSLTGEDIDDMRRQGASGD  548
            G +       +E + + A+   +     + N+A  D N  AQ L+ ++I  M++ G SG 
Sbjct  90   GVLEHVGVEMLEEDEIHAQIPVED---ERSNKAYDDLNGKAQKLSDKEIQRMQQSGVSGQ  146

Query  549  DIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
             IV  L+ANSATF +KT F+QEKYK+KK KK+  K++ R P  R +CEA
Sbjct  147  AIVDELVANSATFSQKTAFAQEKYKMKKMKKHLTKIIARWPSPRYVCEA  195



>ref|XP_783506.2| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Strongylocentrotus purpuratus]
Length=507

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 90/164 (55%), Gaps = 10/164 (6%)
 Frame = +3

Query  201  ITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPI  380
            +  EG +V+L    G  L   ++   +++ +  +++SL P++G PYGS ++++ G    +
Sbjct  6    LVAEGDNVIL--KKGKLLKVYKVIKKAKVFLEKRHFSLAPIVGHPYGSTWELQSGSLVQV  63

Query  381  LARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVK  560
            L         N +  +   Q      DNR + D +T Q L  +DI ++R QG SG +IV 
Sbjct  64   LE--------NTVSQDLAEQIDKGGADNRGIFDGDTTQKLDNDDIMNLREQGKSGQEIVD  115

Query  561  ALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
             L+ NS+TF ++T +S+ KY  KK+ KY  + ++ RP  R +CE
Sbjct  116  QLVENSSTFNERTVYSKAKYLKKKRNKYIVRFVVLRPCIRLMCE  159



>emb|CDW89783.1| trna (adenine-n)-methyltransferase non-catalytic subunit trm6-like 
[Stylonychia lemnae]
Length=359

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 76/135 (56%), Gaps = 12/135 (9%)
 Frame = +3

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNL-------KAESDSQTTDV-----SKDN  464
            LIG  YG  F+V   + G ++         N          AE + +  ++      +DN
Sbjct  17   LIGKEYGQFFEVRDSKSGELIEVTDVHQLTNQFLEDVDFGDAEENEEVKEIIDPVAGRDN  76

Query  465  RALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkky  644
            R  VD+N +Q L+ E+I+ +++QG SG+++++ L+ NS TF K+T+FSQEKY  KK++KY
Sbjct  77   RDYVDDNKSQKLSHEEIEALKKQGMSGNELIQQLVQNSETFSKRTKFSQEKYLRKKKQKY  136

Query  645  apkvllRRPYARSIC  689
                 L++P A  +C
Sbjct  137  QITFQLKKPTALELC  151



>gb|KIY99610.1| tRNA (adenine-N(1)-)-methyltransferasenon-catalytic subunit TRM6 
[Monoraphidium neglectum]
Length=160

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 61/83 (73%), Gaps = 1/83 (1%)
 Frame = +3

Query  447  DVSKDNRALVDNNT-AQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyk  623
            +V KDN  LVD N   Q+L  EDI++++RQG +G DIV+AL +NS TF+ KT+F+Q+KY 
Sbjct  11   EVDKDNSQLVDRNEDNQALKAEDIEELKRQGKAGADIVEALCSNSVTFDTKTEFAQDKYI  70

Query  624  lkkqkkyapkvllRRPYARSICE  692
             +K KKY  +V LRRP  R++CE
Sbjct  71   KRKSKKYVLRVTLRRPTGRTLCE  93



>ref|XP_004902638.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X3 [Heterocephalus glaber]
 ref|XP_004840852.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X3 [Heterocephalus glaber]
Length=520

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 80/158 (51%), Gaps = 23/158 (15%)
 Frame = +3

Query  165  ENSYQNKSFNPRITWEGCSVLLDINDGDRLVFAR--------LTPASRLKIGNKNYSLQP  320
            E+S +  S  P +  + C     I DGD +V  R        +    ++    + + L  
Sbjct  25   ESSGEQPSAQPPLPGDHC-----IRDGDFVVLKREDVFKAVQVQRRKKITFEKQWFYLDN  79

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSL  500
            +IG  YG+ F+V GG           +++    K ES S+T +   DNR ++D+  +Q L
Sbjct  80   VIGHSYGTTFEVTGG----------GSLQPKKKKEESTSETKEAGTDNRNIIDDGKSQKL  129

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQE  614
            T +DI  ++ +G  G++IV+ LI NS TF  KT+F+Q+
Sbjct  130  TQDDIKALKDKGIKGEEIVQQLIENSTTFRDKTEFAQD  167



>gb|EHB14239.1| tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit 
TRM6 [Heterocephalus glaber]
Length=497

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 80/158 (51%), Gaps = 23/158 (15%)
 Frame = +3

Query  165  ENSYQNKSFNPRITWEGCSVLLDINDGDRLVFAR--------LTPASRLKIGNKNYSLQP  320
            E+S +  S  P +  + C     I DGD +V  R        +    ++    + + L  
Sbjct  2    ESSGEQPSAQPPLPGDHC-----IRDGDFVVLKREDVFKAVQVQRRKKITFEKQWFYLDN  56

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSL  500
            +IG  YG+ F+V GG           +++    K ES S+T +   DNR ++D+  +Q L
Sbjct  57   VIGHSYGTTFEVTGGG----------SLQPKKKKEESTSETKEAGTDNRNIIDDGKSQKL  106

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQE  614
            T +DI  ++ +G  G++IV+ LI NS TF  KT+F+Q+
Sbjct  107  TQDDIKALKDKGIKGEEIVQQLIENSTTFRDKTEFAQD  144



>ref|XP_004902637.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X2 [Heterocephalus glaber]
 ref|XP_004840851.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X2 [Heterocephalus glaber]
Length=553

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 80/158 (51%), Gaps = 23/158 (15%)
 Frame = +3

Query  165  ENSYQNKSFNPRITWEGCSVLLDINDGDRLVFAR--------LTPASRLKIGNKNYSLQP  320
            E+S +  S  P +  + C     I DGD +V  R        +    ++    + + L  
Sbjct  25   ESSGEQPSAQPPLPGDHC-----IRDGDFVVLKREDVFKAVQVQRRKKITFEKQWFYLDN  79

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSL  500
            +IG  YG+ F+V GG           +++    K ES S+T +   DNR ++D+  +Q L
Sbjct  80   VIGHSYGTTFEVTGGG----------SLQPKKKKEESTSETKEAGTDNRNIIDDGKSQKL  129

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQE  614
            T +DI  ++ +G  G++IV+ LI NS TF  KT+F+Q+
Sbjct  130  TQDDIKALKDKGIKGEEIVQQLIENSTTFRDKTEFAQD  167



>ref|XP_004902636.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Heterocephalus glaber]
 ref|XP_004840850.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Heterocephalus glaber]
Length=555

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 80/158 (51%), Gaps = 23/158 (15%)
 Frame = +3

Query  165  ENSYQNKSFNPRITWEGCSVLLDINDGDRLVFAR--------LTPASRLKIGNKNYSLQP  320
            E+S +  S  P +  + C     I DGD +V  R        +    ++    + + L  
Sbjct  25   ESSGEQPSAQPPLPGDHC-----IRDGDFVVLKREDVFKAVQVQRRKKITFEKQWFYLDN  79

Query  321  LIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSL  500
            +IG  YG+ F+V GG           +++    K ES S+T +   DNR ++D+  +Q L
Sbjct  80   VIGHSYGTTFEVTGGG----------SLQPKKKKEESTSETKEAGTDNRNIIDDGKSQKL  129

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQE  614
            T +DI  ++ +G  G++IV+ LI NS TF  KT+F+Q+
Sbjct  130  TQDDIKALKDKGIKGEEIVQQLIENSTTFRDKTEFAQD  167



>ref|XP_005789795.1| hypothetical protein EMIHUDRAFT_109824 [Emiliania huxleyi CCMP1516]
 gb|EOD37366.1| hypothetical protein EMIHUDRAFT_109824 [Emiliania huxleyi CCMP1516]
Length=458

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 89/173 (51%), Gaps = 19/173 (11%)
 Frame = +3

Query  210  EGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            EG  V+L ++ G+R    R+   + +++G    +  PL+G P+G+ F VE G G   L R
Sbjct  11   EGSFVVLLLSGGER-KLQRVRSGAAMRVGKHKPTCDPLLGAPFGANFVVETGGGEARLVR  69

Query  390  VSPTIEGNNLKAESDSQTTDVSKD---------NRALVDN---NTAQSLTGEDIDDMRRQ  533
               TIE      E D+  T+V+           N  L D     TAQSL+  +I+ ++  
Sbjct  70   DQRTIE------EIDASVTEVAASLGGASADATNAELNDEREATTAQSLSHAEIEALKAG  123

Query  534  GASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            GASG+ +V A+ A S TF  KT FSQEKY  KK +K+   V   RP    +C+
Sbjct  124  GASGEALVHAIAAGSKTFASKTAFSQEKYLRKKARKHFQTVTALRPSPLVLCD  176



>dbj|GAM24157.1| hypothetical protein SAMD00019534_073320 [Acytostelium subglobosum 
LB1]
Length=505

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 87/163 (53%), Gaps = 7/163 (4%)
 Frame = +3

Query  210  EGCSVLLDINDGDRLVFARLTPASRLKIGN-KNYSLQPLIGCPYGSLFQVEGGEGGPILA  386
            +G +V+L+IN+G+     +L    +   G  KN  L P IG PY + F V       +L 
Sbjct  55   QGDTVILNINNGETYRIIKLDNDMKQTFGKLKNIDLTPAIGLPYYTTFSVGKDR---VLE  111

Query  387  RVSP-TIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKA  563
            +V+P  ++   L+    S   D   +N  L   NT+Q LTG+DI  M+ +G    +++ A
Sbjct  112  QVNPKALDEELLRITEISNNQDA--NNSTLTSYNTSQKLTGDDIKGMKAKGGDYKEVISA  169

Query  564  LIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            LI NS++F  KT +SQ KY  KK  K++  +   RP  +++CE
Sbjct  170  LIDNSSSFHTKTAYSQIKYLKKKMAKHSTMIRFLRPTLKTLCE  212



>gb|ELT95756.1| hypothetical protein CAPTEDRAFT_113381 [Capitella teleta]
Length=423

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 78/135 (58%), Gaps = 17/135 (13%)
 Frame = +3

Query  234  INDGDRLVF--ARLTPASRLKIGNK------NYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I++GD++V   A++    +++ G K       +S   LIG P+G  F+   G    +L +
Sbjct  6    ISEGDQIVIQKAKVLKVVQVRKGRKIWLDRVQFSADELIGKPFGCTFEENKG----VLVQ  61

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
            VS T  G+    ++D+   +  +DNR L  + + Q +T  +I +MR+QG SG +I++ L+
Sbjct  62   VSRT--GSE---DADNAVEEGKRDNRDLQGDQSNQKITKSEIQEMRKQGVSGQEIIEQLV  116

Query  570  ANSATFEKKTQFSQE  614
             NSATF+KK  FSQE
Sbjct  117  ENSATFKKKNTFSQE  131



>ref|XP_002185121.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC43253.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=414

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 80/144 (56%), Gaps = 18/144 (13%)
 Frame = +3

Query  285  LKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILARVSPTIEG---NNLKAESDSQTTDVS  455
            LKI  +N++   LIG PYG+           +L  + P  +G   ++ + + D   TDV 
Sbjct  18   LKINKRNFATGDLIGLPYGT-----------VLEDLVPNFDGKIMSDFEKDVDVDETDVE  66

Query  456  ----KDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyk  623
                +DNR LVDNN AQ+L   ++  MR  G  G  IVK +I NS+TF++KT+FS+ KY 
Sbjct  67   IDQIRDNRNLVDNNDAQALDHFELLRMRESGVDGSKIVKEIIQNSSTFDQKTEFSKAKYI  126

Query  624  lkkqkkyapkvllRRPYARSICEA  695
             +KQKKY  +  + R     ICEA
Sbjct  127  ARKQKKYQLRCRIIRCTPAFICEA  150



>emb|CBK24326.2| unnamed protein product [Blastocystis hominis]
Length=496

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 68/132 (52%), Gaps = 9/132 (7%)
 Frame = +3

Query  210  EGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            EG    L +NDG R  +        +K+  K+Y +  L+G  YG++F+V+G    P+   
Sbjct  5    EGYQFFLYLNDGSRR-YGYALKNGEIKLQRKHYPISDLVGHRYGTVFEVQGKHLVPVNEP  63

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
            + P         +      +   DNR LVD+   Q+L  EDI+ MR++G SG  I++ L 
Sbjct  64   LIP--------VDVADVDVNDENDNRELVDDIKHQTLQQEDIERMRKEGVSGHAILQELA  115

Query  570  ANSATFEKKTQF  605
            ++S TF+ KT F
Sbjct  116  SSSVTFDGKTDF  127



>ref|XP_005844191.1| hypothetical protein CHLNCDRAFT_139358 [Chlorella variabilis]
 gb|EFN52089.1| hypothetical protein CHLNCDRAFT_139358 [Chlorella variabilis]
Length=354

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +3

Query  453  SKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkk  632
            ++ N  LVD+  AQ+L+  DI+ M+ +GA+G DIV AL ANSATF  KT+FSQ+KY+ KK
Sbjct  35   TRTNADLVDSGGAQALSAADIEAMKAEGAAGADIVAALTANSATFAAKTEFSQDKYRKKK  94

Query  633  qkkyapkvllRRPYARSICEA  695
             +KY     +RRP A ++CEA
Sbjct  95   ARKYIQVATVRRPTAAAVCEA  115



>emb|CDX73407.1| BnaC08g25960D [Brassica napus]
Length=246

 Score = 66.6 bits (161),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 54/84 (64%), Gaps = 7/84 (8%)
 Frame = +3

Query  354  VEGGEGGPILARVSPTIEGNNLKAESDS-QTTDVSKDNRALVDNNTAQSLTGEDIDDMRR  530
            ++  + G   +R+ P      +K ES S    D ++DNR L+D+N +Q+ T E I+ MR 
Sbjct  73   IQITQDGSFPSRILP------IKKESSSVNVIDDARDNRELIDDNESQNFTAEKIEAMRT  126

Query  531  QGASGDDIVKALIANSATFEKKTQ  602
            +GA GD+I++ALIANS TF+KK Q
Sbjct  127  EGAKGDEIIEALIANSKTFDKKFQ  150


 Score = 29.3 bits (64),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 27/49 (55%), Gaps = 0/49 (0%)
 Frame = +1

Query  166  KIRIKIKALTLELPGKVAVSCLISTMATVWFSLV*LLPRD*R*GIKITP  312
            +I I +K    +L  KVA  C + TM TV  SLV L   D + GI+IT 
Sbjct  29   RISISLKIQIRDLLAKVAACCSMLTMETVSSSLVYLFLIDLKSGIQITQ  77



>ref|XP_004697902.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Echinops telfairi]
Length=508

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 70/135 (52%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFARLTPASRLKIGNKN--------YSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R      +++  K         + L  +IG  YG+ F+V GG        
Sbjct  27   IRDGDFVVLKREDVLKAVQVQRKKKITFEKQWFYLDNVIGHSYGTTFEVAGG--------  78

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  79   --GSLQPKKKKEELTSETKEAGVDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  136

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+FSQ+
Sbjct  137  ENSTTFRDKTEFSQD  151



>emb|CCI39622.1| unnamed protein product [Albugo candida]
Length=1088

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 98/171 (57%), Gaps = 8/171 (5%)
 Frame = +3

Query  183  KSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEG  362
            KS    I ++G +V+ +++DG R+ F  ++    ++I     SL P+IG    S F+ + 
Sbjct  664  KSREANIIYDGDTVICEVSDG-RMFFQTVSTKECIRISKTLTSLAPVIGA--ASTFEYQN  720

Query  363  GEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGAS  542
             +    L +VS  +  + +  E       +  DNR   D N+AQ L+ E I ++R QGA+
Sbjct  721  QK----LVKVSGGLFPDPVAPEFGEAIVPIC-DNRHYTDTNSAQKLSSESIAELRSQGAT  775

Query  543  GDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            G +I++AL+ NSAT+  +T+FS++KY  KKQ KY P+V + +  A S+C+ 
Sbjct  776  GKEIIEALVENSATWNDRTEFSKQKYLKKKQTKYMPRVRVLKCTAESLCKT  826



>ref|XP_004634391.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Octodon degus]
Length=497

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 71/135 (53%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFARLTPASRLKIGNKN--------YSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            + DGD +V  R      +++  +         + L  +IG  YG+ F+V GG        
Sbjct  20   VRDGDFVVLKREEVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTGG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K ES S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GSLQPKKKKEESTSETKEAGTDNRNIIDDGKSQKLTQDDIRALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_001417818.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96111.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=461

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 93/162 (57%), Gaps = 7/162 (4%)
 Frame = +3

Query  213  GCSVLLDINDGDRLVFARLTPASRLKIGNKN-YSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            G  VL++IN+G+R  FA L     + +G +    ++ L+G P+GS +++    G    A 
Sbjct  24   GDVVLIEINEGERATFATLKEGKSVDVGKRQKVPVEALLGAPFGSRYEIVHNTG----AC  79

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNT-AQSLTGEDIDDMRRQGASGDDIVKAL  566
            V    EG +      S   +  + N+ + + +  AQ LT  DI  +RR+  +G+++V+ +
Sbjct  80   VRLGAEGVDDDVAHGSAPVEDERSNKHVSNKHEGAQRLTDADIAALRRE-FTGEEMVEII  138

Query  567  IANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
             ANS TF++KT F+QEKY+ +K KK+  ++L+R P  R +CE
Sbjct  139  AANSKTFDEKTAFAQEKYRARKMKKHMTRILVRFPSPRQVCE  180



>ref|XP_005380909.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X2 [Chinchilla lanigera]
Length=497

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 70/135 (52%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V GG        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTGGG-------  72

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  73   ---SLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_010605815.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Fukomys damarensis]
 gb|KFO22182.1| tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit 
TRM6 [Fukomys damarensis]
Length=497

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 70/135 (52%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFARLTPASRLKIGNKN--------YSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R      +++  +         + L  +IG  YG+ F+V GG        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFERQWFYLDNVIGHSYGTTFEVTGG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GSLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_010605816.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X2 [Fukomys damarensis]
Length=495

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 70/135 (52%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFARLTPASRLKIGNKN--------YSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R      +++  +         + L  +IG  YG+ F+V GG        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFERQWFYLDNVIGHSYGTTFEVTGG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GSLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_005717779.1| unnamed protein product [Chondrus crispus]
 emb|CDF37908.1| unnamed protein product [Chondrus crispus]
Length=418

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 84/159 (53%), Gaps = 12/159 (8%)
 Frame = +3

Query  222  VLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILARVSPT  401
            V+L   DG + V   ++  S  +IG +   +  L+G  +G LF V  G+      R+ P 
Sbjct  13   VVLSATDGKK-VLGHVSRNSSARIGKRKRKIGALLGARWGDLFAVRSGD------RLEPV  65

Query  402  IEGN--NLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIAN  575
             E    N+ AE++  T    ++N+ L D N  Q L    I  M+ QG  G+ +V+ ++ N
Sbjct  66   EEEQSFNVTAETEMGT---ERNNQYLEDTNENQKLEQSTILAMKEQGIEGEQLVRTVVEN  122

Query  576  SATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            S TF  KT FSQEKY  +K+ K+  KV + RP A ++CE
Sbjct  123  SLTFRGKTAFSQEKYIKRKRAKFDLKVRVLRPTALTLCE  161



>ref|XP_003079466.1| tRNA(1-methyladenosine) methyltransferase, subunit GCD10 (ISS) 
[Ostreococcus tauri]
 emb|CAL54124.1| Eukaryotic initiation factor 3, gamma subunit [Ostreococcus tauri]
Length=457

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 97/182 (53%), Gaps = 8/182 (4%)
 Frame = +3

Query  162  PENSYQNKSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKIGNKNYS-LQPLIGCPY  338
            PE +   +    R   E   VLL++NDG+R  FA L     + +G +  +  +  +G P+
Sbjct  20   PETTASERVHAGRAMRENDVVLLEMNDGERATFATLRAGKVIDLGKRARAPAEAFLGAPF  79

Query  339  GSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVD----NNTAQSLTG  506
            GS+++     G   + R+  T E  N + + +        D R+  +     + AQ+LT 
Sbjct  80   GSMYEARHNTGE--VERIGATTEVINEETDDEEAFAAPLADERSNKNVPNTEHGAQTLTD  137

Query  507  EDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSI  686
             +I  ++R+  +G+++V+ + A S TFE+KT F+QEKYK +K KK+  K+L R P  R +
Sbjct  138  SEIAALKRE-FTGEEMVEIIAAYSKTFEEKTAFAQEKYKARKLKKHMTKILARFPSPRVV  196

Query  687  CE  692
            CE
Sbjct  197  CE  198



>ref|XP_004315757.1| PREDICTED: LOW QUALITY PROTEIN: tRNA (adenine(58)-N(1))-methyltransferase 
non-catalytic subunit TRM6 [Tursiops truncatus]
Length=493

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 68/127 (54%), Gaps = 12/127 (9%)
 Frame = +3

Query  234  INDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILARVSPTIEGN  413
            I DGD +V  R     ++    + + L  +IG  YG+ F+V  G           +++  
Sbjct  20   IRDGDFVVLKR--EDVKVTFEKQWFYLDNVIGHSYGTTFEVTSGG----------SLQPK  67

Query  414  NLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEK  593
              K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI NS TF  
Sbjct  68   KKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLIENSTTFRD  127

Query  594  KTQFSQE  614
            KT+F+Q+
Sbjct  128  KTEFAQD  134



>ref|XP_004227530.2| PREDICTED: LOW QUALITY PROTEIN: tRNA (adenine(58)-N(1))-methyltransferase 
non-catalytic subunit TRM6-like [Ciona intestinalis]
Length=453

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 77/124 (62%), Gaps = 10/124 (8%)
 Frame = +3

Query  324  IGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNN-TAQSL  500
            +GC YG++F+V  GE           I   +L +   +      KDNR+LVD +  +Q++
Sbjct  50   VGCNYGTVFKVANGEM---------EITDQDLDSLDTNADDAQGKDNRSLVDTHGKSQTI  100

Query  501  TGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYAR  680
              E+I +M+ +GA+G++IVK L+ NS++F +KT FSQ KY  KK+KKY   + ++RP +R
Sbjct  101  KRENILEMKGEGATGEEIVKCLVENSSSFNEKTSFSQNKYLKKKKKKYLSYIRIQRPNSR  160

Query  681  SICE  692
             IC+
Sbjct  161  LICQ  164



>gb|EJY66280.1| Gcd10p domain containing protein [Oxytricha trifallax]
Length=402

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 94/187 (50%), Gaps = 33/187 (18%)
 Frame = +3

Query  222  VLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILARVS--  395
            V+ D +   R++  + T   ++K       L  LIG  +GS F+V+  + G  L +V+  
Sbjct  10   VMFDNSSNYRIIKVKAT-GKKIKHFKAMIDLSQLIGKEWGSFFEVKDSKSGQ-LQQVTDV  67

Query  396  ------------------PTIEG-------NNLKAESDSQTTDVS----KDNRALVDNNT  488
                              P  E        N   A   S T +++    +DNR  VD+N 
Sbjct  68   HSLTAAFLEDVDFSNGANPADEEEEKQEQINTSSANQGSNTININQVTGRDNRDYVDDNK  127

Query  489  AQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRR  668
            +Q LT E I+D+++QG +G++++  L+ NS TF K+T+FSQEKY  KK++KY     +++
Sbjct  128  SQKLTHEQIEDLKKQGITGNELINHLVQNSDTFAKRTKFSQEKYLRKKKQKYLVTFQVKK  187

Query  669  PYARSIC  689
            P A  +C
Sbjct  188  PTAFELC  194



>ref|XP_004083383.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Oryzias latipes]
Length=470

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 69/135 (51%), Gaps = 17/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I +GD +V  R        + P  ++    +   L  ++GC YG+ F++  G GG  L  
Sbjct  13   IKEGDYVVLKRGDIYKSVQILPKKKVIFEKQWIFLDNVVGCLYGNTFEIRSG-GGLQLQ-  70

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
                   N    ES   +     DNR ++D+  +Q LT +DI+ ++ QG  G +I++ LI
Sbjct  71   -------NTKTTESPPDSKVAGTDNRNIIDDGKSQKLTKDDIEKLKDQGLKGQEIIQQLI  123

Query  570  ANSATFEKKTQFSQE  614
             NSATF  KT+++Q+
Sbjct  124  ENSATFSNKTEYAQD  138



>ref|XP_008062499.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Tarsius syrichta]
Length=497

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 70/135 (52%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I+DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IHDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GSLQPKKKKEEPTSETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_008139293.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Eptesicus fuscus]
Length=497

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 70/135 (52%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IGDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSG------GS  73

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
            + PT +    K E  S+T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  74   LQPTKK----KKEPTSETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_010377219.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Rhinopithecus roxellana]
Length=458

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 20/136 (15%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQV-EGGEGGPILA  386
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  GG   P   
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSGGSLQPKKK  79

Query  387  RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
            R  PT E           T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ L
Sbjct  80   REEPTAE-----------TKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQL  128

Query  567  IANSATFEKKTQFSQE  614
            I NS TF  KT+F+Q+
Sbjct  129  IENSTTFRDKTEFAQD  144



>ref|XP_006626064.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6-like [Lepisosteus oculatus]
Length=475

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 71/144 (49%), Gaps = 19/144 (13%)
 Frame = +3

Query  210  EGCSVLLDINDGDRLVFARLTPASRLKIGNKN--------YSLQPLIGCPYGSLFQVEGG  365
            E  +    I +GD +V  R      +++  K         + L   IG  YG+ F+V  G
Sbjct  6    EAVNAQWTIKEGDHVVLKREDVFKAVQVQKKRKIIFEKQWFFLDNAIGELYGTNFEVASG  65

Query  366  EGGPILARVSPTIEGNNLKAESDSQ-TTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGAS  542
                       T++   +K E + Q T +   DNR +VD+  +Q LT +DI+ ++ QG  
Sbjct  66   ----------GTLQPRKVKHEENPQETKEAGMDNRNIVDDGRSQKLTRDDIETLKEQGLK  115

Query  543  GDDIVKALIANSATFEKKTQFSQE  614
            G +IV+ LI NS TF  KT+F+QE
Sbjct  116  GKEIVQQLIENSTTFRDKTEFAQE  139



>ref|XP_006096503.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Myotis lucifugus]
Length=497

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 70/135 (52%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IGDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSG------GS  73

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
            + PT +    K E  S+T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  74   LQPTKK----KEEPTSETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_007539628.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Erinaceus europaeus]
Length=497

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFARLTPASRLKIGNKN--------YSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R      ++I  +         + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREEVFKAVQIQRRKKVTFEKQWFYLDNIIGHSYGTTFEVTSGG-------  72

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  73   ---SLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_003495308.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X2 [Cricetulus griseus]
 gb|EGV93093.1| tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit 
TRM6 [Cricetulus griseus]
Length=496

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I+DGD +V  R        +    ++    + + L   IG  YGS F+V  G        
Sbjct  20   IHDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNAIGHSYGSTFEVSNG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GSLQLKKKKEEPTSETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_004343480.1| hypothetical protein CAOG_07606 [Capsaspora owczarzaki ATCC 30864]
Length=568

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 85/154 (55%), Gaps = 9/154 (6%)
 Frame = +3

Query  234  INDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILARVSPTIEGN  413
            +  GD +    +   + +  G  ++ L   IG P  S ++V   +G   + RVS  +   
Sbjct  95   MTKGDSIKIHLVQRGNLVHFGKLSFKLDSAIGQPCDSYYEVTR-DGLTRVNRVSDVL---  150

Query  414  NLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEK  593
                 ++++ + V+K N+ LVD  + Q LT +D+  M+R   +G  ++  L+ NS++FE 
Sbjct  151  -----AETEESSVAKSNQFLVDKGSNQKLTADDVQSMKRANVTGQTLISKLVENSSSFEH  205

Query  594  KTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            KT+FSQ KY  KKQ+++   V + RP A+++CEA
Sbjct  206  KTEFSQAKYIKKKQQRHLNVVRIARPTAQTLCEA  239



>ref|XP_005068726.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Mesocricetus auratus]
Length=496

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I+DGD +V  R        +    ++    + + L   IG  YGS F+V  G        
Sbjct  20   IHDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNAIGHSYGSTFEVSNGG-------  72

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  73   ---SLQLKKKKEEPTSETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>dbj|BAA86467.1| KIAA1153 protein [Homo sapiens]
Length=424

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 20/136 (15%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQV-EGGEGGPILA  386
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  GG   P   
Sbjct  44   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTAFEVTSGGSLQPKKK  103

Query  387  RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
            R  PT E           T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ L
Sbjct  104  REEPTAE-----------TKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQL  152

Query  567  IANSATFEKKTQFSQE  614
            I NS TF  KT+F+Q+
Sbjct  153  IENSTTFRDKTEFAQD  168



>gb|EAX10407.1| CGI-09 protein, isoform CRA_b, partial [Homo sapiens]
 dbj|BAG11288.1| tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit 
TRM6 [synthetic construct]
Length=400

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 20/136 (15%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQV-EGGEGGPILA  386
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  GG   P   
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTAFEVTSGGSLQPKKK  79

Query  387  RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
            R  PT E           T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ L
Sbjct  80   REEPTAE-----------TKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQL  128

Query  567  IANSATFEKKTQFSQE  614
            I NS TF  KT+F+Q+
Sbjct  129  IENSTTFRDKTEFAQD  144



>ref|XP_006758132.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Myotis davidii]
 gb|ELK34550.1| tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit 
TRM6 [Myotis davidii]
Length=497

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 70/135 (52%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IGDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDDVIGHRYGTTFEVTSG------GS  73

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
            + PT +    K E  S+T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  74   LQPTKK----KEEPTSETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_005874808.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Myotis brandtii]
Length=502

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 70/135 (52%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  25   IGDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSG------GS  78

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
            + PT +    K E  S+T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  79   LQPTKK----KEEPTSETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  134

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  135  ENSTTFRDKTEFAQD  149



>ref|XP_011403590.1| PREDICTED: uncharacterized protein LOC100636746 [Amphimedon queenslandica]
Length=969

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 90/162 (56%), Gaps = 13/162 (8%)
 Frame = +3

Query  222  VLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILARVSPT  401
            VLL + D  + +  RL    ++K    ++     IG PYGS F+V    G  IL +    
Sbjct  12   VLLHVKDIYKPI--RLVKRRKIKFDKISFVPDAAIGLPYGSEFEV--ARGNLILVKEE--  65

Query  402  IEGNNLKAESDSQTTDVS-----KDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
                  +  + SQ T+V+     KDNR +VD+  +Q L+ E+I  M++ G SG +I++++
Sbjct  66   --ERRGEEGTISQLTEVAVVESAKDNRLIVDDGLSQKLSHEEIHQMKKDGMSGQEILESV  123

Query  567  IANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICE  692
            +  S++F+ +T+FSQEKY  KK K+++  + + +P  R I +
Sbjct  124  VQGSSSFKDRTKFSQEKYVKKKYKRHSHVLSIIKPTTRLIAQ  165



>ref|XP_003476643.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Cavia porcellus]
Length=497

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 68/135 (50%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L   IG  YG+ F+V GG        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNAIGHSYGTTFEVTGG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
                ++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GCLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>gb|KJE97147.1| hypothetical protein CAOG_007606 [Capsaspora owczarzaki ATCC 
30864]
Length=594

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 85/154 (55%), Gaps = 9/154 (6%)
 Frame = +3

Query  234  INDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILARVSPTIEGN  413
            +  GD +    +   + +  G  ++ L   IG P  S ++V   +G   + RVS  +   
Sbjct  121  MTKGDSIKIHLVQRGNLVHFGKLSFKLDSAIGQPCDSYYEV-TRDGLTRVNRVSDVL---  176

Query  414  NLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEK  593
                 ++++ + V+K N+ LVD  + Q LT +D+  M+R   +G  ++  L+ NS++FE 
Sbjct  177  -----AETEESSVAKSNQFLVDKGSNQKLTADDVQSMKRANVTGQTLISKLVENSSSFEH  231

Query  594  KTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            KT+FSQ KY  KKQ+++   V + RP A+++CEA
Sbjct  232  KTEFSQAKYIKKKQQRHLNVVRIARPTAQTLCEA  265



>ref|XP_005991159.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X3 [Latimeria chalumnae]
Length=417

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 71/138 (51%), Gaps = 17/138 (12%)
 Frame = +3

Query  225  LLDINDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPI  380
            +  + +GD +V  R        L    ++    + + L   IG  YG+ F+V  G  G +
Sbjct  11   VFTMKEGDFVVLKREDVFKAVQLLKKRKIFFEKQWFYLDNAIGHHYGTTFEVSSG--GAL  68

Query  381  LARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVK  560
              +         + +ES ++ T+   DNR ++D+  +Q LT +DI+ ++ QG  G +IV+
Sbjct  69   QPK-------KPVSSESTNEATEAGIDNRNIIDDGKSQKLTRDDIEALKEQGKKGQEIVQ  121

Query  561  ALIANSATFEKKTQFSQE  614
             LI NS TF  KT+F+QE
Sbjct  122  HLIENSTTFRDKTEFAQE  139



>ref|XP_002168557.2| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6-like [Hydra vulgaris]
Length=453

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 76/127 (60%), Gaps = 6/127 (5%)
 Frame = +3

Query  234  INDGDRLVFARLTPASRL-KIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILARVSPT-IE  407
            I  G+ L +  ++ ++++ K+ N  +S + LIG P+GS F+V   E    L ++ P  +E
Sbjct  12   IKKGNNLKYVYVSNSAKVEKMENFFFSCKDLIGHPFGSAFKVLDKER---LLKIDPVLVE  68

Query  408  GNNLKAE-SDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSAT  584
             +N + E + S   D S DNR + D++ +Q L   +I+ MR +G SG++IVK ++ NS+T
Sbjct  69   THNQEYENAGSNLEDTSGDNREIQDDSNSQRLGKNEIEAMRDEGKSGEEIVKEIVENSST  128

Query  585  FEKKTQF  605
            F+ +  F
Sbjct  129  FQGRNIF  135



>emb|CCD75289.1| translation initiation factor eif3-related [Schistosoma mansoni]
Length=441

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 64/120 (53%), Gaps = 4/120 (3%)
 Frame = +3

Query  258  FARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDS  437
            F +++   R K   K +SL+  IG P+GS F V G +  PI       IE   +   ++ 
Sbjct  19   FTKISSEKREKFDGKVFSLRNAIGVPFGSTFSVSGDQIHPIKHESIIDIE---IPPNNEE  75

Query  438  QTTDV-SKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQE  614
            +   V SKDNR +  +   Q LTG  I+ +R  G SG DI+  L+  ++ FE+KT FSQ+
Sbjct  76   KYGGVESKDNRNIKYSQANQKLTGSYIEQLRLNGVSGQDILDQLVEGNSNFEQKTLFSQQ  135



>ref|XP_005991157.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Latimeria chalumnae]
 ref|XP_005991158.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X2 [Latimeria chalumnae]
Length=503

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 71/138 (51%), Gaps = 17/138 (12%)
 Frame = +3

Query  225  LLDINDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPI  380
            +  + +GD +V  R        L    ++    + + L   IG  YG+ F+V  G  G +
Sbjct  11   VFTMKEGDFVVLKREDVFKAVQLLKKRKIFFEKQWFYLDNAIGHHYGTTFEVSSG--GAL  68

Query  381  LARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVK  560
              +         + +ES ++ T+   DNR ++D+  +Q LT +DI+ ++ QG  G +IV+
Sbjct  69   QPK-------KPVSSESTNEATEAGIDNRNIIDDGKSQKLTRDDIEALKEQGKKGQEIVQ  121

Query  561  ALIANSATFEKKTQFSQE  614
             LI NS TF  KT+F+QE
Sbjct  122  HLIENSTTFRDKTEFAQE  139



>ref|XP_008536611.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X2 [Equus przewalskii]
Length=410

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDYVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTNG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GSLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_006984037.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Peromyscus maniculatus bairdii]
Length=498

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I+DGD +V  R        +    ++    + + L   IG  YGS F+V  G        
Sbjct  22   IHDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNAIGHSYGSTFEVSNG--------  73

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  74   --GSLQLKKKKEEPASETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  131

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  132  ENSTTFRDKTEFAQD  146



>ref|XP_005991160.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X4 [Latimeria chalumnae]
Length=403

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 71/139 (51%), Gaps = 17/139 (12%)
 Frame = +3

Query  222  VLLDINDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGP  377
             +  + +GD +V  R        L    ++    + + L   IG  YG+ F+V  G  G 
Sbjct  10   AVFTMKEGDFVVLKREDVFKAVQLLKKRKIFFEKQWFYLDNAIGHHYGTTFEVSSG--GA  67

Query  378  ILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIV  557
            +  +         + +ES ++ T+   DNR ++D+  +Q LT +DI+ ++ QG  G +IV
Sbjct  68   LQPK-------KPVSSESTNEATEAGIDNRNIIDDGKSQKLTRDDIEALKEQGKKGQEIV  120

Query  558  KALIANSATFEKKTQFSQE  614
            + LI NS TF  KT+F+QE
Sbjct  121  QHLIENSTTFRDKTEFAQE  139



>gb|EPQ12972.1| tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit 
TRM6 [Myotis brandtii]
Length=536

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 70/135 (52%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  59   IGDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSG------GS  112

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
            + PT +    K E  S+T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  113  LQPTKK----KEEPTSETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  168

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  169  ENSTTFRDKTEFAQD  183



>ref|XP_011739503.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Macaca nemestrina]
Length=497

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 20/136 (15%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQV-EGGEGGPILA  386
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  GG   P   
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSGGSLQPKKK  79

Query  387  RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
            R  PT E           T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ L
Sbjct  80   REEPTAE-----------TKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQL  128

Query  567  IANSATFEKKTQFSQE  614
            I NS TF  KT+F+Q+
Sbjct  129  IENSTTFRDKTEFAQD  144



>ref|XP_010377221.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X3 [Rhinopithecus roxellana]
Length=497

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 20/136 (15%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQV-EGGEGGPILA  386
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  GG   P   
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSGGSLQPKKK  79

Query  387  RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
            R  PT E           T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ L
Sbjct  80   REEPTAE-----------TKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQL  128

Query  567  IANSATFEKKTQFSQE  614
            I NS TF  KT+F+Q+
Sbjct  129  IENSTTFRDKTEFAQD  144



>ref|XP_011796403.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Colobus angolensis palliatus]
Length=497

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 20/136 (15%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQV-EGGEGGPILA  386
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  GG   P   
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSGGSLQPKKK  79

Query  387  RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
            R  PT E           T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ L
Sbjct  80   REEPTAE-----------TKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQL  128

Query  567  IANSATFEKKTQFSQE  614
            I NS TF  KT+F+Q+
Sbjct  129  IENSTTFRDKTEFAQD  144



>ref|XP_011823462.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Mandrillus leucophaeus]
Length=497

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 20/136 (15%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQV-EGGEGGPILA  386
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  GG   P   
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSGGSLQPKKK  79

Query  387  RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
            R  PT E           T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ L
Sbjct  80   REEPTAE-----------TKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQL  128

Query  567  IANSATFEKKTQFSQE  614
            I NS TF  KT+F+Q+
Sbjct  129  IENSTTFRDKTEFAQD  144



>ref|XP_008016889.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Chlorocebus sabaeus]
Length=497

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 20/136 (15%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQV-EGGEGGPILA  386
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  GG   P   
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSGGSLQPKKK  79

Query  387  RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
            R  PT E           T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ L
Sbjct  80   REEPTAE-----------TKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQL  128

Query  567  IANSATFEKKTQFSQE  614
            I NS TF  KT+F+Q+
Sbjct  129  IENSTTFRDKTEFAQD  144



>ref|XP_003905098.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Papio anubis]
Length=497

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 20/136 (15%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQV-EGGEGGPILA  386
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  GG   P   
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSGGSLQPKKK  79

Query  387  RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
            R  PT E           T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ L
Sbjct  80   REEPTAE-----------TKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQL  128

Query  567  IANSATFEKKTQFSQE  614
            I NS TF  KT+F+Q+
Sbjct  129  IENSTTFRDKTEFAQD  144



>ref|XP_001494320.2| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform 1 [Equus caballus]
 ref|XP_008536536.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Equus przewalskii]
Length=497

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDYVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTNG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GSLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_011907511.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Cercocebus atys]
Length=497

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 20/136 (15%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQV-EGGEGGPILA  386
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  GG   P   
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSGGSLQPKKK  79

Query  387  RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
            R  PT E           T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ L
Sbjct  80   REEPTAE-----------TKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQL  128

Query  567  IANSATFEKKTQFSQE  614
            I NS TF  KT+F+Q+
Sbjct  129  IENSTTFRDKTEFAQD  144



>ref|XP_003252189.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Nomascus leucogenys]
Length=497

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 20/136 (15%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQV-EGGEGGPILA  386
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  GG   P   
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSGGSLQPKKK  79

Query  387  RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
            R  PT E           T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ L
Sbjct  80   REEPTAE-----------TKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQL  128

Query  567  IANSATFEKKTQFSQE  614
            I NS TF  KT+F+Q+
Sbjct  129  IENSTTFRDKTEFAQD  144



>ref|XP_004061830.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Gorilla gorilla gorilla]
Length=497

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 20/136 (15%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQV-EGGEGGPILA  386
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  GG   P   
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTAFEVTSGGSLQPKKK  79

Query  387  RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
            R  PT E           T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ L
Sbjct  80   REEPTAE-----------TKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQL  128

Query  567  IANSATFEKKTQFSQE  614
            I NS TF  KT+F+Q+
Sbjct  129  IENSTTFRDKTEFAQD  144



>ref|NP_001248589.1| tRNA methyltransferase 6 homolog [Macaca mulatta]
 ref|XP_005568449.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Macaca fascicularis]
 gb|EHH19907.1| tRNA(m1A58)-methyltransferase subunit TRM6 [Macaca mulatta]
 gb|EHH65532.1| tRNA(m1A58)-methyltransferase subunit TRM6 [Macaca fascicularis]
Length=497

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 20/136 (15%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQV-EGGEGGPILA  386
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  GG   P   
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSGGSLQPKKK  79

Query  387  RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
            R  PT E           T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ L
Sbjct  80   REEPTAE-----------TKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQL  128

Query  567  IANSATFEKKTQFSQE  614
            I NS TF  KT+F+Q+
Sbjct  129  IENSTTFRDKTEFAQD  144



>ref|XP_006894293.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Elephantulus edwardii]
Length=493

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  17   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVSSGG-------  69

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  70   ---SLQPKKRKEEPTSETKEAGIDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  126

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+FSQ+
Sbjct  127  ENSTTFRDKTEFSQD  141



>ref|XP_002829989.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Pongo abelii]
Length=497

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 20/136 (15%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQV-EGGEGGPILA  386
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  GG   P   
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSGGSLQPKKK  79

Query  387  RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
            R  PT E           T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ L
Sbjct  80   REEPTAE-----------TKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQL  128

Query  567  IANSATFEKKTQFSQE  614
            I NS TF  KT+F+Q+
Sbjct  129  IENSTTFRDKTEFAQD  144



>ref|XP_001166710.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Pan troglodytes]
Length=497

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 20/136 (15%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQV-EGGEGGPILA  386
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  GG   P   
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTAFEVTSGGSLQPKKK  79

Query  387  RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
            R  PT E           T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ L
Sbjct  80   REEPTAE-----------TKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQL  128

Query  567  IANSATFEKKTQFSQE  614
            I NS TF  KT+F+Q+
Sbjct  129  IENSTTFRDKTEFAQD  144



>ref|XP_003821398.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Pan paniscus]
Length=498

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 20/136 (15%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQV-EGGEGGPILA  386
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  GG   P   
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTAFEVTSGGSLQPKKK  79

Query  387  RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
            R  PT E           T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ L
Sbjct  80   REEPTAE-----------TKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQL  128

Query  567  IANSATFEKKTQFSQE  614
            I NS TF  KT+F+Q+
Sbjct  129  IENSTTFRDKTEFAQD  144



>ref|NP_057023.2| tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit 
TRM6 isoform 1 [Homo sapiens]
 sp|Q9UJA5.1|TRM6_HUMAN RecName: Full=tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6; AltName: Full=tRNA(m1A58)-methyltransferase 
subunit TRM6; Short=tRNA(m1A58)MTase subunit TRM6 [Homo 
sapiens]
 gb|AAH01262.1| TRNA methyltransferase 6 homolog (S. cerevisiae) [Homo sapiens]
 gb|EAX10406.1| CGI-09 protein, isoform CRA_a [Homo sapiens]
 gb|AIC51533.1| TRMT6, partial [synthetic construct]
Length=497

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 20/136 (15%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQV-EGGEGGPILA  386
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  GG   P   
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTAFEVTSGGSLQPKKK  79

Query  387  RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
            R  PT E           T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ L
Sbjct  80   REEPTAE-----------TKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQL  128

Query  567  IANSATFEKKTQFSQE  614
            I NS TF  KT+F+Q+
Sbjct  129  IENSTTFRDKTEFAQD  144



>ref|XP_009037160.1| hypothetical protein AURANDRAFT_64086 [Aureococcus anophagefferens]
 gb|EGB08445.1| hypothetical protein AURANDRAFT_64086 [Aureococcus anophagefferens]
Length=705

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 57/161 (35%), Positives = 85/161 (53%), Gaps = 10/161 (6%)
 Frame = +3

Query  213  GCSVLLDINDGDRLVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILARV  392
            G S+LL  ++ D   F    P+ + +IG +      L+   +G LF ++        A V
Sbjct  303  GDSILLATSN-DTYQFVDAKPSVKFRIGKQQVKATDLVDASFGQLFTLQNK------ALV  355

Query  393  SPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIA  572
              T +  N+  E+ +      KDNR L D+N AQSL  + I DMR +G +G  I+ AL  
Sbjct  356  PTTRDALNITLEASNNN---KKDNRDLDDDNKAQSLDADAIKDMRSRGETGAAIIGALAE  412

Query  573  NSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
             SAT++ KT+FS+ K+  +K KKY P V +  P A +I EA
Sbjct  413  GSATWDSKTEFSKAKWLKRKAKKYLPWVQVLEPTANAIAEA  453



>ref|XP_007469191.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Lipotes vexillifer]
Length=503

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNIIGHSYGTTFEVTSGG-------  72

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  73   ---SLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_006870481.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6, partial [Chrysochloris asiatica]
Length=465

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTNG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GSLQPKKKKEEPTSETKEAGIDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+FSQ+
Sbjct  130  ENSTTFRDKTEFSQD  144



>ref|XP_007073306.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Panthera tigris altaica]
Length=497

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNIIGHSYGTTFEVTNG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GSLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_003983793.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Felis catus]
Length=497

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNIIGHSYGTTFEVTNG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GSLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_007636936.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X2 [Cricetulus griseus]
 gb|ERE71812.1| tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit 
TRM6 [Cricetulus griseus]
Length=496

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            ++DGD +V  R        +    ++    + + L   IG  YGS F+V  G        
Sbjct  20   VHDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNAIGHSYGSTFEVSNG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GSLQLKKKKEEPTSETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>gb|AAD27718.1|AF132943_1 CGI-09 protein [Homo sapiens]
Length=330

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 20/136 (15%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQV-EGGEGGPILA  386
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  GG   P   
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTAFEVTSGGSLQPKKK  79

Query  387  RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
            R  PT E           T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ L
Sbjct  80   REEPTAE-----------TKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQL  128

Query  567  IANSATFEKKTQFSQE  614
            I NS TF  KT+F+Q+
Sbjct  129  IENSTTFRDKTEFAQD  144



>ref|XP_005380908.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Chinchilla lanigera]
Length=503

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 59/103 (57%), Gaps = 10/103 (10%)
 Frame = +3

Query  306  YSLQPLIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNN  485
            + L  +IG  YG+ F+V GG           +++    K E  S+T +   DNR ++D+ 
Sbjct  58   FYLDNVIGHSYGTTFEVTGG----------GSLQPKKKKEEPTSETKEAGTDNRNIIDDG  107

Query  486  TAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQE  614
             +Q LT +DI  ++ +G  G++IV+ LI NS TF  KT+F+Q+
Sbjct  108  KSQKLTQDDIKALKDKGIKGEEIVQQLIENSTTFRDKTEFAQD  150



>ref|XP_010992814.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Camelus dromedarius]
Length=497

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNIIGHSYGTTFEVTNG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GSLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_010834750.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Bison bison bison]
Length=497

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNIIGHSYGTTFEVTNG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GSLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_006047802.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Bubalus bubalis]
Length=497

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNIIGHSYGTTFEVTNG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GSLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_006187142.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Camelus ferus]
 ref|XP_010971022.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Camelus bactrianus]
Length=497

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNIIGHSYGTTFEVTNG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GSLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>gb|EJY69889.1| Gcd10p domain containing protein [Oxytricha trifallax]
Length=343

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 82/157 (52%), Gaps = 32/157 (20%)
 Frame = +3

Query  312  LQPLIGCPYGSLFQVEGGEGGPILARVS--------------------PTIEG-------  410
            L  LIG  +GS F+V+  + G  L +V+                    P  E        
Sbjct  4    LSQLIGKEWGSFFEVKDSKSGQ-LQQVTDVHSLTAAFLEDVDFSNGANPADEEEEKQEQI  62

Query  411  NNLKAESDSQTTDVS----KDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANS  578
            N   A   S T +++    +DNR  VD+N +Q LT E I+D+++QG +G++++  L+ NS
Sbjct  63   NTSSANQGSNTININQVTGRDNRDYVDDNKSQKLTHEQIEDLKKQGITGNELINHLVQNS  122

Query  579  ATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSIC  689
             TF K+T+FSQEKY  KK++KY     +++P A  +C
Sbjct  123  DTFAKRTKFSQEKYLRKKKQKYLVTFQVKKPTAFELC  159



>ref|XP_011368359.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Pteropus vampyrus]
Length=497

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 68/135 (50%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTAG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
                ++    K E  S+T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GNLQPKKKKEEPTSETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|NP_001033129.1| tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit 
TRM6 [Bos taurus]
 sp|Q2T9V5.1|TRM6_BOVIN RecName: Full=tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6; AltName: Full=tRNA(m1A58)-methyltransferase 
subunit TRM6; Short=tRNA(m1A58)MTase subunit TRM6 [Bos 
taurus]
 gb|AAI11250.1| TRNA methyltransferase 6 homolog (S. cerevisiae) [Bos taurus]
 tpg|DAA23171.1| TPA: tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit 
TRM6 [Bos taurus]
Length=497

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNIIGHSYGTTFEVTNGG-------  72

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  73   ---SLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_005891117.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Bos mutus]
 gb|ELR59778.1| tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit 
TRM6 [Bos mutus]
Length=497

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNIIGHSYGTTFEVTNG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GSLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_006921672.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Pteropus alecto]
 gb|ELK03980.1| tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit 
TRM6 [Pteropus alecto]
Length=497

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 68/135 (50%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTAG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
                ++    K E  S+T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GNLQPKKKKEEPTSETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_005343166.1| PREDICTED: LOW QUALITY PROTEIN: tRNA methyltransferase 6 homolog 
(S. cerevisiae) [Ictidomys tridecemlineatus]
Length=496

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 70/135 (52%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFARLTPASRLKIGNKN--------YSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I++GD +V  R      +++  +         + L  +IG  YG+ F+V  G G      
Sbjct  20   IHEGDFVVLKREDVLKAVQVQRRKKVTFEKQWFYLDNVIGHNYGATFEVTSGGG------  73

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
                ++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  74   ----LQLKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_004355316.1| tRNA-methyltransferase subunit [Dictyostelium fasciculatum]
 gb|EGG16842.1| tRNA-methyltransferase subunit [Dictyostelium fasciculatum]
Length=452

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 88/167 (53%), Gaps = 16/167 (10%)
 Frame = +3

Query  213  GCSVLLDINDGDRLVFARLTPASRLKIGNK--NYSLQPLIGCPYGSLFQVEGGEGGPILA  386
            G +++L+IN+GD     +L    +  +  K     L  LIG P+ S +QV          
Sbjct  31   GDTIILNINNGDNYKVVKLVQGLQSHVVGKCKKVDLLQLIGKPFYSTYQV----------  80

Query  387  RVSPTIEGNNLKAESDSQT----TDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDI  554
              + T+E  N K      T    T +  DN  L + NT Q LT +DI  M+++G+S  +I
Sbjct  81   LPNGTMERTNQKDIEKELTNLIQTTIDADNSKLTNLNTTQKLTEDDIAKMKQKGSSASEI  140

Query  555  VKALIANSATFEKKTQFSQEkyklkkqkkyapkvllRRPYARSICEA  695
            +KALI NS +F  KT++SQ KY  KK  +++  V + +P ++++ E+
Sbjct  141  IKALIENSDSFHTKTEYSQMKYLKKKMGRHSTVVKILKPTSKNLIES  187



>gb|EPY79157.1| tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit 
TRM6 [Camelus ferus]
Length=434

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNIIGHSYGTTFEVTNGG-------  72

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  73   ---SLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_004276498.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Orcinus orca]
Length=503

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSGG-------  72

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  73   ---SLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_003933267.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Saimiri boliviensis boliviensis]
Length=497

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 70/135 (52%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V GG        
Sbjct  20   ICDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTGG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    + E  ++T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GSLQPKKKREEPTAETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_006735548.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Leptonychotes weddellii]
Length=497

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTNGG-------  72

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  73   ---SLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_007191781.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Balaenoptera acutorostrata scammoni]
Length=503

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSGG-------  72

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  73   ---SLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_005094820.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6-like [Aplysia californica]
Length=518

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 76/136 (56%), Gaps = 20/136 (15%)
 Frame = +3

Query  234  INDGDRLVFARLTPASRLKIGNKN---------YSLQPLIGCPYGSLFQVEGGEGGPILA  386
            I +GD ++F R   +SR+    KN         +S++ LIG PYGS F+++ G+    L 
Sbjct  5    IQEGDHVLFRR-ERSSRVFHIRKNRQVYFEKTKFSVEELIGQPYGSTFEIDRGK----LI  59

Query  387  RVSPTIEGNNLKAESDS-QTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKA  563
            +V       N K E ++ +    S DNR L+D ++ Q ++ +DI  ++ +G +G  I++ 
Sbjct  60   KVE-----TNRKLELETGEAAAPSADNRNLLDLDSNQKMSKDDIMKLKEEGITGKKIIEE  114

Query  564  LIANSATFEKKTQFSQ  611
            LI NS TF  KT+FSQ
Sbjct  115  LIENSETFRNKTEFSQ  130



>ref|XP_007123240.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Physeter catodon]
Length=503

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSGG-------  72

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  73   ---SLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_010668507.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6-like [Beta vulgaris subsp. vulgaris]
Length=167

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 71/132 (54%), Gaps = 11/132 (8%)
 Frame = +3

Query  222  VLLDINDGDR-LVFARLTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILARVSP  398
            +L+   DG   +V A   P S L++      + P+IG PYG++F++  G     L  V  
Sbjct  11   ILIAFLDGSYSMVHAH--PNSNLRLNKVYVPIDPIIGRPYGTVFRLINGS----LVEVEY  64

Query  399  TIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALIANS  578
            ++     + E DS     S DN  L   N+AQ LT  +I+++++   SGD+++  L ANS
Sbjct  65   SLADE--RTELDSNHVP-SNDNSNLFAKNSAQKLTQAEIEELKK-TVSGDELISLLAANS  120

Query  579  ATFEKKTQFSQE  614
             TF  KT++SQE
Sbjct  121  TTFTTKTEYSQE  132



>ref|XP_008701544.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Ursus maritimus]
Length=497

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTNGG-------  72

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  73   ---SLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_002925063.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Ailuropoda melanoleuca]
 gb|EFB15498.1| hypothetical protein PANDA_014492, partial [Ailuropoda melanoleuca]
Length=497

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTNGG-------  72

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  73   ---SLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_004398269.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Odobenus rosmarus divergens]
Length=497

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTNGG-------  72

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  73   ---SLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_004433828.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Ceratotherium simum simum]
Length=497

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTNGG-------  72

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  73   ---SLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_005688232.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Capra hircus]
Length=497

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTNGG-------  72

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  73   ---SLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_011995492.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X2 [Ovis aries musimon]
Length=497

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTNGG-------  72

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  73   ---SLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_006207427.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Vicugna pacos]
Length=497

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTNG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GSLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_005974382.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Pantholops hodgsonii]
Length=497

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTNG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GSLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_004014397.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Ovis aries]
Length=497

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTNGG-------  72

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  73   ---SLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_008571044.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Galeopterus variegatus]
Length=497

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 76/149 (51%), Gaps = 21/149 (14%)
 Frame = +3

Query  192  NPRITWEGCSVLLDINDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSL  347
            +P+++  G  +   I DGD +V  R        +    ++    + + +  +IG  YG+ 
Sbjct  9    SPQLSHAGDHL---IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYMDNVIGHSYGTT  65

Query  348  FQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMR  527
            F+V  G           +++    K E  S+T +   DNR +VD+  +Q LT +DI  ++
Sbjct  66   FEVTSG----------GSLQPKKKKEEPASETKEAGTDNRNIVDDGKSQKLTQDDIKALK  115

Query  528  RQGASGDDIVKALIANSATFEKKTQFSQE  614
             +G  G++IV+ LI NS TF  KT+F+Q+
Sbjct  116  DKGIKGEEIVQQLIENSTTFRDKTEFAQD  144



>ref|XP_007950664.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Orycteropus afer afer]
Length=494

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  17   ICDGDFVVLKREDVFKAVQVQRRKKITFEKQWFYLDNVIGHSYGTTFEVTNGG-------  69

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  70   ---SLQPKKKKEEPTSETKEAGIDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  126

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+FSQ+
Sbjct  127  ENSTTFRDKTEFSQD  141



>ref|XP_004751586.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Mustela putorius furo]
 ref|XP_004792215.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Mustela putorius furo]
Length=496

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTNGG-------  72

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  73   ---SLQPKKKKEEPASETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_011415154.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6-like [Crassostrea gigas]
 gb|EKC26021.1| tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit 
TRM6 [Crassostrea gigas]
Length=453

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 77/129 (60%), Gaps = 10/129 (8%)
 Frame = +3

Query  306  YSLQPLIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNN  485
            +SL   +G  YGS F V+ G+    + +V  T +      E++    +   DNR L D +
Sbjct  52   FSLDGAVGHYYGSTFVVKNGQ----MHKVQKTFK------EAEVLGPEKGTDNRDLHDLD  101

Query  486  TAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQEkyklkkqkkyapkvllR  665
            + Q L+ EDI+ M+++GA G +I++ LI NS TF+ KT+++QEK+  KK++K+  +  + 
Sbjct  102  SNQKLSREDIEKMKKEGAKGQEIIEQLIENSTTFKGKTEYAQEKWVKKKKQKHVAEFTVL  161

Query  666  RPYARSICE  692
            +P  R +C+
Sbjct  162  KPNTRLMCQ  170



>ref|XP_005365613.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Microtus ochrogaster]
Length=496

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 67/135 (50%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L   IG  YGS F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNAIGHSYGSTFEVSNG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
                ++    K E  S+T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GCLQLKKKKEEPTSETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_004593448.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Ochotona princeps]
Length=456

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 17/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V GG        
Sbjct  14   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTGG------GS  67

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
            + P       + E  ++T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  68   LQPK---KKKEGEPTAETKEAGTDNRNIIDDGKSQKLTQDDIKALKDRGIKGEEIVQQLI  124

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  125  ENSTTFRDKTEFAQD  139



>ref|XP_001927431.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Sus scrofa]
Length=497

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 68/135 (50%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHNYGTTFEVTNG--------  71

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
                ++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  72   --GILQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_002710888.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Oryctolagus cuniculus]
Length=497

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 69/136 (51%), Gaps = 20/136 (15%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQV-EGGEGGPILA  386
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  GG   P   
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSGGSLQPKKK  79

Query  387  RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
            +  PT           S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ L
Sbjct  80   QEEPT-----------SETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQL  128

Query  567  IANSATFEKKTQFSQE  614
            I NS TF  KT+F+Q+
Sbjct  129  IENSTTFRDKTEFAQD  144



>ref|NP_001101249.1| tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit 
TRM6 [Rattus norvegicus]
 gb|EDL80274.1| similar to CGI-09 protein (predicted) [Rattus norvegicus]
Length=495

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 68/135 (50%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I+DGD +V  R        +    ++    + + L   IG  YGS F+V  G    +  +
Sbjct  21   IHDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNAIGHSYGSTFEVSSGGSLQLRKK  80

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
            +           E  S+T +   DNR +VD+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  81   LE----------EPTSETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  130

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  131  ENSTTFRDKTEFAQD  145



>ref|XP_004687003.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Condylura cristata]
Length=497

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 68/135 (50%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L   IG  YG+ F+V  G        
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNAIGHSYGTTFEVTHGG-------  72

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  73   ---SLQPKKKKEEPTSETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  129

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  130  ENSTTFRDKTEFAQD  144



>ref|XP_004383106.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Trichechus manatus latirostris]
Length=500

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  G        
Sbjct  23   ICDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTTFEVTSGG-------  75

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  76   ---SLQPKKKKEEPTSETKEAGVDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  132

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  133  ENSTTFRDKTEFAQD  147



>emb|CDQ80939.1| unnamed protein product [Oncorhynchus mykiss]
Length=476

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 68/135 (50%), Gaps = 17/135 (13%)
 Frame = +3

Query  234  INDGDRLVFARLTPASRLKIGNKN--------YSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            +N+GD +V  R      ++I  K         + L   +G  YG+ F+V    GG +  R
Sbjct  13   VNEGDYVVLKRGDIYKAVQIQKKKKTVFEKQWFFLDNAVGELYGTTFEVV--TGGTLQPR  70

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
                IE       S +   +   DNR ++D+  +Q LT +DI+ ++ QG  G +IV+ LI
Sbjct  71   KPKCIE-------SSADAKEAGTDNRNILDDGKSQKLTRDDIETLKEQGLKGQEIVQQLI  123

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+QE
Sbjct  124  ENSTTFRDKTEFAQE  138



>ref|XP_003411629.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Loxodonta africana]
Length=503

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 68/135 (50%), Gaps = 18/135 (13%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQVEGGEGGPILAR  389
            I DGD +V  R        +    ++    + + L   IG  YG+ F+V  G        
Sbjct  26   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNAIGHSYGTTFEVTSG--------  77

Query  390  VSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKALI  569
               +++    K E  S+T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ LI
Sbjct  78   --GSLQPKKKKEEPTSETKEAGIDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQLI  135

Query  570  ANSATFEKKTQFSQE  614
             NS TF  KT+F+Q+
Sbjct  136  ENSTTFRDKTEFAQD  150



>ref|XP_005672738.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X2 [Sus scrofa]
Length=503

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 70/136 (51%), Gaps = 14/136 (10%)
 Frame = +3

Query  234  INDGDRLVFAR--------LTPASRLKIGNKNYSLQPLIGCPYGSLFQV-EGGEGGPILA  386
            I DGD +V  R        +    ++    + + L  +IG  YG+ F+V  GG   P   
Sbjct  20   IRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHNYGTTFEVTNGGILQPKKK  79

Query  387  RVSPTIEGNNLKAESDSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRRQGASGDDIVKAL  566
            +  PT E       S  +T +   DNR ++D+  +Q LT +DI  ++ +G  G++IV+ L
Sbjct  80   KEEPTSEQF-----SSLETKEAGTDNRNIIDDGKSQKLTQDDIKALKDKGIKGEEIVQQL  134

Query  567  IANSATFEKKTQFSQE  614
            I NS TF  KT+F+Q+
Sbjct  135  IENSTTFRDKTEFAQD  150



>ref|XP_007424782.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 isoform X1 [Python bivittatus]
Length=481

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 74/148 (50%), Gaps = 8/148 (5%)
 Frame = +3

Query  183  KSFNPRITWEGCSVLLDINDGDRLVFARLTPASRLKI--GNKNYSLQPLIGCPYGSLFQV  356
            +S +P +  EG   +L  +D    VF  +    R KI    + + L   IG  YG+ F+V
Sbjct  6    RSASPHVICEGDWAVLKRDD----VFKAVAVVKRRKIIFEKQWFCLDNAIGHVYGTAFEV  61

Query  357  EGGEGGPILARVSPTIEGNNLKAES--DSQTTDVSKDNRALVDNNTAQSLTGEDIDDMRR  530
              G       R+     G + K E     +T +   DNR ++D+  +Q LT +DI  ++ 
Sbjct  62   TSGGSLQPKRRLEEMNPGASDKTECRISEETKEAGTDNRNIIDDGKSQKLTHDDIKALKD  121

Query  531  QGASGDDIVKALIANSATFEKKTQFSQE  614
            +G  G +IV+ LI NS TF  KT+F+Q+
Sbjct  122  KGIKGQEIVQQLIENSTTFRDKTEFAQD  149



>ref|XP_005147482.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic 
subunit TRM6 [Melopsittacus undulatus]
Length=484

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 57/103 (55%), Gaps = 10/103 (10%)
 Frame = +3

Query  306  YSLQPLIGCPYGSLFQVEGGEGGPILARVSPTIEGNNLKAESDSQTTDVSKDNRALVDNN  485
            + L   IG  YG+ F+V GG        + P  E      E++ +T +   DNR +VD+ 
Sbjct  43   FYLDNAIGHVYGTTFEVTGG------GNLQPKQEAE----ETNKETKEAGTDNRNIVDDG  92

Query  486  TAQSLTGEDIDDMRRQGASGDDIVKALIANSATFEKKTQFSQE  614
             +Q LT +DI  ++ +G  G +IV+ LI NS TF  KT+F+Q+
Sbjct  93   KSQKLTHDDIKALKDKGIKGQEIVQQLIENSTTFRDKTEFAQD  135



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1197759904156