BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10364

Length=794
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009602718.1|  PREDICTED: zinc transporter 11                     314   2e-102   Nicotiana tomentosiformis
ref|XP_009764644.1|  PREDICTED: zinc transporter 11                     311   4e-101   Nicotiana sylvestris
emb|CBI39712.3|  unnamed protein product                                307   6e-101   Vitis vinifera
ref|XP_010644552.1|  PREDICTED: zinc transporter 11-like                306   1e-99    Vitis vinifera
emb|CAN73198.1|  hypothetical protein VITISV_014079                     306   2e-99    Vitis vinifera
emb|CBI39714.3|  unnamed protein product                                301   1e-98    Vitis vinifera
ref|XP_006452568.1|  hypothetical protein CICLE_v10010292mg             303   6e-98    Citrus clementina [clementine]
ref|XP_006474910.1|  PREDICTED: zinc transporter 2-like                 301   1e-97    Citrus sinensis [apfelsine]
ref|XP_006346153.1|  PREDICTED: zinc transporter 2-like                 301   2e-97    
ref|XP_002265513.1|  PREDICTED: zinc transporter 11                     301   3e-97    Vitis vinifera
ref|NP_001234349.1|  zinc transporter-like precursor                    300   5e-97    Solanum lycopersicum
ref|XP_002265634.1|  PREDICTED: zinc transporter 11-like                297   7e-96    Vitis vinifera
emb|CBI39718.3|  unnamed protein product                                295   3e-95    Vitis vinifera
ref|XP_010644553.1|  PREDICTED: zinc transporter 11-like                294   1e-94    Vitis vinifera
ref|XP_011095528.1|  PREDICTED: zinc transporter 11 isoform X1          294   1e-94    Sesamum indicum [beniseed]
gb|KJB13866.1|  hypothetical protein B456_002G098900                    291   1e-93    Gossypium raimondii
gb|KJB13868.1|  hypothetical protein B456_002G098900                    290   6e-93    Gossypium raimondii
ref|XP_012071031.1|  PREDICTED: zinc transporter 2                      289   7e-93    Jatropha curcas
gb|KJB13867.1|  hypothetical protein B456_002G098900                    289   9e-93    Gossypium raimondii
ref|XP_011095529.1|  PREDICTED: zinc transporter 11 isoform X2          288   2e-92    Sesamum indicum [beniseed]
ref|XP_009415332.1|  PREDICTED: zinc transporter 2                      287   1e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008244614.1|  PREDICTED: zinc transporter 11-like                285   2e-91    
ref|XP_011625123.1|  PREDICTED: zinc transporter 11 isoform X1          285   7e-91    Amborella trichopoda
ref|XP_008244596.1|  PREDICTED: zinc transporter 11-like                283   2e-90    Prunus mume [ume]
emb|CDP13728.1|  unnamed protein product                                282   6e-90    Coffea canephora [robusta coffee]
ref|XP_008664495.1|  PREDICTED: zinc transporter 2-like                 278   6e-90    
gb|KHG22377.1|  Zinc transporter 11 -like protein                       280   2e-89    Gossypium arboreum [tree cotton]
ref|XP_009376781.1|  PREDICTED: zinc transporter 11-like                280   2e-89    Pyrus x bretschneideri [bai li]
ref|XP_007146623.1|  hypothetical protein PHAVU_006G055800g             280   3e-89    Phaseolus vulgaris [French bean]
ref|XP_010061468.1|  PREDICTED: zinc transporter 11 isoform X2          280   4e-89    Eucalyptus grandis [rose gum]
ref|XP_010061467.1|  PREDICTED: zinc transporter 2 isoform X1           279   7e-89    Eucalyptus grandis [rose gum]
ref|XP_002300374.2|  Zinc transporter 11 precursor family protein       279   7e-89    Populus trichocarpa [western balsam poplar]
ref|XP_002522767.1|  zinc transporter, putative                         278   2e-88    
ref|XP_006848976.1|  PREDICTED: zinc transporter 11 isoform X2          278   2e-88    Amborella trichopoda
ref|XP_008462987.1|  PREDICTED: zinc transporter 11                     278   2e-88    Cucumis melo [Oriental melon]
ref|XP_010936402.1|  PREDICTED: zinc transporter 2-like                 278   2e-88    Elaeis guineensis
ref|XP_008363870.1|  PREDICTED: zinc transporter 11-like isoform X1     277   5e-88    
ref|XP_004984039.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...    277   5e-88    
ref|XP_008790338.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...    277   8e-88    Phoenix dactylifera
ref|XP_011038777.1|  PREDICTED: zinc transporter 11                     276   8e-88    Populus euphratica
ref|XP_010252748.1|  PREDICTED: zinc transporter 11 isoform X2          276   1e-87    Nelumbo nucifera [Indian lotus]
gb|ACG48698.1|  zinc transporter 2 precursor                            276   1e-87    Zea mays [maize]
ref|XP_010252747.1|  PREDICTED: zinc transporter 11 isoform X1          273   2e-86    Nelumbo nucifera [Indian lotus]
gb|KJB81422.1|  hypothetical protein B456_013G153700                    272   2e-86    Gossypium raimondii
ref|XP_003557730.1|  PREDICTED: zinc transporter 2                      273   4e-86    Brachypodium distachyon [annual false brome]
gb|EMS62988.1|  Zinc transporter 2                                      270   2e-85    Triticum urartu
ref|XP_003532170.1|  PREDICTED: zinc transporter 2-like                 270   6e-85    Glycine max [soybeans]
ref|XP_007205813.1|  hypothetical protein PRUPE_ppa010754mg             265   7e-85    
ref|XP_008363896.1|  PREDICTED: zinc transporter 11-like                265   8e-85    
ref|XP_004498136.1|  PREDICTED: zinc transporter 2-like isoform X2      269   9e-85    
gb|EMT09169.1|  Zinc transporter 11                                     266   2e-84    
ref|XP_002891860.1|  predicted protein                                  267   2e-84    Arabidopsis lyrata subsp. lyrata
ref|NP_564703.1|  putative zinc transporter ZIP2 - like protein         267   3e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003551465.1|  PREDICTED: zinc transporter 2-like isoform X1      268   3e-84    Glycine max [soybeans]
gb|KHN31651.1|  Zinc transporter 2                                      268   3e-84    Glycine soja [wild soybean]
emb|CDY42395.1|  BnaA08g00190D                                          266   4e-84    Brassica napus [oilseed rape]
ref|XP_006602141.1|  PREDICTED: zinc transporter 2-like isoform X2      267   5e-84    Glycine max [soybeans]
ref|XP_006392587.1|  hypothetical protein EUTSA_v10011655mg             266   6e-84    Eutrema salsugineum [saltwater cress]
gb|KFK35551.1|  hypothetical protein AALP_AA4G005400                    266   6e-84    Arabis alpina [alpine rockcress]
ref|XP_010480153.1|  PREDICTED: zinc transporter 11 isoform X3          266   6e-84    Camelina sativa [gold-of-pleasure]
ref|XP_009106819.1|  PREDICTED: zinc transporter 11                     266   8e-84    Brassica rapa
ref|XP_007150347.1|  hypothetical protein PHAVU_005G146000g             265   2e-83    Phaseolus vulgaris [French bean]
ref|XP_010534791.1|  PREDICTED: zinc transporter 11                     265   3e-83    Tarenaya hassleriana [spider flower]
ref|XP_004498135.1|  PREDICTED: zinc transporter 2-like isoform X1      265   4e-83    Cicer arietinum [garbanzo]
gb|AAR08417.1|  metal transport protein                                 265   5e-83    Medicago truncatula
emb|CDY10522.1|  BnaC03g70920D                                          263   6e-83    Brassica napus [oilseed rape]
ref|XP_006650191.1|  PREDICTED: zinc transporter 2-like                 265   6e-83    
ref|XP_009376780.1|  PREDICTED: zinc transporter 11-like                264   6e-83    Pyrus x bretschneideri [bai li]
gb|AAF79317.1|AC002304_10  F14J16.16                                    264   6e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010480151.1|  PREDICTED: zinc transporter 11 isoform X1          263   7e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010501220.1|  PREDICTED: zinc transporter 11-like                263   8e-83    Camelina sativa [gold-of-pleasure]
gb|ABK95071.1|  unknown                                                 264   9e-83    Populus trichocarpa [western balsam poplar]
ref|XP_006369999.1|  hypothetical protein POPTR_0001s37490g             263   1e-82    
ref|XP_010106522.1|  Zinc transporter 2                                 263   1e-82    Morus notabilis
ref|XP_008222239.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...    263   2e-82    Prunus mume [ume]
ref|XP_004150296.1|  PREDICTED: zinc transporter 11                     262   2e-82    Cucumis sativus [cucumbers]
ref|XP_008363887.1|  PREDICTED: zinc transporter 11-like isoform X3     263   2e-82    
gb|EEE59243.1|  hypothetical protein OsJ_11245                          262   2e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010462455.1|  PREDICTED: zinc transporter 11-like                262   2e-82    Camelina sativa [gold-of-pleasure]
ref|XP_012066988.1|  PREDICTED: zinc transporter 2                      261   4e-82    Jatropha curcas
gb|ABK25966.1|  unknown                                                 262   6e-82    Picea sitchensis
ref|XP_007016363.1|  ZRT/IRT-like protein 2 isoform 2                   261   6e-82    
ref|XP_007016362.1|  ZRT/IRT-like protein 2 isoform 1                   261   7e-82    
ref|NP_001050351.1|  Os03g0411800                                       261   1e-81    
ref|XP_010096108.1|  Zinc transporter 11                                260   2e-81    Morus notabilis
ref|XP_008345017.1|  PREDICTED: zinc transporter 11-like                260   2e-81    
ref|XP_008363879.1|  PREDICTED: zinc transporter 11-like isoform X2     260   2e-81    
gb|AFK49261.1|  unknown                                                 260   2e-81    Lotus japonicus
gb|KJB55840.1|  hypothetical protein B456_009G097300                    258   7e-81    Gossypium raimondii
gb|KHG12249.1|  Zinc transporter 1                                      259   7e-81    Gossypium arboreum [tree cotton]
gb|EYU27430.1|  hypothetical protein MIMGU_mgv1a009274mg                259   8e-81    Erythranthe guttata [common monkey flower]
ref|XP_002520540.1|  zinc transporter, putative                         258   1e-80    Ricinus communis
ref|XP_006424873.1|  hypothetical protein CICLE_v10030012mg             258   1e-80    Citrus clementina [clementine]
gb|KDO72816.1|  hypothetical protein CISIN_1g036650mg                   258   2e-80    Citrus sinensis [apfelsine]
ref|XP_006488365.1|  PREDICTED: zinc transporter 2-like                 257   2e-80    Citrus sinensis [apfelsine]
ref|XP_007020535.1|  Zinc transporter 11 precursor isoform 1            258   2e-80    
ref|XP_002283239.1|  PREDICTED: zinc transporter 2                      256   3e-80    Vitis vinifera
ref|XP_004291561.1|  PREDICTED: zinc transporter 11-like                256   4e-80    Fragaria vesca subsp. vesca
ref|XP_010675904.1|  PREDICTED: zinc transporter 11                     255   1e-79    Beta vulgaris subsp. vulgaris [field beet]
emb|CBI16100.3|  unnamed protein product                                256   1e-79    Vitis vinifera
ref|XP_007020536.1|  Zinc transporter 11 precursor isoform 2            253   2e-79    
gb|EMT23274.1|  Zinc transporter 11                                     250   2e-79    
ref|XP_003543520.2|  PREDICTED: zinc transporter 1-like                 255   2e-79    
gb|KHN30150.1|  Zinc transporter 1                                      254   2e-79    Glycine soja [wild soybean]
ref|XP_009409509.1|  PREDICTED: zinc transporter 1                      254   3e-79    
ref|XP_011089491.1|  PREDICTED: zinc transporter 2                      254   3e-79    Sesamum indicum [beniseed]
ref|XP_008801587.1|  PREDICTED: zinc transporter 1                      254   4e-79    
ref|XP_008384937.1|  PREDICTED: zinc transporter 2-like                 253   6e-79    
ref|XP_009375917.1|  PREDICTED: zinc transporter 2-like                 253   6e-79    Pyrus x bretschneideri [bai li]
ref|XP_004294650.1|  PREDICTED: zinc transporter 2                      254   6e-79    Fragaria vesca subsp. vesca
ref|XP_008356901.1|  PREDICTED: zinc transporter 2                      253   9e-79    Malus domestica [apple tree]
ref|XP_003597387.1|  Zinc transporter                                   253   1e-78    Medicago truncatula
emb|CAJ19368.1|  putative zinc transporter                              246   2e-78    Triticum aestivum [Canadian hard winter wheat]
emb|CDP09088.1|  unnamed protein product                                251   3e-78    Coffea canephora [robusta coffee]
gb|ACU19636.1|  unknown                                                 251   4e-78    Glycine max [soybeans]
ref|XP_010520271.1|  PREDICTED: zinc transporter 2                      251   9e-78    Tarenaya hassleriana [spider flower]
gb|EYU30563.1|  hypothetical protein MIMGU_mgv1a018072mg                250   1e-77    Erythranthe guttata [common monkey flower]
ref|XP_003547243.1|  PREDICTED: zinc transporter 1-like                 249   3e-77    
ref|XP_004240368.1|  PREDICTED: zinc transporter 2                      249   3e-77    
gb|EMS61060.1|  Zinc transporter 2                                      247   3e-77    Triticum urartu
ref|XP_006358694.1|  PREDICTED: zinc transporter 2-like                 249   4e-77    Solanum tuberosum [potatoes]
gb|ACU21244.1|  unknown                                                 248   1e-76    Glycine max [soybeans]
ref|XP_009607802.1|  PREDICTED: zinc transporter 2                      248   1e-76    Nicotiana tomentosiformis
gb|ABK23604.1|  unknown                                                 244   3e-76    Picea sitchensis
ref|XP_008355309.1|  PREDICTED: zinc transporter 11-like                246   5e-76    
gb|AHU86549.1|  ZIP5                                                    246   8e-76    Marchantia polymorpha
ref|XP_006846276.1|  PREDICTED: zinc transporter 1                      245   1e-75    Amborella trichopoda
ref|XP_007214183.1|  hypothetical protein PRUPE_ppa019717mg             244   1e-75    
gb|ABB55317.1|  zinc transporter, putative                              253   1e-75    Asparagus officinalis
gb|EEE56089.1|  hypothetical protein OsJ_04930                          241   3e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002313423.2|  hypothetical protein POPTR_0009s03950g             244   3e-75    
ref|XP_011032271.1|  PREDICTED: zinc transporter 2                      244   3e-75    Populus euphratica
ref|XP_003547009.1|  PREDICTED: zinc transporter 1-like                 244   3e-75    Glycine max [soybeans]
gb|KHN33366.1|  Zinc transporter 1                                      244   4e-75    Glycine soja [wild soybean]
ref|XP_004486988.1|  PREDICTED: zinc transporter 2-like                 243   4e-75    Cicer arietinum [garbanzo]
ref|XP_010262554.1|  PREDICTED: zinc transporter 1                      243   6e-75    Nelumbo nucifera [Indian lotus]
ref|XP_008349915.1|  PREDICTED: zinc transporter 11-like                242   1e-74    
ref|XP_001771951.1|  predicted protein                                  242   1e-74    
ref|XP_007150346.1|  hypothetical protein PHAVU_005G145900g             242   1e-74    Phaseolus vulgaris [French bean]
ref|XP_009759327.1|  PREDICTED: zinc transporter 2                      242   2e-74    Nicotiana sylvestris
ref|XP_007211580.1|  hypothetical protein PRUPE_ppa008533mg             241   2e-74    
ref|XP_002985477.1|  hypothetical protein SELMODRAFT_269005             242   4e-74    
ref|XP_008244618.1|  PREDICTED: zinc transporter 11-like                239   1e-73    
ref|XP_006645396.1|  PREDICTED: zinc transporter 1-like                 239   2e-73    Oryza brachyantha
ref|NP_001045540.1|  Os01g0972200                                       240   2e-73    
gb|EAY77405.1|  hypothetical protein OsI_05394                          239   2e-73    Oryza sativa Indica Group [Indian rice]
ref|XP_007020537.1|  Zinc transporter 11 precursor                      238   3e-73    
ref|XP_004291560.1|  PREDICTED: zinc transporter 11-like                238   4e-73    Fragaria vesca subsp. vesca
gb|AHU86548.1|  ZIP4                                                    239   4e-73    Marchantia polymorpha
gb|EPS59794.1|  hypothetical protein M569_15010                         236   5e-73    Genlisea aurea
ref|XP_010685717.1|  PREDICTED: zinc transporter 2                      239   5e-73    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002987094.1|  hypothetical protein SELMODRAFT_235171             237   3e-72    
ref|XP_002459178.1|  hypothetical protein SORBIDRAFT_03g047340          236   5e-72    Sorghum bicolor [broomcorn]
ref|XP_010270211.1|  PREDICTED: zinc transporter 2-like isoform X2      239   8e-72    Nelumbo nucifera [Indian lotus]
ref|XP_010270210.1|  PREDICTED: zinc transporter 2-like isoform X1      239   1e-71    Nelumbo nucifera [Indian lotus]
ref|XP_006400951.1|  hypothetical protein EUTSA_v10013963mg             235   2e-71    Eutrema salsugineum [saltwater cress]
ref|XP_010920539.1|  PREDICTED: zinc transporter 1                      237   2e-71    
ref|XP_001777685.1|  predicted protein                                  233   2e-71    
gb|ABF55691.1|  putative zinc transporter                               234   3e-71    Triticum aestivum [Canadian hard winter wheat]
emb|CDY48680.1|  BnaC02g09920D                                          233   6e-71    Brassica napus [oilseed rape]
ref|XP_003569091.1|  PREDICTED: zinc transporter 1-like                 233   8e-71    
gb|EMT15508.1|  Zinc transporter 2                                      232   2e-70    
ref|XP_009126693.1|  PREDICTED: zinc transporter 2                      232   2e-70    Brassica rapa
ref|XP_001755316.1|  predicted protein                                  229   1e-69    
emb|CDY53449.1|  BnaA02g07030D                                          230   1e-69    Brassica napus [oilseed rape]
ref|XP_006282282.1|  hypothetical protein CARUB_v10028566mg             228   4e-69    Capsella rubella
ref|XP_010455125.1|  PREDICTED: zinc transporter 2                      224   3e-67    Camelina sativa [gold-of-pleasure]
ref|NP_200760.1|  zinc transporter 2                                    223   6e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866334.1|  hypothetical protein ARALYDRAFT_496085             221   2e-66    
gb|AAC24198.1|  putative zinc transporter                               221   3e-66    Arabidopsis thaliana [mouse-ear cress]
gb|ABB55331.1|  Zinc transporter, putative                              227   2e-65    Asparagus officinalis
ref|XP_010043503.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...    218   3e-65    
ref|XP_010483591.1|  PREDICTED: zinc transporter 2-like                 216   3e-64    Camelina sativa [gold-of-pleasure]
ref|XP_010443712.1|  PREDICTED: zinc transporter 2-like                 216   4e-64    Camelina sativa [gold-of-pleasure]
emb|CAN72193.1|  hypothetical protein VITISV_022309                     227   6e-64    Vitis vinifera
ref|XP_010106524.1|  Zinc transporter 1                                 215   5e-63    
gb|ABK23592.1|  unknown                                                 213   6e-63    Picea sitchensis
gb|EMS61835.1|  Zinc transporter 1                                      214   8e-63    Triticum urartu
gb|KCW85518.1|  hypothetical protein EUGRSUZ_B02315                     210   3e-62    Eucalyptus grandis [rose gum]
ref|XP_010274157.1|  PREDICTED: zinc transporter 2-like                 201   1e-60    
emb|CAN76037.1|  hypothetical protein VITISV_009080                     197   3e-58    Vitis vinifera
dbj|BAD11665.1|  putative zinc transporter                              201   7e-58    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008364560.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...    172   3e-48    
gb|EAY77402.1|  hypothetical protein OsI_05391                          166   8e-48    Oryza sativa Indica Group [Indian rice]
gb|KCW68411.1|  hypothetical protein EUGRSUZ_F02060                     162   2e-43    Eucalyptus grandis [rose gum]
ref|XP_010064669.1|  PREDICTED: zinc transporter 11-like                160   4e-43    Eucalyptus grandis [rose gum]
ref|XP_010064670.1|  PREDICTED: zinc transporter 2-like                 159   5e-43    
gb|KCW68410.1|  hypothetical protein EUGRSUZ_F02059                     159   1e-42    Eucalyptus grandis [rose gum]
ref|XP_010106523.1|  Zinc transporter 11                                147   4e-40    Morus notabilis
ref|XP_001770289.1|  predicted protein                                  134   6e-35    
gb|EKC42332.1|  Zinc transporter ZIP1                                 83.2    2e-15    Crassostrea gigas
ref|XP_011424525.1|  PREDICTED: zinc transporter ZIP1-like            81.3    3e-14    
emb|CBY19542.1|  unnamed protein product                              79.3    4e-14    Oikopleura dioica
emb|CBY31560.1|  unnamed protein product                              79.3    4e-14    Oikopleura dioica
ref|XP_005174889.1|  PREDICTED: zinc transporter 4, chloroplastic...  80.9    5e-14    Musca domestica
ref|XP_004537672.1|  PREDICTED: zinc transporter ZIP1-like isofor...  79.3    2e-13    Ceratitis capitata [medfly]
ref|XP_009062372.1|  hypothetical protein LOTGIDRAFT_128233           76.6    4e-13    Lottia gigantea
ref|NP_997748.2|  zinc transporter ZIP1                               76.3    6e-13    Danio rerio [leopard danio]
sp|P59889.1|S39A1_DANRE  RecName: Full=Zinc transporter ZIP1; Alt...  76.3    6e-13    Danio rerio [leopard danio]
gb|KDR21281.1|  Zinc transporter ZIP1                                 77.4    1e-12    Zootermopsis nevadensis
ref|XP_001999675.1|  GI22942                                          77.0    1e-12    Drosophila mojavensis
ref|XP_002097626.1|  GE24385                                          77.0    1e-12    Drosophila yakuba
gb|AAL48543.1|  RE02747p                                              77.0    1e-12    Drosophila melanogaster
ref|NP_536747.2|  Zinc/iron regulated transporter-related protein...  77.0    1e-12    Drosophila melanogaster
emb|CAC14874.1|  zinc/iron regulated transporter-related protein ...  76.6    2e-12    Drosophila melanogaster
ref|XP_001980165.1|  GG16992                                          76.6    2e-12    Drosophila erecta
ref|XP_002041241.1|  GM15144                                          76.3    2e-12    Drosophila sechellia
ref|XP_002072759.1|  GK13772                                          76.3    2e-12    Drosophila willistoni
ref|XP_002103205.1|  GD19087                                          76.3    2e-12    Drosophila simulans
ref|XP_002053140.1|  GJ23722                                          76.3    2e-12    Drosophila virilis
ref|XP_001954870.1|  GF18487                                          75.5    4e-12    Drosophila ananassae
ref|XP_004360230.1|  zinc/iron permease                               74.7    5e-12    Cavenderia fasciculata
gb|KFD55103.1|  hypothetical protein M513_04021                       75.5    6e-12    Trichuris suis
gb|KFD72540.1|  hypothetical protein M514_04021                       75.5    6e-12    Trichuris suis
emb|CEF62101.1|  Zinc transporter ZIP2                                73.6    8e-12    Strongyloides ratti
ref|XP_008274276.1|  PREDICTED: zinc transporter ZIP1-like            73.6    8e-12    Stegastes partitus
ref|XP_010776077.1|  PREDICTED: zinc transporter ZIP1-like            73.2    9e-12    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_001990763.1|  GH19543                                          74.3    9e-12    Drosophila grimshawi
gb|ETE61967.1|  Zinc transporter ZIP2                                 72.8    9e-12    Ophiophagus hannah
ref|XP_002017319.1|  GL21597                                          73.6    2e-11    
emb|CDW54842.1|  Fmp27 GFWDK and Apt1 and Zip domain containing p...  73.9    2e-11    Trichuris trichiura
ref|XP_645880.1|  zinc/iron permease                                  73.6    2e-11    Dictyostelium discoideum AX4
ref|XP_002602874.1|  hypothetical protein BRAFLDRAFT_243746           72.0    3e-11    Branchiostoma floridae
ref|XP_007445170.1|  PREDICTED: zinc transporter ZIP2-like            70.1    4e-11    Python bivittatus
gb|KJB55839.1|  hypothetical protein B456_009G097300                  54.3    4e-11    Gossypium raimondii
ref|XP_006628913.1|  PREDICTED: zinc transporter ZIP1-like            71.2    4e-11    Lepisosteus oculatus
emb|CCT67735.1|  related to ZRT1 Zinc transporter I                   72.0    5e-11    Fusarium fujikuroi IMI 58289
ref|XP_006759834.1|  PREDICTED: zinc transporter ZIP2-like            70.9    6e-11    Myotis davidii
ref|XP_005989801.1|  PREDICTED: zinc transporter ZIP1-like            70.9    7e-11    Latimeria chalumnae
ref|XP_001950888.1|  PREDICTED: zinc transporter ZIP1-like            71.6    7e-11    
gb|KJE94254.1|  solute carrier family 39                              71.6    8e-11    Capsaspora owczarzaki ATCC 30864
gb|ACO14718.1|  Zinc transporter ZIP1                                 70.5    8e-11    Caligus clemensi
ref|XP_008487278.1|  PREDICTED: zinc transporter ZIP1-like            67.4    8e-11    Diaphorina citri
gb|ABA29004.1|  zinc transporter protein                              71.2    8e-11    Fusarium verticillioides
gb|KJE94255.1|  solute carrier family 39, variant                     71.2    8e-11    Capsaspora owczarzaki ATCC 30864
gb|EWZ82379.1|  hypothetical protein FOWG_14060                       71.2    9e-11    Fusarium oxysporum f. sp. lycopersici MN25
gb|ACI34150.1|  Zinc transporter ZIP1                                 70.5    1e-10    Salmo salar
gb|KIH49367.1|  metal cation transporter, ZIP family                  68.6    1e-10    Ancylostoma duodenale
ref|XP_004347674.2|  solute carrier family 39                         71.2    1e-10    Capsaspora owczarzaki ATCC 30864
gb|EWZ01178.1|  hypothetical protein FOYG_00854                       70.9    1e-10    Fusarium oxysporum FOSC 3-a
gb|EXK44537.1|  hypothetical protein FOMG_03245                       70.9    1e-10    Fusarium oxysporum f. sp. melonis 26406
gb|EWZ47215.1|  hypothetical protein FOZG_03172                       70.5    1e-10    Fusarium oxysporum Fo47
gb|EXA43207.1|  hypothetical protein FOVG_08222                       70.5    1e-10    Fusarium oxysporum f. sp. pisi HDV247
emb|CDQ77779.1|  unnamed protein product                              70.1    1e-10    Oncorhynchus mykiss
ref|XP_005856624.1|  PREDICTED: zinc transporter ZIP2 isoform X1      69.7    2e-10    Myotis brandtii
ref|XP_001359463.2|  GA19939                                          70.5    2e-10    Drosophila pseudoobscura pseudoobscura
emb|CDQ79559.1|  unnamed protein product                              69.7    2e-10    Oncorhynchus mykiss
gb|KHJ48748.1|  metal cation transporter, ZIP family                  70.1    2e-10    Trichuris suis
gb|EXK82348.1|  hypothetical protein FOQG_13371                       70.1    2e-10    Fusarium oxysporum f. sp. raphani 54005
ref|XP_005856625.1|  PREDICTED: zinc transporter ZIP2 isoform X2      69.7    2e-10    
gb|EXL68117.1|  hypothetical protein FOPG_15800                       70.1    2e-10    Fusarium oxysporum f. sp. conglutinans race 2 54008
gb|ELU00805.1|  hypothetical protein CAPTEDRAFT_26618                 69.3    3e-10    Capitella teleta
gb|EMT66653.1|  Zinc-regulated transporter 1                          69.7    3e-10    Fusarium oxysporum f. sp. cubense race 4
ref|XP_002934324.1|  PREDICTED: zinc transporter ZIP1-like            68.9    3e-10    Xenopus tropicalis [western clawed frog]
ref|XP_002124508.1|  PREDICTED: zinc transporter ZIP1                 69.3    3e-10    Ciona intestinalis [sea vase]
ref|XP_009696729.1|  PREDICTED: zinc transporter ZIP3                 68.9    3e-10    Cariama cristata
ref|XP_008159770.1|  PREDICTED: zinc transporter ZIP2-like            68.6    3e-10    
ref|XP_007884309.1|  PREDICTED: zinc transporter ZIP1                 68.2    4e-10    Callorhinchus milii [Australian ghost shark]
ref|XP_010171600.1|  PREDICTED: zinc transporter ZIP3                 68.9    4e-10    Antrostomus carolinensis
ref|XP_005371039.1|  PREDICTED: zinc transporter ZIP2                 68.6    4e-10    Microtus ochrogaster [prairie voles]
gb|EXM16289.1|  hypothetical protein FOTG_15389                       68.9    4e-10    Fusarium oxysporum f. sp. vasinfectum 25433
ref|XP_005102657.1|  PREDICTED: zinc transporter ZIP1-like isofor...  68.9    5e-10    Aplysia californica
gb|EYC03727.1|  hypothetical protein Y032_0092g2590                   68.9    5e-10    Ancylostoma ceylanicum
ref|XP_011309654.1|  PREDICTED: zinc transporter ZIP3-like isofor...  68.9    5e-10    Fopius arisanus
ref|XP_010080301.1|  PREDICTED: zinc transporter ZIP3                 68.6    5e-10    Pterocles gutturalis
ref|XP_009095160.1|  PREDICTED: zinc transporter ZIP3                 68.2    6e-10    Serinus canaria [canary]
gb|EYC03726.1|  hypothetical protein Y032_0092g2590                   68.9    6e-10    Ancylostoma ceylanicum
gb|EYC03725.1|  hypothetical protein Y032_0092g2590                   68.9    6e-10    Ancylostoma ceylanicum
ref|XP_637915.1|  zinc/iron permease                                  68.6    6e-10    Dictyostelium discoideum AX4
gb|EPB67159.1|  metal cation transporter, ZIP family                  68.6    7e-10    Ancylostoma ceylanicum
gb|ENH67948.1|  Zinc-regulated transporter 1                          68.6    7e-10    Fusarium oxysporum f. sp. cubense race 1
gb|KDR22729.1|  Zinc transporter ZIP1                                 67.0    7e-10    Zootermopsis nevadensis
ref|XP_002740474.1|  PREDICTED: zinc transporter ZIP1-like            68.2    8e-10    Saccoglossus kowalevskii
gb|KFV14049.1|  Zinc transporter ZIP3                                 67.8    9e-10    Pterocles gutturalis
ref|XP_009571444.1|  PREDICTED: zinc transporter ZIP3                 67.8    1e-09    Fulmarus glacialis
gb|ETN70774.1|  metal cation transporter, ZIP family                  68.2    1e-09    Necator americanus
ref|XP_011487174.1|  PREDICTED: zinc transporter ZIP1                 67.4    1e-09    
gb|KFP53320.1|  Zinc transporter ZIP3                                 67.4    1e-09    Cathartes aura
ref|XP_008308732.1|  PREDICTED: zinc transporter ZIP1-like            67.4    1e-09    Cynoglossus semilaevis [half-smooth tongue sole]
gb|EUB61986.1|  Zinc transporter ZIP1                                 68.2    1e-09    
gb|KHJ95124.1|  metal cation transporter, ZIP family                  67.8    1e-09    
ref|XP_009467364.1|  PREDICTED: zinc transporter ZIP3                 67.4    1e-09    
gb|EFA82691.1|  zinc/iron permease                                    67.4    1e-09    
ref|XP_009919141.1|  PREDICTED: zinc transporter ZIP3                 67.0    2e-09    
ref|XP_001659748.1|  AAEL001626-PA                                    67.4    2e-09    
emb|CCI11296.1|  unnamed protein product                              67.0    2e-09    
ref|XP_006190898.1|  PREDICTED: zinc transporter ZIP2                 67.0    2e-09    
ref|XP_011594797.1|  PREDICTED: zinc transporter ZIP3                 67.0    2e-09    
ref|XP_005509330.1|  PREDICTED: zinc transporter ZIP3                 67.0    2e-09    
ref|XP_010988508.1|  PREDICTED: zinc transporter ZIP2                 67.0    2e-09    
emb|CEF63453.1|  Zinc transporter ZIP2                                67.0    2e-09    
dbj|GAM22090.1|  hypothetical protein SAMD00019534_052650             67.0    2e-09    
gb|ACO11533.1|  Zinc transporter ZIP3                                 66.6    2e-09    
ref|XP_010281587.1|  PREDICTED: zinc transporter ZIP3                 66.6    2e-09    
ref|XP_002735524.1|  PREDICTED: zinc transporter ZIP3-like            67.0    2e-09    
ref|XP_010117405.1|  PREDICTED: zinc transporter ZIP3                 66.6    2e-09    
ref|XP_004390052.1|  PREDICTED: zinc transporter ZIP2                 66.6    2e-09    
gb|KFQ66336.1|  Zinc transporter ZIP3                                 66.6    2e-09    
gb|KFQ81875.1|  Zinc transporter ZIP3                                 66.6    2e-09    
ref|XP_010743634.1|  PREDICTED: zinc transporter ZIP1                 66.6    2e-09    
ref|XP_007067557.1|  PREDICTED: zinc transporter ZIP2                 66.6    2e-09    
ref|XP_009931218.1|  PREDICTED: zinc transporter ZIP3                 66.6    2e-09    
ref|XP_003223929.2|  PREDICTED: zinc transporter ZIP2                 66.2    2e-09    
emb|CCA23639.1|  zinc (Zn2)Iron (Fe2) Permease (ZIP) family putative  67.0    3e-09    
ref|XP_004584704.1|  PREDICTED: zinc transporter ZIP2                 66.2    3e-09    
gb|ENN70945.1|  hypothetical protein YQE_12347                        66.6    3e-09    
ref|XP_009643858.1|  PREDICTED: zinc transporter ZIP3                 66.2    3e-09    
ref|XP_002776763.1|  Zinc transporter, putative                       66.2    3e-09    
ref|XP_009881817.1|  PREDICTED: zinc transporter ZIP3                 66.2    3e-09    
ref|XP_005087090.1|  PREDICTED: zinc transporter ZIP2                 66.2    3e-09    
ref|XP_001952426.2|  PREDICTED: uncharacterized protein LOC100166684  66.6    3e-09    
ref|XP_003514665.1|  PREDICTED: zinc transporter ZIP2                 66.2    3e-09    
ref|XP_009566572.1|  PREDICTED: zinc transporter ZIP3                 66.2    3e-09    
ref|XP_001844755.1|  zinc/iron transporter                            66.6    3e-09    
gb|EPY76521.1|  hypothetical protein CB1_001415002                    67.0    3e-09    
ref|XP_006101269.1|  PREDICTED: zinc transporter ZIP2-like            66.2    3e-09    
ref|XP_006996847.1|  PREDICTED: zinc transporter ZIP2-like            66.2    3e-09    
gb|ENN70946.1|  hypothetical protein YQE_12347                        66.2    3e-09    
ref|XP_009967670.1|  PREDICTED: zinc transporter ZIP3                 66.2    3e-09    
gb|KIH48276.1|  hypothetical protein ANCDUO_21656                     63.2    4e-09    
ref|XP_003213317.1|  PREDICTED: zinc transporter ZIP3                 65.9    4e-09    
ref|XP_009988765.1|  PREDICTED: zinc transporter ZIP3                 65.9    4e-09    
ref|XP_006897975.1|  PREDICTED: zinc transporter ZIP3                 65.9    4e-09    
ref|XP_974693.1|  PREDICTED: zinc transporter ZIP1                    66.2    4e-09    
ref|XP_009485223.1|  PREDICTED: zinc transporter ZIP3                 65.9    4e-09    
gb|EGW14102.1|  Zinc transporter ZIP2                                 65.9    4e-09    
gb|ERG84415.1|  zinc transporter zip1                                 65.5    4e-09    
ref|NP_001096167.1|  zinc transporter ZIP3                            65.9    4e-09    
ref|XP_009278051.1|  PREDICTED: zinc transporter ZIP3                 65.9    4e-09    
ref|XP_009332987.1|  PREDICTED: zinc transporter ZIP3                 65.9    4e-09    
emb|CAF99867.1|  unnamed protein product                              65.9    4e-09    
ref|XP_010193185.1|  PREDICTED: zinc transporter ZIP3                 65.9    4e-09    
ref|XP_008874598.1|  hypothetical protein H310_10112                  65.9    4e-09    
ref|XP_003373778.1|  putative JmjC domain-containing histone deme...  66.6    4e-09    
ref|XP_003373225.1|  putative metal cation transporter, zinc (Zn2...  66.2    5e-09    
gb|EMP28513.1|  Zinc transporter ZIP2                                 65.5    5e-09    
ref|XP_007072816.1|  PREDICTED: LOW QUALITY PROTEIN: solute carri...  65.9    5e-09    
ref|XP_011661022.1|  PREDICTED: zinc transporter ZIP3-like            64.7    5e-09    
ref|XP_005244196.1|  PREDICTED: zinc transporter ZIP3                 65.5    5e-09    
ref|NP_001100730.1|  zinc transporter ZIP2                            65.5    5e-09    
ref|XP_010020275.1|  PREDICTED: zinc transporter ZIP3                 65.5    5e-09    
gb|EPQ12124.1|  Zinc transporter ZIP2                                 65.5    6e-09    
ref|XP_008176255.1|  PREDICTED: zinc transporter ZIP1                 65.5    6e-09    
ref|XP_006008653.1|  PREDICTED: zinc transporter ZIP1                 65.5    6e-09    
gb|EDL88447.1|  solute carrier family 39 (zinc transporter), memb...  65.1    6e-09    
ref|XP_002776765.1|  zinc transport protein, putative                 65.1    6e-09    
ref|XP_010306706.1|  PREDICTED: zinc transporter ZIP3                 65.5    6e-09    
ref|XP_010864589.1|  PREDICTED: zinc transporter ZIP1-like            65.1    6e-09    
ref|XP_011674509.1|  PREDICTED: zinc transporter ZIP3-like            65.5    7e-09    
ref|XP_010201076.1|  PREDICTED: zinc transporter ZIP3                 65.1    7e-09    
ref|XP_005873359.1|  PREDICTED: zinc transporter ZIP2-like            65.1    7e-09    
ref|XP_009808859.1|  PREDICTED: zinc transporter ZIP3                 65.1    7e-09    
ref|XP_005140845.1|  PREDICTED: zinc transporter ZIP3                 65.1    8e-09    
ref|XP_005843138.1|  hypothetical protein CHLNCDRAFT_141521           65.5    8e-09    
ref|XP_010003616.1|  PREDICTED: zinc transporter ZIP3                 65.1    8e-09    
gb|EKC42331.1|  Zinc transporter ZIP3                                 65.5    9e-09    
ref|XP_004921880.1|  PREDICTED: zinc transporter ZIP1-like            65.1    1e-08    
ref|XP_006772447.1|  PREDICTED: zinc transporter ZIP2 isoform X1      64.7    1e-08    
ref|XP_006218766.1|  PREDICTED: zinc transporter ZIP2                 64.7    1e-08    
ref|XP_002594664.1|  hypothetical protein BRAFLDRAFT_246615           64.3    1e-08    
gb|KHN81602.1|  Zinc transporter ZIP3                                 64.7    1e-08    
ref|XP_009507296.1|  PREDICTED: zinc transporter ZIP3                 64.7    1e-08    
gb|KFB45855.1|  AGAP002624-PA-like protein                            64.7    1e-08    
gb|EFX71838.1|  hypothetical protein DAPPUDRAFT_308636                64.7    1e-08    
gb|KFP96474.1|  Zinc transporter ZIP3                                 63.5    1e-08    
ref|XP_009959866.1|  PREDICTED: zinc transporter ZIP3-like            63.5    1e-08    
ref|XP_008157997.1|  PREDICTED: zinc transporter ZIP2                 64.3    1e-08    
ref|XP_011424524.1|  PREDICTED: zinc transporter ZIP3-like            64.3    1e-08    
ref|XP_009872799.1|  PREDICTED: zinc transporter ZIP3                 64.3    2e-08    
gb|KFD55161.1|  hypothetical protein M513_04079                       64.7    2e-08    
ref|XP_008486719.1|  PREDICTED: zinc transporter ZIP3-like            64.3    2e-08    
gb|KFV95976.1|  Zinc transporter ZIP3                                 63.2    2e-08    
ref|XP_010156490.1|  PREDICTED: zinc transporter ZIP3                 63.2    2e-08    
gb|EFX71837.1|  hypothetical protein DAPPUDRAFT_308677                62.4    2e-08    
ref|XP_002409471.1|  zinc/iron transporter, putative                  63.9    2e-08    
gb|KFH42498.1|  Zinc-regulated transporter-like protein               64.3    2e-08    
ref|XP_002776762.1|  Zinc transporter, putative                       63.5    2e-08    
ref|XP_003288312.1|  hypothetical protein DICPUDRAFT_152527           64.3    2e-08    
ref|XP_005939224.1|  PREDICTED: zinc transporter ZIP1-like            63.5    2e-08    
ref|XP_003745363.1|  PREDICTED: zinc transporter ZIP1-like            63.9    2e-08    
ref|XP_974711.1|  PREDICTED: zinc transporter ZIP1                    63.9    2e-08    
gb|KHJ48799.1|  metal cation transporter, ZIP family                  63.9    2e-08    
ref|XP_009044101.1|  hypothetical protein LOTGIDRAFT_103006           63.5    2e-08    
ref|XP_005762636.1|  hypothetical protein EMIHUDRAFT_215869           63.9    2e-08    
ref|XP_003642922.1|  PREDICTED: zinc transporter ZIP3                 63.5    2e-08    
gb|KFZ58897.1|  Zinc transporter ZIP3                                 63.2    2e-08    
ref|XP_002776764.1|  zinc transport protein, putative                 63.5    2e-08    
gb|KJH53365.1|  metal cation transporter, ZIP family                  63.9    3e-08    
ref|XP_003788772.1|  PREDICTED: zinc transporter ZIP3                 63.5    3e-08    
gb|EMP28209.1|  Zinc transporter ZIP1                                 63.5    3e-08    
gb|AAI13770.1|  Solute carrier family 39 (zinc transporter), memb...  63.5    3e-08    
ref|XP_006087484.1|  PREDICTED: zinc transporter ZIP2 isoform X2      63.5    3e-08    
ref|XP_006087483.1|  PREDICTED: zinc transporter ZIP2 isoform X1      63.5    3e-08    
ref|XP_002032638.1|  GM20856                                          63.2    3e-08    
dbj|BAP46885.1|  solute carrier family 39 member 1-2                  63.5    3e-08    
ref|XP_005531229.1|  PREDICTED: zinc transporter ZIP3                 63.5    3e-08    
gb|KFD72487.1|  hypothetical protein M514_04079                       63.9    3e-08    
ref|WP_028831089.1|  hypothetical protein                             63.5    3e-08    
ref|XP_002089368.1|  GE24543                                          63.2    3e-08    
ref|XP_006996845.1|  PREDICTED: zinc transporter ZIP2                 63.2    3e-08    
ref|NP_001034765.2|  zinc transporter ZIP2                            63.2    3e-08    
gb|KFV66402.1|  Zinc transporter ZIP3                                 63.2    3e-08    
ref|XP_974675.1|  PREDICTED: zinc transporter ZIP1                    63.5    4e-08    
ref|XP_009017185.1|  hypothetical protein HELRODRAFT_191647           63.5    4e-08    
gb|ELT89145.1|  hypothetical protein CAPTEDRAFT_54529                 62.8    4e-08    
gb|ACJ24247.1|  hypothetical protein                                  63.2    4e-08    
emb|CDJ05527.1|  zinc transporter zip1                                63.5    4e-08    
emb|CDW54777.1|  ZIP Zinc transporter family protein                  63.2    4e-08    
gb|EDL42275.1|  mCG18706, isoform CRA_a                               62.8    5e-08    
gb|ACI33536.1|  Zinc transporter ZIP1                                 62.8    5e-08    
gb|EFX71835.1|  hypothetical protein DAPPUDRAFT_326723                62.8    5e-08    
ref|XP_009897510.1|  PREDICTED: zinc transporter ZIP3                 62.4    5e-08    
ref|XP_008470598.1|  PREDICTED: zinc transporter ZIP1-like            62.0    5e-08    
emb|CEF66436.1|  Zinc transporter ZIP2                                63.2    5e-08    
ref|XP_003456803.1|  PREDICTED: zinc transporter ZIP1-like            62.4    6e-08    
ref|XP_011214818.1|  PREDICTED: protein zntC-like                     62.8    7e-08    
ref|XP_005773098.1|  hypothetical protein EMIHUDRAFT_241967           62.0    7e-08    
ref|XP_006039171.1|  PREDICTED: zinc transporter ZIP2-like            61.2    7e-08    
gb|KGB33050.1|  Zinc transporter ZIP1                                 62.8    7e-08    
ref|XP_001626411.1|  predicted protein                                62.4    7e-08    
ref|XP_003755849.1|  PREDICTED: zinc transporter ZIP2                 62.4    7e-08    
ref|NP_610231.2|  Zinc/iron regulated transporter-related protein...  62.4    8e-08    
ref|XP_009020089.1|  hypothetical protein HELRODRAFT_94735            62.4    8e-08    
ref|XP_001970735.1|  GG10805                                          60.8    8e-08    
ref|XP_002077547.1|  GD15477                                          62.0    8e-08    
ref|XP_006062113.1|  PREDICTED: zinc transporter ZIP2 isoform X1      62.0    8e-08    
gb|ETN59379.1|  hypothetical protein AND_009030                       62.4    9e-08    
ref|XP_001961295.1|  GF13795                                          62.0    9e-08    
ref|XP_005060227.1|  PREDICTED: zinc transporter ZIP3                 62.0    9e-08    
ref|XP_005022664.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...  62.0    1e-07    
ref|XP_002740188.1|  PREDICTED: zinc transporter ZIP1-like            62.0    1e-07    
ref|XP_006031021.1|  PREDICTED: zinc transporter ZIP1                 62.0    1e-07    
ref|XP_002080190.1|  GD24343                                          62.0    1e-07    
ref|XP_006978322.1|  PREDICTED: zinc transporter ZIP3                 61.6    1e-07    
emb|CDW86623.1|  zip zinc transporter family protein                  62.4    1e-07    
ref|XP_011374243.1|  PREDICTED: zinc transporter ZIP2-like isofor...  61.2    1e-07    
emb|CDQ64988.1|  unnamed protein product                              62.0    1e-07    
ref|XP_006793958.1|  PREDICTED: zinc transporter ZIP1-like            61.6    1e-07    
ref|XP_004557982.1|  PREDICTED: zinc transporter ZIP1-like            61.6    1e-07    
ref|XP_008830766.1|  PREDICTED: zinc transporter ZIP2                 61.6    1e-07    
ref|XP_005746888.1|  PREDICTED: zinc transporter ZIP1-like            61.6    1e-07    
ref|XP_002198247.1|  PREDICTED: zinc transporter ZIP3                 61.6    1e-07    
ref|XP_011194455.1|  PREDICTED: zinc transporter ZIP10                62.0    1e-07    
ref|XP_008497407.1|  PREDICTED: zinc transporter ZIP3                 61.6    1e-07    
ref|XP_001970736.1|  GG10806                                          61.6    1e-07    
ref|XP_008898012.1|  hypothetical protein PPTG_06013                  60.5    1e-07    
gb|EFX71886.1|  hypothetical protein DAPPUDRAFT_308662                59.7    2e-07    
ref|XP_011062087.1|  PREDICTED: zinc transporter ZIP1-like isofor...  61.6    2e-07    
ref|XP_002898908.1|  Zinc (Zn2 )-Iron (Fe2 ) Permease (ZIP) Family    61.2    2e-07    
emb|CBJ25853.1|  conserved unknown protein                            61.2    2e-07    
ref|XP_001987134.1|  GH20143                                          61.2    2e-07    
ref|NP_001272701.1|  solute carrier family 39 (zinc transporter),...  61.2    2e-07    
ref|XP_008557653.1|  PREDICTED: zinc transporter ZIP1-like isofor...  61.2    2e-07    
gb|EHJ66056.1|  zinc/iron transporter                                 60.8    2e-07    
ref|XP_007949202.1|  PREDICTED: zinc transporter ZIP3                 60.1    2e-07    
ref|XP_004367068.1|  zinc/iron permease                               61.2    2e-07    
ref|XP_002122816.1|  PREDICTED: zinc transporter ZIP2-like            61.2    2e-07    
ref|XP_006869037.1|  PREDICTED: zinc transporter ZIP3                 60.8    2e-07    
ref|XP_011172337.1|  PREDICTED: zinc transporter ZIP1-like isofor...  61.2    2e-07    
ref|XP_004892767.1|  PREDICTED: zinc transporter ZIP2 isoform X1      60.8    2e-07    
ref|XP_011860607.1|  PREDICTED: zinc transporter ZIP3-like isofor...  61.2    2e-07    
ref|XP_003744367.1|  PREDICTED: zinc transporter ZIP1-like            60.8    2e-07    
emb|CDS33921.1|  zinc transporter zip1                                61.2    3e-07    
ref|XP_011453296.1|  PREDICTED: zinc transporter ZIP1-like            60.8    3e-07    
emb|CDW89019.1|  zip zinc transporter family protein                  60.8    3e-07    
ref|XP_002900827.1|  Zinc (Zn2 )-Iron (Fe2 ) Permease (ZIP) Family    60.8    3e-07    
gb|KDO33963.1|  hypothetical protein SPRG_01241                       60.5    3e-07    
ref|XP_010869645.1|  PREDICTED: zinc transporter ZIP3                 60.5    3e-07    
ref|XP_002432686.1|  zinc/iron transporter, putative                  60.8    3e-07    
ref|XP_006264396.1|  PREDICTED: zinc transporter ZIP1                 60.8    3e-07    
ref|XP_012057235.1|  PREDICTED: zinc transporter ZIP1-like            60.8    3e-07    
gb|KFD48370.1|  hypothetical protein M513_10782                       60.5    3e-07    
ref|XP_002032637.1|  GM20857                                          60.8    3e-07    
ref|XP_005284292.1|  PREDICTED: zinc transporter ZIP2                 60.5    3e-07    
ref|XP_007120531.1|  PREDICTED: zinc transporter ZIP3                 60.5    3e-07    
ref|XP_004694742.1|  PREDICTED: zinc transporter ZIP2                 60.5    3e-07    
emb|CCD76552.1|  putative zinc/iron transporter                       60.8    3e-07    
ref|XP_002066053.1|  GK22156                                          60.5    3e-07    
ref|XP_011374242.1|  PREDICTED: zinc transporter ZIP2-like isofor...  60.5    3e-07    
ref|XP_002680018.1|  predicted protein                                60.8    3e-07    
ref|XP_003746816.1|  PREDICTED: zinc transporter ZIP2-like            60.8    3e-07    
ref|XP_011399141.1|  Zinc transporter ZIP1                            60.5    3e-07    
ref|XP_002005004.1|  GI20235                                          60.5    3e-07    
emb|CDQ69648.1|  unnamed protein product                              60.1    4e-07    
ref|XP_007813371.1|  zinc transporter protein                         60.5    4e-07    
gb|AGL94528.1|  putative zinc/iron regulated protein                  60.1    4e-07    
ref|XP_004367069.1|  zinc/iron permease                               60.5    4e-07    
gb|ETO61217.1|  hypothetical protein F444_20745                       60.1    4e-07    
ref|XP_002734196.1|  PREDICTED: zinc transporter ZIP1-like            60.1    4e-07    
gb|ETL79516.1|  hypothetical protein L917_19877                       60.1    4e-07    
ref|NP_001192577.1|  zinc transporter ZIP2                            60.1    4e-07    
ref|XP_008896036.1|  hypothetical protein PPTG_03980                  58.9    4e-07    
ref|XP_004689427.1|  PREDICTED: zinc transporter ZIP3                 60.1    4e-07    
ref|XP_010837728.1|  PREDICTED: zinc transporter ZIP2                 60.1    4e-07    
ref|XP_007949323.1|  PREDICTED: zinc transporter ZIP2                 60.1    4e-07    
ref|XP_008322433.1|  PREDICTED: zinc transporter ZIP1                 60.1    4e-07    
ref|XP_005300788.1|  PREDICTED: zinc transporter ZIP1-like            59.3    4e-07    
ref|XP_005900633.1|  PREDICTED: zinc transporter ZIP2                 60.1    4e-07    
gb|EPS31506.1|  hypothetical protein PDE_06461                        60.1    5e-07    
gb|EFA84409.1|  zinc/iron permease                                    60.1    5e-07    



>ref|XP_009602718.1| PREDICTED: zinc transporter 11 [Nicotiana tomentosiformis]
Length=348

 Score =   314 bits (805),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 174/201 (87%), Gaps = 8/201 (4%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHA-----SSLGDSLLLIFALCFHS  625
            D++LQ +TE    NGI T   Q Q Q CDG E +F  A     SSLGDS+LLI ALCFHS
Sbjct  151  DVQLQGDTENGKGNGIVT---QGQSQVCDGREDYFSKAPLATASSLGDSILLIVALCFHS  207

Query  624  VFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAIS  445
            VFEGIAIGVAD+KADAW+ALWTVCLHKIFAAIAMGIALLRMIPNRPLLSC AY+FAFAIS
Sbjct  208  VFEGIAIGVADSKADAWRALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCAAYAFAFAIS  267

Query  444  SPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPH  265
            SP+GVAIGIIIDATTQG VADWI+AISMG+ACGVF+YVSINHLLS+GYKPQK V VDKP 
Sbjct  268  SPIGVAIGIIIDATTQGVVADWIFAISMGLACGVFVYVSINHLLSRGYKPQKMVLVDKPQ  327

Query  264  FKFLAVLLGIGVIAVVMIWDT  202
            FKFLAVLLG+GVIAVVMIWDT
Sbjct  328  FKFLAVLLGVGVIAVVMIWDT  348



>ref|XP_009764644.1| PREDICTED: zinc transporter 11 [Nicotiana sylvestris]
Length=345

 Score =   311 bits (796),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 172/201 (86%), Gaps = 11/201 (5%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHA-----SSLGDSLLLIFALCFHS  625
            D++LQ  TE    NG+G      Q Q CDG E +F  A     SSLGDS+LLI ALCFHS
Sbjct  151  DVQLQGATENGKGNGVG------QSQVCDGREDYFSKAPLATASSLGDSILLIVALCFHS  204

Query  624  VFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAIS  445
            VFEGIAIGVAD+KADAW+ALWTVCLHKIFAAIAMGIALLRMIPNRPLLSC AY+FAFAIS
Sbjct  205  VFEGIAIGVADSKADAWRALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCAAYAFAFAIS  264

Query  444  SPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPH  265
            SP+GVAIGIIIDATTQG VADWI+AISMG+ACGVF+YVSINHLLS+GYKPQK V VDKPH
Sbjct  265  SPIGVAIGIIIDATTQGVVADWIFAISMGLACGVFVYVSINHLLSRGYKPQKMVLVDKPH  324

Query  264  FKFLAVLLGIGVIAVVMIWDT  202
            FKFLAVLLG+G IAVVMIWDT
Sbjct  325  FKFLAVLLGVGAIAVVMIWDT  345



>emb|CBI39712.3| unnamed protein product [Vitis vinifera]
Length=255

 Score =   307 bits (786),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 176/202 (87%), Gaps = 6/202 (3%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQ-GCDGTESHFLH-----ASSLGDSLLLIFALCFH  628
            D+ELQ N +G++ +  G +H  +Q+Q G DG E H ++     A+SLGDS+LLIFALCFH
Sbjct  54   DVELQANMQGKSCSNGGHSHSLAQVQTGKDGKEVHSVNSPLKTATSLGDSILLIFALCFH  113

Query  627  SVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAI  448
            SVFEGIAIGVA+TKADAW+ALWTVCLHKIFAAIAMGIALLRMIP+RPLLSC AY+FAFAI
Sbjct  114  SVFEGIAIGVAETKADAWRALWTVCLHKIFAAIAMGIALLRMIPDRPLLSCAAYAFAFAI  173

Query  447  SSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKP  268
            SSP+GVA GI+IDATTQG VADWI+AISMG+ACG+FIYVSINHLLSKGY  QKTV  D P
Sbjct  174  SSPIGVATGIVIDATTQGAVADWIFAISMGLACGIFIYVSINHLLSKGYTSQKTVPFDTP  233

Query  267  HFKFLAVLLGIGVIAVVMIWDT  202
            ++KFLAVLLGIGVIAVVMIWDT
Sbjct  234  NYKFLAVLLGIGVIAVVMIWDT  255



>ref|XP_010644552.1| PREDICTED: zinc transporter 11-like [Vitis vinifera]
Length=346

 Score =   306 bits (785),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 176/202 (87%), Gaps = 6/202 (3%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQ-GCDGTESHFLH-----ASSLGDSLLLIFALCFH  628
            D+ELQ N +G++ +  G +H  +Q+Q G DG E H ++     A+SLGDS+LLIFALCFH
Sbjct  145  DVELQANMQGKSCSNGGHSHSLAQVQTGKDGKEVHSVNSPLKTATSLGDSILLIFALCFH  204

Query  627  SVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAI  448
            SVFEGIAIGVA+TKADAW+ALWTVCLHKIFAAIAMGIALLRMIP+RPLLSC AY+FAFAI
Sbjct  205  SVFEGIAIGVAETKADAWRALWTVCLHKIFAAIAMGIALLRMIPDRPLLSCAAYAFAFAI  264

Query  447  SSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKP  268
            SSP+GVA GI+IDATTQG VADWI+AISMG+ACG+FIYVSINHLLSKGY  QKTV  D P
Sbjct  265  SSPIGVATGIVIDATTQGAVADWIFAISMGLACGIFIYVSINHLLSKGYTSQKTVPFDTP  324

Query  267  HFKFLAVLLGIGVIAVVMIWDT  202
            ++KFLAVLLGIGVIAVVMIWDT
Sbjct  325  NYKFLAVLLGIGVIAVVMIWDT  346



>emb|CAN73198.1| hypothetical protein VITISV_014079 [Vitis vinifera]
Length=346

 Score =   306 bits (785),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 176/202 (87%), Gaps = 6/202 (3%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQ-GCDGTESHFLH-----ASSLGDSLLLIFALCFH  628
            D+ELQ N +G++ +  G +H  +Q+Q G DG E H ++     A+SLGDS+LLIFALCFH
Sbjct  145  DVELQANMQGKSCSNGGHSHSLAQVQTGKDGKEVHSVNSPLKTATSLGDSILLIFALCFH  204

Query  627  SVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAI  448
            SVFEGIAIGVA+TKADAW+ALWTVCLHKIFAAIAMGIALLRMIP+RPLLSC AY+FAFAI
Sbjct  205  SVFEGIAIGVAETKADAWRALWTVCLHKIFAAIAMGIALLRMIPDRPLLSCAAYAFAFAI  264

Query  447  SSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKP  268
            SSP+GVA GI+IDATTQG VADWI+AISMG+ACG+FIYVSINHLLSKGY  QKTV  D P
Sbjct  265  SSPIGVATGIVIDATTQGAVADWIFAISMGLACGIFIYVSINHLLSKGYTSQKTVPFDTP  324

Query  267  HFKFLAVLLGIGVIAVVMIWDT  202
            ++KFLAVLLGIGVIAVVMIWDT
Sbjct  325  NYKFLAVLLGIGVIAVVMIWDT  346



>emb|CBI39714.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   301 bits (771),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 175/201 (87%), Gaps = 7/201 (3%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHA-----SSLGDSLLLIFALCFHS  625
            D+ELQ N +G++ +  G +    Q Q C  TE HF++A     +SLGD++LLIFALCFHS
Sbjct  54   DVELQANMQGKSSSNGGNSESLGQDQNC--TELHFVNAPLRTATSLGDNILLIFALCFHS  111

Query  624  VFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAIS  445
            VFEGIAIGVA+T+ADAW+ALWTVCLHKIFAAIAMGIALLRMIP+RPLLSC+AY+FAFAIS
Sbjct  112  VFEGIAIGVAETEADAWRALWTVCLHKIFAAIAMGIALLRMIPDRPLLSCVAYAFAFAIS  171

Query  444  SPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPH  265
            SPVGVAIGI+IDATTQG VADWIYAISMG+ACG+FIYVSINHLLSKGY  Q+TV  D P+
Sbjct  172  SPVGVAIGIVIDATTQGAVADWIYAISMGLACGIFIYVSINHLLSKGYNCQRTVPFDTPN  231

Query  264  FKFLAVLLGIGVIAVVMIWDT  202
            +KFLAVLLG+GVIAVVMIWDT
Sbjct  232  YKFLAVLLGVGVIAVVMIWDT  252



>ref|XP_006452568.1| hypothetical protein CICLE_v10010292mg [Citrus clementina]
 gb|ESR65808.1| hypothetical protein CICLE_v10010292mg [Citrus clementina]
Length=347

 Score =   303 bits (775),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 175/201 (87%), Gaps = 4/201 (2%)
 Frame = -3

Query  792  ADLELQVNTE-GRNFNGIGTTHPQSQLQ-GCDGTESHF--LHASSLGDSLLLIFALCFHS  625
            ADLE Q   E G++ +   T+   SQ Q G DG  S F    ASSLGDS+LLI ALCFHS
Sbjct  147  ADLERQGGLERGKSSHHSATSQSVSQGQNGTDGHSSKFSLTAASSLGDSILLIVALCFHS  206

Query  624  VFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAIS  445
            VFEGIAIGVA+T+ADAWKALWT+CLHKIFAAIAMGIALLRMIP+RPLLSC+AY+FAFAIS
Sbjct  207  VFEGIAIGVAETQADAWKALWTICLHKIFAAIAMGIALLRMIPDRPLLSCVAYAFAFAIS  266

Query  444  SPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPH  265
            SPVGVAIGIIIDATTQG VADWI+AISMG+ACGVFIYVSINHLLSKGY PQKTV+VD P+
Sbjct  267  SPVGVAIGIIIDATTQGPVADWIFAISMGLACGVFIYVSINHLLSKGYTPQKTVSVDTPN  326

Query  264  FKFLAVLLGIGVIAVVMIWDT  202
            +KFLAV+LG+GVIAVVMIWDT
Sbjct  327  YKFLAVVLGVGVIAVVMIWDT  347



>ref|XP_006474910.1| PREDICTED: zinc transporter 2-like [Citrus sinensis]
 gb|KDO59084.1| hypothetical protein CISIN_1g044590mg [Citrus sinensis]
Length=347

 Score =   301 bits (772),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 172/202 (85%), Gaps = 6/202 (3%)
 Frame = -3

Query  792  ADLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESH-----FLHASSLGDSLLLIFALCFH  628
            ADLE Q   EG   +    T  QS  QG +GT+ H        ASSLGDS+LLI ALCFH
Sbjct  147  ADLERQGGLEGGKSSHHSAT-SQSVSQGQNGTDGHSSKFSLTAASSLGDSILLIVALCFH  205

Query  627  SVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAI  448
            SVFEGIAIGVA+T+ADAWKALWT+CLHKIFAAIAMGIALLRMIP+RP LSC+AY+FAFAI
Sbjct  206  SVFEGIAIGVAETQADAWKALWTICLHKIFAAIAMGIALLRMIPDRPFLSCVAYAFAFAI  265

Query  447  SSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKP  268
            SSPVGVAIGIIIDATTQG VADWI+AISMG+ACGVFIYVSINHLLSKGY PQKTV+VD P
Sbjct  266  SSPVGVAIGIIIDATTQGPVADWIFAISMGLACGVFIYVSINHLLSKGYTPQKTVSVDTP  325

Query  267  HFKFLAVLLGIGVIAVVMIWDT  202
            ++KFLAV+LG+GVIAVVMIWDT
Sbjct  326  NYKFLAVVLGVGVIAVVMIWDT  347



>ref|XP_006346153.1| PREDICTED: zinc transporter 2-like [Solanum tuberosum]
Length=348

 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 173/201 (86%), Gaps = 9/201 (4%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHA-----SSLGDSLLLIFALCFHS  625
            D++LQ    G++ NG   T  Q Q Q  DG E+ +  A     SSLGDS+LLI ALCFHS
Sbjct  152  DVQLQDAENGKS-NG---TVAQGQSQVSDGRENDYSKAPLATASSLGDSILLIVALCFHS  207

Query  624  VFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAIS  445
            VFEGIAIGVAD++ADAW+ALWTV LHKIFAAIAMGIALLRMIPNRPLLSC AY+FAFAIS
Sbjct  208  VFEGIAIGVADSQADAWRALWTVSLHKIFAAIAMGIALLRMIPNRPLLSCAAYAFAFAIS  267

Query  444  SPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPH  265
            SP+GVAIGIIIDATTQG VADWI+AISMG+ACGVFI+VSINHLLSKGYKPQK V++DKPH
Sbjct  268  SPIGVAIGIIIDATTQGVVADWIFAISMGLACGVFIFVSINHLLSKGYKPQKMVSIDKPH  327

Query  264  FKFLAVLLGIGVIAVVMIWDT  202
            FKFLAVLLG+G+IAVVMIWDT
Sbjct  328  FKFLAVLLGVGIIAVVMIWDT  348



>ref|XP_002265513.1| PREDICTED: zinc transporter 11 [Vitis vinifera]
Length=345

 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 175/201 (87%), Gaps = 7/201 (3%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHA-----SSLGDSLLLIFALCFHS  625
            D+ELQ N +G++ +  G +    Q Q C  TE HF++A     +SLGD++LLIFALCFHS
Sbjct  147  DVELQANMQGKSSSNGGNSESLGQDQNC--TELHFVNAPLRTATSLGDNILLIFALCFHS  204

Query  624  VFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAIS  445
            VFEGIAIGVA+T+ADAW+ALWTVCLHKIFAAIAMGIALLRMIP+RPLLSC+AY+FAFAIS
Sbjct  205  VFEGIAIGVAETEADAWRALWTVCLHKIFAAIAMGIALLRMIPDRPLLSCVAYAFAFAIS  264

Query  444  SPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPH  265
            SPVGVAIGI+IDATTQG VADWIYAISMG+ACG+FIYVSINHLLSKGY  Q+TV  D P+
Sbjct  265  SPVGVAIGIVIDATTQGAVADWIYAISMGLACGIFIYVSINHLLSKGYNCQRTVPFDTPN  324

Query  264  FKFLAVLLGIGVIAVVMIWDT  202
            +KFLAVLLG+GVIAVVMIWDT
Sbjct  325  YKFLAVLLGVGVIAVVMIWDT  345



>ref|NP_001234349.1| zinc transporter-like precursor [Solanum lycopersicum]
 gb|ABL61268.1| putative zinc transporter [Solanum lycopersicum]
Length=350

 Score =   300 bits (769),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 170/201 (85%), Gaps = 9/201 (4%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHA-----SSLGDSLLLIFALCFHS  625
            D++LQ    G++   +     Q Q Q  DG E+ +  A     SSLGDS+LLI ALCFHS
Sbjct  154  DVQLQDTENGKSNGAVA----QGQSQVSDGRENDYSKAPLATASSLGDSILLIVALCFHS  209

Query  624  VFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAIS  445
            VFEGIAIGVAD++ADAW+ALWTV LHKIFAAIAMGIALLRMIPNRPLLSC AY+FAFAIS
Sbjct  210  VFEGIAIGVADSQADAWRALWTVSLHKIFAAIAMGIALLRMIPNRPLLSCAAYAFAFAIS  269

Query  444  SPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPH  265
            SP+GVAIGIIIDATTQG VADWI+AISMG+ACGVFI+VSINHLLSKGYKPQK V +DKPH
Sbjct  270  SPIGVAIGIIIDATTQGVVADWIFAISMGLACGVFIFVSINHLLSKGYKPQKMVKIDKPH  329

Query  264  FKFLAVLLGIGVIAVVMIWDT  202
            FKFLAVLLG+G+IAVVMIWDT
Sbjct  330  FKFLAVLLGVGIIAVVMIWDT  350



>ref|XP_002265634.1| PREDICTED: zinc transporter 11-like [Vitis vinifera]
Length=347

 Score =   297 bits (761),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 175/201 (87%), Gaps = 7/201 (3%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHA-----SSLGDSLLLIFALCFHS  625
            D+ELQ N +G++ +  G +   +Q Q C  TE H ++A     +SLGD++LLIFALCFHS
Sbjct  149  DVELQENMQGKSSSNGGNSESLAQDQNC--TEVHSVNAPLRTATSLGDNILLIFALCFHS  206

Query  624  VFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAIS  445
            VFEGIAIGVA+T+ADAW+ALWTVCLHKIFAAIAMGIALLRMIP+RPLLSC+AY+FAFAIS
Sbjct  207  VFEGIAIGVAETEADAWRALWTVCLHKIFAAIAMGIALLRMIPDRPLLSCVAYAFAFAIS  266

Query  444  SPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPH  265
            SPVGVAIGI+IDATTQG VADWIYAISMG+ACG+FIYVSINHLLSKGY  Q+TV  D P+
Sbjct  267  SPVGVAIGIVIDATTQGAVADWIYAISMGLACGIFIYVSINHLLSKGYTCQRTVPFDTPN  326

Query  264  FKFLAVLLGIGVIAVVMIWDT  202
            +KFLAVLLG+GVIAVVMIWDT
Sbjct  327  YKFLAVLLGVGVIAVVMIWDT  347



>emb|CBI39718.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   295 bits (755),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 148/201 (74%), Positives = 174/201 (87%), Gaps = 7/201 (3%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHA-----SSLGDSLLLIFALCFHS  625
            D+ELQ N +G++ +  G +    Q+Q  + TE  F +A     +SLGDS+LLIFALCFHS
Sbjct  124  DVELQANMQGKSSSNGGNSVSLGQVQ--NRTEVPFANAPLKTATSLGDSILLIFALCFHS  181

Query  624  VFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAIS  445
            VFEGIA+GVA+T+ADAW+ALWT+CLHKIFAAIAMGIALLRMIP+RPLLSC+AY+FAFAIS
Sbjct  182  VFEGIAVGVAETQADAWRALWTICLHKIFAAIAMGIALLRMIPDRPLLSCVAYAFAFAIS  241

Query  444  SPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPH  265
            SPVGVAIGI+IDATTQG VADWI+AISMG+ACG+FIYVSINHLLSKGY  Q+TV  D P+
Sbjct  242  SPVGVAIGIVIDATTQGAVADWIFAISMGLACGIFIYVSINHLLSKGYTCQRTVPFDTPN  301

Query  264  FKFLAVLLGIGVIAVVMIWDT  202
            +KFLAVLLGIGVIAVVMIWDT
Sbjct  302  YKFLAVLLGIGVIAVVMIWDT  322



>ref|XP_010644553.1| PREDICTED: zinc transporter 11-like [Vitis vinifera]
Length=350

 Score =   294 bits (753),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/201 (74%), Positives = 174/201 (87%), Gaps = 7/201 (3%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHA-----SSLGDSLLLIFALCFHS  625
            D+ELQ N +G++ +  G +    Q+Q  + TE  F +A     +SLGDS+LLIFALCFHS
Sbjct  152  DVELQANMQGKSSSNGGNSVSLGQVQ--NRTEVPFANAPLKTATSLGDSILLIFALCFHS  209

Query  624  VFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAIS  445
            VFEGIA+GVA+T+ADAW+ALWT+CLHKIFAAIAMGIALLRMIP+RPLLSC+AY+FAFAIS
Sbjct  210  VFEGIAVGVAETQADAWRALWTICLHKIFAAIAMGIALLRMIPDRPLLSCVAYAFAFAIS  269

Query  444  SPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPH  265
            SPVGVAIGI+IDATTQG VADWI+AISMG+ACG+FIYVSINHLLSKGY  Q+TV  D P+
Sbjct  270  SPVGVAIGIVIDATTQGAVADWIFAISMGLACGIFIYVSINHLLSKGYTCQRTVPFDTPN  329

Query  264  FKFLAVLLGIGVIAVVMIWDT  202
            +KFLAVLLGIGVIAVVMIWDT
Sbjct  330  YKFLAVLLGIGVIAVVMIWDT  350



>ref|XP_011095528.1| PREDICTED: zinc transporter 11 isoform X1 [Sesamum indicum]
Length=345

 Score =   294 bits (753),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 168/201 (84%), Gaps = 7/201 (3%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHAS-----SLGDSLLLIFALCFHS  625
            D+ELQ N      NG    H  S+LQ  +  E H  +AS     SLGDS+LLI ALCFHS
Sbjct  147  DVELQANAHNAGGNG-NRLHSDSKLQE-NAPERHLANASLATAASLGDSILLIAALCFHS  204

Query  624  VFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAIS  445
            VFEGIAIGVA+T+ADAW+ALWTVCLHKIFAAIAMGIALLRMIP+RPLLSC AY+FAFAIS
Sbjct  205  VFEGIAIGVAETEADAWRALWTVCLHKIFAAIAMGIALLRMIPDRPLLSCAAYAFAFAIS  264

Query  444  SPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPH  265
            SP G+AIGI+IDATTQG VADWI+AISMG+ACGVFIYVSINHLLSKGYK QK V++D P 
Sbjct  265  SPAGIAIGIVIDATTQGAVADWIFAISMGLACGVFIYVSINHLLSKGYKAQKMVSLDSPE  324

Query  264  FKFLAVLLGIGVIAVVMIWDT  202
            ++FLAVLLG+GVIAVVMIWDT
Sbjct  325  YRFLAVLLGVGVIAVVMIWDT  345



>gb|KJB13866.1| hypothetical protein B456_002G098900 [Gossypium raimondii]
Length=324

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 167/199 (84%), Gaps = 5/199 (3%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLH---ASSLGDSLLLIFALCFHSVF  619
            DLELQ   E    N  G   P     G D T +  L    ASS GDS+LLI ALCFHSVF
Sbjct  128  DLELQ-GAERSKTNPHGQGDPPVG-NGTDTTCAQSLSLTSASSFGDSVLLIVALCFHSVF  185

Query  618  EGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSP  439
            EGIAIGVA+T+ADAWKALWT+ LHKIFAAIAMGIALLRMIP+RPLLSCIAY+FAFAISSP
Sbjct  186  EGIAIGVAETEADAWKALWTISLHKIFAAIAMGIALLRMIPDRPLLSCIAYAFAFAISSP  245

Query  438  VGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFK  259
            VGVAIGIIIDATTQG VADWI+AISMG+ACGVFIYVSINHLL+KGY PQKTV+VD+PH K
Sbjct  246  VGVAIGIIIDATTQGAVADWIFAISMGLACGVFIYVSINHLLAKGYAPQKTVSVDRPHHK  305

Query  258  FLAVLLGIGVIAVVMIWDT  202
            FL+VLLG+GVIAVVMIWDT
Sbjct  306  FLSVLLGVGVIAVVMIWDT  324



>gb|KJB13868.1| hypothetical protein B456_002G098900 [Gossypium raimondii]
Length=351

 Score =   290 bits (742),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 167/199 (84%), Gaps = 5/199 (3%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLH---ASSLGDSLLLIFALCFHSVF  619
            DLELQ   E    N  G   P     G D T +  L    ASS GDS+LLI ALCFHSVF
Sbjct  155  DLELQ-GAERSKTNPHGQGDPPVG-NGTDTTCAQSLSLTSASSFGDSVLLIVALCFHSVF  212

Query  618  EGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSP  439
            EGIAIGVA+T+ADAWKALWT+ LHKIFAAIAMGIALLRMIP+RPLLSCIAY+FAFAISSP
Sbjct  213  EGIAIGVAETEADAWKALWTISLHKIFAAIAMGIALLRMIPDRPLLSCIAYAFAFAISSP  272

Query  438  VGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFK  259
            VGVAIGIIIDATTQG VADWI+AISMG+ACGVFIYVSINHLL+KGY PQKTV+VD+PH K
Sbjct  273  VGVAIGIIIDATTQGAVADWIFAISMGLACGVFIYVSINHLLAKGYAPQKTVSVDRPHHK  332

Query  258  FLAVLLGIGVIAVVMIWDT  202
            FL+VLLG+GVIAVVMIWDT
Sbjct  333  FLSVLLGVGVIAVVMIWDT  351



>ref|XP_012071031.1| PREDICTED: zinc transporter 2 [Jatropha curcas]
 gb|KDP39292.1| hypothetical protein JCGZ_01049 [Jatropha curcas]
Length=332

 Score =   289 bits (740),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 145/196 (74%), Positives = 163/196 (83%), Gaps = 12/196 (6%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGI  610
            DLELQ N +    N   T+H            SHF   SS GDS+LLI ALCFHS+FEGI
Sbjct  149  DLELQDNVQRGKTNQQETSH------------SHFATVSSFGDSILLIVALCFHSIFEGI  196

Query  609  AIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGV  430
            AIGVA+TKADAWKALWT+ LHK+FAAIAMGIALLRMIP+RPLLSC+AY+FAFAISSPVGV
Sbjct  197  AIGVAETKADAWKALWTISLHKLFAAIAMGIALLRMIPDRPLLSCVAYAFAFAISSPVGV  256

Query  429  AIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLA  250
            AIGI+IDATTQG+VADWI+AISMG+ACGVFIYV+INHLLSKGYKP   V+VD P F+ +A
Sbjct  257  AIGIVIDATTQGRVADWIFAISMGLACGVFIYVAINHLLSKGYKPLNAVSVDTPFFRLVA  316

Query  249  VLLGIGVIAVVMIWDT  202
            VLLGIGVIAVVMIWDT
Sbjct  317  VLLGIGVIAVVMIWDT  332



>gb|KJB13867.1| hypothetical protein B456_002G098900 [Gossypium raimondii]
Length=340

 Score =   289 bits (740),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 164/196 (84%), Gaps = 10/196 (5%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGI  610
            DLELQ     +       T+P  Q    D        ASS GDS+LLI ALCFHSVFEGI
Sbjct  155  DLELQGAERSK-------TNPHGQ---GDPPSLSLTSASSFGDSVLLIVALCFHSVFEGI  204

Query  609  AIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGV  430
            AIGVA+T+ADAWKALWT+ LHKIFAAIAMGIALLRMIP+RPLLSCIAY+FAFAISSPVGV
Sbjct  205  AIGVAETEADAWKALWTISLHKIFAAIAMGIALLRMIPDRPLLSCIAYAFAFAISSPVGV  264

Query  429  AIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLA  250
            AIGIIIDATTQG VADWI+AISMG+ACGVFIYVSINHLL+KGY PQKTV+VD+PH KFL+
Sbjct  265  AIGIIIDATTQGAVADWIFAISMGLACGVFIYVSINHLLAKGYAPQKTVSVDRPHHKFLS  324

Query  249  VLLGIGVIAVVMIWDT  202
            VLLG+GVIAVVMIWDT
Sbjct  325  VLLGVGVIAVVMIWDT  340



>ref|XP_011095529.1| PREDICTED: zinc transporter 11 isoform X2 [Sesamum indicum]
Length=339

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 169/201 (84%), Gaps = 13/201 (6%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHAS-----SLGDSLLLIFALCFHS  625
            D+ELQ    G N N +   H  S+LQ  +  E H  +AS     SLGDS+LLI ALCFHS
Sbjct  147  DVELQ----GGNGNRL---HSDSKLQE-NAPERHLANASLATAASLGDSILLIAALCFHS  198

Query  624  VFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAIS  445
            VFEGIAIGVA+T+ADAW+ALWTVCLHKIFAAIAMGIALLRMIP+RPLLSC AY+FAFAIS
Sbjct  199  VFEGIAIGVAETEADAWRALWTVCLHKIFAAIAMGIALLRMIPDRPLLSCAAYAFAFAIS  258

Query  444  SPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPH  265
            SP G+AIGI+IDATTQG VADWI+AISMG+ACGVFIYVSINHLLSKGYK QK V++D P 
Sbjct  259  SPAGIAIGIVIDATTQGAVADWIFAISMGLACGVFIYVSINHLLSKGYKAQKMVSLDSPE  318

Query  264  FKFLAVLLGIGVIAVVMIWDT  202
            ++FLAVLLG+GVIAVVMIWDT
Sbjct  319  YRFLAVLLGVGVIAVVMIWDT  339



>ref|XP_009415332.1| PREDICTED: zinc transporter 2 [Musa acuminata subsp. malaccensis]
Length=350

 Score =   287 bits (734),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 158/183 (86%), Gaps = 3/183 (2%)
 Frame = -3

Query  741  GTTHPQSQLQGCDGTES---HFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWK  571
            G +  Q ++  C G  S       A+SLGDS+LLIFALCFHSVFEGIAIGVADTKADAWK
Sbjct  168  GVSQSQQEVGQCTGDHSVASLLRDANSLGDSILLIFALCFHSVFEGIAIGVADTKADAWK  227

Query  570  ALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGK  391
            ALWT+ LHK+FAAIAMGIALLRM+PNRPLLSC AYSFAFAISSP+GVAIGIIIDATTQG+
Sbjct  228  ALWTISLHKVFAAIAMGIALLRMMPNRPLLSCAAYSFAFAISSPIGVAIGIIIDATTQGR  287

Query  390  VADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMI  211
            VADWIYAISMG+A GVFIYVSINHLL+KGYKPQK VA D P  ++ AV+LGIGVIAVVMI
Sbjct  288  VADWIYAISMGLATGVFIYVSINHLLAKGYKPQKPVAADTPFIRWFAVVLGIGVIAVVMI  347

Query  210  WDT  202
            WDT
Sbjct  348  WDT  350



>ref|XP_008244614.1| PREDICTED: zinc transporter 11-like [Prunus mume]
Length=330

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 159/183 (87%), Gaps = 1/183 (1%)
 Frame = -3

Query  750  NGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWK  571
            N  G + P  +LQG D         +SLGDS+LLI ALCFHSVFEGIAIGVA+TKADAWK
Sbjct  149  NKGGGSAPDLELQGKDKANVR-QGLTSLGDSILLIVALCFHSVFEGIAIGVANTKADAWK  207

Query  570  ALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGK  391
            ALWT+ LHK+FAAIAMGIALLRM+PNRP LSC  Y+FAFAISSP+GVAIGI+IDATTQG 
Sbjct  208  ALWTISLHKVFAAIAMGIALLRMMPNRPFLSCAVYAFAFAISSPIGVAIGILIDATTQGA  267

Query  390  VADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMI  211
            VADWI+AISMGIACGVFIYV++NHLL+KGYKP K V++DKPH+KFLAVLLG+GVIAVVMI
Sbjct  268  VADWIFAISMGIACGVFIYVAVNHLLAKGYKPNKAVSIDKPHYKFLAVLLGVGVIAVVMI  327

Query  210  WDT  202
            WDT
Sbjct  328  WDT  330



>ref|XP_011625123.1| PREDICTED: zinc transporter 11 isoform X1 [Amborella trichopoda]
Length=344

 Score =   285 bits (728),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 159/193 (82%), Gaps = 3/193 (2%)
 Frame = -3

Query  771  NTEGRNFNGIGTTHPQSQLQG---CDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIG  601
            +++   + G G TH   QL G   C   E+   + SSLGDS+LLI ALCFHSVFEGIAIG
Sbjct  152  SSQVSKYGGYGHTHSNVQLFGPGPCTLAEAGIGNVSSLGDSILLIVALCFHSVFEGIAIG  211

Query  600  VADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIG  421
            VA+TK DAW+ LWTVCLHKIFAAIAMGIALLRMIP RPLLSC AY+FAFAISSP+GV IG
Sbjct  212  VAETKDDAWRVLWTVCLHKIFAAIAMGIALLRMIPERPLLSCSAYAFAFAISSPIGVVIG  271

Query  420  IIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLL  241
            I+IDATTQG VADWIYAISMG+ACG+FIYVSINHLLSKGY PQK   VD P +KFLAVLL
Sbjct  272  IVIDATTQGTVADWIYAISMGLACGIFIYVSINHLLSKGYAPQKPALVDSPFYKFLAVLL  331

Query  240  GIGVIAVVMIWDT  202
            G+ VIA+VMIWDT
Sbjct  332  GVTVIAIVMIWDT  344



>ref|XP_008244596.1| PREDICTED: zinc transporter 11-like [Prunus mume]
Length=347

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 167/201 (83%), Gaps = 16/201 (8%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHA-----SSLGDSLLLIFALCFHS  625
            DLEL+ + E     G G        Q  + + +HF +      SSLGDS+LLI ALCFHS
Sbjct  158  DLELRGSAE----QGKGG-------QNGNVSHNHFANVAVANVSSLGDSILLIVALCFHS  206

Query  624  VFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAIS  445
            VFEGIAIGVAD+KADAWKALWT+ LHK+FAAIAMGIALLRM+PNRP LSC AY+FAFAIS
Sbjct  207  VFEGIAIGVADSKADAWKALWTISLHKVFAAIAMGIALLRMMPNRPFLSCAAYAFAFAIS  266

Query  444  SPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPH  265
            SP+GVAIGI+IDATTQG VADWI+AISMG+ACGVFIYV++NHLL+KGYKP K V++DKPH
Sbjct  267  SPIGVAIGILIDATTQGAVADWIFAISMGVACGVFIYVAVNHLLAKGYKPDKAVSIDKPH  326

Query  264  FKFLAVLLGIGVIAVVMIWDT  202
            +KFLAVLLG+GVIAVVMIWDT
Sbjct  327  YKFLAVLLGVGVIAVVMIWDT  347



>emb|CDP13728.1| unnamed protein product [Coffea canephora]
Length=357

 Score =   282 bits (722),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 163/196 (83%), Gaps = 10/196 (5%)
 Frame = -3

Query  774  VNTEGRNFNGIGTTHPQSQLQGCDGTESHF-----LHASSLGDSLLLIFALCFHSVFEGI  610
            V   G+     G   P+ Q+ G   ++ HF     + A+SLGDS+LLI ALCFHSVFEGI
Sbjct  167  VAHSGKGTGNGGAAQPEVQVHGP--SDHHFSKAPVVTAASLGDSILLIVALCFHSVFEGI  224

Query  609  AIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGV  430
            AIGVA++KADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSC AY+FAFAISSP+GV
Sbjct  225  AIGVAESKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCAAYAFAFAISSPIGV  284

Query  429  AIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLA  250
            AIGIIIDATT+G VADW YAISMG+ACGVFIYVSINHLLSKGY PQ+   VD P+ KFLA
Sbjct  285  AIGIIIDATTEGAVADWTYAISMGLACGVFIYVSINHLLSKGYNPQE---VDMPYHKFLA  341

Query  249  VLLGIGVIAVVMIWDT  202
            VLLG+GVIAVVMIWDT
Sbjct  342  VLLGVGVIAVVMIWDT  357



>ref|XP_008664495.1| PREDICTED: zinc transporter 2-like [Zea mays]
Length=223

 Score =   278 bits (710),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 159/187 (85%), Gaps = 1/187 (1%)
 Frame = -3

Query  759  RNFNGIGTTHPQSQLQGCDGTESHFL-HASSLGDSLLLIFALCFHSVFEGIAIGVADTKA  583
            R  NG  +    +   G D + +  L +AS++GDS+LLI ALCFHSVFEGIAIG+A+TKA
Sbjct  37   RTANGTRSEPTPADAHGSDHSAASILRNASTIGDSVLLIVALCFHSVFEGIAIGIAETKA  96

Query  582  DAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDAT  403
            DAWKALWT+ LHKIFAAIAMGIALLRM+PNRPLLSC AY+FAFAISSPVGV IGIIIDAT
Sbjct  97   DAWKALWTISLHKIFAAIAMGIALLRMLPNRPLLSCFAYAFAFAISSPVGVGIGIIIDAT  156

Query  402  TQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIA  223
            TQG+VADWI+A+SMG+A G+F+YVSINHLLSKGY+PQ+ VAVD P  ++LAV+ G+ VIA
Sbjct  157  TQGRVADWIFAVSMGLATGIFVYVSINHLLSKGYRPQRPVAVDTPVGRWLAVVFGVAVIA  216

Query  222  VVMIWDT  202
            VVMIWDT
Sbjct  217  VVMIWDT  223



>gb|KHG22377.1| Zinc transporter 11 -like protein [Gossypium arboreum]
Length=323

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 166/202 (82%), Gaps = 11/202 (5%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASS------LGDSLLLIFALCFH  628
            DLELQ   + +        H Q      +GT++    +SS       GDS+LLI ALCFH
Sbjct  127  DLELQGAEQSKT-----NPHGQGDPPVGNGTDTKCAQSSSLTSASSFGDSVLLIIALCFH  181

Query  627  SVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAI  448
            SVFEGIAIGVA+T+ADAWKALWT+ LHKIFAAIAMGIALLRMIP+RPLLSCIAY+FAFAI
Sbjct  182  SVFEGIAIGVAETEADAWKALWTISLHKIFAAIAMGIALLRMIPDRPLLSCIAYAFAFAI  241

Query  447  SSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKP  268
            SSPVGVAIGI+IDATTQG VADWI+AISMG+ACGVFIYVSINHLL+KGY PQK V+VD+P
Sbjct  242  SSPVGVAIGIVIDATTQGAVADWIFAISMGLACGVFIYVSINHLLAKGYAPQKMVSVDRP  301

Query  267  HFKFLAVLLGIGVIAVVMIWDT  202
            H KFL+VLLG+GVIAVVMIWDT
Sbjct  302  HHKFLSVLLGVGVIAVVMIWDT  323



>ref|XP_009376781.1| PREDICTED: zinc transporter 11-like [Pyrus x bretschneideri]
 ref|XP_009350384.1| PREDICTED: zinc transporter 11-like [Pyrus x bretschneideri]
Length=345

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 165/204 (81%), Gaps = 20/204 (10%)
 Frame = -3

Query  792  ADLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESH-------FLHASSLGDSLLLIFALC  634
            ADL++Q N E     G G         G  GT+SH          A+SLGDS+LLI ALC
Sbjct  155  ADLQVQGNIE----QGKG---------GQYGTQSHNHFANAVVASATSLGDSILLIVALC  201

Query  633  FHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAF  454
            FHSVFEGIAIGVA+TKADAWKALWT+ LHK+FAAIAMGIALLRM+PNRP LSC AY+FAF
Sbjct  202  FHSVFEGIAIGVAETKADAWKALWTISLHKVFAAIAMGIALLRMMPNRPFLSCAAYAFAF  261

Query  453  AISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVD  274
            AISSP+GVAIGI+IDATTQG VADWI+AISM +ACGVFIYV+INHLL+KGY P + V+VD
Sbjct  262  AISSPIGVAIGILIDATTQGAVADWIFAISMALACGVFIYVAINHLLAKGYTPDRAVSVD  321

Query  273  KPHFKFLAVLLGIGVIAVVMIWDT  202
            KP +KFLAVLLGIGVIAVVMIWDT
Sbjct  322  KPQYKFLAVLLGIGVIAVVMIWDT  345



>ref|XP_007146623.1| hypothetical protein PHAVU_006G055800g [Phaseolus vulgaris]
 gb|ESW18617.1| hypothetical protein PHAVU_006G055800g [Phaseolus vulgaris]
Length=352

 Score =   280 bits (717),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 167/202 (83%), Gaps = 7/202 (3%)
 Frame = -3

Query  789  DLELQ-VNTEGRNFNGIGTTHPQSQLQGCDGTESHFLH-----ASSLGDSLLLIFALCFH  628
            D+E+Q  +T   + NG+ T+  Q++      T+ +F       A SLGD++LLI ALC H
Sbjct  152  DVEIQGRDTSKVSTNGV-TSQSQNRNLSISSTDHNFASPALASAHSLGDTILLIVALCAH  210

Query  627  SVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAI  448
            SVFEG+AIGVA+TKADAWKALWT+CLHKIFAAIAMGIALLRMIPNRPL+SC+AY+FAFAI
Sbjct  211  SVFEGLAIGVAETKADAWKALWTICLHKIFAAIAMGIALLRMIPNRPLMSCVAYAFAFAI  270

Query  447  SSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKP  268
            SSP+GVAIGII+DATTQG VADWI+AISMG+ACGVFIYVS+NHLL+KGYKP     VD  
Sbjct  271  SSPIGVAIGIILDATTQGHVADWIFAISMGLACGVFIYVSVNHLLAKGYKPHNPTKVDSA  330

Query  267  HFKFLAVLLGIGVIAVVMIWDT  202
            +FKF AVLLG+GVIAVVMIWDT
Sbjct  331  YFKFFAVLLGVGVIAVVMIWDT  352



>ref|XP_010061468.1| PREDICTED: zinc transporter 11 isoform X2 [Eucalyptus grandis]
 gb|KCW68409.1| hypothetical protein EUGRSUZ_F02058 [Eucalyptus grandis]
Length=335

 Score =   280 bits (715),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 162/199 (81%), Gaps = 15/199 (8%)
 Frame = -3

Query  789  DLELQ---VNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVF  619
            DLELQ   V  +G + NG    HP S   G            SL D++LLI ALCFHSVF
Sbjct  149  DLELQGSTVQGKGSSENGATHHHPPSVAVG------------SLSDNILLIVALCFHSVF  196

Query  618  EGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSP  439
            EGIAIGVA+TKADAWKALWT+ LHKIFAAIAMGIALLRM+PNRPLLSC++Y+FAFAISSP
Sbjct  197  EGIAIGVAETKADAWKALWTISLHKIFAAIAMGIALLRMMPNRPLLSCVSYAFAFAISSP  256

Query  438  VGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFK  259
            +GVAIGIIIDATTQG VADWI+AISMG+ACGVF+YVSINHLLSKGY PQ+ V+VD P  K
Sbjct  257  IGVAIGIIIDATTQGAVADWIFAISMGLACGVFVYVSINHLLSKGYIPQRAVSVDTPIHK  316

Query  258  FLAVLLGIGVIAVVMIWDT  202
            FLAV LG+GVIA+VMIWDT
Sbjct  317  FLAVTLGVGVIAIVMIWDT  335



>ref|XP_010061467.1| PREDICTED: zinc transporter 2 isoform X1 [Eucalyptus grandis]
 gb|KCW68408.1| hypothetical protein EUGRSUZ_F02058 [Eucalyptus grandis]
Length=336

 Score =   279 bits (714),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 162/200 (81%), Gaps = 16/200 (8%)
 Frame = -3

Query  789  DLELQ----VNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSV  622
            DLELQ    V  +G + NG    HP S   G            SL D++LLI ALCFHSV
Sbjct  149  DLELQAGSTVQGKGSSENGATHHHPPSVAVG------------SLSDNILLIVALCFHSV  196

Query  621  FEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISS  442
            FEGIAIGVA+TKADAWKALWT+ LHKIFAAIAMGIALLRM+PNRPLLSC++Y+FAFAISS
Sbjct  197  FEGIAIGVAETKADAWKALWTISLHKIFAAIAMGIALLRMMPNRPLLSCVSYAFAFAISS  256

Query  441  PVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHF  262
            P+GVAIGIIIDATTQG VADWI+AISMG+ACGVF+YVSINHLLSKGY PQ+ V+VD P  
Sbjct  257  PIGVAIGIIIDATTQGAVADWIFAISMGLACGVFVYVSINHLLSKGYIPQRAVSVDTPIH  316

Query  261  KFLAVLLGIGVIAVVMIWDT  202
            KFLAV LG+GVIA+VMIWDT
Sbjct  317  KFLAVTLGVGVIAIVMIWDT  336



>ref|XP_002300374.2| Zinc transporter 11 precursor family protein [Populus trichocarpa]
 gb|EEE85179.2| Zinc transporter 11 precursor family protein [Populus trichocarpa]
Length=347

 Score =   279 bits (714),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 165/201 (82%), Gaps = 9/201 (4%)
 Frame = -3

Query  789  DLELQVNT-EGRNFNGIGTTHPQSQLQGCDGTE-----SHFLHASSLGDSLLLIFALCFH  628
            D+ELQ    +G+  +   T+  QS  Q  +GT+     S    ASS GDS+LLIFALCFH
Sbjct  150  DVELQGGVLQGKRSH---TSSSQSHFQMHNGTDAASAKSTLSTASSFGDSILLIFALCFH  206

Query  627  SVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAI  448
            SVFEGIAIGVA T ADAWKALWT+ LHKIFAAIAMGIALLRMIP+RP +SC+AY+FAFAI
Sbjct  207  SVFEGIAIGVAKTNADAWKALWTITLHKIFAAIAMGIALLRMIPDRPCVSCVAYAFAFAI  266

Query  447  SSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKP  268
            SSPVGVAIGIIIDATTQG VADWI+AISMG+ACGVFIYVSINHL +KGY PQ++V VD P
Sbjct  267  SSPVGVAIGIIIDATTQGPVADWIFAISMGLACGVFIYVSINHLSTKGYLPQRSVLVDTP  326

Query  267  HFKFLAVLLGIGVIAVVMIWD  205
             +KFLAV LGIGVIAVVMIWD
Sbjct  327  LYKFLAVSLGIGVIAVVMIWD  347



>ref|XP_002522767.1| zinc transporter, putative [Ricinus communis]
 gb|EEF39618.1| zinc transporter, putative [Ricinus communis]
Length=350

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 164/205 (80%), Gaps = 9/205 (4%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCD---------GTESHFLHASSLGDSLLLIFAL  637
            DLELQ + E    +   T+  Q Q+   +           +S     SS GDS+LLI AL
Sbjct  146  DLELQESVEHVKTSHHDTSESQVQIWCINIVQIDVQAASADSKLSTLSSFGDSILLIVAL  205

Query  636  CFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFA  457
            CFHS+FEGIAIGVA+TKADAWKALWT+ LHKIFAAIAMGIALLRMIP+RP LSC+AY+FA
Sbjct  206  CFHSIFEGIAIGVAETKADAWKALWTITLHKIFAAIAMGIALLRMIPDRPFLSCVAYAFA  265

Query  456  FAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAV  277
            FAISSPVGVAIGI+IDATTQG VADWIYAISMG+ACGVFIYV+INHLLSKGY PQ +++V
Sbjct  266  FAISSPVGVAIGIVIDATTQGAVADWIYAISMGLACGVFIYVAINHLLSKGYMPQISISV  325

Query  276  DKPHFKFLAVLLGIGVIAVVMIWDT  202
            + P  +FLAVLLGIG+IAVVMIWDT
Sbjct  326  NTPFHRFLAVLLGIGIIAVVMIWDT  350



>ref|XP_006848976.1| PREDICTED: zinc transporter 11 isoform X2 [Amborella trichopoda]
 gb|ERN10557.1| hypothetical protein AMTR_s00028p00046320 [Amborella trichopoda]
Length=333

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 157/190 (83%), Gaps = 8/190 (4%)
 Frame = -3

Query  771  NTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVAD  592
            +++   + G G TH  S +Q   G      + SSLGDS+LLI ALCFHSVFEGIAIGVA+
Sbjct  152  SSQVSKYGGYGHTH--SNVQAGIG------NVSSLGDSILLIVALCFHSVFEGIAIGVAE  203

Query  591  TKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIII  412
            TK DAW+ LWTVCLHKIFAAIAMGIALLRMIP RPLLSC AY+FAFAISSP+GV IGI+I
Sbjct  204  TKDDAWRVLWTVCLHKIFAAIAMGIALLRMIPERPLLSCSAYAFAFAISSPIGVVIGIVI  263

Query  411  DATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIG  232
            DATTQG VADWIYAISMG+ACG+FIYVSINHLLSKGY PQK   VD P +KFLAVLLG+ 
Sbjct  264  DATTQGTVADWIYAISMGLACGIFIYVSINHLLSKGYAPQKPALVDSPFYKFLAVLLGVT  323

Query  231  VIAVVMIWDT  202
            VIA+VMIWDT
Sbjct  324  VIAIVMIWDT  333



>ref|XP_008462987.1| PREDICTED: zinc transporter 11 [Cucumis melo]
Length=338

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 156/187 (83%), Gaps = 7/187 (4%)
 Frame = -3

Query  741  GTTHPQSQLQGCDGTESHFLHA-------SSLGDSLLLIFALCFHSVFEGIAIGVADTKA  583
            G     S+ Q  +G+  H  H         S GDS+LLI ALCFHSVFEGIAIGVA+T+A
Sbjct  152  GAATSPSKFQVQNGSNGHHPHPHQALTTMGSFGDSILLIVALCFHSVFEGIAIGVAETEA  211

Query  582  DAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDAT  403
            DAWKALWT+ LHK+FAAIAMGIALLRMIPNRPLLS  AYSFAFAISSP+G+AIGI+IDAT
Sbjct  212  DAWKALWTISLHKVFAAIAMGIALLRMIPNRPLLSSAAYSFAFAISSPIGIAIGIVIDAT  271

Query  402  TQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIA  223
            TQG VADWI+AISMG+ACGVFIYVSINHLLSKGY P+ +V VD P++KFLAVLLGIGVIA
Sbjct  272  TQGAVADWIFAISMGLACGVFIYVSINHLLSKGYTPRDSVVVDNPNYKFLAVLLGIGVIA  331

Query  222  VVMIWDT  202
            +VMIWDT
Sbjct  332  IVMIWDT  338



>ref|XP_010936402.1| PREDICTED: zinc transporter 2-like [Elaeis guineensis]
Length=359

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 161/188 (86%), Gaps = 4/188 (2%)
 Frame = -3

Query  756  NFNGIGTTHPQSQLQGCDGTES---HFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTK  586
            + NG G +  Q +++G    +S       A +LGDS+LLI ALCFHSVFEGIAIGVA+ K
Sbjct  173  SING-GGSQLQPEVEGTSNNQSLASMLRDAGTLGDSILLIVALCFHSVFEGIAIGVAENK  231

Query  585  ADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDA  406
            ADAWKALWT+ LHKIFAAIAMGIALLRM+PNRPLLSC+AY+FAFAISSP+GVAIGIIIDA
Sbjct  232  ADAWKALWTISLHKIFAAIAMGIALLRMMPNRPLLSCVAYAFAFAISSPIGVAIGIIIDA  291

Query  405  TTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVI  226
            TTQG+VADW +AISMG+ACG+FIYVSINHL +KGYKPQ+ +AVD P +++ +V+LG+GVI
Sbjct  292  TTQGRVADWTFAISMGLACGIFIYVSINHLFAKGYKPQRPLAVDTPMYRWFSVVLGVGVI  351

Query  225  AVVMIWDT  202
            AVVMIWDT
Sbjct  352  AVVMIWDT  359



>ref|XP_008363870.1| PREDICTED: zinc transporter 11-like isoform X1 [Malus domestica]
Length=345

 Score =   277 bits (709),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 164/202 (81%), Gaps = 16/202 (8%)
 Frame = -3

Query  792  ADLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHA-----SSLGDSLLLIFALCFH  628
            ADL++Q N E       GT            + +HF +A     +SLGDS+LLI ALCFH
Sbjct  155  ADLQVQGNIEQGKGGQYGTQ-----------SHNHFANAVVASATSLGDSILLIVALCFH  203

Query  627  SVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAI  448
            SVFEGIAIGVA+TKADAWKALWT+ LHK+FAAIAMGIALL M+PNR  LSC AY+FAFAI
Sbjct  204  SVFEGIAIGVAETKADAWKALWTISLHKVFAAIAMGIALLXMMPNRXFLSCAAYAFAFAI  263

Query  447  SSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKP  268
            SSP+GVAIGI+IDATTQG VADWI+AISMG+ACGVFIYV+INHLL+KGY+P + V+VDKP
Sbjct  264  SSPIGVAIGILIDATTQGAVADWIFAISMGLACGVFIYVAINHLLAKGYRPDRAVSVDKP  323

Query  267  HFKFLAVLLGIGVIAVVMIWDT  202
             +KFLAVLLGIGVIAVVMIWDT
Sbjct  324  QYKFLAVLLGIGVIAVVMIWDT  345



>ref|XP_004984039.1| PREDICTED: LOW QUALITY PROTEIN: zinc transporter 2-like [Setaria 
italica]
Length=352

 Score =   277 bits (709),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 160/184 (87%), Gaps = 1/184 (1%)
 Frame = -3

Query  750  NGIGTTHPQSQLQGCDGTESHFLH-ASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAW  574
            NG  +    ++  G D + +  LH A++LGDS+LLI ALCFHSVFEGIAIGVA+TKADAW
Sbjct  169  NGTSSEPQPAEAHGSDHSVASMLHNANTLGDSILLIAALCFHSVFEGIAIGVAETKADAW  228

Query  573  KALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQG  394
            KALWT+ LHKIFAAIAMGIALLRM+PNRP LSC AY+FAFAISSP+GVAIGI+IDATTQG
Sbjct  229  KALWTISLHKIFAAIAMGIALLRMLPNRPFLSCFAYAFAFAISSPIGVAIGIVIDATTQG  288

Query  393  KVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVM  214
            +VADWI+AISMG+A G+F+YVSINHLLSKGYKP++ VAVD P  ++LAV+LG+ VIAVVM
Sbjct  289  RVADWIFAISMGLATGIFVYVSINHLLSKGYKPRRPVAVDTPVGRWLAVVLGVAVIAVVM  348

Query  213  IWDT  202
            IWDT
Sbjct  349  IWDT  352



>ref|XP_008790338.1| PREDICTED: LOW QUALITY PROTEIN: zinc transporter 2 [Phoenix dactylifera]
Length=354

 Score =   277 bits (708),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 165/197 (84%), Gaps = 6/197 (3%)
 Frame = -3

Query  783  ELQVNTEGRNFNGIGTTHPQSQLQGCDGTES--HFLH-ASSLGDSLLLIFALCFHSVFEG  613
            + Q +  G N  G   +  Q +++   G +S    LH A SLGDS+LLI ALCFHSVFEG
Sbjct  161  KFQESKVGSNGGG---SQLQPEVESTSGHQSLASMLHDADSLGDSILLIVALCFHSVFEG  217

Query  612  IAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVG  433
            IAIGVA+ KADAWKALWT+ LHKIFAAIAMGIALLR+IPNRPLLSC+AY+FAFAISSP+G
Sbjct  218  IAIGVAENKADAWKALWTISLHKIFAAIAMGIALLRIIPNRPLLSCVAYAFAFAISSPIG  277

Query  432  VAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFL  253
            VAIGIIIDATT+G+VADWI+AISMG+ACG+FIYVSINHL +KGYKPQ+ +AVD P +++ 
Sbjct  278  VAIGIIIDATTEGRVADWIFAISMGLACGIFIYVSINHLFAKGYKPQRPIAVDTPMYRWF  337

Query  252  AVLLGIGVIAVVMIWDT  202
            +V+ G+GVIAVVMIWDT
Sbjct  338  SVVFGVGVIAVVMIWDT  354



>ref|XP_011038777.1| PREDICTED: zinc transporter 11 [Populus euphratica]
Length=343

 Score =   276 bits (707),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 155/183 (85%), Gaps = 5/183 (3%)
 Frame = -3

Query  738  TTHPQSQLQGCDG-----TESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAW  574
            T+  QS  Q  +G      +S     SSLGDS+LLIFALC HSVFEGIAIGVA+TKADAW
Sbjct  161  TSSSQSHFQMHNGIDAASAKSTLATTSSLGDSILLIFALCLHSVFEGIAIGVAETKADAW  220

Query  573  KALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQG  394
            +ALWT+ LHKIFAAIAMGIALLRMIP RP +SC+AY+FAFAISSPVGVAIGIIIDATTQG
Sbjct  221  RALWTITLHKIFAAIAMGIALLRMIPERPFVSCVAYAFAFAISSPVGVAIGIIIDATTQG  280

Query  393  KVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVM  214
             VADWI+AISMG+ACGVFIYVSINHL +KGY PQ++V VD P +KFLAV LGIGVIAVVM
Sbjct  281  AVADWIFAISMGLACGVFIYVSINHLSTKGYCPQRSVLVDTPFYKFLAVSLGIGVIAVVM  340

Query  213  IWD  205
            IWD
Sbjct  341  IWD  343



>ref|XP_010252748.1| PREDICTED: zinc transporter 11 isoform X2 [Nelumbo nucifera]
Length=351

 Score =   276 bits (707),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 160/201 (80%), Gaps = 6/201 (3%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGT-THPQSQLQGCDGTESHFLHAS-----SLGDSLLLIFALCFH  628
            D+ELQ N +G +   I   T  QS  Q  + +E+  +  S     SLGD++LLI ALCFH
Sbjct  151  DVELQGNGKGPSTRSISNGTTSQSHFQAENKSENQVMKPSLATAYSLGDTILLIVALCFH  210

Query  627  SVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAI  448
            SVFEGI+IGVA+ KADAW+ALWTV LHKIFAAIAMGIALLRMIP+RPL+SC AY+FAFAI
Sbjct  211  SVFEGISIGVAENKADAWRALWTVSLHKIFAAIAMGIALLRMIPDRPLVSCAAYAFAFAI  270

Query  447  SSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKP  268
            SSP+GVAIGI+IDATT+G VADWIYAISMG+ACGVFIYVSINHLL+KGY P     VD P
Sbjct  271  SSPIGVAIGIVIDATTEGPVADWIYAISMGLACGVFIYVSINHLLAKGYTPHNLTLVDTP  330

Query  267  HFKFLAVLLGIGVIAVVMIWD  205
              KF AVL GIGVIAVVMIWD
Sbjct  331  FHKFFAVLTGIGVIAVVMIWD  351



>gb|ACG48698.1| zinc transporter 2 precursor [Zea mays]
Length=359

 Score =   276 bits (707),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 159/187 (85%), Gaps = 1/187 (1%)
 Frame = -3

Query  759  RNFNGIGTTHPQSQLQGCDGTESHFL-HASSLGDSLLLIFALCFHSVFEGIAIGVADTKA  583
            R  NG  +    +   G D + +  L +AS++GDS+LLI ALCFHSVFEGIAIG+A+TKA
Sbjct  173  RTTNGTRSEPTPADAHGSDHSAASILRNASTIGDSVLLIVALCFHSVFEGIAIGIAETKA  232

Query  582  DAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDAT  403
            DAWKALWT+ LHKIFAAIAMGIALLRM+PNRPLLSC AY+FAFAISSPVGV IGIIIDAT
Sbjct  233  DAWKALWTISLHKIFAAIAMGIALLRMLPNRPLLSCFAYAFAFAISSPVGVGIGIIIDAT  292

Query  402  TQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIA  223
            TQG+VADWI+A+SMG+A G+F+YVSINHLLSKGY+PQ+ VAVD P  ++LAV+ G+ VIA
Sbjct  293  TQGRVADWIFAVSMGLATGIFVYVSINHLLSKGYRPQRPVAVDTPVGRWLAVVFGVAVIA  352

Query  222  VVMIWDT  202
            VVMIWDT
Sbjct  353  VVMIWDT  359



>ref|XP_010252747.1| PREDICTED: zinc transporter 11 isoform X1 [Nelumbo nucifera]
Length=352

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 160/202 (79%), Gaps = 7/202 (3%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGI--GTTHPQSQLQGCDGTESHFLHAS-----SLGDSLLLIFALCF  631
            D+ELQ N +G +   I  GTT      Q  + +E+  +  S     SLGD++LLI ALCF
Sbjct  151  DVELQGNGKGPSTRSISNGTTSQSHFQQAENKSENQVMKPSLATAYSLGDTILLIVALCF  210

Query  630  HSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFA  451
            HSVFEGI+IGVA+ KADAW+ALWTV LHKIFAAIAMGIALLRMIP+RPL+SC AY+FAFA
Sbjct  211  HSVFEGISIGVAENKADAWRALWTVSLHKIFAAIAMGIALLRMIPDRPLVSCAAYAFAFA  270

Query  450  ISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDK  271
            ISSP+GVAIGI+IDATT+G VADWIYAISMG+ACGVFIYVSINHLL+KGY P     VD 
Sbjct  271  ISSPIGVAIGIVIDATTEGPVADWIYAISMGLACGVFIYVSINHLLAKGYTPHNLTLVDT  330

Query  270  PHFKFLAVLLGIGVIAVVMIWD  205
            P  KF AVL GIGVIAVVMIWD
Sbjct  331  PFHKFFAVLTGIGVIAVVMIWD  352



>gb|KJB81422.1| hypothetical protein B456_013G153700 [Gossypium raimondii]
Length=330

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = -3

Query  669  LGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNR  490
             GDS+LLI ALCFHSVFEGIAIGVA+T+ADAWK LW + LHKIFAAIAMGIALLRMIP+R
Sbjct  175  FGDSVLLIVALCFHSVFEGIAIGVAETEADAWKTLWIISLHKIFAAIAMGIALLRMIPDR  234

Query  489  PLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLS  310
            P LSCIAY+FAFAISSP GVAIGII+DATT+G +ADWI+AISMG+ACGVFIYVSINHLLS
Sbjct  235  PFLSCIAYAFAFAISSPAGVAIGIILDATTEGVMADWIFAISMGLACGVFIYVSINHLLS  294

Query  309  KGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            KGY P KTV+VDKPH+KFLAVLLG+GVIAVVMIWD 
Sbjct  295  KGYTPHKTVSVDKPHYKFLAVLLGVGVIAVVMIWDN  330



>ref|XP_003557730.1| PREDICTED: zinc transporter 2 [Brachypodium distachyon]
Length=358

 Score =   273 bits (697),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 162/197 (82%), Gaps = 13/197 (7%)
 Frame = -3

Query  765  EGRNFNGIGTTHPQS-QLQGCDGTESHFLH--------ASSLGDSLLLIFALCFHSVFEG  613
            EG+    +GTT+  S + Q  D   S   H        AS+LGDS+LLI ALCFHSVFEG
Sbjct  166  EGK----LGTTNGNSSEPQAADAHGSSTDHSVPSMLGNASTLGDSILLIAALCFHSVFEG  221

Query  612  IAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVG  433
            IAIGVA+TKADAWKALWT+ LHKIFAAIAMGIALLRM+PNRPLLSC AY+FAFAISSP+G
Sbjct  222  IAIGVAETKADAWKALWTISLHKIFAAIAMGIALLRMLPNRPLLSCFAYAFAFAISSPIG  281

Query  432  VAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFL  253
            V IGI+IDATTQG+VADWI+AISMG+A G+FIYVSINHL+SKGYKPQ+ VA D P  ++L
Sbjct  282  VGIGIVIDATTQGRVADWIFAISMGLATGIFIYVSINHLISKGYKPQRPVAADTPVGRWL  341

Query  252  AVLLGIGVIAVVMIWDT  202
             V+LG+GVIAVVMIWDT
Sbjct  342  TVVLGVGVIAVVMIWDT  358



>gb|EMS62988.1| Zinc transporter 2 [Triticum urartu]
Length=321

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  699  TESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMG  520
            T S   +AS+LGDS+LLI ALCFHSVFEGIAIGVA+TKADAWKALWT+ LHK+FAA+AMG
Sbjct  156  TASMLRNASTLGDSILLIAALCFHSVFEGIAIGVAETKADAWKALWTISLHKVFAAVAMG  215

Query  519  IALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVF  340
            IALLRM+PNRPLLSC AY+FAFA+SSPVGV +GI IDATTQG VADW++A+SMG+A G+F
Sbjct  216  IALLRMLPNRPLLSCFAYAFAFAVSSPVGVGVGIAIDATTQGDVADWVFAVSMGLATGIF  275

Query  339  IYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            IYVS+NHLLSKGYKPQ+ V  D P  ++LAV+LG+GVIAVVMIWDT
Sbjct  276  IYVSVNHLLSKGYKPQRPVKADTPLGRWLAVVLGVGVIAVVMIWDT  321



>ref|XP_003532170.1| PREDICTED: zinc transporter 2-like [Glycine max]
Length=349

 Score =   270 bits (689),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 158/198 (80%), Gaps = 6/198 (3%)
 Frame = -3

Query  777  QVNTEGRNFNGIGTTHPQSQLQGCDGTESHFL------HASSLGDSLLLIFALCFHSVFE  616
             V  +G + N + +    SQ Q      +H L      +  S+GD++LLI ALC HSVFE
Sbjct  152  DVQGQGADVNKLSSNGVTSQSQHRSHDANHHLASPALGYVHSVGDTVLLIVALCAHSVFE  211

Query  615  GIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPV  436
            G+AIGVA+TKADAWKALWT+CLHKIFAAIAMGIALLRMIP+RPL+SC  Y+FAFAISSP+
Sbjct  212  GLAIGVAETKADAWKALWTICLHKIFAAIAMGIALLRMIPDRPLVSCAVYAFAFAISSPI  271

Query  435  GVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKF  256
            GVAIGII+DATTQG VADWI+AISMG+ACGVFIYVS+NHLL+KGY P +   VD  +FKF
Sbjct  272  GVAIGIILDATTQGHVADWIFAISMGLACGVFIYVSVNHLLAKGYMPHRPTKVDSAYFKF  331

Query  255  LAVLLGIGVIAVVMIWDT  202
            LAV LG+GVIAVVMIWDT
Sbjct  332  LAVFLGVGVIAVVMIWDT  349



>ref|XP_007205813.1| hypothetical protein PRUPE_ppa010754mg [Prunus persica]
 gb|EMJ07012.1| hypothetical protein PRUPE_ppa010754mg [Prunus persica]
Length=237

 Score =   265 bits (678),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 147/187 (79%), Gaps = 6/187 (3%)
 Frame = -3

Query  765  EGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTK  586
            EGR      T       +  DG    FL  SS GD++LLI ALCFHSVFEGIA+GVADTK
Sbjct  57   EGR------TDAEHDHKEDEDGVSPVFLKTSSFGDTILLIIALCFHSVFEGIAVGVADTK  110

Query  585  ADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDA  406
            ADAW+ LWT+ LHKIFAAIAMGIALLRM+P R LL   AYSFAFA+SSP GV IGI IDA
Sbjct  111  ADAWRNLWTISLHKIFAAIAMGIALLRMLPKRALLVTAAYSFAFAVSSPFGVGIGIAIDA  170

Query  405  TTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVI  226
            TTQG+VADWIYAISMG+ACGVFIYV+INHL++KG+KPQ     D P FKFLAVLLG+GVI
Sbjct  171  TTQGRVADWIYAISMGLACGVFIYVAINHLIAKGFKPQAKSYFDTPAFKFLAVLLGVGVI  230

Query  225  AVVMIWD  205
            AVVMIWD
Sbjct  231  AVVMIWD  237



>ref|XP_008363896.1| PREDICTED: zinc transporter 11-like [Malus domestica]
 ref|XP_008373993.1| PREDICTED: zinc transporter 11-like [Malus domestica]
Length=216

 Score =   265 bits (676),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  678  ASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMI  499
            A+SLGDS+LLI ALCFHSVFEGIAIGVA+TKADAWKALWT+ LHK+FAAIAMGIA L M+
Sbjct  14   ATSLGDSILLIXALCFHSVFEGIAIGVAETKADAWKALWTISLHKVFAAIAMGIAXLXMM  73

Query  498  PNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINH  319
            PN   LSC AY+FAFAISSP+GVAI I+IDATTQG VADWI+AISMG+ACGVFIYV+INH
Sbjct  74   PNXXFLSCAAYAFAFAISSPIGVAIXILIDATTQGAVADWIFAISMGLACGVFIYVAINH  133

Query  318  LLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            LL+KGY+P + V+VDKP +KFLAVLLGIGVIAVVMIWDT
Sbjct  134  LLAKGYRPDRAVSVDKPQYKFLAVLLGIGVIAVVMIWDT  172



>ref|XP_004498136.1| PREDICTED: zinc transporter 2-like isoform X2 [Cicer arietinum]
Length=349

 Score =   269 bits (687),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 159/201 (79%), Gaps = 8/201 (4%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLL-----IFALCFHS  625
            D+E Q   +GR  NG+ T+H   Q         H    SS+GD++ +     I ALC HS
Sbjct  152  DVEGQETDKGRG-NGV-TSHSHYQSSAVTNDTDH-TSNSSIGDTVYIFVYVYIIALCAHS  208

Query  624  VFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAIS  445
            VFEG+AIGV++TKADAWKALWT+CLHKIFAAI+MGIALLRM+PNRPLLSC AY+FAFAIS
Sbjct  209  VFEGLAIGVSETKADAWKALWTICLHKIFAAISMGIALLRMVPNRPLLSCAAYAFAFAIS  268

Query  444  SPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPH  265
            SP+GVAIGI++DATTQG VADW +AISMG+ACGVFIYVSINHL +KGY P K   VD P+
Sbjct  269  SPIGVAIGIVLDATTQGPVADWTFAISMGLACGVFIYVSINHLFAKGYVPHKHTKVDTPY  328

Query  264  FKFLAVLLGIGVIAVVMIWDT  202
             KFLAVLLGIGVIAVVMIWDT
Sbjct  329  MKFLAVLLGIGVIAVVMIWDT  349



>gb|EMT09169.1| Zinc transporter 11 [Aegilops tauschii]
Length=294

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 163/205 (80%), Gaps = 18/205 (9%)
 Frame = -3

Query  765  EGR--NFNGIGTTHPQSQLQGCDG-------TESHFLHASSLGDSLLLIFALCFHSVFEG  613
            EG+  + NG G+   Q+  Q   G       T S   +AS+LGDS+LLI ALCFHSVFEG
Sbjct  91   EGKLSSTNGNGSDQ-QAAEQDAHGPSATGHSTASMLRNASTLGDSILLIAALCFHSVFEG  149

Query  612  IAIGVA--------DTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFA  457
            IAIGVA        +TKADAWKALWT+ LHK+FAA+AMGIALLRM+PNRPLLSC AY+FA
Sbjct  150  IAIGVAALINIGIAETKADAWKALWTISLHKVFAAVAMGIALLRMLPNRPLLSCFAYAFA  209

Query  456  FAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAV  277
            FA+SSP+GVA+GI IDATTQG VADWI+A+SMG+A G+FIYVS+NHLLSKGYKPQ+ VA 
Sbjct  210  FAVSSPIGVAVGIAIDATTQGAVADWIFAVSMGLATGIFIYVSVNHLLSKGYKPQRPVAA  269

Query  276  DKPHFKFLAVLLGIGVIAVVMIWDT  202
            D P  ++LAV+LG+GVIAVVMIWDT
Sbjct  270  DTPLGRWLAVVLGVGVIAVVMIWDT  294



>ref|XP_002891860.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68119.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=327

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = -3

Query  735  THPQSQLQGCDGT-ESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWT  559
            T    +LQG D + ++     +S+GDS+LLI ALCFHSVFEGIAIG+++TK+DAW+ALWT
Sbjct  149  TQNDLELQGEDKSNQTSATTETSIGDSILLIVALCFHSVFEGIAIGISETKSDAWRALWT  208

Query  558  VCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADW  379
            + LHKIFAAIAMGIALLRMIP+RPL S I YSFAFAISSP+GVAIGI+IDATTQG +ADW
Sbjct  209  ITLHKIFAAIAMGIALLRMIPDRPLFSSITYSFAFAISSPIGVAIGIVIDATTQGSIADW  268

Query  378  IYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            I+A+SM +ACGVF+YVS+NHLL+KGY+P K V VD+P +KFLAVL G+ VIA+VMIWDT
Sbjct  269  IFAVSMSLACGVFVYVSVNHLLAKGYRPNKKVHVDEPSYKFLAVLFGVVVIAIVMIWDT  327



>ref|NP_564703.1| putative zinc transporter ZIP2 - like protein [Arabidopsis thaliana]
 sp|Q94EG9.1|ZIP11_ARATH RecName: Full=Zinc transporter 11; AltName: Full=ZRT/IRT-like 
protein 11; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK95314.1|AF410328_1 At1g55910/F14J16_22 [Arabidopsis thaliana]
 gb|AAL67952.1|AF367763_1 putative metal transporter ZIP11 [Arabidopsis thaliana]
 gb|AAL67953.1|AF367764_1 putative metal transporter ZIP11 [Arabidopsis thaliana]
 gb|AAM10357.1| At1g55910/F14J16_22 [Arabidopsis thaliana]
 gb|AEE33318.1| putative zinc transporter ZIP2 - like protein [Arabidopsis thaliana]
Length=326

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 153/179 (85%), Gaps = 1/179 (1%)
 Frame = -3

Query  735  THPQSQLQGCDGT-ESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWT  559
            T    +LQG D + +      +S+GDS+LLI ALCFHSVFEGIAIG+++TK+DAW+ALWT
Sbjct  148  TQNDLELQGEDKSNQRSATTETSIGDSILLIVALCFHSVFEGIAIGISETKSDAWRALWT  207

Query  558  VCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADW  379
            + LHKIFAAIAMGIALLRMIP+RPL S I YSFAFAISSP+GVAIGI+IDATTQG +ADW
Sbjct  208  ITLHKIFAAIAMGIALLRMIPDRPLFSSITYSFAFAISSPIGVAIGIVIDATTQGSIADW  267

Query  378  IYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            I+A+SM +ACGVF+YVS+NHLL+KGY+P K V VD+P +KFLAVL G+ VIA+VMIWDT
Sbjct  268  IFALSMSLACGVFVYVSVNHLLAKGYRPNKKVHVDEPRYKFLAVLFGVVVIAIVMIWDT  326



>ref|XP_003551465.1| PREDICTED: zinc transporter 2-like isoform X1 [Glycine max]
Length=360

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  672  SLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPN  493
            SLGD++LLI ALC HSVFEG+AIGVA+TKA+AWKALWT+CLHKIFAAIAMGIALLRMIPN
Sbjct  204  SLGDTILLIVALCAHSVFEGLAIGVAETKANAWKALWTICLHKIFAAIAMGIALLRMIPN  263

Query  492  RPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLL  313
            RPL+SC AY+FAFAISSP+GVAIGII+DATTQG VADWI+AISMG+ACGVFIYVS+NHLL
Sbjct  264  RPLVSCAAYAFAFAISSPIGVAIGIILDATTQGHVADWIFAISMGLACGVFIYVSVNHLL  323

Query  312  SKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            +KGY P     VD  +FKFLAVLLG+GVIAVVMIWDT
Sbjct  324  AKGYMPHIPTKVDSAYFKFLAVLLGVGVIAVVMIWDT  360



>gb|KHN31651.1| Zinc transporter 2 [Glycine soja]
Length=360

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  672  SLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPN  493
            SLGD++LLI ALC HSVFEG+AIGVA+TKA+AWKALWT+CLHKIFAAIAMGIALLRMIPN
Sbjct  204  SLGDTILLIVALCAHSVFEGLAIGVAETKANAWKALWTICLHKIFAAIAMGIALLRMIPN  263

Query  492  RPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLL  313
            RPL+SC AY+FAFAISSP+GVAIGII+DATTQG VADWI+AISMG+ACGVFIYVS+NHLL
Sbjct  264  RPLVSCAAYAFAFAISSPIGVAIGIILDATTQGHVADWIFAISMGLACGVFIYVSVNHLL  323

Query  312  SKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            +KGY P     VD  +FKFLAVLLG+GVIAVVMIWDT
Sbjct  324  AKGYMPHIPTKVDSAYFKFLAVLLGVGVIAVVMIWDT  360



>emb|CDY42395.1| BnaA08g00190D [Brassica napus]
Length=324

 Score =   266 bits (681),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 150/179 (84%), Gaps = 4/179 (2%)
 Frame = -3

Query  738  TTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWT  559
            T     +LQG +         S +GDS+LLI ALCFHSVFEGIAIG+++TKADAW+ALWT
Sbjct  150  TPSKDVELQGAEKPN----QGSGIGDSILLIVALCFHSVFEGIAIGISETKADAWRALWT  205

Query  558  VCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADW  379
            + LHK+FAAIAMGIALLRMIP+RPL S I YSFAFAISSP+GVAIGI+IDATTQGKVADW
Sbjct  206  ITLHKVFAAIAMGIALLRMIPDRPLFSSIMYSFAFAISSPIGVAIGIVIDATTQGKVADW  265

Query  378  IYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            I+A+SM +ACGVF+YVS+NHLL+KGY P K V VD+P FKFLAVL G+ VIA+VMIWDT
Sbjct  266  IFALSMSLACGVFVYVSVNHLLAKGYLPNKKVNVDEPRFKFLAVLSGVVVIAIVMIWDT  324



>ref|XP_006602141.1| PREDICTED: zinc transporter 2-like isoform X2 [Glycine max]
Length=347

 Score =   267 bits (682),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  672  SLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPN  493
            SLGD++LLI ALC HSVFEG+AIGVA+TKA+AWKALWT+CLHKIFAAIAMGIALLRMIPN
Sbjct  191  SLGDTILLIVALCAHSVFEGLAIGVAETKANAWKALWTICLHKIFAAIAMGIALLRMIPN  250

Query  492  RPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLL  313
            RPL+SC AY+FAFAISSP+GVAIGII+DATTQG VADWI+AISMG+ACGVFIYVS+NHLL
Sbjct  251  RPLVSCAAYAFAFAISSPIGVAIGIILDATTQGHVADWIFAISMGLACGVFIYVSVNHLL  310

Query  312  SKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            +KGY P     VD  +FKFLAVLLG+GVIAVVMIWDT
Sbjct  311  AKGYMPHIPTKVDSAYFKFLAVLLGVGVIAVVMIWDT  347



>ref|XP_006392587.1| hypothetical protein EUTSA_v10011655mg [Eutrema salsugineum]
 gb|ESQ29873.1| hypothetical protein EUTSA_v10011655mg [Eutrema salsugineum]
Length=322

 Score =   266 bits (679),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = -3

Query  744  IGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKAL  565
            I   + ++Q    +  E    + SS+GDS+LLI ALCFHSVFEGIAIG+++TK+DAW+AL
Sbjct  142  ISHVYSKTQSSSSNDLEVQKSNQSSVGDSILLIVALCFHSVFEGIAIGISETKSDAWRAL  201

Query  564  WTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVA  385
            WT+ LHKIFAAIAMGIALLRMIP+RPL S I YSF+FA+SSP+GVAIGI+IDATTQG VA
Sbjct  202  WTITLHKIFAAIAMGIALLRMIPDRPLFSSITYSFSFAVSSPIGVAIGIVIDATTQGSVA  261

Query  384  DWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            DWI+A+SM +ACGVF+YVS+NHLL+KGY P K V VD+P FKFLAVL G+ VIA+VMIWD
Sbjct  262  DWIFAVSMSLACGVFVYVSVNHLLAKGYLPNKKVHVDEPRFKFLAVLFGVVVIAIVMIWD  321

Query  204  T  202
            T
Sbjct  322  T  322



>gb|KFK35551.1| hypothetical protein AALP_AA4G005400 [Arabis alpina]
Length=324

 Score =   266 bits (679),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 150/173 (87%), Gaps = 4/173 (2%)
 Frame = -3

Query  720  QLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKI  541
            +LQG    E    + +S+GDS+LLI ALCFHSVFEGIAIGV++TK+DAW+ALWT+ LHKI
Sbjct  156  ELQG----EHKSKNQTSVGDSILLIVALCFHSVFEGIAIGVSETKSDAWRALWTITLHKI  211

Query  540  FAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISM  361
            FAAIAMGIALLRMIP+RPLLS I YSFAFAISSP+GVAIGI+IDATTQG VADWIYA+SM
Sbjct  212  FAAIAMGIALLRMIPDRPLLSTITYSFAFAISSPIGVAIGIVIDATTQGSVADWIYAVSM  271

Query  360  GIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
             +ACGVF+YVS+NHLL+KGY P K V VD+P +KFLAVL G+ VI +VMIWDT
Sbjct  272  SLACGVFVYVSVNHLLAKGYVPSKKVCVDEPRYKFLAVLFGVVVIGIVMIWDT  324



>ref|XP_010480153.1| PREDICTED: zinc transporter 11 isoform X3 [Camelina sativa]
Length=329

 Score =   266 bits (680),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 153/179 (85%), Gaps = 1/179 (1%)
 Frame = -3

Query  735  THPQSQLQGCDGT-ESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWT  559
            T    +LQG D + ++     +S+GDS+LLI ALCFHSVFEGIAIG+++TK+DAW+ALWT
Sbjct  151  TQKDLELQGEDKSRQTSATSETSVGDSILLIVALCFHSVFEGIAIGISETKSDAWRALWT  210

Query  558  VCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADW  379
            + LHKIFAAIAMGIALLRMIP+RPL S + YSFAFAISSP+GVAIGI+IDATTQG VADW
Sbjct  211  ITLHKIFAAIAMGIALLRMIPDRPLFSSVTYSFAFAISSPIGVAIGIVIDATTQGSVADW  270

Query  378  IYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            I+A+SM +ACGVF+YVS+NHLL+KGY P K V VD+P +KFLAVL G+ VIA+VMIWDT
Sbjct  271  IFAVSMSLACGVFLYVSVNHLLAKGYTPNKKVHVDEPRYKFLAVLFGVVVIAIVMIWDT  329



>ref|XP_009106819.1| PREDICTED: zinc transporter 11 [Brassica rapa]
Length=324

 Score =   266 bits (679),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 150/179 (84%), Gaps = 4/179 (2%)
 Frame = -3

Query  738  TTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWT  559
            T     +LQG    E      S +GDS+LLI ALCFHSVFEGIAIG+++TKADAW+ALWT
Sbjct  150  TPSKDVELQG----EEKPNQGSGIGDSILLIVALCFHSVFEGIAIGISETKADAWRALWT  205

Query  558  VCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADW  379
            + LHK+FAAIAMGIALLRMIP+RPL S I YSFAFAISSP+GVAIGI+IDATTQG+VADW
Sbjct  206  ITLHKVFAAIAMGIALLRMIPDRPLFSSIMYSFAFAISSPIGVAIGIVIDATTQGRVADW  265

Query  378  IYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            I+A+SM +ACGVF+YVS+NHLL+KGY P K V VD+P FKFLAVL G+ VIA+VMIWDT
Sbjct  266  IFAVSMSLACGVFVYVSVNHLLAKGYLPNKKVNVDEPRFKFLAVLSGVVVIAIVMIWDT  324



>ref|XP_007150347.1| hypothetical protein PHAVU_005G146000g [Phaseolus vulgaris]
 gb|ESW22341.1| hypothetical protein PHAVU_005G146000g [Phaseolus vulgaris]
Length=331

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = -3

Query  741  GTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALW  562
            G T PQ      D T    L  SS+GD++LLI ALCFHSVFEGIA+GV+DTKADAW+ LW
Sbjct  153  GGTTPQEPHHAVDTTNPMLLKTSSVGDTILLILALCFHSVFEGIAVGVSDTKADAWRNLW  212

Query  561  TVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVAD  382
            T+ LHKIFAAIAMGIALLRM+P RPL++  AYSFAFAISSP+GV IGI ++ATTQG+ AD
Sbjct  213  TISLHKIFAAIAMGIALLRMLPKRPLITTAAYSFAFAISSPIGVGIGIALNATTQGRTAD  272

Query  381  WIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            W++AISMGIACGVFIYV+INHL+SKG+KPQK    D P F+FLAVL G+ V+AVVMIWD
Sbjct  273  WMFAISMGIACGVFIYVAINHLISKGFKPQKPTRFDTPWFRFLAVLSGVAVMAVVMIWD  331



>ref|XP_010534791.1| PREDICTED: zinc transporter 11 [Tarenaya hassleriana]
Length=339

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 157/196 (80%), Gaps = 8/196 (4%)
 Frame = -3

Query  792  ADLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEG  613
            ADLELQ  T+ +  N                  S    ASS+GDS+LLI ALCFHSVFEG
Sbjct  151  ADLELQGGTQQQKMN--------QNNTSHSHLTSSSHTASSVGDSVLLIIALCFHSVFEG  202

Query  612  IAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVG  433
            IAIGV+D+K+DAW+ALWT+ LHKIFAAIAMGIALLRM+PNRP LS +AYSFAFAISSP+G
Sbjct  203  IAIGVSDSKSDAWRALWTITLHKIFAAIAMGIALLRMMPNRPFLSSVAYSFAFAISSPIG  262

Query  432  VAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFL  253
            VAIGIIIDATTQG VADWI+A+SMG+ACGVF+YVS+NHLL+KGY P K V VD+P +KFL
Sbjct  263  VAIGIIIDATTQGSVADWIFAVSMGLACGVFVYVSVNHLLAKGYSPLKRVYVDQPLYKFL  322

Query  252  AVLLGIGVIAVVMIWD  205
            AV LG+ ++A+VMIWD
Sbjct  323  AVSLGVVLMAIVMIWD  338



>ref|XP_004498135.1| PREDICTED: zinc transporter 2-like isoform X1 [Cicer arietinum]
Length=351

 Score =   265 bits (676),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 158/202 (78%), Gaps = 8/202 (4%)
 Frame = -3

Query  789  DLELQ-VNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLL-----IFALCFH  628
            D+E Q   T+    NG+ T+H   Q         H    SS+GD++ +     I ALC H
Sbjct  152  DVEGQGAETDKGRGNGV-TSHSHYQSSAVTNDTDH-TSNSSIGDTVYIFVYVYIIALCAH  209

Query  627  SVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAI  448
            SVFEG+AIGV++TKADAWKALWT+CLHKIFAAI+MGIALLRM+PNRPLLSC AY+FAFAI
Sbjct  210  SVFEGLAIGVSETKADAWKALWTICLHKIFAAISMGIALLRMVPNRPLLSCAAYAFAFAI  269

Query  447  SSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKP  268
            SSP+GVAIGI++DATTQG VADW +AISMG+ACGVFIYVSINHL +KGY P K   VD P
Sbjct  270  SSPIGVAIGIVLDATTQGPVADWTFAISMGLACGVFIYVSINHLFAKGYVPHKHTKVDTP  329

Query  267  HFKFLAVLLGIGVIAVVMIWDT  202
            + KFLAVLLGIGVIAVVMIWDT
Sbjct  330  YMKFLAVLLGIGVIAVVMIWDT  351



>gb|AAR08417.1| metal transport protein [Medicago truncatula]
 gb|AFK36412.1| unknown [Medicago truncatula]
 gb|KEH34046.1| ZIP metal ion transporter family protein [Medicago truncatula]
Length=350

 Score =   265 bits (676),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 163/203 (80%), Gaps = 10/203 (5%)
 Frame = -3

Query  792  ADLELQVNTEGRNFNGIGTTHPQSQLQGCDGT-ESHFLHASSLGDSLLL-----IFALCF  631
            AD+E Q   +GR+ NG+ +   QSQ Q   GT ++    +SS+GD++ +     I ALC 
Sbjct  152  ADVEGQGVDKGRS-NGVNS---QSQYQSSAGTNDADLAPSSSIGDTVYIFIYVYIIALCA  207

Query  630  HSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFA  451
            HSVFEG+AIGV+ TKADAWKALWT+CLHKIFAAIAMGIALLRM+PNRPLLSC AY+FAFA
Sbjct  208  HSVFEGLAIGVSVTKADAWKALWTICLHKIFAAIAMGIALLRMVPNRPLLSCAAYAFAFA  267

Query  450  ISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDK  271
            ISSP+GVAIGI++D+TTQG VADWI+AISMG+ACGVFIYVSINHL +KGY P K    D 
Sbjct  268  ISSPIGVAIGIVLDSTTQGHVADWIFAISMGLACGVFIYVSINHLFAKGYVPHKHSKADS  327

Query  270  PHFKFLAVLLGIGVIAVVMIWDT  202
             + KFLAV LGIGVIAVVMIWDT
Sbjct  328  AYMKFLAVSLGIGVIAVVMIWDT  350



>emb|CDY10522.1| BnaC03g70920D [Brassica napus]
Length=324

 Score =   263 bits (673),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 149/179 (83%), Gaps = 4/179 (2%)
 Frame = -3

Query  738  TTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWT  559
            T     +LQG    E      S +GDS+LLI ALCFHSVFEGIAIG+++TKADAW+ALWT
Sbjct  150  TPSKDVELQG----EEKPNQGSGIGDSILLIVALCFHSVFEGIAIGISETKADAWRALWT  205

Query  558  VCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADW  379
            + LHK+FAAIAMGIALLRMIP+RPLLS I YSFAFAISSP+GVAIGI+IDATTQG VADW
Sbjct  206  ITLHKVFAAIAMGIALLRMIPDRPLLSSIMYSFAFAISSPIGVAIGIVIDATTQGTVADW  265

Query  378  IYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            I+A+SM  ACGVF+YVS+NHLL+KGY P + V VD+P FKFLAVL G+ VIA+VMIWDT
Sbjct  266  IFAVSMSFACGVFVYVSVNHLLAKGYLPNQKVNVDEPRFKFLAVLSGVVVIAIVMIWDT  324



>ref|XP_006650191.1| PREDICTED: zinc transporter 2-like [Oryza brachyantha]
Length=369

 Score =   265 bits (677),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -3

Query  693  SHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIA  514
            S   +AS+LGDS+LLI ALCFHSVFEGIAIGVA+TKADAWKALWT+ LHKIFAAIAMGIA
Sbjct  206  SMLRNASTLGDSVLLIAALCFHSVFEGIAIGVAETKADAWKALWTISLHKIFAAIAMGIA  265

Query  513  LLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIY  334
            LLRM+PNRP LSC  Y+FAFA+SSPVGVAIGI+IDATTQG VADWI+++SMGIA G+FIY
Sbjct  266  LLRMLPNRPFLSCFGYAFAFAVSSPVGVAIGIVIDATTQGPVADWIFSVSMGIATGIFIY  325

Query  333  VSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            VSINHLL+KGY+PQ  VA D P  + LAV+LG+ VIAVVMIWDT
Sbjct  326  VSINHLLNKGYRPQSPVAADTPAGRLLAVVLGVAVIAVVMIWDT  369



>ref|XP_009376780.1| PREDICTED: zinc transporter 11-like [Pyrus x bretschneideri]
Length=343

 Score =   264 bits (675),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 163/198 (82%), Gaps = 10/198 (5%)
 Frame = -3

Query  792  ADLELQVNTEGRNFNGIGTT-HPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFE  616
            ADL++Q NTE       GT  H Q+ +            A+SLGDS+LLI ALCFHSVFE
Sbjct  155  ADLQVQGNTEQGKGGQYGTQGHNQNVVVAS---------ATSLGDSILLIVALCFHSVFE  205

Query  615  GIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPV  436
            GIAIG+A+TKADAWKALWT+ LHK+FAAIAMGIALLRM+PNRP LSC A +FAFAISSP+
Sbjct  206  GIAIGIAETKADAWKALWTISLHKVFAAIAMGIALLRMMPNRPFLSCAACAFAFAISSPI  265

Query  435  GVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKF  256
            GVAIGI+IDATTQG VADWI+AISM +ACGVFIY++INHLL+KGY P K V+VDKP +KF
Sbjct  266  GVAIGILIDATTQGAVADWIFAISMALACGVFIYIAINHLLAKGYAPNKAVSVDKPQYKF  325

Query  255  LAVLLGIGVIAVVMIWDT  202
            LAVLLGIGVIAVVMIWDT
Sbjct  326  LAVLLGIGVIAVVMIWDT  343



>gb|AAF79317.1|AC002304_10 F14J16.16 [Arabidopsis thaliana]
Length=354

 Score =   264 bits (675),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  675  SSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIP  496
            +S+GDS+LLI ALCFHSVFEGIAIG+++TK+DAW+ALWT+ LHKIFAAIAMGIALLRMIP
Sbjct  197  TSIGDSILLIVALCFHSVFEGIAIGISETKSDAWRALWTITLHKIFAAIAMGIALLRMIP  256

Query  495  NRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHL  316
            +RPL S I YSFAFAISSP+GVAIGI+IDATTQG +ADWI+A+SM +ACGVF+YVS+NHL
Sbjct  257  DRPLFSSITYSFAFAISSPIGVAIGIVIDATTQGSIADWIFALSMSLACGVFVYVSVNHL  316

Query  315  LSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            L+KGY+P K V VD+P +KFLAVL G+ VIA+VMIWDT
Sbjct  317  LAKGYRPNKKVHVDEPRYKFLAVLFGVVVIAIVMIWDT  354



>ref|XP_010480151.1| PREDICTED: zinc transporter 11 isoform X1 [Camelina sativa]
 ref|XP_010480152.1| PREDICTED: zinc transporter 11 isoform X2 [Camelina sativa]
Length=330

 Score =   263 bits (673),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 152/180 (84%), Gaps = 2/180 (1%)
 Frame = -3

Query  735  THPQSQLQGCD--GTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALW  562
            T    +LQG +    ++     +S+GDS+LLI ALCFHSVFEGIAIG+++TK+DAW+ALW
Sbjct  151  TQKDLELQGGEDKSRQTSATSETSVGDSILLIVALCFHSVFEGIAIGISETKSDAWRALW  210

Query  561  TVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVAD  382
            T+ LHKIFAAIAMGIALLRMIP+RPL S + YSFAFAISSP+GVAIGI+IDATTQG VAD
Sbjct  211  TITLHKIFAAIAMGIALLRMIPDRPLFSSVTYSFAFAISSPIGVAIGIVIDATTQGSVAD  270

Query  381  WIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            WI+A+SM +ACGVF+YVS+NHLL+KGY P K V VD+P +KFLAVL G+ VIA+VMIWDT
Sbjct  271  WIFAVSMSLACGVFLYVSVNHLLAKGYTPNKKVHVDEPRYKFLAVLFGVVVIAIVMIWDT  330



>ref|XP_010501220.1| PREDICTED: zinc transporter 11-like [Camelina sativa]
Length=330

 Score =   263 bits (672),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 152/180 (84%), Gaps = 2/180 (1%)
 Frame = -3

Query  735  THPQSQLQGCD--GTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALW  562
            T    +LQG +    ++     +S+GDS+LLI ALCFHSVFEGIAIG+++TK+DAW+ALW
Sbjct  151  TQRDLELQGGEDKSRQTSATSETSVGDSILLIVALCFHSVFEGIAIGISETKSDAWRALW  210

Query  561  TVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVAD  382
            T+ LHKIFAAIAMGIALLRMIP+RPL S + YSFAFAISSP+GVAIGI+IDATTQG VAD
Sbjct  211  TITLHKIFAAIAMGIALLRMIPDRPLFSSVTYSFAFAISSPIGVAIGIVIDATTQGSVAD  270

Query  381  WIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            W++A+SM +ACGVF+YVS+NHLL+KGY P K V VD+P +KFLAVL GI VIA+VMIWDT
Sbjct  271  WLFAVSMSLACGVFVYVSVNHLLAKGYTPNKKVHVDEPRYKFLAVLFGIVVIAIVMIWDT  330



>gb|ABK95071.1| unknown [Populus trichocarpa]
Length=354

 Score =   264 bits (674),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 160/200 (80%), Gaps = 9/200 (5%)
 Frame = -3

Query  789  DLELQVNT-EGRNFNGIGTTHPQSQLQGCDGT-----ESHFLHASSLGDSLLLIFALCFH  628
            DLELQ    +G+  +   T+  QS  Q  +GT     +S    ASS GD++LLIFALCFH
Sbjct  152  DLELQGGVLQGKRSH---TSSFQSHFQMHNGTDLASAQSTLPTASSFGDTILLIFALCFH  208

Query  627  SVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAI  448
            SVFEGIAIGV  TKA+AW+ALWT+ LHKIFAAIAMGI+LLR IP+ P +SC+AY+F FAI
Sbjct  209  SVFEGIAIGVEKTKANAWRALWTISLHKIFAAIAMGISLLRTIPDHPFVSCVAYAFVFAI  268

Query  447  SSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKP  268
            SSP+GVAIGIIID TTQG VADWI+AISMG+ACGVFIYVSINHL +KGY PQ++V VD P
Sbjct  269  SSPIGVAIGIIIDTTTQGLVADWIFAISMGLACGVFIYVSINHLSTKGYLPQRSVLVDTP  328

Query  267  HFKFLAVLLGIGVIAVVMIW  208
             +KFLAV LGIGV+AVVMIW
Sbjct  329  LYKFLAVSLGIGVVAVVMIW  348



>ref|XP_006369999.1| hypothetical protein POPTR_0001s37490g [Populus trichocarpa]
 gb|ABK94968.1| unknown [Populus trichocarpa]
 gb|ERP66568.1| hypothetical protein POPTR_0001s37490g [Populus trichocarpa]
Length=350

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 160/200 (80%), Gaps = 9/200 (5%)
 Frame = -3

Query  789  DLELQVNT-EGRNFNGIGTTHPQSQLQGCDGTE-----SHFLHASSLGDSLLLIFALCFH  628
            DLELQ    +G+  +   T+  QS  Q  +GT+     S    ASS GD++LLIFALCFH
Sbjct  148  DLELQGGVLQGKRSH---TSSFQSHFQMHNGTDIASAKSTLPTASSFGDTILLIFALCFH  204

Query  627  SVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAI  448
            SVFEGIAIGV  TKA+AW+ALWT+ LHKIFAAIAMGI+LLR IP+ P +SC+AY+F FAI
Sbjct  205  SVFEGIAIGVEKTKANAWRALWTISLHKIFAAIAMGISLLRTIPDHPFVSCVAYAFVFAI  264

Query  447  SSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKP  268
            SSP+GVAIGIIID TTQG VADWI+AISMG+ACGVFIYVSINHL +KGY PQ++V VD P
Sbjct  265  SSPIGVAIGIIIDTTTQGLVADWIFAISMGLACGVFIYVSINHLSTKGYLPQRSVLVDTP  324

Query  267  HFKFLAVLLGIGVIAVVMIW  208
             +KFLAV LGIGV+AVVMIW
Sbjct  325  LYKFLAVSLGIGVVAVVMIW  344



>ref|XP_010106522.1| Zinc transporter 2 [Morus notabilis]
 gb|EXC10698.1| Zinc transporter 2 [Morus notabilis]
Length=331

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 153/196 (78%), Gaps = 7/196 (4%)
 Frame = -3

Query  792  ADLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEG  613
            +D E +V TE       GT+    +  G D     F+  +SLGD++LLI ALCFHSVFEG
Sbjct  143  SDREARVETEE------GTSSDHEKAAGTD-VSPLFMRTTSLGDTILLIHALCFHSVFEG  195

Query  612  IAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVG  433
            IAIG+AD KA+AW+ LWT+ LHKIFAAIAMGIALLRM+P RPL    AYSFAFAISSPVG
Sbjct  196  IAIGIADNKAEAWRNLWTISLHKIFAAIAMGIALLRMLPKRPLQVTAAYSFAFAISSPVG  255

Query  432  VAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFL  253
            V IGI ID+TTQG VADWIYAISMG+ACG+FIYV+INHL++KG+KPQ     D P FKFL
Sbjct  256  VGIGIAIDSTTQGAVADWIYAISMGLACGIFIYVAINHLIAKGFKPQSKCHFDTPFFKFL  315

Query  252  AVLLGIGVIAVVMIWD  205
            AVLLG+GVIAVVMIWD
Sbjct  316  AVLLGVGVIAVVMIWD  331



>ref|XP_008222239.1| PREDICTED: LOW QUALITY PROTEIN: zinc transporter 2 [Prunus mume]
Length=339

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = -3

Query  705  DGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIA  526
            DG    FL  SS GD++LLI +LCFHSVFEGIA+GVADTKADAW+ LWT+ LHKIFAA+A
Sbjct  173  DGVSPVFLKTSSFGDTILLILSLCFHSVFEGIAVGVADTKADAWRNLWTISLHKIFAAVA  232

Query  525  MGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACG  346
            MGIALLRM+P R LL   AYSFAFA+SSP+GV IGI IDATTQG+VADWIYAISMG+ACG
Sbjct  233  MGIALLRMLPKRALLVTAAYSFAFAVSSPIGVGIGIAIDATTQGRVADWIYAISMGLACG  292

Query  345  VFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            VFIYV+INHL++KG+KPQ     D P FKFLAVLLG+GVIAVVMIWD
Sbjct  293  VFIYVAINHLIAKGFKPQAKSYFDTPAFKFLAVLLGVGVIAVVMIWD  339



>ref|XP_004150296.1| PREDICTED: zinc transporter 11 [Cucumis sativus]
 gb|KGN44071.1| hypothetical protein Csa_7G162550 [Cucumis sativus]
Length=334

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 156/187 (83%), Gaps = 7/187 (4%)
 Frame = -3

Query  741  GTTHPQSQLQGCDGTESHFLHA-------SSLGDSLLLIFALCFHSVFEGIAIGVADTKA  583
            G     S+ Q  +G+  H  H         S GDS+LLI ALCFHSVFEGIAIGVA+TKA
Sbjct  148  GAATSPSKFQVQNGSNGHHTHPHQALTTMGSFGDSILLIVALCFHSVFEGIAIGVAETKA  207

Query  582  DAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDAT  403
            DAWKALWT+ LHK+FAAIAMGIALLRMIPNRPLLS  AYSFAFAISSP+G+AIGIIIDAT
Sbjct  208  DAWKALWTISLHKVFAAIAMGIALLRMIPNRPLLSSAAYSFAFAISSPIGIAIGIIIDAT  267

Query  402  TQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIA  223
            TQG VADWI+AISMG+ACGVFIYVSINHLLSKGY P+ +V VD P++KFLAVLLGIGVIA
Sbjct  268  TQGAVADWIFAISMGLACGVFIYVSINHLLSKGYTPRDSVLVDNPNYKFLAVLLGIGVIA  327

Query  222  VVMIWDT  202
            +VMIWDT
Sbjct  328  IVMIWDT  334



>ref|XP_008363887.1| PREDICTED: zinc transporter 11-like isoform X3 [Malus domestica]
Length=343

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 162/197 (82%), Gaps = 8/197 (4%)
 Frame = -3

Query  792  ADLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEG  613
            ADL++Q N E       GT   QS  Q      +    A+SLGD++LLI ALCFHSVFEG
Sbjct  155  ADLQVQGNIEQGKGGQYGT---QSHTQ-----NTVVASATSLGDNILLIVALCFHSVFEG  206

Query  612  IAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVG  433
            IAIGVA+TKADAWKALWT+ LHK+FAAIAMGIALLRM+PNRP LSC A +FAFAISSP+G
Sbjct  207  IAIGVAETKADAWKALWTISLHKVFAAIAMGIALLRMMPNRPFLSCAACAFAFAISSPIG  266

Query  432  VAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFL  253
            VAIGI+IDATTQG VADWI+AISMG+ACGVFIYV+INHLL+KGY P K V+VDKP +K L
Sbjct  267  VAIGILIDATTQGAVADWIFAISMGLACGVFIYVAINHLLAKGYAPDKAVSVDKPQYKXL  326

Query  252  AVLLGIGVIAVVMIWDT  202
            AVLLGIGVIAVVMIWDT
Sbjct  327  AVLLGIGVIAVVMIWDT  343



>gb|EEE59243.1| hypothetical protein OsJ_11245 [Oryza sativa Japonica Group]
Length=327

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  693  SHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIA  514
            S   +AS+LGDS+LLI ALCFHSVFEGIAIGVA+TKADAWKALWT+ LHKIFAAIAMGIA
Sbjct  164  SMLRNASTLGDSVLLIAALCFHSVFEGIAIGVAETKADAWKALWTISLHKIFAAIAMGIA  223

Query  513  LLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIY  334
            LLRM+P+RP LSC  Y+FAFA+SSPVGV IGI+IDATTQG+VADWI+A+SMG+A G+FIY
Sbjct  224  LLRMLPDRPFLSCFGYAFAFAVSSPVGVGIGIVIDATTQGRVADWIFAVSMGLATGIFIY  283

Query  333  VSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            VSINHLLSKGY P + VA D P  + LAV+LG+ VIAVVMIWDT
Sbjct  284  VSINHLLSKGYTPLRPVAADTPAGRLLAVVLGVAVIAVVMIWDT  327



>ref|XP_010462455.1| PREDICTED: zinc transporter 11-like [Camelina sativa]
Length=330

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 152/180 (84%), Gaps = 2/180 (1%)
 Frame = -3

Query  735  THPQSQLQGCD--GTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALW  562
            T    +LQG +    ++     +S+GDS+LLI ALCFHSVFEGIAIG+++TK+DAW+ALW
Sbjct  151  TQRDLELQGGEDKSRQTSATTETSVGDSILLIVALCFHSVFEGIAIGISETKSDAWRALW  210

Query  561  TVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVAD  382
            T+ LHKIFAAIAMGIALLRMIP+RPL S + YSFAFAISSP+GVAIGI+IDATTQG VAD
Sbjct  211  TITLHKIFAAIAMGIALLRMIPDRPLFSSVTYSFAFAISSPIGVAIGIVIDATTQGSVAD  270

Query  381  WIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            WI+A+SM +ACGVF+YVS+NHLL+KGY P K V VD+P +KFLAVL G+ VIA+VMIWDT
Sbjct  271  WIFAVSMSLACGVFVYVSVNHLLAKGYTPNKKVHVDEPPYKFLAVLFGVVVIAIVMIWDT  330



>ref|XP_012066988.1| PREDICTED: zinc transporter 2 [Jatropha curcas]
 gb|KDP42230.1| hypothetical protein JCGZ_02960 [Jatropha curcas]
Length=336

 Score =   261 bits (668),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 145/172 (84%), Gaps = 5/172 (3%)
 Frame = -3

Query  705  DGTESH-----FLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKI  541
            + TE H     FL  +S+GD++LLI ALCFHSVFEGIA+GVADTK DAW+ LWT+ LHKI
Sbjct  165  EATEVHELNPVFLKTTSIGDTILLILALCFHSVFEGIAVGVADTKTDAWRNLWTISLHKI  224

Query  540  FAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISM  361
            FAAI MGIALLRM+P RPL   +AYSFAFAISSP+GV IGI IDATTQG VADWIYAISM
Sbjct  225  FAAIGMGIALLRMLPKRPLTLTMAYSFAFAISSPIGVGIGIAIDATTQGPVADWIYAISM  284

Query  360  GIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            G+ACG+FIYV+INHL++KG+KPQ  +  D P FKFLAVLLG+GVIAVVMIWD
Sbjct  285  GLACGIFIYVAINHLIAKGFKPQANLFFDTPFFKFLAVLLGVGVIAVVMIWD  336



>gb|ABK25966.1| unknown [Picea sitchensis]
Length=358

 Score =   262 bits (669),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 149/180 (83%), Gaps = 3/180 (2%)
 Frame = -3

Query  735  THPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTV  556
            T P S  +      +  +  +S+GDSLLLI ALCFHSVFEGIAIGVA TKADAW+ALWTV
Sbjct  179  TPPHSNGESSMVKAASLVKKTSMGDSLLLILALCFHSVFEGIAIGVAATKADAWRALWTV  238

Query  555  CLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWI  376
            CLHKIFAAIAMGIALLR+IPNRP LSC AY+FAFAISSPVGVAIGI+IDATTQG VADWI
Sbjct  239  CLHKIFAAIAMGIALLRIIPNRPFLSCAAYAFAFAISSPVGVAIGILIDATTQGHVADWI  298

Query  375  YAISMGIACGVFIYVSINHLLSKG--YKPQ-KTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            YAISMG ACGVF+YV+INHLL KG  Y P+ + +  DKP FK+LAVL G G+IAVVMIWD
Sbjct  299  YAISMGFACGVFVYVAINHLLLKGLMYNPKNRAIPFDKPIFKYLAVLTGAGLIAVVMIWD  358



>ref|XP_007016363.1| ZRT/IRT-like protein 2 isoform 2, partial [Theobroma cacao]
 gb|EOY33982.1| ZRT/IRT-like protein 2 isoform 2, partial [Theobroma cacao]
Length=327

 Score =   261 bits (667),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 150/195 (77%), Gaps = 5/195 (3%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGI  610
            + E +V  E     G       S+  G D     FL  +SLGD++LLI ALCFHSVFEGI
Sbjct  138  EREARVEME----EGRTADEEHSKDVGMDANPV-FLRTTSLGDTVLLILALCFHSVFEGI  192

Query  609  AIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGV  430
            A+GVADTKADAW+ LWT+ LHKIFAAIAMGIALLRMIP RP L    YSFAFA+SSP+GV
Sbjct  193  AVGVADTKADAWRNLWTISLHKIFAAIAMGIALLRMIPKRPFLLTCGYSFAFAVSSPIGV  252

Query  429  AIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLA  250
             IGI IDATTQG VADWIYAISMG+ACGVFIYV+INHL++KG+KPQ     D P+FKFLA
Sbjct  253  GIGIAIDATTQGHVADWIYAISMGLACGVFIYVAINHLIAKGFKPQAKCYFDTPYFKFLA  312

Query  249  VLLGIGVIAVVMIWD  205
            VLLG+ VIAVVMIWD
Sbjct  313  VLLGVAVIAVVMIWD  327



>ref|XP_007016362.1| ZRT/IRT-like protein 2 isoform 1 [Theobroma cacao]
 gb|EOY33981.1| ZRT/IRT-like protein 2 isoform 1 [Theobroma cacao]
Length=334

 Score =   261 bits (667),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 153/196 (78%), Gaps = 9/196 (5%)
 Frame = -3

Query  792  ADLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEG  613
            A +E++   EGR  +        S+  G D     FL  +SLGD++LLI ALCFHSVFEG
Sbjct  148  ARVEME---EGRTAD-----EEHSKDVGMDANPV-FLRTTSLGDTVLLILALCFHSVFEG  198

Query  612  IAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVG  433
            IA+GVADTKADAW+ LWT+ LHKIFAAIAMGIALLRMIP RP L    YSFAFA+SSP+G
Sbjct  199  IAVGVADTKADAWRNLWTISLHKIFAAIAMGIALLRMIPKRPFLLTCGYSFAFAVSSPIG  258

Query  432  VAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFL  253
            V IGI IDATTQG VADWIYAISMG+ACGVFIYV+INHL++KG+KPQ     D P+FKFL
Sbjct  259  VGIGIAIDATTQGHVADWIYAISMGLACGVFIYVAINHLIAKGFKPQAKCYFDTPYFKFL  318

Query  252  AVLLGIGVIAVVMIWD  205
            AVLLG+ VIAVVMIWD
Sbjct  319  AVLLGVAVIAVVMIWD  334



>ref|NP_001050351.1| Os03g0411800 [Oryza sativa Japonica Group]
 sp|Q852F6.1|ZIP2_ORYSJ RecName: Full=Zinc transporter 2; AltName: Full=ZRT/IRT-like 
protein 2; Short=OsZIP2; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAO37513.1| putative zinc transporter [Oryza sativa Japonica Group]
 gb|AAP59426.1| zinc transporter [Oryza sativa Japonica Group]
 gb|ABF96572.1| zinc transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12265.1| Os03g0411800 [Oryza sativa Japonica Group]
 gb|EAY90433.1| hypothetical protein OsI_12019 [Oryza sativa Indica Group]
Length=358

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  693  SHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIA  514
            S   +AS+LGDS+LLI ALCFHSVFEGIAIGVA+TKADAWKALWT+ LHKIFAAIAMGIA
Sbjct  195  SMLRNASTLGDSVLLIAALCFHSVFEGIAIGVAETKADAWKALWTISLHKIFAAIAMGIA  254

Query  513  LLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIY  334
            LLRM+P+RP LSC  Y+FAFA+SSPVGV IGI+IDATTQG+VADWI+A+SMG+A G+FIY
Sbjct  255  LLRMLPDRPFLSCFGYAFAFAVSSPVGVGIGIVIDATTQGRVADWIFAVSMGLATGIFIY  314

Query  333  VSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            VSINHLLSKGY P + VA D P  + LAV+LG+ VIAVVMIWDT
Sbjct  315  VSINHLLSKGYTPLRPVAADTPAGRLLAVVLGVAVIAVVMIWDT  358



>ref|XP_010096108.1| Zinc transporter 11 [Morus notabilis]
 gb|EXB63273.1| Zinc transporter 11 [Morus notabilis]
Length=346

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 162/202 (80%), Gaps = 8/202 (4%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASS------LGDSLLLIFALCFH  628
            D+E+  + E       G T PQS  Q  D T+ H   A+S      LGDS+LLI ALCFH
Sbjct  147  DVEVGGSIEKGKAGQNGGT-PQSHFQSHD-TKPHANPAASVATVGSLGDSILLIVALCFH  204

Query  627  SVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAI  448
            S+FEGIAIGVA+TKADAWKALWT+ LHKIFAAIAMGIALLRMIPNRPLLSC AY+FAFAI
Sbjct  205  SLFEGIAIGVAETKADAWKALWTISLHKIFAAIAMGIALLRMIPNRPLLSCAAYAFAFAI  264

Query  447  SSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKP  268
            SSP+GV IGIIIDATTQG VADWI+AISMG+ACGVFIYVSINHLL+ GY PQKTV VD P
Sbjct  265  SSPIGVVIGIIIDATTQGPVADWIFAISMGLACGVFIYVSINHLLAMGYTPQKTVYVDTP  324

Query  267  HFKFLAVLLGIGVIAVVMIWDT  202
              KF AVL GIGVIAVVMIWDT
Sbjct  325  FLKFSAVLFGIGVIAVVMIWDT  346



>ref|XP_008345017.1| PREDICTED: zinc transporter 11-like [Malus domestica]
Length=343

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 161/198 (81%), Gaps = 10/198 (5%)
 Frame = -3

Query  792  ADLELQVNTEGRNFNGIGT-THPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFE  616
            ADL+++ N E       GT +H Q+ +            A+SLGD +LLI ALCFHSVFE
Sbjct  155  ADLQVRGNIEQGKGGQYGTQSHTQNTVVAS---------ATSLGDXILLIVALCFHSVFE  205

Query  615  GIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPV  436
            GIAIGVA+TKADAWKALWT+ LHK+FAAIAMGIALLRM+PNRP LSC A +FAFAISSP+
Sbjct  206  GIAIGVAETKADAWKALWTISLHKVFAAIAMGIALLRMMPNRPFLSCAACAFAFAISSPI  265

Query  435  GVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKF  256
            GVAIGI+IDATTQG VADWI+AISMG+ACGVFIYV+INHL  KGY P K V+VDKP +KF
Sbjct  266  GVAIGILIDATTQGAVADWIFAISMGLACGVFIYVAINHLXXKGYAPDKAVSVDKPQYKF  325

Query  255  LAVLLGIGVIAVVMIWDT  202
            LAVLLGIGVIAVVMIWDT
Sbjct  326  LAVLLGIGVIAVVMIWDT  343



>ref|XP_008363879.1| PREDICTED: zinc transporter 11-like isoform X2 [Malus domestica]
Length=343

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 163/198 (82%), Gaps = 10/198 (5%)
 Frame = -3

Query  792  ADLELQVNTEGRNFNGIGT-THPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFE  616
            ADL+++ N E       GT +H Q+ +            A+SLGD++LLI ALCFHSVFE
Sbjct  155  ADLQVRGNIEQGKGGQYGTQSHTQNTVVAS---------ATSLGDNILLIVALCFHSVFE  205

Query  615  GIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPV  436
            GIAIGVA+TKADAWKALWT+ LHK+FAAIAMGIALLRM+PNRP LSC A +FAFAISSP+
Sbjct  206  GIAIGVAETKADAWKALWTISLHKVFAAIAMGIALLRMMPNRPFLSCAACAFAFAISSPI  265

Query  435  GVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKF  256
            GVAIGI+IDATTQG VADWI+AISMG+ACGVFIYV+INHLL+KGY P K V+VDKP +K 
Sbjct  266  GVAIGILIDATTQGAVADWIFAISMGLACGVFIYVAINHLLAKGYAPDKAVSVDKPQYKX  325

Query  255  LAVLLGIGVIAVVMIWDT  202
            LAVLLGIGVIAVVMIWDT
Sbjct  326  LAVLLGIGVIAVVMIWDT  343



>gb|AFK49261.1| unknown [Lotus japonicus]
Length=344

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 149/181 (82%), Gaps = 3/181 (2%)
 Frame = -3

Query  738  TTHPQSQLQ--GCDGTESH-FLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKA  568
            TT  + + +    + T +H F+  SSLGD++LLI ALCFHS+FEGIA+GV+ TKA+AW+ 
Sbjct  164  TTQEREEDREFSVEKTTNHAFMKTSSLGDTILLILALCFHSIFEGIAVGVSGTKAEAWRN  223

Query  567  LWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKV  388
            LWT+ LHKIFAA+AMGIALLRMIP RPLL   AYSFAFAISSP+GV IGI IDATTQG+ 
Sbjct  224  LWTISLHKIFAAVAMGIALLRMIPKRPLLITAAYSFAFAISSPIGVGIGIAIDATTQGRT  283

Query  387  ADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIW  208
            ADW YAISMGIACGVF+YV+INHL+SKG+KP++    D P FKFLAVLLG+ VIAVVMIW
Sbjct  284  ADWTYAISMGIACGVFVYVAINHLISKGFKPERKSRFDTPWFKFLAVLLGVAVIAVVMIW  343

Query  207  D  205
            D
Sbjct  344  D  344



>gb|KJB55840.1| hypothetical protein B456_009G097300 [Gossypium raimondii]
Length=338

 Score =   258 bits (660),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 146/195 (75%), Gaps = 4/195 (2%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGI  610
            ++ +QV  E     G       S+  G D     F   +S GD+LLLI ALCFHS+FEGI
Sbjct  148  EVRVQVQVE----EGRTADDEHSKDVGMDSNNPVFFKTTSFGDTLLLILALCFHSIFEGI  203

Query  609  AIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGV  430
            AIGVA TK DAW+ LWT+ LHKIFAAIAMGIALLRMIP RP L    YSFAFA+SSP+GV
Sbjct  204  AIGVAGTKGDAWRNLWTISLHKIFAAIAMGIALLRMIPKRPFLLTCGYSFAFAVSSPIGV  263

Query  429  AIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLA  250
             IGI IDATTQG VADWIYAISMG+ACGVFIYV+INHL++KG+KPQ     D P FKFLA
Sbjct  264  GIGIAIDATTQGHVADWIYAISMGLACGVFIYVAINHLIAKGFKPQAKCYFDTPSFKFLA  323

Query  249  VLLGIGVIAVVMIWD  205
            VLLG+ VIAVVMIWD
Sbjct  324  VLLGVAVIAVVMIWD  338



>gb|KHG12249.1| Zinc transporter 1 [Gossypium arboreum]
Length=340

 Score =   259 bits (661),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 140/174 (80%), Gaps = 0/174 (0%)
 Frame = -3

Query  726  QSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLH  547
             S+  G D     F   SS GD+LLLI ALCFHS+FEGIAIGVA TK DAW+ LWT+ LH
Sbjct  167  HSKDVGMDSNNPVFFKTSSFGDTLLLILALCFHSIFEGIAIGVAGTKGDAWRNLWTISLH  226

Query  546  KIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAI  367
            KIFAAIAMGIALLRMIP RP L    YSFAFA+SSP+GV IGI IDATTQG VADWIYAI
Sbjct  227  KIFAAIAMGIALLRMIPKRPFLLTCGYSFAFAVSSPIGVGIGIAIDATTQGHVADWIYAI  286

Query  366  SMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            SMG+ACGVFIYV+INHL++KG+KPQ    +D P FKFLAVLLG+ VIAVVMIWD
Sbjct  287  SMGLACGVFIYVAINHLIAKGFKPQAKCYIDTPSFKFLAVLLGVAVIAVVMIWD  340



>gb|EYU27430.1| hypothetical protein MIMGU_mgv1a009274mg [Erythranthe guttata]
Length=347

 Score =   259 bits (661),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 165/202 (82%), Gaps = 9/202 (4%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIG---TTHPQS---QLQG-CDGTESHFLHASSLGDSLLLIFALCF  631
            DLELQ N      NG      + PQ    Q QG C  T++    A+SLGDS+LLI ALCF
Sbjct  148  DLELQENAHNTAGNGNRLSLDSKPQENAVQEQGQC--TKASLTTATSLGDSILLIGALCF  205

Query  630  HSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFA  451
            HSVFEGIAIGVA+T++DAW+ LWTV LHKIFAAIAMGIALLR+IP+RPLLS  AY+FAFA
Sbjct  206  HSVFEGIAIGVAETESDAWRTLWTVSLHKIFAAIAMGIALLRIIPDRPLLSSAAYAFAFA  265

Query  450  ISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDK  271
            ISSP+GVAIGI+IDATTQG VADWIYAISMG+ACGVFI+VSINHLLSKGYKP+K V+ D 
Sbjct  266  ISSPIGVAIGIVIDATTQGDVADWIYAISMGLACGVFIFVSINHLLSKGYKPRKIVSYDT  325

Query  270  PHFKFLAVLLGIGVIAVVMIWD  205
              ++FLAVLLG+GVIAVVMIWD
Sbjct  326  SLYRFLAVLLGVGVIAVVMIWD  347



>ref|XP_002520540.1| zinc transporter, putative [Ricinus communis]
 gb|EEF41953.1| zinc transporter, putative [Ricinus communis]
Length=335

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = -3

Query  741  GTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALW  562
            G   P+   Q         L  SSLGD++LLI ALCFHSVFEGIA+GVA TKA+AW+ LW
Sbjct  157  GRVAPEGDKQVEADVNPVLLRTSSLGDTILLILALCFHSVFEGIAVGVAATKAEAWRNLW  216

Query  561  TVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVAD  382
            T+ LHKIFAAIAMGIALLRMIP RP L  + YSFAFAISSP+GV IGI IDATTQG+ AD
Sbjct  217  TISLHKIFAAIAMGIALLRMIPKRPFLLTVTYSFAFAISSPIGVGIGIAIDATTQGQDAD  276

Query  381  WIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            W+YAISMGIACGVFIYV+INHL++KG+KPQ     D P FKFLAVLLG+G+IAVVMIWD
Sbjct  277  WVYAISMGIACGVFIYVAINHLIAKGFKPQTHSYFDTPFFKFLAVLLGVGIIAVVMIWD  335



>ref|XP_006424873.1| hypothetical protein CICLE_v10030012mg [Citrus clementina]
 gb|ESR38113.1| hypothetical protein CICLE_v10030012mg [Citrus clementina]
Length=334

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 145/180 (81%), Gaps = 1/180 (1%)
 Frame = -3

Query  744  IGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKAL  565
            +     +S+  G DG    F+  SS+GD++LLI ALCFHSVFEGIAIGV+ TK +AW+ L
Sbjct  156  VDVEEEKSEEVGTDGNPV-FVRTSSIGDTILLILALCFHSVFEGIAIGVSATKGEAWRNL  214

Query  564  WTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVA  385
            WT+ LHKIFAAIAMGIALLRMIP RP L   AYSFAFAISSP+GV IGI IDATTQG +A
Sbjct  215  WTISLHKIFAAIAMGIALLRMIPKRPFLLTAAYSFAFAISSPIGVGIGIAIDATTQGHIA  274

Query  384  DWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            DWIYAISMG+ACGVFIYV+INHL++KG+KPQ     D P FKFLAVL G+GVIAVVMIWD
Sbjct  275  DWIYAISMGLACGVFIYVAINHLIAKGFKPQNKCYFDTPFFKFLAVLSGVGVIAVVMIWD  334



>gb|KDO72816.1| hypothetical protein CISIN_1g036650mg [Citrus sinensis]
Length=334

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 144/180 (80%), Gaps = 1/180 (1%)
 Frame = -3

Query  744  IGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKAL  565
            +     +S+  G DG    F   SS+GD++LLI ALCFHSVFEGIAIGV+ TK +AW+ L
Sbjct  156  VDVEEEKSEEVGTDGNPV-FFRTSSIGDTILLILALCFHSVFEGIAIGVSATKGEAWRNL  214

Query  564  WTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVA  385
            WT+ LHKIFAAIAMGIALLRMIP RP L   AYSFAFAISSP+GV IGI IDATTQG +A
Sbjct  215  WTISLHKIFAAIAMGIALLRMIPKRPFLLTAAYSFAFAISSPIGVGIGIAIDATTQGHIA  274

Query  384  DWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            DWIYAISMG+ACGVFIYV+INHL++KG+KPQ     D P FKFLAVL G+GVIAVVMIWD
Sbjct  275  DWIYAISMGLACGVFIYVAINHLIAKGFKPQNKCYFDAPFFKFLAVLSGVGVIAVVMIWD  334



>ref|XP_006488365.1| PREDICTED: zinc transporter 2-like [Citrus sinensis]
Length=334

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 144/180 (80%), Gaps = 1/180 (1%)
 Frame = -3

Query  744  IGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKAL  565
            +     +S+  G DG    F   SS+GD++LLI ALCFHSVFEGIAIGV+ TK +AW+ L
Sbjct  156  VDVEEEKSEEVGTDGNPV-FFRTSSVGDTILLILALCFHSVFEGIAIGVSATKGEAWRNL  214

Query  564  WTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVA  385
            WT+ LHKIFAAIAMGIALLRMIP RP L   AYSFAFAISSP+GV IGI IDATTQG +A
Sbjct  215  WTISLHKIFAAIAMGIALLRMIPKRPFLLTAAYSFAFAISSPIGVGIGIAIDATTQGHIA  274

Query  384  DWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            DWIYAISMG+ACGVFIYV+INHL++KG+KPQ     D P FKFLAVL G+GVIAVVMIWD
Sbjct  275  DWIYAISMGLACGVFIYVAINHLIAKGFKPQNKCYFDTPFFKFLAVLSGVGVIAVVMIWD  334



>ref|XP_007020535.1| Zinc transporter 11 precursor isoform 1 [Theobroma cacao]
 gb|EOY12060.1| Zinc transporter 11 precursor isoform 1 [Theobroma cacao]
Length=358

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 156/200 (78%), Gaps = 4/200 (2%)
 Frame = -3

Query  789  DLELQVNTEGR-NFNGIGTTHPQSQLQGCDGTE---SHFLHASSLGDSLLLIFALCFHSV  622
            DLELQ   + + N +G G         G D T    S     SS GDS+LLI ALC HSV
Sbjct  159  DLELQGPEQTKSNPHGHGNPPVSYGGNGTDTTSARSSSLTTVSSFGDSVLLIVALCCHSV  218

Query  621  FEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISS  442
            FEG+AIGVA T+A AWKALWT+ LHKIFAAIAMGIALLRMIP+ PLLSC+AY+FAFAISS
Sbjct  219  FEGVAIGVAKTEAAAWKALWTISLHKIFAAIAMGIALLRMIPDYPLLSCVAYAFAFAISS  278

Query  441  PVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHF  262
            P+ VAIGI+IDAT +G VA+WI+AI MG+ACGVFI VSINHLLSKGY PQKT++VD PH 
Sbjct  279  PIWVAIGILIDATIEGVVAEWIFAILMGLACGVFINVSINHLLSKGYTPQKTISVDTPHH  338

Query  261  KFLAVLLGIGVIAVVMIWDT  202
            K LAVLLG+GVIAV MIWDT
Sbjct  339  KVLAVLLGVGVIAVAMIWDT  358



>ref|XP_002283239.1| PREDICTED: zinc transporter 2 [Vitis vinifera]
Length=331

 Score =   256 bits (655),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -3

Query  702  GTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAM  523
            G    FL  +S GD++LLI ALCFHSVFEGIAIGV+ TKA+AW+ LWT+ LHKIFAAIAM
Sbjct  166  GLNPAFLQTTSFGDTMLLILALCFHSVFEGIAIGVSGTKAEAWRNLWTISLHKIFAAIAM  225

Query  522  GIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGV  343
            GIALLRM P RP ++  AYSFAFA+SSP+GV IGI IDATTQGK ADWIYAISMG+ACGV
Sbjct  226  GIALLRMKPKRPFVTTAAYSFAFAVSSPIGVGIGIAIDATTQGKAADWIYAISMGLACGV  285

Query  342  FIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            FIYV+INHL++KG+KPQ  +  D P FKFLAVL G+GVIAVVMIWD
Sbjct  286  FIYVAINHLVAKGFKPQTQLYFDTPFFKFLAVLAGVGVIAVVMIWD  331



>ref|XP_004291561.1| PREDICTED: zinc transporter 11-like [Fragaria vesca subsp. vesca]
Length=337

 Score =   256 bits (655),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 165/202 (82%), Gaps = 15/202 (7%)
 Frame = -3

Query  792  ADLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHAS-----SLGDSLLLIFALCFH  628
            +DLE Q + E       G T  Q Q      + +HF++AS     SLGDS+LLI ALCFH
Sbjct  146  SDLETQGSVEHEQ----GVTASQFQ------SHNHFVNASVANVSSLGDSVLLIVALCFH  195

Query  627  SVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAI  448
            SVFEGIAIGV +TKADAWKALWT+ LHK+FAAIAMGIALLRM+PNRP LSC AY+FAFA 
Sbjct  196  SVFEGIAIGVTETKADAWKALWTISLHKVFAAIAMGIALLRMMPNRPFLSCAAYAFAFAS  255

Query  447  SSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKP  268
            SSP+GVAIGIIIDATTQG VADWI+AISMG+ACGVFIYV++NHLL+KGY P K V++DK 
Sbjct  256  SSPIGVAIGIIIDATTQGAVADWIFAISMGLACGVFIYVAVNHLLAKGYTPDKPVSLDKS  315

Query  267  HFKFLAVLLGIGVIAVVMIWDT  202
            H+KFLAVLLG+GVIAVVMIWDT
Sbjct  316  HYKFLAVLLGVGVIAVVMIWDT  337



>ref|XP_010675904.1| PREDICTED: zinc transporter 11 [Beta vulgaris subsp. vulgaris]
Length=346

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 157/194 (81%), Gaps = 6/194 (3%)
 Frame = -3

Query  765  EGRNFNGIGTTHPQSQLQGCDG-TESHFLHA-----SSLGDSLLLIFALCFHSVFEGIAI  604
            EG         H  +     +G T +HF +A     SSLGD++LLI ALCFHSVFEGIAI
Sbjct  153  EGLPNQKTNNQHTNTTAHSQEGDTHNHFANATLAAASSLGDTILLITALCFHSVFEGIAI  212

Query  603  GVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAI  424
            GV++TK DAWKALWT+ LHKIFAAIAM IALLRMIPNRP LSC +Y+FAFAISSP+GVAI
Sbjct  213  GVSETKEDAWKALWTISLHKIFAAIAMAIALLRMIPNRPFLSCASYAFAFAISSPIGVAI  272

Query  423  GIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVL  244
            GIIID T QG+VADWI+AISMGIACGVF+YVSINHLL+KGY P+K V VD P F+FLAV+
Sbjct  273  GIIIDQTAQGQVADWIFAISMGIACGVFVYVSINHLLAKGYSPRKKVGVDTPFFRFLAVV  332

Query  243  LGIGVIAVVMIWDT  202
            LG+GVIAVVMIWDT
Sbjct  333  LGVGVIAVVMIWDT  346



>emb|CBI16100.3| unnamed protein product [Vitis vinifera]
Length=384

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -3

Query  702  GTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAM  523
            G    FL  +S GD++LLI ALCFHSVFEGIAIGV+ TKA+AW+ LWT+ LHKIFAAIAM
Sbjct  219  GLNPAFLQTTSFGDTMLLILALCFHSVFEGIAIGVSGTKAEAWRNLWTISLHKIFAAIAM  278

Query  522  GIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGV  343
            GIALLRM P RP ++  AYSFAFA+SSP+GV IGI IDATTQGK ADWIYAISMG+ACGV
Sbjct  279  GIALLRMKPKRPFVTTAAYSFAFAVSSPIGVGIGIAIDATTQGKAADWIYAISMGLACGV  338

Query  342  FIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            FIYV+INHL++KG+KPQ  +  D P FKFLAVL G+GVIAVVMIWD
Sbjct  339  FIYVAINHLVAKGFKPQTQLYFDTPFFKFLAVLAGVGVIAVVMIWD  384



>ref|XP_007020536.1| Zinc transporter 11 precursor isoform 2, partial [Theobroma cacao]
 gb|EOY12061.1| Zinc transporter 11 precursor isoform 2, partial [Theobroma cacao]
Length=297

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 152/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHA-SSLGDSLLLIFALCFHSVFEG  613
            DLELQ   + ++        P           S  L   SS GDS+LLI ALC HSVFEG
Sbjct  101  DLELQGPEQTKSNPHGHGNPPGGNGTDTTSARSSSLTTVSSFGDSVLLIVALCCHSVFEG  160

Query  612  IAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVG  433
            +AIGVA T+A AWKALWT+ LHKIFAAIAMGIALLRMIP+ PLLSC+AY+FAFAISSP+ 
Sbjct  161  VAIGVAKTEAAAWKALWTISLHKIFAAIAMGIALLRMIPDYPLLSCVAYAFAFAISSPIW  220

Query  432  VAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFL  253
            VAIGI+IDAT +G VA+WI+AI MG+ACGVFI VSINHLLSKGY PQKT++VD PH K L
Sbjct  221  VAIGILIDATIEGVVAEWIFAILMGLACGVFINVSINHLLSKGYTPQKTISVDTPHHKVL  280

Query  252  AVLLGIGVIAVVMIWDT  202
            AVLLG+GVIAV MIWDT
Sbjct  281  AVLLGVGVIAVAMIWDT  297



>gb|EMT23274.1| Zinc transporter 11 [Aegilops tauschii]
Length=214

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 155/189 (82%), Gaps = 3/189 (2%)
 Frame = -3

Query  765  EGR--NFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVAD  592
            EG+  + NG  ++ P +       T S   +AS++GD +LLI ALCFHSVFEGIAIGVA+
Sbjct  26   EGKLSSTNG-NSSGPHTADAHGPSTASMLRNASTIGDGVLLIAALCFHSVFEGIAIGVAE  84

Query  591  TKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIII  412
            T+ADAWKALWT+ LHKIFAAIAMGIALLRM+P+RPLLSC  Y+FAFA+SSP+GV +GI++
Sbjct  85   TEADAWKALWTISLHKIFAAIAMGIALLRMLPDRPLLSCFGYAFAFAVSSPIGVGVGILV  144

Query  411  DATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIG  232
            DATT+G+VADWIYAISMG+A G+F+YVSINHLL+KGY  +   A D P  ++L+V+LG+G
Sbjct  145  DATTEGRVADWIYAISMGLATGIFVYVSINHLLAKGYMLEGPAAADTPVGRWLSVVLGVG  204

Query  231  VIAVVMIWD  205
            VIAVVMIW+
Sbjct  205  VIAVVMIWN  213



>ref|XP_003543520.2| PREDICTED: zinc transporter 1-like [Glycine max]
Length=339

 Score =   255 bits (651),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 148/195 (76%), Gaps = 6/195 (3%)
 Frame = -3

Query  771  NTEGRNFNGIGTTHPQSQLQGCD------GTESHFLHASSLGDSLLLIFALCFHSVFEGI  610
            N E +     G T PQ      D       T    L  SSLGD++LLI ALCFHSVFEGI
Sbjct  145  NREAKVVELEGGTTPQEHDLARDHCAVAETTNPVLLKTSSLGDTILLILALCFHSVFEGI  204

Query  609  AIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGV  430
            A+GVA TKADAW+ LWT+ LHKIFAAIAMGIALLRM+P RP ++  AYS AFA+SSP+GV
Sbjct  205  AVGVAGTKADAWRNLWTISLHKIFAAIAMGIALLRMLPKRPFVTTAAYSLAFAVSSPIGV  264

Query  429  AIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLA  250
             IGI IDATTQG  ADW++AI+MGIACGVFIYV+INHL+SKG+KPQ+T+  D P F+F+A
Sbjct  265  GIGIAIDATTQGSTADWMFAITMGIACGVFIYVAINHLISKGFKPQRTMRYDTPLFRFVA  324

Query  249  VLLGIGVIAVVMIWD  205
            VL G+ VIAVVMIWD
Sbjct  325  VLSGVAVIAVVMIWD  339



>gb|KHN30150.1| Zinc transporter 1 [Glycine soja]
Length=333

 Score =   254 bits (650),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 148/195 (76%), Gaps = 6/195 (3%)
 Frame = -3

Query  771  NTEGRNFNGIGTTHPQSQLQGCD------GTESHFLHASSLGDSLLLIFALCFHSVFEGI  610
            N E +     G T PQ      D       T    L  SSLGD++LLI ALCFHSVFEGI
Sbjct  139  NREAKVVELEGGTTPQEHDLARDHCAVAETTNPVLLKTSSLGDTILLILALCFHSVFEGI  198

Query  609  AIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGV  430
            A+GVA TKADAW+ LWT+ LHKIFAAIAMGIALLRM+P RP ++  AYS AFA+SSP+GV
Sbjct  199  AVGVAGTKADAWRNLWTISLHKIFAAIAMGIALLRMLPKRPFVTTAAYSLAFAVSSPIGV  258

Query  429  AIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLA  250
             IGI IDATTQG  ADW++AI+MGIACGVFIYV+INHL+SKG+KPQ+T+  D P F+F+A
Sbjct  259  GIGIAIDATTQGSTADWMFAITMGIACGVFIYVAINHLISKGFKPQRTMRYDTPLFRFVA  318

Query  249  VLLGIGVIAVVMIWD  205
            VL G+ VIAVVMIWD
Sbjct  319  VLSGVAVIAVVMIWD  333



>ref|XP_009409509.1| PREDICTED: zinc transporter 1 [Musa acuminata subsp. malaccensis]
Length=342

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  687  FLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALL  508
            FL  +S GD+LLLI ALCFHSVFEGIAIGV+DTK  AW+ LWT+ LHKIFAAIAMGIALL
Sbjct  182  FLRTTSFGDTLLLILALCFHSVFEGIAIGVSDTKGSAWRNLWTISLHKIFAAIAMGIALL  241

Query  507  RMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVS  328
            RM+P RP L+ +AYS AFAISSPVGV IGI IDATT+G  ADWIY ISMG+ACGVFIYV+
Sbjct  242  RMLPKRPFLTTVAYSLAFAISSPVGVGIGIAIDATTEGSTADWIYCISMGLACGVFIYVA  301

Query  327  INHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            +NHL++KG+KP K  ++D P FKFLAVL G+GVIAVVMIWD
Sbjct  302  VNHLIAKGFKPYKPSSLDTPFFKFLAVLAGVGVIAVVMIWD  342



>ref|XP_011089491.1| PREDICTED: zinc transporter 2 [Sesamum indicum]
Length=325

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = -3

Query  711  GCDGTESHFL-HASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFA  535
            G +   + FL   +S+GD+LLLI ALCFHSVFEGIA+GVADTKADAW+ +WT+ LHKIFA
Sbjct  156  GKEAAPNPFLAKTTSVGDTLLLILALCFHSVFEGIAVGVADTKADAWRNMWTISLHKIFA  215

Query  534  AIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGI  355
            A+AMGIALL++IP RP L+ +AYSFAFAISSPVGV IGI +DATTQG+ ADW YAISMG+
Sbjct  216  AVAMGIALLKLIPKRPFLATLAYSFAFAISSPVGVGIGIALDATTQGRRADWTYAISMGL  275

Query  354  ACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            ACGVF+YV+INHL++KG++PQ     D P FKF AVL G+GVIAVVMIWD
Sbjct  276  ACGVFVYVAINHLIAKGFRPQNKCHFDTPFFKFFAVLFGVGVIAVVMIWD  325



>ref|XP_008801587.1| PREDICTED: zinc transporter 1 [Phoenix dactylifera]
Length=331

 Score =   254 bits (648),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 147/193 (76%), Gaps = 6/193 (3%)
 Frame = -3

Query  783  ELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAI  604
            E +V  EG N    G  H +        T   F+  +SLGD+LLLI ALCFHSVFEGIA+
Sbjct  145  EARVEVEGGN---RGEGHGEEMRPDLHPT---FVRTTSLGDTLLLILALCFHSVFEGIAV  198

Query  603  GVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAI  424
            GVADTK  AW+ LWT+ LHKIFAAIAMGIALLRM+P RP L  + YS AFAISSP+GV I
Sbjct  199  GVADTKTSAWRNLWTISLHKIFAAIAMGIALLRMLPKRPFLMTVVYSLAFAISSPIGVGI  258

Query  423  GIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVL  244
            GI IDATTQG  ADWIYAISMG+ACGVFIYV+INHL++KG+KPQ+    D P FKFLAVL
Sbjct  259  GIAIDATTQGPAADWIYAISMGLACGVFIYVAINHLIAKGFKPQEPSFFDTPFFKFLAVL  318

Query  243  LGIGVIAVVMIWD  205
            +G+ VIAVVMIWD
Sbjct  319  IGVAVIAVVMIWD  331



>ref|XP_008384937.1| PREDICTED: zinc transporter 2-like [Malus domestica]
Length=334

 Score =   253 bits (647),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 143/169 (85%), Gaps = 2/169 (1%)
 Frame = -3

Query  705  DGTESH--FLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAA  532
            DG + +  FL  SS GD++LLI ALCFHSVFEGIA+GVADTK+DAW+ LWT+ LHKIFAA
Sbjct  166  DGEDDNPVFLKTSSFGDTILLILALCFHSVFEGIAVGVADTKSDAWRNLWTISLHKIFAA  225

Query  531  IAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIA  352
            IAMGIALLRM+P R  L   AYSFAFA+SSP+GV IGI I+ATTQG VADWIYAISMG+A
Sbjct  226  IAMGIALLRMLPKRAFLVTAAYSFAFAVSSPIGVGIGIAINATTQGHVADWIYAISMGLA  285

Query  351  CGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            CGVFIYV+INHL++KG+KPQ     D P FKF+AVLLG+GVIA+VMIWD
Sbjct  286  CGVFIYVAINHLIAKGFKPQAKCYFDTPAFKFIAVLLGVGVIAIVMIWD  334



>ref|XP_009375917.1| PREDICTED: zinc transporter 2-like [Pyrus x bretschneideri]
Length=334

 Score =   253 bits (647),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 143/169 (85%), Gaps = 2/169 (1%)
 Frame = -3

Query  705  DGTESH--FLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAA  532
            DG + +  FL  SS GD++LLI ALCFHSVFEGIA+GVADTK+DAW+ LWT+ LHKIFAA
Sbjct  166  DGEDDNPVFLKTSSFGDTILLILALCFHSVFEGIAVGVADTKSDAWRNLWTISLHKIFAA  225

Query  531  IAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIA  352
            IAMGIALLRM+P R  L   AYSFAFA+SSP+GV IGI I+ATTQG VADWIYAISMG+A
Sbjct  226  IAMGIALLRMLPKRAFLVTAAYSFAFAVSSPIGVGIGIAINATTQGHVADWIYAISMGLA  285

Query  351  CGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            CGVFIYV+INHL++KG+KPQ     D P FKF+AVLLG+GVIA+VMIWD
Sbjct  286  CGVFIYVAINHLIAKGFKPQAKCYFDTPAFKFVAVLLGVGVIAIVMIWD  334



>ref|XP_004294650.1| PREDICTED: zinc transporter 2 [Fragaria vesca subsp. vesca]
Length=344

 Score =   254 bits (648),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = -3

Query  711  GCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAA  532
            G D     FL  +S GD++LLI ALCFHSVFEGIA+GVADTK DAW+ LWT+ LHKIFAA
Sbjct  176  GHDELNPAFLKTTSFGDTILLILALCFHSVFEGIAVGVADTKGDAWRNLWTISLHKIFAA  235

Query  531  IAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIA  352
            +AMGIALLRM+P R  L   AYSFAFA+SSPVGV IGI IDATT+G  ADW+YAISMG+A
Sbjct  236  VAMGIALLRMLPKRAFLVTAAYSFAFAVSSPVGVGIGIAIDATTEGAAADWVYAISMGLA  295

Query  351  CGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            CGVF+YV+INHL++KG+KPQ     D P +KFLAVLLG+GVIAVVMIWD
Sbjct  296  CGVFVYVAINHLIAKGFKPQTKCDFDTPSYKFLAVLLGVGVIAVVMIWD  344



>ref|XP_008356901.1| PREDICTED: zinc transporter 2 [Malus domestica]
Length=337

 Score =   253 bits (646),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 144/169 (85%), Gaps = 2/169 (1%)
 Frame = -3

Query  705  DGTESH--FLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAA  532
            DG +++  FL  SS GD++LLI ALCFHSVFEGIA+G+ADTK+DAW+ LWT+ LHKIFAA
Sbjct  169  DGEDANPVFLKTSSFGDTILLILALCFHSVFEGIAVGIADTKSDAWRNLWTISLHKIFAA  228

Query  531  IAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIA  352
            IAMGIALLRM+P R  L   AYSFAFA+SSPVGV IGI I+ATTQG VADWIYAISMG+A
Sbjct  229  IAMGIALLRMLPKRAFLVTAAYSFAFAVSSPVGVGIGIAINATTQGPVADWIYAISMGLA  288

Query  351  CGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            CGVF+YV+INHL++KG+KPQ     D P FKF++VLLG+GVIAVVMIWD
Sbjct  289  CGVFVYVAINHLIAKGFKPQAKCYFDTPAFKFVSVLLGVGVIAVVMIWD  337



>ref|XP_003597387.1| Zinc transporter [Medicago truncatula]
 gb|AAG09635.1| zinc transporter [Medicago truncatula]
 gb|ABD33123.1| Zinc/iron permease [Medicago truncatula]
 gb|AES67638.1| ZIP metal ion transporter family protein [Medicago truncatula]
Length=336

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 147/184 (80%), Gaps = 6/184 (3%)
 Frame = -3

Query  741  GTTHPQSQLQGC-----DGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADA  577
            G   PQ + +G      D +   F+  +++GD++LLI ALCFHSVFEGIA+G++ TK +A
Sbjct  154  GGRTPQEE-EGTTELAMDESNVAFMKTTNVGDTILLILALCFHSVFEGIAVGISGTKEEA  212

Query  576  WKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQ  397
            W+ LWT+ LHKIFAAIAMGIALLRM+P RPL++   YSFAFAISSP+GV IGI IDATT+
Sbjct  213  WRNLWTISLHKIFAAIAMGIALLRMLPKRPLITTAGYSFAFAISSPIGVGIGIAIDATTE  272

Query  396  GKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVV  217
            GK ADW+YAISMGIACGVF+YV+INHL+SKG+KPQ+    D P F+FLAVL G+ VIAVV
Sbjct  273  GKTADWMYAISMGIACGVFVYVAINHLISKGFKPQRKSRFDTPWFRFLAVLFGVAVIAVV  332

Query  216  MIWD  205
            MIWD
Sbjct  333  MIWD  336



>emb|CAJ19368.1| putative zinc transporter [Triticum aestivum]
Length=164

 Score =   246 bits (629),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = -3

Query  681  HASSLGDSLLLIFALCFHSVFEGIAIGVA-DTKADAWKALWTVCLHKIFAAIAMGIALLR  505
            +AS++GD +LLI ALCFHSVFEGIAIGVA +T+ADAWKALWT+ LHKIFAAIAMGIALLR
Sbjct  4    NASTIGDGVLLIAALCFHSVFEGIAIGVAAETEADAWKALWTISLHKIFAAIAMGIALLR  63

Query  504  MIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSI  325
            M+P+RPLLSC  Y+FAFA+SSP+GV +GI++DATT+G+VADWIYAISMG+A G+F+YVSI
Sbjct  64   MLPDRPLLSCFGYAFAFAVSSPIGVGVGILVDATTEGRVADWIYAISMGLATGIFVYVSI  123

Query  324  NHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            NHLL+KGY  Q+ VA D P  ++L+V+LG+GVIAVVMIW+
Sbjct  124  NHLLAKGYMLQRPVAADTPVGRWLSVVLGVGVIAVVMIWN  163



>emb|CDP09088.1| unnamed protein product [Coffea canephora]
Length=338

 Score =   251 bits (642),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = -3

Query  684  LHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLR  505
            +  SS+GD++LLI ALCFHSVFEGIA+GVA TK+DAWK LWT+ LHKIFAAIAMGIALLR
Sbjct  179  VKTSSVGDTILLILALCFHSVFEGIAVGVAATKSDAWKNLWTISLHKIFAAIAMGIALLR  238

Query  504  MIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSI  325
            MIP RP L+ +AYSFAFA+SSP+GV IGI IDATTQG+ ADWI+AISMGIA GVFIYV+I
Sbjct  239  MIPKRPFLTTVAYSFAFAVSSPIGVGIGIAIDATTQGRTADWIFAISMGIASGVFIYVAI  298

Query  324  NHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            NHL++KG+KP   +  D P FK LAVLLG+GVIAVVMIWD
Sbjct  299  NHLVTKGFKPHAKLYFDTPFFKLLAVLLGVGVIAVVMIWD  338



>gb|ACU19636.1| unknown [Glycine max]
Length=339

 Score =   251 bits (642),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 147/195 (75%), Gaps = 6/195 (3%)
 Frame = -3

Query  771  NTEGRNFNGIGTTHPQSQLQGCD------GTESHFLHASSLGDSLLLIFALCFHSVFEGI  610
            N E +     G T PQ      D       T    L  SSLGD++LLI ALCFHSVF GI
Sbjct  145  NREAKVVELEGGTTPQEHDLARDHCAVAETTNPVLLKTSSLGDTILLILALCFHSVFGGI  204

Query  609  AIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGV  430
            A+GVA TKADAW+ LWT+ LHKIFAAIAMGIALLRM+P RP ++  AYS AFA+SSP+GV
Sbjct  205  AVGVAGTKADAWRNLWTISLHKIFAAIAMGIALLRMLPKRPFVTTAAYSLAFAVSSPIGV  264

Query  429  AIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLA  250
             IGI IDATTQG  ADW++AI+MGIACGVFIYV+INHL+SKG+KPQ+T+  D P F+F+A
Sbjct  265  GIGIAIDATTQGSTADWMFAITMGIACGVFIYVAINHLISKGFKPQRTMRYDTPLFRFVA  324

Query  249  VLLGIGVIAVVMIWD  205
            VL G+ VIAVVMIWD
Sbjct  325  VLSGVAVIAVVMIWD  339



>ref|XP_010520271.1| PREDICTED: zinc transporter 2 [Tarenaya hassleriana]
Length=347

 Score =   251 bits (640),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 146/181 (81%), Gaps = 5/181 (3%)
 Frame = -3

Query  741  GTTHPQSQLQGCDGTESH--FLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKA  568
            G T P ++   C   E++  FL  S  GD++LLI ALCFHSVFEGIA+GV+DTK DAW+ 
Sbjct  170  GETPPAAR---CGDREANPLFLRTSGFGDTVLLILALCFHSVFEGIAVGVSDTKRDAWRN  226

Query  567  LWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKV  388
            LWT+ LHK+FAA+AMGIALL++IP RPLL  + YSFAFAISSP+GV IGI I+ATTQG  
Sbjct  227  LWTISLHKVFAAVAMGIALLKLIPKRPLLLTVGYSFAFAISSPIGVGIGIAINATTQGAT  286

Query  387  ADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIW  208
            ADW+YAISMGIACGVFIYV+INHL+SKGYKP++    D P FKFL+V LG+ +++VVMIW
Sbjct  287  ADWVYAISMGIACGVFIYVAINHLISKGYKPREPCYFDTPFFKFLSVFLGVALLSVVMIW  346

Query  207  D  205
            D
Sbjct  347  D  347



>gb|EYU30563.1| hypothetical protein MIMGU_mgv1a018072mg [Erythranthe guttata]
Length=336

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = -3

Query  711  GCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAA  532
            G D         SS+GD++LLI ALCFHSVFEGIA+G+ADTK DAW+ LWT+ LHKIFAA
Sbjct  168  GKDHNNPVLTTTSSVGDTVLLILALCFHSVFEGIAVGIADTKGDAWRNLWTISLHKIFAA  227

Query  531  IAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIA  352
            IAMGIALLRMIP RP L+ + YSFAFAISSPVG+ IGI +DAT+QG+ ADW YAI+MGIA
Sbjct  228  IAMGIALLRMIPKRPFLTTLIYSFAFAISSPVGIGIGIALDATSQGRSADWTYAITMGIA  287

Query  351  CGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            CGVFIYV+INHL+SKG+KP      D P FKFLAV+LG+GVIAVVMIWD
Sbjct  288  CGVFIYVAINHLISKGFKPVAKCYFDTPFFKFLAVVLGVGVIAVVMIWD  336



>ref|XP_003547243.1| PREDICTED: zinc transporter 1-like [Glycine max]
 gb|KHN33365.1| Zinc transporter 1 [Glycine soja]
Length=345

 Score =   249 bits (637),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 144/187 (77%), Gaps = 8/187 (4%)
 Frame = -3

Query  741  GTTHPQSQLQG--------CDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTK  586
            GTT PQ              + T    L  SS+GD++LLI ALCFHSVFEGIA+GVA TK
Sbjct  159  GTTPPQEHEHDQARDHCAVAETTNPVLLKTSSVGDTILLILALCFHSVFEGIAVGVAGTK  218

Query  585  ADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDA  406
            ADAW+ LWT+ LHKIFAAIAMGIALLRM+P RP ++  AYS AFA+SSP+GV IGI I+A
Sbjct  219  ADAWRNLWTISLHKIFAAIAMGIALLRMLPKRPFVTTAAYSLAFAVSSPIGVGIGIAINA  278

Query  405  TTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVI  226
            TTQG  ADW++AI+MGIACGVFIYV+INHL+SKG+KP KT   D P F+F+AVL G+ VI
Sbjct  279  TTQGSTADWMFAITMGIACGVFIYVAINHLISKGFKPHKTTRYDTPWFRFVAVLSGVAVI  338

Query  225  AVVMIWD  205
            AVVMIWD
Sbjct  339  AVVMIWD  345



>ref|XP_004240368.1| PREDICTED: zinc transporter 2 [Solanum lycopersicum]
Length=337

 Score =   249 bits (636),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 152/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  792  ADLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEG  613
            ++ +++V+ EGR+ N I   H         GT   FL  +SLGD++LLI ALCFHS+FEG
Sbjct  153  SESKVEVDEEGRSTN-IDEGH---------GTNP-FLKTTSLGDTILLILALCFHSIFEG  201

Query  612  IAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVG  433
            IA+GV+ +K +AW+ LWT+ LHKIFAAIAMGIALLRMIP RP L   AYSFAFAISSP+G
Sbjct  202  IAVGVSASKGEAWRNLWTISLHKIFAAIAMGIALLRMIPKRPFLLTCAYSFAFAISSPIG  261

Query  432  VAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFL  253
            V IGI IDAT++G+ ADW YAISM IACGVFIYV+INHL++KG+KPQ     D   FKF+
Sbjct  262  VGIGIAIDATSEGRTADWTYAISMAIACGVFIYVAINHLIAKGFKPQNKCYFDTQFFKFV  321

Query  252  AVLLGIGVIAVVMIWD  205
            AVLLG+GVIAVVMIWD
Sbjct  322  AVLLGVGVIAVVMIWD  337



>gb|EMS61060.1| Zinc transporter 2 [Triticum urartu]
Length=285

 Score =   247 bits (631),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 147/178 (83%), Gaps = 6/178 (3%)
 Frame = -3

Query  738  TTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWT  559
            +  PQ+       T S   +AS++GD +LLI ALCFHSVFEGIAIGVA+T+ADAWKALWT
Sbjct  113  SIEPQTSDAHGPSTASMLRNASTIGDGVLLIAALCFHSVFEGIAIGVAETEADAWKALWT  172

Query  558  VCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADW  379
            + LHKI AAIAMGI+LLRM+P+RPLLSC  Y+FAFA+ SP+GVA+ I++DATT+G+VADW
Sbjct  173  ISLHKILAAIAMGISLLRMLPDRPLLSCFGYAFAFAVPSPIGVAVSILVDATTEGRVADW  232

Query  378  IYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            IYAISMG+A G+F+YVSINHLL+KGY+PQ+ V       ++LAV LG+GVIAVVMIWD
Sbjct  233  IYAISMGLATGIFVYVSINHLLAKGYRPQRPVG------RWLAVALGVGVIAVVMIWD  284



>ref|XP_006358694.1| PREDICTED: zinc transporter 2-like [Solanum tuberosum]
Length=336

 Score =   249 bits (635),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 152/196 (78%), Gaps = 11/196 (6%)
 Frame = -3

Query  792  ADLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEG  613
            ++ +++V+ EGR+ N I   H         GT   FL  +SLGD++LLI ALCFHS+FEG
Sbjct  152  SESKVEVDEEGRSTN-IDEGH---------GTNP-FLKTTSLGDTILLILALCFHSIFEG  200

Query  612  IAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVG  433
            IA+GV+ +K +AW+ LWT+ LHKIFAAIAMGIALLRMIP RP L   AYSFAFAISSP+G
Sbjct  201  IAVGVSASKGEAWRNLWTISLHKIFAAIAMGIALLRMIPKRPFLLTCAYSFAFAISSPIG  260

Query  432  VAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFL  253
            V IGI IDAT++G+ ADW YAISM IACGVFIYV+INHL++KG+KPQ     D   FKF+
Sbjct  261  VGIGIAIDATSEGRTADWTYAISMAIACGVFIYVAINHLIAKGFKPQNKCYFDTQFFKFV  320

Query  252  AVLLGIGVIAVVMIWD  205
            AVLLG+GVIAVVMIWD
Sbjct  321  AVLLGVGVIAVVMIWD  336



>gb|ACU21244.1| unknown [Glycine max]
Length=345

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 144/187 (77%), Gaps = 8/187 (4%)
 Frame = -3

Query  741  GTTHPQSQLQG--------CDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTK  586
            GTT PQ              + T    L  SS+GD++LLI ALCFHSVFEGIA+GVA TK
Sbjct  159  GTTPPQEHEHDQARDHCAVAETTNPVLLKTSSVGDTILLILALCFHSVFEGIAVGVAGTK  218

Query  585  ADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDA  406
            ADAW+ LWT+ LHKIFAAIAMGIALLRM+P RP ++  AYS AFA+SSP+GV IGI I+A
Sbjct  219  ADAWRNLWTISLHKIFAAIAMGIALLRMLPKRPFVTTAAYSLAFAVSSPIGVGIGIAINA  278

Query  405  TTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVI  226
            +TQG  ADW++AI+MGIACGVFIYV+INHL+SKG+KP KT   D P F+F+AVL G+ VI
Sbjct  279  STQGSTADWMFAITMGIACGVFIYVAINHLISKGFKPHKTTRYDTPWFRFVAVLSGVAVI  338

Query  225  AVVMIWD  205
            AVVMIWD
Sbjct  339  AVVMIWD  345



>ref|XP_009607802.1| PREDICTED: zinc transporter 2 [Nicotiana tomentosiformis]
Length=343

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 135/166 (81%), Gaps = 0/166 (0%)
 Frame = -3

Query  702  GTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAM  523
            G  + FL  +S GD++LLI ALCFHS+FEGIA+GV+ TK +AW+ LWT+ LHKIFAA+AM
Sbjct  178  GETNPFLKTTSFGDTILLILALCFHSIFEGIAVGVSATKGEAWRNLWTISLHKIFAAVAM  237

Query  522  GIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGV  343
            GIALLRMIP RP L   AYSFAFAISSP+GV IGI IDAT++GK ADW YAISMGIACGV
Sbjct  238  GIALLRMIPKRPFLLTCAYSFAFAISSPIGVGIGIAIDATSEGKTADWTYAISMGIACGV  297

Query  342  FIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            FIYV+INHL+SKG++PQ     D   FKF AV LG+G IA+VMIWD
Sbjct  298  FIYVAINHLISKGFRPQNKCYFDTQFFKFFAVFLGVGTIAIVMIWD  343



>gb|ABK23604.1| unknown [Picea sitchensis]
Length=258

 Score =   244 bits (623),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/194 (65%), Positives = 148/194 (76%), Gaps = 9/194 (5%)
 Frame = -3

Query  762  GRNFNGIGTTHPQSQLQGCDG-----TESHFLHASSLGDSLLLIFALCFHSVFEGIAIGV  598
            G   +G+ T + Q  L   DG          +  +S+GDSLLL+ ALCFHSVFEGIAIGV
Sbjct  66   GDTESGVTTLNSQ-DLHTVDGGVQMVKAVSLVKKTSIGDSLLLVLALCFHSVFEGIAIGV  124

Query  597  ADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGI  418
            A TK DAW+ALWTVCLHKIFAAIAMGIALLR+IP+RP LSC AY+FAFAISSPVG+ IGI
Sbjct  125  AATKHDAWRALWTVCLHKIFAAIAMGIALLRIIPDRPFLSCAAYAFAFAISSPVGIGIGI  184

Query  417  IIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKG--YKPQK-TVAVDKPHFKFLAV  247
            +IDATTQG+VADWIYAISM  ACGVF+YV+INHLL KG    P K  +  DKP +K+LA 
Sbjct  185  LIDATTQGRVADWIYAISMAFACGVFVYVAINHLLLKGVIQNPNKGAIPFDKPFYKYLAA  244

Query  246  LLGIGVIAVVMIWD  205
            + G G+IAVVM WD
Sbjct  245  VTGAGLIAVVMNWD  258



>ref|XP_008355309.1| PREDICTED: zinc transporter 11-like [Malus domestica]
Length=343

 Score =   246 bits (628),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 155/198 (78%), Gaps = 10/198 (5%)
 Frame = -3

Query  792  ADLELQVNTEGRNFNGIGT-THPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFE  616
            ADL+++ N E       GT +H Q+ +            A+SLGD +LLI ALCFHSVFE
Sbjct  155  ADLQVRGNIEQGKGGQYGTQSHTQNTVVAS---------ATSLGDXILLIVALCFHSVFE  205

Query  615  GIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPV  436
            GIAIGVA+TKADAWKALWT+ LHK+FAAIAMGIA L M+PN   LSC A +FAFAISSP+
Sbjct  206  GIAIGVAETKADAWKALWTISLHKVFAAIAMGIAXLXMMPNXXFLSCAAXAFAFAISSPI  265

Query  435  GVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKF  256
            GVAI I+IDATTQG VADWI+AISMG+ACGVFIYV+INHL  KGY P K V+VDKP +K 
Sbjct  266  GVAIXILIDATTQGAVADWIFAISMGLACGVFIYVAINHLXXKGYAPDKAVSVDKPQYKX  325

Query  255  LAVLLGIGVIAVVMIWDT  202
            LAVLLGIGVIAVVMIWDT
Sbjct  326  LAVLLGIGVIAVVMIWDT  343



>gb|AHU86549.1| ZIP5 [Marchantia polymorpha]
Length=344

 Score =   246 bits (627),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 145/188 (77%), Gaps = 11/188 (6%)
 Frame = -3

Query  735  THPQSQLQGCDGTESH---------FLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKA  583
            T  +S + G  G   H          +H +S+GD++LLI ALCFHSVFEGIAIGVA  KA
Sbjct  157  TGKESAITGAVGPNDHEAGHMVQATLIHTASMGDAVLLILALCFHSVFEGIAIGVAANKA  216

Query  582  DAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDAT  403
            DAW++LWT+ LHK+FAAIAMGIALLR++PNRP LSC AY+ AFAISSPVG+AIGIIID+T
Sbjct  217  DAWRSLWTISLHKVFAAIAMGIALLRILPNRPFLSCAAYALAFAISSPVGIAIGIIIDST  276

Query  402  TQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKP--QKTVAVDKPHFKFLAVLLGIGV  229
            TQG  ADWIYAISMG A GVFIYV+INHLL+KG+ P   + VAVD P  K LA  LG+GV
Sbjct  277  TQGSTADWIYAISMGFAAGVFIYVAINHLLAKGFIPPNNEKVAVDTPVLKLLAFALGLGV  336

Query  228  IAVVMIWD  205
            + VVMIWD
Sbjct  337  LFVVMIWD  344



>ref|XP_006846276.1| PREDICTED: zinc transporter 1 [Amborella trichopoda]
 gb|ERN07951.1| hypothetical protein AMTR_s00012p00248530 [Amborella trichopoda]
Length=333

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -3

Query  693  SHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIA  514
            S F+  + +GD++LLI ALCFHSVFEGIA+G+ADTKADAW+ LW + LHKIFAAI+MGIA
Sbjct  170  SAFVKTTYVGDTVLLILALCFHSVFEGIAVGIADTKADAWRNLWVISLHKIFAAISMGIA  229

Query  513  LLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIY  334
            LLRM+PNRPLL+ +AYSF+FAISSP+GV IGI I+ TT+G+ ADWIYAISMG+ACGVFIY
Sbjct  230  LLRMLPNRPLLTTVAYSFSFAISSPIGVGIGITINTTTEGRAADWIYAISMGLACGVFIY  289

Query  333  VSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            V+INHL++KG+KP      D  ++KFLAVL+G+ +IA+VMIWD+
Sbjct  290  VAINHLIAKGFKPTNPSYFDTSYWKFLAVLIGVLLIAIVMIWDS  333



>ref|XP_007214183.1| hypothetical protein PRUPE_ppa019717mg [Prunus persica]
 gb|EMJ15382.1| hypothetical protein PRUPE_ppa019717mg [Prunus persica]
Length=306

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 144/171 (84%), Gaps = 3/171 (2%)
 Frame = -3

Query  714  QGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFA  535
            Q C   E   +H  S+GDS+LLI ALCFHS FEGIAIGVA TKA+AWKALWTV +HKI A
Sbjct  139  QECSDLE---VHVGSVGDSILLIVALCFHSFFEGIAIGVAKTKAEAWKALWTVSVHKIIA  195

Query  534  AIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGI  355
            AIAMGIALLRM+PNRP LSC+AY+F F ISSPVGV +GI ID+TTQG  ADW++AIS+G+
Sbjct  196  AIAMGIALLRMLPNRPFLSCMAYAFVFGISSPVGVGVGITIDSTTQGATADWLFAISIGL  255

Query  354  ACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            ACGVFIYVSINHLLSKGY  QK V+VDKPH+KFLAVL GIGVI+V M WD+
Sbjct  256  ACGVFIYVSINHLLSKGYTAQKAVSVDKPHYKFLAVLFGIGVISVAMFWDS  306



>gb|ABB55317.1| zinc transporter, putative [Asparagus officinalis]
Length=617

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 149/182 (82%), Gaps = 10/182 (5%)
 Frame = -3

Query  741  GTTHPQSQLQGCDG------TESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKAD  580
             +T P SQ +G  G       E    HASSLGDS+LLI ALCFHSVFEGIAIGVA+ KAD
Sbjct  158  NSTKPHSQPEGPHGGAHNQSVEYVLSHASSLGDSILLIVALCFHSVFEGIAIGVAENKAD  217

Query  579  AWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATT  400
            AWKALWT+ LHKIFAAIAMGIALLRMIP+RPL+SC AY+FAFAISSPVGVAIGIIIDATT
Sbjct  218  AWKALWTISLHKIFAAIAMGIALLRMIPDRPLISCAAYAFAFAISSPVGVAIGIIIDATT  277

Query  399  QGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAV  220
            +G VADWI+AISMGIACG+FIYV+INHLL+KGY+PQ+ VAV+ P    +A  LG+   +V
Sbjct  278  EGHVADWIFAISMGIACGIFIYVAINHLLAKGYQPQQPVAVNTP----IAYRLGVKEFSV  333

Query  219  VM  214
            V+
Sbjct  334  VV  335



>gb|EEE56089.1| hypothetical protein OsJ_04930 [Oryza sativa Japonica Group]
Length=252

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  687  FLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALL  508
             +  SS  D++LLI ALCFHSVFEGIAIGV+ +K++AW+ LWT+ LHKIFAA+AMGIALL
Sbjct  92   LVRTSSFEDAVLLIVALCFHSVFEGIAIGVSASKSEAWRNLWTIGLHKIFAAVAMGIALL  151

Query  507  RMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVS  328
            RMIP RP L  + YS AFA+SSPVGV IGI IDAT+QG+ ADW YAISMG+A GVFIYV+
Sbjct  152  RMIPKRPFLMTVVYSLAFAVSSPVGVGIGIAIDATSQGRAADWTYAISMGLATGVFIYVA  211

Query  327  INHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            INHL++KGY+P    A DKP FKFLAVLLG+ V+AVVMIWD
Sbjct  212  INHLIAKGYRPHHPTAADKPLFKFLAVLLGVAVMAVVMIWD  252



>ref|XP_002313423.2| hypothetical protein POPTR_0009s03950g [Populus trichocarpa]
 gb|EEE87378.2| hypothetical protein POPTR_0009s03950g [Populus trichocarpa]
Length=333

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -3

Query  687  FLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALL  508
            FL  +SLGD++LLI ALCFHSVFEGIA+GVA TK +AW+ LWT+ LHKIFAAI MGIALL
Sbjct  173  FLKTTSLGDTILLILALCFHSVFEGIAVGVAGTKGEAWRNLWTISLHKIFAAIGMGIALL  232

Query  507  RMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVS  328
            RM+P RP L   AYSFAFAISSP+GV IGI IDAT QG+ ADWI+ ISMG+ACGVFIYV+
Sbjct  233  RMLPKRPFLLTAAYSFAFAISSPLGVGIGIAIDATAQGQEADWIFGISMGLACGVFIYVA  292

Query  327  INHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            INHL++KG+ PQ  +  D P FKF+AV LG+GVIAVVMIWD
Sbjct  293  INHLIAKGFHPQAKLYFDTPFFKFVAVFLGVGVIAVVMIWD  333



>ref|XP_011032271.1| PREDICTED: zinc transporter 2 [Populus euphratica]
Length=339

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -3

Query  687  FLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALL  508
            FL  +SLGD++LLI ALCFHSVFEGIA+GVA TK +AW+ LWT+ LHKIFAAI MGIALL
Sbjct  179  FLKTTSLGDTILLILALCFHSVFEGIAVGVAGTKGEAWRNLWTISLHKIFAAIGMGIALL  238

Query  507  RMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVS  328
            RM+P RP L   AYSFAFAISSP+GV IGI IDAT QG+ ADWI+ ISMG+ACGVFIYV+
Sbjct  239  RMLPKRPFLLTAAYSFAFAISSPIGVGIGIAIDATAQGQDADWIFGISMGLACGVFIYVA  298

Query  327  INHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            INHL++KG+ PQ  +  D P FKF+AV LG+GVIAVVMIWD
Sbjct  299  INHLIAKGFHPQAKLYFDTPFFKFVAVFLGVGVIAVVMIWD  339



>ref|XP_003547009.1| PREDICTED: zinc transporter 1-like [Glycine max]
Length=342

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 144/187 (77%), Gaps = 8/187 (4%)
 Frame = -3

Query  741  GTTHPQSQLQ------GCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKAD  580
            G   PQ Q          + T    L  SS+GD++LLI ALCFHS+FEGIA+GVA TKA+
Sbjct  156  GGKAPQEQHDQARDHCAVETTNPALLKTSSVGDTILLILALCFHSLFEGIAVGVAGTKAE  215

Query  579  AWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATT  400
            AW+ LWT+ LHKIFAAIAMGIALLRM+P RPLL+   YSFAFA+SSP+GV IGI IDATT
Sbjct  216  AWRNLWTISLHKIFAAIAMGIALLRMLPKRPLLTTAVYSFAFAVSSPIGVGIGIAIDATT  275

Query  399  QGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQ--KTVAVDKPHFKFLAVLLGIGVI  226
            QG  ADW++AI+MG+ACGVFIYV+INHL+SKG+K Q   T + D P F+FLAVL G+ VI
Sbjct  276  QGSTADWMFAITMGVACGVFIYVAINHLISKGFKQQAGTTSSFDTPWFRFLAVLSGVAVI  335

Query  225  AVVMIWD  205
            AVVMIWD
Sbjct  336  AVVMIWD  342



>gb|KHN33366.1| Zinc transporter 1 [Glycine soja]
Length=342

 Score =   244 bits (623),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 144/179 (80%), Gaps = 3/179 (2%)
 Frame = -3

Query  732  HPQSQLQ-GCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTV  556
            H Q++     + T    L  SS+GD++LLI ALCFHS+FEGIA+GVA TKA+AW+ LWT+
Sbjct  164  HDQARDHCAVETTNPALLKTSSVGDTILLILALCFHSLFEGIAVGVAGTKAEAWRNLWTI  223

Query  555  CLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWI  376
             LHKIFAAIAMGIALLRM+P RPLL+   YSFAFA+SSP+GV IGI IDATTQG  ADW+
Sbjct  224  SLHKIFAAIAMGIALLRMLPKRPLLTTAVYSFAFAVSSPIGVGIGIAIDATTQGSTADWM  283

Query  375  YAISMGIACGVFIYVSINHLLSKGYKPQ--KTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            +AI+MG+ACGVFIYV+INHL+SKG+K Q   T + D P F+FLAVL G+ VIAVVMIWD
Sbjct  284  FAITMGVACGVFIYVAINHLISKGFKQQAGTTSSFDTPWFRFLAVLSGVAVIAVVMIWD  342



>ref|XP_004486988.1| PREDICTED: zinc transporter 2-like [Cicer arietinum]
Length=334

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 148/192 (77%), Gaps = 7/192 (4%)
 Frame = -3

Query  780  LQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIG  601
            L+V  EG      G T PQ   Q  + T+   +  S++GD++LLI ALCFHSVFEGIA+G
Sbjct  150  LEVEEEG------GIT-PQEPHQHQEITDVAIMKTSNIGDTILLIIALCFHSVFEGIAVG  202

Query  600  VADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIG  421
            V+ +K +AW+ LWT+ LHKIFAAIAMGIALLRM+P R L++   YSFAFAISSP+GV IG
Sbjct  203  VSGSKREAWRTLWTISLHKIFAAIAMGIALLRMLPKRALITTAGYSFAFAISSPIGVGIG  262

Query  420  IIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLL  241
            I IDATT+G  A+W+YAISMGIACGVF+YV++NHL+S+G+KPQ+    D P FKFLAVL 
Sbjct  263  IAIDATTEGNTANWVYAISMGIACGVFVYVAVNHLISEGFKPQRKTRFDTPLFKFLAVLF  322

Query  240  GIGVIAVVMIWD  205
            G+ VI++ MIWD
Sbjct  323  GVTVISIAMIWD  334



>ref|XP_010262554.1| PREDICTED: zinc transporter 1 [Nelumbo nucifera]
Length=337

 Score =   243 bits (621),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = -3

Query  684  LHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLR  505
            + AS +GD+LLLI ALCFHS+FEGIA+GV+ TKADAW+ LWT+ LHK+FAAIAMGIALLR
Sbjct  178  MKASFIGDTLLLILALCFHSIFEGIAVGVSATKADAWRNLWTISLHKVFAAIAMGIALLR  237

Query  504  MIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSI  325
            M+P RP L+ +AY+FAFAISSP+GV IGI IDATTQG VADWI+AISM +ACGVFIYV+I
Sbjct  238  MLPKRPFLTTVAYAFAFAISSPIGVGIGIAIDATTQGAVADWIFAISMSLACGVFIYVAI  297

Query  324  NHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            NHL++KG+KP +    D P FKFLAVL G+ V++VV IWD
Sbjct  298  NHLIAKGFKPLEKSYFDTPFFKFLAVLAGVAVMSVVFIWD  337



>ref|XP_008349915.1| PREDICTED: zinc transporter 11-like, partial [Malus domestica]
Length=315

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -3

Query  726  QSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLH  547
             S  +G D    H     S+GDS+LLI ALCFHS FEGIAIGVA TKA+AWKALWTV LH
Sbjct  141  DSDPEGHDVHGDHPATVGSVGDSILLIVALCFHSFFEGIAIGVASTKAEAWKALWTVSLH  200

Query  546  KIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAI  367
            KIFAAIAM IALLRMIP+RP LSC AY+F FAISSP+G+ +GI IDATTQG+ ADWI AI
Sbjct  201  KIFAAIAMAIALLRMIPDRPFLSCTAYAFLFAISSPIGIGVGITIDATTQGRTADWISAI  260

Query  366  SMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            S+G+ACGVFIYVSINHLLSKGY   K V+VD PH+KFLAVL GIGV++VVMIWDT
Sbjct  261  SIGLACGVFIYVSINHLLSKGYTVHKAVSVDTPHYKFLAVLFGIGVVSVVMIWDT  315



>ref|XP_001771951.1| predicted protein [Physcomitrella patens]
 gb|EDQ63212.1| predicted protein [Physcomitrella patens]
Length=336

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = -3

Query  699  TESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMG  520
            T++    + +L D++LLIFALCFHS+FEGIAIGVA TK D W +LWTV LHK+FAAIAMG
Sbjct  172  TKAAIQSSYNLSDAVLLIFALCFHSIFEGIAIGVAATKDDTWTSLWTVSLHKVFAAIAMG  231

Query  519  IALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVF  340
            IALLRM+PNRPLL C+ Y+FAFAIS+P+GVAIGIII++T +G++ADWIYA+SMGIA GVF
Sbjct  232  IALLRMLPNRPLLQCVLYAFAFAISTPIGVAIGIIINSTVEGRIADWIYAVSMGIATGVF  291

Query  339  IYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            +YV+INHLL+KG+KP K VA+D+P +++ AV+LG  +I +VMIWD
Sbjct  292  VYVAINHLLAKGHKPNKKVALDRPLWRWAAVVLGATLIGIVMIWD  336



>ref|XP_007150346.1| hypothetical protein PHAVU_005G145900g [Phaseolus vulgaris]
 gb|ESW22340.1| hypothetical protein PHAVU_005G145900g [Phaseolus vulgaris]
Length=332

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 139/184 (76%), Gaps = 5/184 (3%)
 Frame = -3

Query  741  GTTHPQSQLQGCD-----GTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADA  577
            G T PQ   Q  D      T    L  SS GD++LLI ALCFHSVFEGIA+GVA TK +A
Sbjct  149  GGTTPQEHDQAGDHCAVEATNPILLKTSSTGDTILLILALCFHSVFEGIAVGVAGTKREA  208

Query  576  WKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQ  397
            WK LWT+ LHKIFAAIAMGIALLRM+P RPLL+   YS AFAISSP GV IGI IDATTQ
Sbjct  209  WKNLWTISLHKIFAAIAMGIALLRMLPKRPLLTTAVYSLAFAISSPSGVGIGIAIDATTQ  268

Query  396  GKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVV  217
            G  ADW++AI+MGIACGVFIYV+INHL+SKG+K + T   D   F+FLAVL G+ VIAVV
Sbjct  269  GSTADWMFAITMGIACGVFIYVAINHLISKGFKQKGTSRFDTSWFRFLAVLSGVAVIAVV  328

Query  216  MIWD  205
            MIWD
Sbjct  329  MIWD  332



>ref|XP_009759327.1| PREDICTED: zinc transporter 2 [Nicotiana sylvestris]
Length=332

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 144/196 (73%), Gaps = 12/196 (6%)
 Frame = -3

Query  792  ADLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEG  613
            A +E++   EGR+ N     H         G  + FL  +SLGD++LLI ALCFHS+FEG
Sbjct  149  AKVEVE---EGRSGNNTEEGH---------GEANPFLKTTSLGDTILLILALCFHSIFEG  196

Query  612  IAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVG  433
            IA+GV+ TK +AW+ LWT+ LHKIFAAIAMGIALLRMIP RP L   AYSFAFAISSP+G
Sbjct  197  IAVGVSATKGEAWRNLWTISLHKIFAAIAMGIALLRMIPKRPFLLTCAYSFAFAISSPIG  256

Query  432  VAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFL  253
            V IGI IDAT++GK ADW YAISM IACGVFIYV+INHL+ KG++P+     D   FKF 
Sbjct  257  VGIGIAIDATSEGKTADWTYAISMAIACGVFIYVAINHLILKGFRPKNKCYFDTQFFKFF  316

Query  252  AVLLGIGVIAVVMIWD  205
            AV  G+G IA+VMIWD
Sbjct  317  AVFSGVGTIAIVMIWD  332



>ref|XP_007211580.1| hypothetical protein PRUPE_ppa008533mg [Prunus persica]
 gb|EMJ12779.1| hypothetical protein PRUPE_ppa008533mg [Prunus persica]
Length=328

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 149/198 (75%), Gaps = 35/198 (18%)
 Frame = -3

Query  750  NGIGTTHPQSQLQGC--------DGTESH-------FLHASSLGDSLLLIFALCFHSVFE  616
             G+G+  P  +L+G         +G ESH         + SSLGDS+LLI ALCFHSVFE
Sbjct  151  KGVGSA-PDLELRGSAEQGKGGQNGNESHNHFANVAVANVSSLGDSILLIVALCFHSVFE  209

Query  615  GIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPV  436
            GIAIGV                   FAAIAMGIALLRM+PNRP LSC AY+FAFAISSP+
Sbjct  210  GIAIGV-------------------FAAIAMGIALLRMMPNRPFLSCAAYAFAFAISSPI  250

Query  435  GVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKF  256
            GVAIGI+IDATTQG VADWI+AISMGIACGVFIYV++NHLL+KGYKP+K V++DKPH+KF
Sbjct  251  GVAIGILIDATTQGAVADWIFAISMGIACGVFIYVAVNHLLAKGYKPEKAVSIDKPHYKF  310

Query  255  LAVLLGIGVIAVVMIWDT  202
            LAVLLG+GVIAVVMIWDT
Sbjct  311  LAVLLGVGVIAVVMIWDT  328



>ref|XP_002985477.1| hypothetical protein SELMODRAFT_269005 [Selaginella moellendorffii]
 gb|EFJ13351.1| hypothetical protein SELMODRAFT_269005 [Selaginella moellendorffii]
Length=356

 Score =   242 bits (617),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 146/188 (78%), Gaps = 1/188 (1%)
 Frame = -3

Query  765  EGRNFNGIGTTHPQSQLQGCD-GTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADT  589
            +G +    G+T   + L   +  T    +  +S GDSLLLI ALCFHSVFEGIAIG+A  
Sbjct  169  KGDDLTKEGSTVEDNTLNMKNIVTAPAIVKEASFGDSLLLIIALCFHSVFEGIAIGIAGK  228

Query  588  KADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIID  409
              DAW+ LWT+CLHK+FAAIAMGIALL+++PNRPLLS   YSFAFAIS+P+GVAIGIIID
Sbjct  229  LRDAWRNLWTICLHKLFAAIAMGIALLKIMPNRPLLSTSLYSFAFAISTPIGVAIGIIID  288

Query  408  ATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGV  229
            +TTQG  ADWIYAISMGIACGVF+YV+INHLL+KG+ P +    D P ++FLAV+LG  V
Sbjct  289  STTQGAAADWIYAISMGIACGVFVYVAINHLLAKGFVPDRASFWDTPFYRFLAVVLGAAV  348

Query  228  IAVVMIWD  205
            IAVVMIWD
Sbjct  349  IAVVMIWD  356



>ref|XP_008244618.1| PREDICTED: zinc transporter 11-like [Prunus mume]
Length=314

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 149/182 (82%), Gaps = 4/182 (2%)
 Frame = -3

Query  735  THPQSQLQGCD----GTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKA  568
            ++  ++ +G D    G+  H     S+GDS+LLI ALCFHS FEGIAIGVA TKA+AWKA
Sbjct  133  SYVYAKQEGSDLEVQGSGHHPATVGSVGDSILLIVALCFHSFFEGIAIGVAKTKAEAWKA  192

Query  567  LWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKV  388
            LWTV +HKI AAIAMGIALLRM+PNRP LSC+AY+F F ISSPVGV +GI ID+TTQG  
Sbjct  193  LWTVSVHKIIAAIAMGIALLRMLPNRPFLSCMAYAFVFGISSPVGVGVGITIDSTTQGAT  252

Query  387  ADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIW  208
            ADW++AIS+G++CGVFIYVSINHLLSKGY  Q+ V+VDKPH+KFLAVL GIGVI+V M W
Sbjct  253  ADWLFAISIGLSCGVFIYVSINHLLSKGYTAQQAVSVDKPHYKFLAVLFGIGVISVAMFW  312

Query  207  DT  202
            D+
Sbjct  313  DS  314



>ref|XP_006645396.1| PREDICTED: zinc transporter 1-like [Oryza brachyantha]
Length=344

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = -3

Query  684  LHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLR  505
            + +SS  D++LLI ALCFHSVFEGIAIGV+ TK++AW+ LWT+ LHKIFAA+AMGIALLR
Sbjct  185  VRSSSFEDAVLLIVALCFHSVFEGIAIGVSATKSEAWRNLWTIGLHKIFAAVAMGIALLR  244

Query  504  MIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSI  325
            MIP RP L  + YS AFA+SSPVGV IGI IDAT QG+ ADW YAISMG+A GVFIYV+I
Sbjct  245  MIPKRPFLMTVVYSLAFAVSSPVGVGIGIAIDATAQGRAADWTYAISMGLATGVFIYVAI  304

Query  324  NHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            NHL++KGY+  +  A DKP FKFLAVLLG+ V+AVVMIWD
Sbjct  305  NHLIAKGYRTHRPTAADKPSFKFLAVLLGVAVMAVVMIWD  344



>ref|NP_001045540.1| Os01g0972200 [Oryza sativa Japonica Group]
 sp|Q94DG6.1|ZIP1_ORYSJ RecName: Full=Zinc transporter 1; AltName: Full=ZRT/IRT-like 
protein 1; Short=OsZIP1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB63683.1| zinc transporter [Oryza sativa Japonica Group]
 gb|AAP59425.1| zinc transporter [Oryza sativa Japonica Group]
 dbj|BAF07454.1| Os01g0972200 [Oryza sativa Japonica Group]
Length=352

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  687  FLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALL  508
             +  SS  D++LLI ALCFHSVFEGIAIGV+ +K++AW+ LWT+ LHKIFAA+AMGIALL
Sbjct  192  LVRTSSFEDAVLLIVALCFHSVFEGIAIGVSASKSEAWRNLWTIGLHKIFAAVAMGIALL  251

Query  507  RMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVS  328
            RMIP RP L  + YS AFA+SSPVGV IGI IDAT+QG+ ADW YAISMG+A GVFIYV+
Sbjct  252  RMIPKRPFLMTVVYSLAFAVSSPVGVGIGIAIDATSQGRAADWTYAISMGLATGVFIYVA  311

Query  327  INHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            INHL++KGY+P    A DKP FKFLAVLLG+ V+AVVMIWD
Sbjct  312  INHLIAKGYRPHHPTAADKPLFKFLAVLLGVAVMAVVMIWD  352



>gb|EAY77405.1| hypothetical protein OsI_05394 [Oryza sativa Indica Group]
Length=352

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  687  FLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALL  508
             +  SS  D++LLI ALCFHSVFEGIAIGV+ +K++AW+ LWT+ LHKIFAA+AMGIALL
Sbjct  192  LVRTSSFEDAVLLIVALCFHSVFEGIAIGVSASKSEAWRNLWTIGLHKIFAAVAMGIALL  251

Query  507  RMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVS  328
            RMIP RP L  + YS AFA+SSPVGV IGI IDAT+QG+ ADW YAISMG+A GVFIYV+
Sbjct  252  RMIPKRPFLMTVVYSLAFAVSSPVGVGIGIAIDATSQGRAADWTYAISMGLATGVFIYVA  311

Query  327  INHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            INHL++KGY+P    A DKP FKFLAVLLG+ V+AVVMIWD
Sbjct  312  INHLIAKGYRPHHPTAADKPLFKFLAVLLGVAVMAVVMIWD  352



>ref|XP_007020537.1| Zinc transporter 11 precursor [Theobroma cacao]
 gb|EOY12062.1| Zinc transporter 11 precursor [Theobroma cacao]
Length=318

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  591  TKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIII  412
            T+ADAWKALWT+ LHKIFAAIAMGIALLRMIP+RPLLSC+AY+FAFAISSPVGVAIGIII
Sbjct  189  TEADAWKALWTISLHKIFAAIAMGIALLRMIPDRPLLSCVAYAFAFAISSPVGVAIGIII  248

Query  411  DATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIG  232
            DATTQG VADWI+AISMG+ACGVFIYVSINHLLSKGY PQKTV+VD PH KF AVLLG+G
Sbjct  249  DATTQGAVADWIFAISMGLACGVFIYVSINHLLSKGYTPQKTVSVDTPHHKFFAVLLGVG  308

Query  231  VIAVVMIWDT  202
            VIAVVMIWDT
Sbjct  309  VIAVVMIWDT  318



>ref|XP_004291560.1| PREDICTED: zinc transporter 11-like [Fragaria vesca subsp. vesca]
Length=324

 Score =   238 bits (607),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 149/187 (80%), Gaps = 1/187 (1%)
 Frame = -3

Query  762  GRNFNGIGTTHPQSQLQGCDGTESHFLHA-SSLGDSLLLIFALCFHSVFEGIAIGVADTK  586
            G+  +       Q + +   G ++H + A  S GD++LL+ ALCFHS FEGIAIG+A TK
Sbjct  138  GKQKSSTSDPEVQGKEEAHKGHDTHHIAAVGSFGDTILLVVALCFHSFFEGIAIGIAKTK  197

Query  585  ADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDA  406
             DAWKALWTVCLHKI AAIAM IALLRMIP+RP +SC+AY+F FA+SSPVGV +GIIIDA
Sbjct  198  PDAWKALWTVCLHKIIAAIAMSIALLRMIPSRPFISCMAYAFVFAVSSPVGVGVGIIIDA  257

Query  405  TTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVI  226
            TTQG  ADW++AIS+G+ACGVFI+VS+NHLL+KGY  Q  ++VDKP +KFLAV+ GIGVI
Sbjct  258  TTQGATADWMFAISIGLACGVFIFVSVNHLLAKGYTAQNAISVDKPQYKFLAVVFGIGVI  317

Query  225  AVVMIWD  205
            +V MIWD
Sbjct  318  SVAMIWD  324



>gb|AHU86548.1| ZIP4 [Marchantia polymorpha]
Length=361

 Score =   239 bits (610),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = -3

Query  672  SLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPN  493
            S GD++LL+FALCFHS+FEGIAIGVA T  DAW++LWT+ LHK+FAAIAMGIALLR+IP+
Sbjct  206  SFGDAVLLVFALCFHSIFEGIAIGVAATTKDAWRSLWTITLHKVFAAIAMGIALLRIIPD  265

Query  492  RPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLL  313
            RPL SC AYSFAFAISSP+GVAIGI+ID T+QG  ADWIYA+SMG A GVFIYV+INHLL
Sbjct  266  RPLWSCAAYSFAFAISSPIGVAIGILIDQTSQGNTADWIYAVSMGFAAGVFIYVAINHLL  325

Query  312  SKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            +KGY P   + VD+P +KFL V +G+ V++VVMIWD
Sbjct  326  AKGYTPPCKIGVDQPFYKFLFVTVGVAVMSVVMIWD  361



>gb|EPS59794.1| hypothetical protein M569_15010, partial [Genlisea aurea]
Length=284

 Score =   236 bits (603),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = -3

Query  702  GTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAM  523
            G +  F+  +++GD++LLI ALCFHS+FEG+A+G++DTK+ AWK LW + LHK+FAAIAM
Sbjct  119  GHQIVFVRTTNVGDTILLILALCFHSIFEGLAVGISDTKSSAWKGLWVILLHKVFAAIAM  178

Query  522  GIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGV  343
            GIALL+M+P RP L+  AYSF FAISSP+GV IGI +DATT+G  A+W YAISMGIACGV
Sbjct  179  GIALLKMLPTRPFLTTAAYSFIFAISSPIGVGIGIALDATTEGAGANWTYAISMGIACGV  238

Query  342  FIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            FI+V++NHL++KGYKPQ+ +A D P +KF AVL G+ +IA+VMIWD
Sbjct  239  FIFVAVNHLIAKGYKPQQKLAFDTPFYKFFAVLAGVTLIAIVMIWD  284



>ref|XP_010685717.1| PREDICTED: zinc transporter 2 [Beta vulgaris subsp. vulgaris]
Length=349

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 136/170 (80%), Gaps = 3/170 (2%)
 Frame = -3

Query  705  DGTESH---FLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFA  535
            DG   H   F+  +S+G++ LLI ALCFHSVFEGIA+G+AD + DAWK LWT+ LHK+F 
Sbjct  180  DGAVEHSPMFIRTTSVGNTFLLIAALCFHSVFEGIAVGIADNERDAWKNLWTISLHKVFG  239

Query  534  AIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGI  355
            AIAMGIALLRMIP RPLL+ +AYSF+FAISSP+GV IG+ IDATT+G+ ADW YAISMG 
Sbjct  240  AIAMGIALLRMIPKRPLLATVAYSFSFAISSPIGVGIGMAIDATTEGRAADWTYAISMGF  299

Query  354  ACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            A G+FIY++INHL+SKGYKP      D P ++F AV LG+ V+A+VMIWD
Sbjct  300  ATGIFIYIAINHLISKGYKPHSPCYFDTPFYRFFAVFLGVTVLAIVMIWD  349



>ref|XP_002987094.1| hypothetical protein SELMODRAFT_235171 [Selaginella moellendorffii]
 gb|EFJ11937.1| hypothetical protein SELMODRAFT_235171 [Selaginella moellendorffii]
Length=352

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -3

Query  675  SSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIP  496
            +S GDSLLLI ALCFHSVFEGIAIG+A    DAW+ LWT+CLHK+FAAIAMGIALL+++P
Sbjct  196  ASFGDSLLLIIALCFHSVFEGIAIGIAGKLRDAWRNLWTICLHKLFAAIAMGIALLKIMP  255

Query  495  NRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHL  316
            NRPLLS   YSFAFAIS+P+GVAIGIIID+T QG  ADWIYAISMGIACGVF+YV+INHL
Sbjct  256  NRPLLSTSLYSFAFAISTPIGVAIGIIIDSTAQGAAADWIYAISMGIACGVFVYVAINHL  315

Query  315  LSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            L+KG+ P +    D   ++FLAV+LG  VIAVVMIWD
Sbjct  316  LAKGFVPDRASFWDTSFYRFLAVVLGAAVIAVVMIWD  352



>ref|XP_002459178.1| hypothetical protein SORBIDRAFT_03g047340 [Sorghum bicolor]
 gb|EES04298.1| hypothetical protein SORBIDRAFT_03g047340 [Sorghum bicolor]
Length=361

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 143/194 (74%), Gaps = 8/194 (4%)
 Frame = -3

Query  774  VNTEGRNFNGIGTTHPQSQLQGCDGTESHF-----LHASSLGDSLLLIFALCFHSVFEGI  610
            VN   R     G    Q+Q +  D   +       +  +S  D++LLIFALCFHS+FEGI
Sbjct  170  VNEAARE---EGDARHQTQTKQEDAAHARHPMLVTVRTASFEDAVLLIFALCFHSIFEGI  226

Query  609  AIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGV  430
            AIGV+ TK+DAW+ LWT+ LHK+FAA+AMGIALLRMIP RP L  +AYS AFA+SSPVGV
Sbjct  227  AIGVSATKSDAWRNLWTIGLHKVFAAVAMGIALLRMIPKRPFLMTVAYSLAFAVSSPVGV  286

Query  429  AIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLA  250
             IGI IDAT +G+ ADW +AISMG A GVF+YV+INHL++KGY+PQ+   VD P FKFL 
Sbjct  287  GIGIGIDATAEGRAADWTFAISMGFATGVFLYVAINHLIAKGYRPQEPTRVDSPSFKFLG  346

Query  249  VLLGIGVIAVVMIW  208
            VLLG+ V+AVVMIW
Sbjct  347  VLLGVAVMAVVMIW  360



>ref|XP_010270211.1| PREDICTED: zinc transporter 2-like isoform X2 [Nelumbo nucifera]
Length=474

 Score =   239 bits (610),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 140/176 (80%), Gaps = 8/176 (5%)
 Frame = -3

Query  705  DGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIA  526
            D  E+      SLGDS+LLI ALCFHSVFEGIAIGVA+TKA+AW+A+WTV LHKIFAA+ 
Sbjct  298  DFVETSLATVRSLGDSILLIVALCFHSVFEGIAIGVAETKANAWRAVWTVSLHKIFAAVG  357

Query  525  MGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACG  346
            MGIALLRMIP+RPL SCIAY+FAFAISSP GV IGI+ID+TT+G VADWIYA+SMG+A G
Sbjct  358  MGIALLRMIPDRPLSSCIAYAFAFAISSPSGVVIGIVIDSTTRGVVADWIYAVSMGLASG  417

Query  345  VFIYVSINHLLSKG--YKPQKTVAVDKPH------FKFLAVLLGIGVIAVVMIWDT  202
            VFIYV +NHLLSKG  Y PQ     D+          FLAVL G+GVIAVVMIWDT
Sbjct  418  VFIYVCVNHLLSKGYTYTPQSQSQRDRHRQGESSFCNFLAVLSGVGVIAVVMIWDT  473



>ref|XP_010270210.1| PREDICTED: zinc transporter 2-like isoform X1 [Nelumbo nucifera]
Length=475

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 140/176 (80%), Gaps = 8/176 (5%)
 Frame = -3

Query  705  DGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIA  526
            D  E+      SLGDS+LLI ALCFHSVFEGIAIGVA+TKA+AW+A+WTV LHKIFAA+ 
Sbjct  299  DFVETSLATVRSLGDSILLIVALCFHSVFEGIAIGVAETKANAWRAVWTVSLHKIFAAVG  358

Query  525  MGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACG  346
            MGIALLRMIP+RPL SCIAY+FAFAISSP GV IGI+ID+TT+G VADWIYA+SMG+A G
Sbjct  359  MGIALLRMIPDRPLSSCIAYAFAFAISSPSGVVIGIVIDSTTRGVVADWIYAVSMGLASG  418

Query  345  VFIYVSINHLLSKG--YKPQKTVAVDKPH------FKFLAVLLGIGVIAVVMIWDT  202
            VFIYV +NHLLSKG  Y PQ     D+          FLAVL G+GVIAVVMIWDT
Sbjct  419  VFIYVCVNHLLSKGYTYTPQSQSQRDRHRQGESSFCNFLAVLSGVGVIAVVMIWDT  474



>ref|XP_006400951.1| hypothetical protein EUTSA_v10013963mg [Eutrema salsugineum]
 gb|ESQ42404.1| hypothetical protein EUTSA_v10013963mg [Eutrema salsugineum]
Length=353

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 142/193 (74%), Gaps = 11/193 (6%)
 Frame = -3

Query  783  ELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAI  604
            ++ V  EGR   G G    Q+ L+            S  GD+ LLI ALCFHSVFEGIAI
Sbjct  172  DVAVKEEGRREIGRGVDVNQAILR-----------TSGFGDTALLILALCFHSVFEGIAI  220

Query  603  GVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAI  424
            GV+DTK+DAW+ LWT+ +HKIFAA+AMGIALL++IP RP    + YSFAF ISSP+GV I
Sbjct  221  GVSDTKSDAWRNLWTISMHKIFAAVAMGIALLKLIPKRPFFLTVVYSFAFGISSPLGVGI  280

Query  423  GIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVL  244
            GI I+AT+QG   DW YAISM IACGVF+YV++NHL+ KGYKP++    DKP +KFLAVL
Sbjct  281  GIGINATSQGAAGDWTYAISMSIACGVFVYVAVNHLIGKGYKPREECYFDKPIYKFLAVL  340

Query  243  LGIGVIAVVMIWD  205
            LG+ ++++VMIWD
Sbjct  341  LGVTLLSIVMIWD  353



>ref|XP_010920539.1| PREDICTED: zinc transporter 1 [Elaeis guineensis]
Length=423

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  642  ALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYS  463
            ALCFHSVFEGIA+GVADTKA AW+ LWT+ LHKIFAAIAMGIALLRM+P RP L  + YS
Sbjct  278  ALCFHSVFEGIAVGVADTKASAWRNLWTISLHKIFAAIAMGIALLRMLPKRPFLMTVVYS  337

Query  462  FAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTV  283
             AFAISSP+GV IGI IDATTQG VADWIYAISMG+ACGVFIYV+INHL+SKG+KPQ+  
Sbjct  338  LAFAISSPIGVGIGIAIDATTQGPVADWIYAISMGLACGVFIYVAINHLISKGFKPQEPS  397

Query  282  AVDKPHFKFLAVLLGIGVIAVVMIWD  205
              D P FKF AVL+G+ +IAVVMIWD
Sbjct  398  YFDTPFFKFFAVLIGVAIIAVVMIWD  423



>ref|XP_001777685.1| predicted protein [Physcomitrella patens]
 gb|EDQ57465.1| predicted protein [Physcomitrella patens]
Length=321

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 138/179 (77%), Gaps = 2/179 (1%)
 Frame = -3

Query  738  TTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWT  559
             +H  + +    G     +H +S GD+L+LI ALCFHSVFEGIAIGVA+TK DAWK LWT
Sbjct  145  NSHAPASVDEVKGVT--LMHRTSFGDALILILALCFHSVFEGIAIGVAETKQDAWKVLWT  202

Query  558  VCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADW  379
            + LHK+FAA+AMG+ALLRM+PNRPL+SC +Y+  FAIS+P+GVAIGIIIDATTQG  ADW
Sbjct  203  ISLHKVFAALAMGVALLRMLPNRPLVSCFSYALVFAISTPIGVAIGIIIDATTQGVTADW  262

Query  378  IYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            +YAISMG+A GVFIYV+INHLL+KG        +++P  KF AV LG   IAVVMIWD 
Sbjct  263  VYAISMGMASGVFIYVAINHLLAKGDVSPPKNCLNEPFHKFTAVTLGAATIAVVMIWDN  321



>gb|ABF55691.1| putative zinc transporter [Triticum aestivum]
 emb|CDM87069.1| unnamed protein product [Triticum aestivum]
Length=355

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -3

Query  675  SSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIP  496
            SS  D++LLIFALCFHS+FEGIAIGV+ TK +AW+ LWT+ LHKIFAA+AMGIALLRMIP
Sbjct  199  SSFEDAILLIFALCFHSIFEGIAIGVSATKGEAWRNLWTIGLHKIFAAVAMGIALLRMIP  258

Query  495  NRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHL  316
             RP L  + YS AFA+SSPVGV IGI IDAT +G  ADW YAISMGIA G+F+YV+INHL
Sbjct  259  KRPFLMTVLYSLAFAVSSPVGVGIGIAIDATAEGPAADWTYAISMGIATGIFVYVAINHL  318

Query  315  LSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            +++GY+PQ+    DKP FKFL VL G+ V+AVVMIWD
Sbjct  319  MARGYRPQQPNYFDKPIFKFLGVLTGVAVMAVVMIWD  355



>emb|CDY48680.1| BnaC02g09920D [Brassica napus]
Length=356

 Score =   233 bits (595),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 141/195 (72%), Gaps = 11/195 (6%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGI  610
            D+ ++V  EGR   G      Q+            L  S  GD+ LLI ALCFHSVFEGI
Sbjct  173  DVAVEVKEEGRRETGSSVDVNQT-----------ILRKSGFGDTALLIVALCFHSVFEGI  221

Query  609  AIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGV  430
            AIGV+DTK+DAW+ LWT+ LHKIFAA+AMGIALL++IP RP      YSFAF ISSP+GV
Sbjct  222  AIGVSDTKSDAWRNLWTISLHKIFAAVAMGIALLKLIPKRPFFLTAVYSFAFGISSPLGV  281

Query  429  AIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLA  250
             IGI I+AT+QG   DW YAISM IACGVF+YVSI+HL++KGYKP++    DKP +KFLA
Sbjct  282  GIGIAINATSQGAAGDWTYAISMSIACGVFMYVSIHHLIAKGYKPREECYFDKPIYKFLA  341

Query  249  VLLGIGVIAVVMIWD  205
            V LG+ ++++VMIWD
Sbjct  342  VFLGVILLSIVMIWD  356



>ref|XP_003569091.1| PREDICTED: zinc transporter 1-like [Brachypodium distachyon]
Length=360

 Score =   233 bits (595),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = -3

Query  678  ASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMI  499
            A+S  D++LLI ALCFHSVFEGIAIGV+ TK +AW+ LWT+ LHKIFAA+AMGIALLRMI
Sbjct  203  AASFEDAVLLIVALCFHSVFEGIAIGVSATKDEAWRNLWTIGLHKIFAAVAMGIALLRMI  262

Query  498  PNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINH  319
            P RP L  + YS AFA+SSP+GV IGI IDATT+G  ADW YAISMGIA GVF+YV++NH
Sbjct  263  PKRPFLMTVLYSLAFAVSSPIGVGIGIAIDATTEGLAADWTYAISMGIATGVFVYVAVNH  322

Query  318  LLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            L++KGY+PQ+    DKP FKFL+ LLGI V+A+VMIWD
Sbjct  323  LMAKGYRPQQPNYFDKPIFKFLSALLGIAVMAIVMIWD  360



>gb|EMT15508.1| Zinc transporter 2 [Aegilops tauschii]
Length=349

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -3

Query  675  SSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIP  496
            SS  D++LLI ALCFHS+FEGIAIGV+ TK +AW+ LWT+ LHKIFAA+AMGIALLRMIP
Sbjct  193  SSFEDAILLIVALCFHSIFEGIAIGVSATKGEAWRNLWTIGLHKIFAAVAMGIALLRMIP  252

Query  495  NRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHL  316
             RP L  + YS AFA+SSPVGV IGI IDAT +G  ADW YAISMGIA GVF+YV+INHL
Sbjct  253  KRPFLMTVLYSLAFAVSSPVGVGIGIAIDATAEGPAADWTYAISMGIATGVFVYVAINHL  312

Query  315  LSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            ++KGY+PQ+    DKP FKFL VL GI V++VVMIWD
Sbjct  313  MAKGYRPQQPNYFDKPIFKFLGVLTGIAVMSVVMIWD  349



>ref|XP_009126693.1| PREDICTED: zinc transporter 2 [Brassica rapa]
Length=356

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 140/195 (72%), Gaps = 11/195 (6%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGI  610
            D  ++V  EGR   G      Q+            L  S  GD+ LLI ALCFHSVFEGI
Sbjct  173  DDAVEVKEEGRRETGSSVDVNQT-----------ILRTSGFGDTALLIVALCFHSVFEGI  221

Query  609  AIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGV  430
            AIGV+DTK+DAW+ LWT+ LHKIFAA+AMGIALL++IP RP      YSFAF ISSP+GV
Sbjct  222  AIGVSDTKSDAWRNLWTISLHKIFAAVAMGIALLKLIPKRPFFLTAVYSFAFGISSPLGV  281

Query  429  AIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLA  250
             IGI I+AT+QG   DW YAISM IACGVF+YVSI+HL++KGYKP++    DKP +KFLA
Sbjct  282  GIGIAINATSQGAAGDWTYAISMSIACGVFMYVSIHHLIAKGYKPREGCYFDKPIYKFLA  341

Query  249  VLLGIGVIAVVMIWD  205
            V LG+ ++++VMIWD
Sbjct  342  VFLGVILLSIVMIWD  356



>ref|XP_001755316.1| predicted protein [Physcomitrella patens]
 gb|EDQ79796.1| predicted protein [Physcomitrella patens]
Length=341

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 142/176 (81%), Gaps = 1/176 (1%)
 Frame = -3

Query  732  HPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVC  553
               +QL   DG +      +S GD+LLLI ALCFHSVFEGIAIGV+ TK DAWKA WT+ 
Sbjct  166  RSSAQLGSLDGEKDGAAKLASFGDTLLLILALCFHSVFEGIAIGVSVTKQDAWKAFWTIT  225

Query  552  LHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIY  373
            LHK+FAAIAMGIALLRM+PNRPLLSC  YSFAFAIS+P+G+AIGIIIDATT+G VADWIY
Sbjct  226  LHKVFAAIAMGIALLRMLPNRPLLSCFCYSFAFAISTPIGIAIGIIIDATTEGAVADWIY  285

Query  372  AISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            AI+MG+A GVFIYV+INHLL K Y P KT +V++P  KF+A+ LG   +A+VMIWD
Sbjct  286  AIAMGLATGVFIYVAINHLLGKEYMPSKT-SVEQPFKKFIALTLGAATMAIVMIWD  340



>emb|CDY53449.1| BnaA02g07030D [Brassica napus]
Length=356

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 139/195 (71%), Gaps = 11/195 (6%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGI  610
            D  ++V  EGR            + +         L  S  GD+ LLI ALCFHSVFEGI
Sbjct  173  DDAVEVKEEGRR-----------ETRSSVDVNQTILRTSGFGDTALLIVALCFHSVFEGI  221

Query  609  AIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGV  430
            AIGV+DTK+DAW+ LWT+ LHKIFAA+AMGIALL++IP RP      YSFAF ISSP+GV
Sbjct  222  AIGVSDTKSDAWRNLWTISLHKIFAAVAMGIALLKLIPKRPFFLTAVYSFAFGISSPLGV  281

Query  429  AIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLA  250
             IGI I+AT+QG   DW YAISM IACGVF+YVSI+HL++KGYKP++    DKP +KFLA
Sbjct  282  GIGIAINATSQGAAGDWTYAISMSIACGVFMYVSIHHLIAKGYKPREGCYFDKPIYKFLA  341

Query  249  VLLGIGVIAVVMIWD  205
            V LG+ ++++VMIWD
Sbjct  342  VFLGVILLSIVMIWD  356



>ref|XP_006282282.1| hypothetical protein CARUB_v10028566mg [Capsella rubella]
 gb|EOA15180.1| hypothetical protein CARUB_v10028566mg [Capsella rubella]
Length=348

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 130/160 (81%), Gaps = 0/160 (0%)
 Frame = -3

Query  684  LHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLR  505
            +  S  GD+ LLIFALCFHS+FEGIAIG++ TK+DAW+ LWT+ LHK+FAA+AMGIALL+
Sbjct  189  IRTSGFGDTALLIFALCFHSIFEGIAIGLSVTKSDAWRNLWTISLHKVFAAVAMGIALLK  248

Query  504  MIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSI  325
            +IP RP    + YSFAF ISSP+GV IGI I+AT+QG   DW YAISM +ACGVF+YV++
Sbjct  249  LIPKRPFFLTVLYSFAFGISSPIGVGIGIAINATSQGAAGDWTYAISMSLACGVFVYVAV  308

Query  324  NHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            NHL+SKGYKP++    DKP +KFLAV LG+ +++ VMIWD
Sbjct  309  NHLISKGYKPREKCYFDKPIYKFLAVFLGVALLSFVMIWD  348



>ref|XP_010455125.1| PREDICTED: zinc transporter 2 [Camelina sativa]
Length=355

 Score =   224 bits (571),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 141/195 (72%), Gaps = 10/195 (5%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGI  610
            D ++ V  EG         H + +  G D  +   L  +  GD+ LLIFALCFHS+FEGI
Sbjct  171  DDDVAVKEEG---------HREIRSTGVDVNQV-ILRTTGFGDTALLIFALCFHSIFEGI  220

Query  609  AIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGV  430
            AIG+++TK+DAW+ LWT+ LHK+FAA+AMGIALL++IP RP    + YSFAF ISSP+GV
Sbjct  221  AIGLSETKSDAWRNLWTISLHKVFAAVAMGIALLKLIPKRPFFLTVVYSFAFGISSPLGV  280

Query  429  AIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLA  250
             IGI I+AT+QG   DW YAISM +ACGVF+YV++NHL+SKGYKP++    DKP +KFL 
Sbjct  281  GIGIGINATSQGAAGDWTYAISMSLACGVFVYVAVNHLISKGYKPREKCYFDKPVYKFLD  340

Query  249  VLLGIGVIAVVMIWD  205
            V LG+ +++ VMI D
Sbjct  341  VFLGVALLSFVMIGD  355



>ref|NP_200760.1| zinc transporter 2 [Arabidopsis thaliana]
 sp|Q9LTH9.1|ZIP2_ARATH RecName: Full=Zinc transporter 2; AltName: Full=ZRT/IRT-like 
protein 2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA97486.1| zinc transporter [Arabidopsis thaliana]
 dbj|BAE99882.1| putative zinc transporter ZIP2 - like [Arabidopsis thaliana]
 gb|AED97200.1| ZRT/IRT-like protein 2 [Arabidopsis thaliana]
Length=353

 Score =   223 bits (568),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 146/195 (75%), Gaps = 11/195 (6%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGI  610
            D ++ V  EGR          +    G D +++  +  S  GD+ LLIFALCFHS+FEGI
Sbjct  170  DDDVAVKEEGR----------REIKSGVDVSQA-LIRTSGFGDTALLIFALCFHSIFEGI  218

Query  609  AIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGV  430
            AIG++DTK+DAW+ LWT+ LHK+FAA+AMGIALL++IP RP    + YSFAF ISSP+GV
Sbjct  219  AIGLSDTKSDAWRNLWTISLHKVFAAVAMGIALLKLIPKRPFFLTVVYSFAFGISSPIGV  278

Query  429  AIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLA  250
             IGI I+AT+QG   DW YAISMG+ACGVF+YV++NHL+SKGYKP++    DKP +KF+A
Sbjct  279  GIGIGINATSQGAGGDWTYAISMGLACGVFVYVAVNHLISKGYKPREECYFDKPIYKFIA  338

Query  249  VLLGIGVIAVVMIWD  205
            V LG+ +++VVMIWD
Sbjct  339  VFLGVALLSVVMIWD  353



>ref|XP_002866334.1| hypothetical protein ARALYDRAFT_496085 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42593.1| hypothetical protein ARALYDRAFT_496085 [Arabidopsis lyrata subsp. 
lyrata]
Length=349

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 145/195 (74%), Gaps = 11/195 (6%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGI  610
            D E  V  EGR          +    G D +++  +  S  GD+ LLIFALCFHS+FEGI
Sbjct  166  DDEAAVKEEGR----------REIKSGVDVSQA-LIRTSGYGDTALLIFALCFHSIFEGI  214

Query  609  AIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGV  430
            AIG+++TK+DAW+ LWT+ LHK+FAA+AMGIALL++IP RP    + YSFAF ISSP+GV
Sbjct  215  AIGLSETKSDAWRNLWTISLHKVFAAVAMGIALLKLIPKRPFFLTVVYSFAFGISSPIGV  274

Query  429  AIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLA  250
             IGI I+AT+QG   DW YAISMG+ACGVF+YV++NHL+SKGYKP++    DKP +KF+A
Sbjct  275  GIGIGINATSQGAGGDWTYAISMGLACGVFVYVAVNHLISKGYKPREECYFDKPIYKFIA  334

Query  249  VLLGIGVIAVVMIWD  205
            V LG+ +++VVMIWD
Sbjct  335  VFLGVALLSVVMIWD  349



>gb|AAC24198.1| putative zinc transporter [Arabidopsis thaliana]
Length=353

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 145/195 (74%), Gaps = 11/195 (6%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGI  610
            D ++ V  EGR          +    G D +++  +  S  GD+ LLIFALCFHS+FEGI
Sbjct  170  DDDVAVKEEGR----------REIKSGVDVSQA-LIRTSGFGDTALLIFALCFHSIFEGI  218

Query  609  AIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGV  430
            AIG++DTK+DAW+ LWT+ LHK+FAA+AMGIALL++IP RP    + YSFAF ISSP+GV
Sbjct  219  AIGLSDTKSDAWRNLWTISLHKVFAAVAMGIALLKLIPKRPFFLTVVYSFAFGISSPIGV  278

Query  429  AIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLA  250
             IGI I+AT+QG   DW YAISMG+ACGVF+YV++NHL+SKGYKP +    DKP +KF+A
Sbjct  279  GIGIGINATSQGAGGDWTYAISMGLACGVFVYVAVNHLISKGYKPLEECYFDKPIYKFIA  338

Query  249  VLLGIGVIAVVMIWD  205
            V LG+ +++VVMIWD
Sbjct  339  VFLGVALLSVVMIWD  353



>gb|ABB55331.1| Zinc transporter, putative [Asparagus officinalis]
Length=662

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -3

Query  594  DTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGII  415
            + KADAWKALWT+ LHKIFAAIAMGIALLRMIP+RPL+SC AY+FAFAISSPVGVAIGII
Sbjct  532  ENKADAWKALWTISLHKIFAAIAMGIALLRMIPDRPLISCAAYAFAFAISSPVGVAIGII  591

Query  414  IDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGI  235
            IDATT+G VADWI+AISMGIACG+FIYV+INHLL+KGY+PQ+ VAV+ P +++LA++LGI
Sbjct  592  IDATTEGHVADWIFAISMGIACGIFIYVAINHLLAKGYQPQQPVAVNTPMYRWLALVLGI  651

Query  234  GVIAVVMIWDT  202
            GVIAVVMIWDT
Sbjct  652  GVIAVVMIWDT  662



>ref|XP_010043503.1| PREDICTED: LOW QUALITY PROTEIN: zinc transporter 2 [Eucalyptus 
grandis]
Length=324

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 139/193 (72%), Gaps = 22/193 (11%)
 Frame = -3

Query  783  ELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAI  604
            +++V  EG    G    +P+++    +     FL  +SLGD++LL+              
Sbjct  154  KVRVAEEG----GPDENNPRAK----EDVNPMFLQTTSLGDTILLL--------------  191

Query  603  GVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAI  424
            GV+ TK+DAW+ LWT+ LHKIFAAI+MGIALL+M+P RP L   AYSFAFAISSP+GV I
Sbjct  192  GVSVTKSDAWRNLWTISLHKIFAAISMGIALLKMLPTRPFLMTAAYSFAFAISSPIGVGI  251

Query  423  GIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVL  244
            GI IDATT+G VADWIYAISMGIACGVFIYV+INHL++KG+KPQ   A D P +KFLAVL
Sbjct  252  GIAIDATTEGHVADWIYAISMGIACGVFIYVAINHLIAKGFKPQNKCAFDTPFYKFLAVL  311

Query  243  LGIGVIAVVMIWD  205
            LG+ +IAVVM WD
Sbjct  312  LGVAIIAVVMTWD  324



>ref|XP_010483591.1| PREDICTED: zinc transporter 2-like [Camelina sativa]
 ref|XP_010483592.1| PREDICTED: zinc transporter 2-like [Camelina sativa]
Length=357

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = -3

Query  732  HPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVC  553
            H + +  G D  +   L  +  GD+ LLIFALCFHS+FEGIAIG+++TK+DAW+ LWT+ 
Sbjct  183  HREIRSTGVDVNQV-ILRTTGFGDTALLIFALCFHSIFEGIAIGLSETKSDAWRNLWTIS  241

Query  552  LHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIY  373
            LHK+FAA+AMGIALL++IP RP    + YS AF ISSP+GV IGI I+AT+QG   DW Y
Sbjct  242  LHKVFAAVAMGIALLKLIPKRPFFLTVVYSLAFGISSPIGVGIGIGINATSQGAAGDWTY  301

Query  372  AISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            AISM +ACGVF+YV++NHL+SKGYKP++    DKP +KFLAV LG+ +++ VMIWD
Sbjct  302  AISMSLACGVFVYVAVNHLISKGYKPREKCYFDKPVYKFLAVFLGVALLSFVMIWD  357



>ref|XP_010443712.1| PREDICTED: zinc transporter 2-like [Camelina sativa]
Length=358

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = -3

Query  732  HPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVC  553
            H + +  G D  +   L  +  GD+ LLIFALCFHS+FEGIAIG+++TK+DAW+ LWT+ 
Sbjct  184  HREIRSTGVDVNQV-ILRTTGFGDTALLIFALCFHSIFEGIAIGLSETKSDAWRNLWTIS  242

Query  552  LHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIY  373
            LHK+FAA+AMGIALL++IP RP    + YS AF ISSP+GV IGI I+AT+QG   DW Y
Sbjct  243  LHKVFAAVAMGIALLKLIPKRPFFLTVVYSLAFGISSPIGVGIGIGINATSQGAAGDWTY  302

Query  372  AISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            AISM +ACGVF+YV++NHL+SKGYKP++    DKP +KFLAV LG+ +++ VMIWD
Sbjct  303  AISMSLACGVFVYVAVNHLISKGYKPREKCYFDKPVYKFLAVFLGVALLSFVMIWD  358



>emb|CAN72193.1| hypothetical protein VITISV_022309 [Vitis vinifera]
Length=1218

 Score =   227 bits (579),  Expect = 6e-64, Method: Composition-based stats.
 Identities = 108/154 (70%), Positives = 122/154 (79%), Gaps = 13/154 (8%)
 Frame = -3

Query  627   SVFEGIAIGVA-------------DTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRP  487
             SVFEGIAIGV+              TKA+AW+ LWT+ LHKIFAAIAMGIALLRM P RP
Sbjct  1065  SVFEGIAIGVSASADSILTSLCSSGTKAEAWRNLWTISLHKIFAAIAMGIALLRMXPKRP  1124

Query  486   LLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSK  307
              ++  AYSFAFA+SSP GV IGI IDATTQGK ADWIYAISMG+ACGVFIYV+INHL++K
Sbjct  1125  FVTTAAYSFAFAVSSPXGVGIGIAIDATTQGKAADWIYAISMGLACGVFIYVAINHLVAK  1184

Query  306   GYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
             G+KPQ  +  D P FKFLAVL G+GVIAVVMIWD
Sbjct  1185  GFKPQTQLYFDTPFFKFLAVLAGVGVIAVVMIWD  1218



>ref|XP_010106524.1| Zinc transporter 1 [Morus notabilis]
 gb|EXC10700.1| Zinc transporter 1 [Morus notabilis]
Length=417

 Score =   215 bits (547),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 138/193 (72%), Gaps = 9/193 (5%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGI  610
            D E +V  E     G  + H +   +   G    F+  +SLGD++LLI ALCFHSVFEGI
Sbjct  142  DREARVEIE----EGRSSDHDK---EAGTGVTPLFMQTASLGDTILLILALCFHSVFEGI  194

Query  609  AIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGV  430
            AIG+AD KA+AW+ LWT+ LHKIFAAIAMGIALLRM+P RPLL   AYSFAFAISSPVGV
Sbjct  195  AIGIADNKAEAWRNLWTISLHKIFAAIAMGIALLRMLPKRPLLVTAAYSFAFAISSPVGV  254

Query  429  AIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQ--KTVAVDKPHFKF  256
             IGI IDATTQG VADWIYAISMG+ACGVFIYV+INHL++K  K    + +     H  F
Sbjct  255  GIGIAIDATTQGAVADWIYAISMGLACGVFIYVAINHLIAKDNKADVWRNLWTISLHKIF  314

Query  255  LAVLLGIGVIAVV  217
             A+  GI ++ ++
Sbjct  315  AAIATGIAILRML  327


 Score =   180 bits (456),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 98/120 (82%), Gaps = 2/120 (2%)
 Frame = -3

Query  594  DTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGII  415
            D KAD W+ LWT+ LHKIFAAIA GIA+LRM+P RPLL   A+SF FAISSPVG+ IGI 
Sbjct  296  DNKADVWRNLWTISLHKIFAAIATGIAILRMLPKRPLLVTAAHSFVFAISSPVGIVIGIA  355

Query  414  IDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGI  235
            IDATTQG VADWIYAISMG+ACGVFIY  INHL++KG+KPQ     D P FKFLAVLLG+
Sbjct  356  IDATTQGAVADWIYAISMGLACGVFIY--INHLIAKGFKPQSKCHFDTPFFKFLAVLLGV  413



>gb|ABK23592.1| unknown [Picea sitchensis]
Length=352

 Score =   213 bits (541),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 131/174 (75%), Gaps = 15/174 (9%)
 Frame = -3

Query  678  ASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMI  499
            A++ G+S LLI ALCFHSVFEG+A+GVA++K  AW+ALWTVCLHK+FAA AM IALLRM 
Sbjct  179  AAATGESTLLILALCFHSVFEGMAVGVAESKGGAWRALWTVCLHKVFAATAMAIALLRMK  238

Query  498  PNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINH  319
            PNRP LSC+AY+FAF ISSPVGV+IGII+D+TT+G VA W++AI+MG+A G+FIYV++NH
Sbjct  239  PNRPFLSCVAYAFAFGISSPVGVSIGIIVDSTTEGPVARWLFAITMGLATGIFIYVALNH  298

Query  318  LLSKGY--KPQKTVAVDKPH-------------FKFLAVLLGIGVIAVVMIWDT  202
            +L   +   P+      +               + FLA LLG+GVIAV MIWDT
Sbjct  299  MLRGAHAQAPRNNSGTTREEDDDDGDDRHGPSLYNFLAFLLGVGVIAVAMIWDT  352



>gb|EMS61835.1| Zinc transporter 1 [Triticum urartu]
Length=398

 Score =   214 bits (544),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 123/150 (82%), Gaps = 2/150 (1%)
 Frame = -3

Query  675  SSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIP  496
            SS  D++LLI ALCFHS+FEGIAIGV+ TK +AW+ LWT+ LHKIFAA+AMGIALLRMIP
Sbjct  199  SSFEDAILLIIALCFHSIFEGIAIGVSATKGEAWRNLWTIGLHKIFAAVAMGIALLRMIP  258

Query  495  NRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHL  316
             RP L  + YS AFA+SSPVGV IGI IDAT +G  +DW YAISMGIA GVF+Y++INHL
Sbjct  259  KRPFLLTVLYSLAFAVSSPVGVGIGIAIDATAEG--SDWTYAISMGIATGVFVYIAINHL  316

Query  315  LSKGYKPQKTVAVDKPHFKFLAVLLGIGVI  226
            ++KGY+PQ+    DKP FKFL+VL GI VI
Sbjct  317  MAKGYRPQQPNYFDKPIFKFLSVLTGISVI  346



>gb|KCW85518.1| hypothetical protein EUGRSUZ_B02315 [Eucalyptus grandis]
Length=324

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 137/193 (71%), Gaps = 22/193 (11%)
 Frame = -3

Query  783  ELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAI  604
            +++V  EG    G    +P+++    +     FL  +SLGD++LL+      S F+ I  
Sbjct  154  KVRVAEEG----GPDENNPRAK----EDVNPMFLQTTSLGDTILLL------SEFQVIN-  198

Query  603  GVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAI  424
                   DAW+ LWT+ LHKIFAAI+MGIALL+M+P RP L   AYSFAFAISSP+GV I
Sbjct  199  -------DAWRNLWTISLHKIFAAISMGIALLKMLPTRPFLMTAAYSFAFAISSPIGVGI  251

Query  423  GIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVL  244
            GI IDATT+G VADWIYAISMGIACGVFIYV+INHL++KG+KPQ   A D P +KFLAVL
Sbjct  252  GIAIDATTEGHVADWIYAISMGIACGVFIYVAINHLIAKGFKPQNKCAFDTPFYKFLAVL  311

Query  243  LGIGVIAVVMIWD  205
            LG+ +IAVVM WD
Sbjct  312  LGVAIIAVVMTWD  324



>ref|XP_010274157.1| PREDICTED: zinc transporter 2-like [Nelumbo nucifera]
Length=190

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -3

Query  765  EGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTK  586
            E R+ N   +   + +    D  E+   +  SLG ++LLI ALCFHSVF+GIAIGVA+TK
Sbjct  32   EHRSHNNGDSKTTEIRDDHFDCVETSLANVHSLGYNILLIVALCFHSVFQGIAIGVAETK  91

Query  585  ADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDA  406
            ADAW+ALWTV LHKIFA   MGIALLRMIP+RPL SC+AY+FAFAISSP GV IGI+ID+
Sbjct  92   ADAWRALWTVSLHKIFATAGMGIALLRMIPDRPLSSCVAYAFAFAISSPSGVVIGIVIDS  151

Query  405  TTQGKVADWIYAISMGIACGVFIYVSINHLLSKGY  301
            TT G VADW Y +SMG+A GVFIY+ +NH+LS+GY
Sbjct  152  TTWGVVADWTYDVSMGLASGVFIYICVNHMLSRGY  186



>emb|CAN76037.1| hypothetical protein VITISV_009080 [Vitis vinifera]
Length=243

 Score =   197 bits (501),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  543  IFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAIS  364
            IFAAIAMGIALLRMIP+RPLLSC+AY+FAFAISSPVGVAIGI+IDATTQG VADWIYAIS
Sbjct  130  IFAAIAMGIALLRMIPDRPLLSCVAYAFAFAISSPVGVAIGIVIDATTQGAVADWIYAIS  189

Query  363  MGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT  202
            MG+ACG+FIYVSINHLLSKGY  Q+TV  D P++K LAVLLG+GVIAVVMIWDT
Sbjct  190  MGLACGIFIYVSINHLLSKGYTCQRTVPFDTPNYKXLAVLLGVGVIAVVMIWDT  243



>dbj|BAD11665.1| putative zinc transporter [Oryza sativa Japonica Group]
 dbj|BAD13156.1| putative zinc transporter [Oryza sativa Japonica Group]
Length=398

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  591  TKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIII  412
            +K++AW+ LWT+ LHKIFAA+AMGIALLRMIP RP L  + YS AFA+SSPVGV IGI I
Sbjct  270  SKSEAWRNLWTIGLHKIFAAVAMGIALLRMIPKRPFLMTVVYSLAFAVSSPVGVGIGIAI  329

Query  411  DATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIG  232
            DAT+QG+ ADW YAISMG+A GVFIYV+INHL++KGY+P    A DKP FKFLAVLLG+ 
Sbjct  330  DATSQGRAADWTYAISMGLATGVFIYVAINHLIAKGYRPHHPTAADKPLFKFLAVLLGVA  389

Query  231  VIAVVMIWD  205
            V+AVVMIWD
Sbjct  390  VMAVVMIWD  398



>ref|XP_008364560.1| PREDICTED: LOW QUALITY PROTEIN: zinc transporter 2-like [Malus 
domestica]
Length=291

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 115/145 (79%), Gaps = 10/145 (7%)
 Frame = -3

Query  792  ADLELQVNTEGRNFNGIGT-THPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFE  616
            ADL+++ N E       GT +H Q+ +            A+SLGD++LLI ALCFHSVFE
Sbjct  155  ADLQVRGNIEQGKGGQYGTQSHTQNTVVAS---------ATSLGDNILLIVALCFHSVFE  205

Query  615  GIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPV  436
            GIAIGVA+TKADAWKALWT+ LHK+FAAIAMGIALLRM+PNRP LSC A +FAFAISSP+
Sbjct  206  GIAIGVAETKADAWKALWTISLHKVFAAIAMGIALLRMMPNRPFLSCAACAFAFAISSPI  265

Query  435  GVAIGIIIDATTQGKVADWIYAISM  361
            GVAIGI+IDATTQG VADWI+AISM
Sbjct  266  GVAIGILIDATTQGAVADWIFAISM  290



>gb|EAY77402.1| hypothetical protein OsI_05391 [Oryza sativa Indica Group]
Length=107

 Score =   166 bits (419),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -3

Query  525  MGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACG  346
            MGIALLRMIP RP L  + YS AFA+SSPVGV IGI IDAT+QG+ ADW YAISMG+A G
Sbjct  1    MGIALLRMIPKRPFLMTVVYSLAFAVSSPVGVGIGIAIDATSQGRAADWTYAISMGLATG  60

Query  345  VFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            VFIYV+INHL++KGY+P    A DKP FKFLAVLLG+ V+AVVMIWD
Sbjct  61   VFIYVAINHLIAKGYRPHHPTAADKPLFKFLAVLLGVAVMAVVMIWD  107



>gb|KCW68411.1| hypothetical protein EUGRSUZ_F02060 [Eucalyptus grandis]
Length=349

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 125/206 (61%), Gaps = 19/206 (9%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGI  610
            DLE+     G+  +  G TH    L    G  S         D +LLI ALC HSVF GI
Sbjct  155  DLEVSGIVHGKGSSANGATH-HHNLSVAVGLPS---------DGILLIIALCLHSVFLGI  204

Query  609  AIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGV  430
            AIGVA+TK DAWK + T+  H IFAA+AMGI LLR +PNRPL S  AY+FA+AISS +G+
Sbjct  205  AIGVAETKPDAWKTMRTIFPHNIFAAVAMGIVLLRTMPNRPLSSRAAYAFAYAISSSIGM  264

Query  429  AIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLA  250
            AIGI+ID TTQG VA W  AI  G  CG+FIYVS+   +S  Y  Q   +VD     FLA
Sbjct  265  AIGIVIDPTTQGVVAGWSSAIFSGF-CGMFIYVSV---ISYRY-VQNVDSVD----AFLA  315

Query  249  VLLGIGVIAVVMIWDT*ALPQPAYIL  172
             ++G G+I  +MIWD        Y+L
Sbjct  316  TIVGFGIIVGLMIWDAFGYSAAVYLL  341



>ref|XP_010064669.1| PREDICTED: zinc transporter 11-like [Eucalyptus grandis]
Length=341

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 121/200 (61%), Gaps = 26/200 (13%)
 Frame = -3

Query  789  DLELQ---VNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVF  619
            DLE+    V  +G + NG+   H  S   G               DS+LLI ALCF S+F
Sbjct  153  DLEVSGGIVQGKGSSANGVTHHHDASMAVGLPC------------DSILLIVALCFFSLF  200

Query  618  EGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFA--IS  445
             GI IG+A  KA A KA+W +    IFAAIAMGIALLRM+PNRPLL C  Y+FAFA  IS
Sbjct  201  GGITIGIAGPKAGARKAMWIISPQGIFAAIAMGIALLRMMPNRPLLLCAVYAFAFAIVIS  260

Query  444  SPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPH  265
            SP+G+AIGII+D T QG VA WI+   MG+A GVF YV     LS+ Y P          
Sbjct  261  SPIGMAIGIIVDPTAQGAVAGWIFNFFMGLAPGVFWYVFSKLSLSRQYMPIH--------  312

Query  264  FKFLAVLLGIGVIAVVMIWD  205
             KFLA +L +GV AV++IWD
Sbjct  313  -KFLAKMLRVGVNAVLVIWD  331



>ref|XP_010064670.1| PREDICTED: zinc transporter 2-like [Eucalyptus grandis]
Length=307

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 112/164 (68%), Gaps = 9/164 (5%)
 Frame = -3

Query  663  DSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPL  484
            D +LLI ALC HSVF GIAIGVA+TK DAWK + T+  H IFAA+AMGI LLR +PNRPL
Sbjct  145  DGILLIIALCLHSVFLGIAIGVAETKPDAWKTMRTIFPHNIFAAVAMGIVLLRTMPNRPL  204

Query  483  LSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKG  304
             S  AY+FA+AISS +G+AIGI+ID TTQG VA W  AI  G  CG+FIYVS+   +S  
Sbjct  205  SSRAAYAFAYAISSSIGMAIGIVIDPTTQGVVAGWSSAIFSGF-CGMFIYVSV---ISYR  260

Query  303  YKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWDT*ALPQPAYIL  172
            Y  Q   +VD     FLA ++G G+I  +MIWD        Y+L
Sbjct  261  YV-QNVDSVD----AFLATIVGFGIIVGLMIWDAFGYSAAVYLL  299



>gb|KCW68410.1| hypothetical protein EUGRSUZ_F02059 [Eucalyptus grandis]
Length=334

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 107/155 (69%), Gaps = 11/155 (7%)
 Frame = -3

Query  663  DSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPL  484
            DS+LLI ALCF S+F GI IG+A  KA A KA+W +    IFAAIAMGIALLRM+PNRPL
Sbjct  179  DSILLIVALCFFSLFGGITIGIAGPKAGARKAMWIISPQGIFAAIAMGIALLRMMPNRPL  238

Query  483  LSCIAYSFAFA--ISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLS  310
            L C  Y+FAFA  ISSP+G+AIGII+D T QG VA WI+   MG+A GVF YV     LS
Sbjct  239  LLCAVYAFAFAIVISSPIGMAIGIIVDPTAQGAVAGWIFNFFMGLAPGVFWYVFSKLSLS  298

Query  309  KGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            + Y P           KFLA +L +GV AV++IWD
Sbjct  299  RQYMPIH---------KFLAKMLRVGVNAVLVIWD  324



>ref|XP_010106523.1| Zinc transporter 11 [Morus notabilis]
 gb|EXC10699.1| Zinc transporter 11 [Morus notabilis]
Length=143

 Score =   147 bits (370),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 80/96 (83%), Gaps = 2/96 (2%)
 Frame = -3

Query  492  RPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLL  313
            RPLL   AYSFAFAISSPVGV IGI IDATTQG VADWIYAISMG+ACGVFIYV  NH +
Sbjct  50   RPLLVTAAYSFAFAISSPVGVGIGIAIDATTQGAVADWIYAISMGLACGVFIYV--NHRI  107

Query  312  SKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIWD  205
            +KG+KPQ     D P FKFLAVLLG+GVIAVV+IWD
Sbjct  108  AKGFKPQSKCHFDTPFFKFLAVLLGVGVIAVVLIWD  143



>ref|XP_001770289.1| predicted protein [Physcomitrella patens]
 gb|EDQ64964.1| predicted protein [Physcomitrella patens]
Length=156

 Score =   134 bits (337),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = -3

Query  699  TESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMG  520
            T++  L   +L DS+LLI  LCFHS+F+GI IGVA TKA +W+ +W V +HK+  A+AMG
Sbjct  8    TKATILATLNLFDSVLLILTLCFHSIFDGITIGVAGTKAGSWEKMWMVGIHKVVLALAMG  67

Query  519  IALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACG  346
            I +LR+  NRPLLS + Y   FA S+ VGV IGI+I+ T +G  ADWI+AI MGIA G
Sbjct  68   IVVLRLASNRPLLSSLLYGLVFANSTSVGVVIGILINGTAEGGTADWIFAIWMGIATG  125



>gb|EKC42332.1| Zinc transporter ZIP1 [Crassostrea gigas]
Length=274

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 83/146 (57%), Gaps = 9/146 (6%)
 Frame = -3

Query  660  SLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLL  481
            S++L+FAL FH +FEG+++G+  T  D W+ +  + LHK   A ++G+ L      + L 
Sbjct  123  SVVLLFALSFHMIFEGLSVGLQKTDPDTWRIMGVLALHKCIVAFSVGLQLAEGF--KRLR  180

Query  480  SCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYA-ISMGIACGVFIYVSINHLLSKG  304
            + I+     +I +P+GV IG I+  T +   ++ I A +  G++ G FIYV+   +L+K 
Sbjct  181  NIISSLVLLSIVAPIGVMIGYIVTETGEDNRSENIAAGVLQGLSIGSFIYVTFFEILNKE  240

Query  303  YKPQKTVAVDKPHFKFLAVLLGIGVI  226
             +  + V      +K L+ +LG GV+
Sbjct  241  LEKGRNV------WKVLSTMLGFGVV  260



>ref|XP_011424525.1| PREDICTED: zinc transporter ZIP1-like [Crassostrea gigas]
 ref|XP_011424526.1| PREDICTED: zinc transporter ZIP1-like [Crassostrea gigas]
 ref|XP_011424527.1| PREDICTED: zinc transporter ZIP1-like [Crassostrea gigas]
Length=395

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 83/146 (57%), Gaps = 9/146 (6%)
 Frame = -3

Query  660  SLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLL  481
            S++L+FAL FH +FEG+++G+  T  D W+ +  + LHK   A ++G+ L      + L 
Sbjct  244  SVVLLFALSFHMIFEGLSVGLQKTDPDTWRIMGVLALHKCIVAFSVGLQLAEGF--KRLR  301

Query  480  SCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYA-ISMGIACGVFIYVSINHLLSKG  304
            + I+     +I +P+GV IG I+  T +   ++ I A +  G++ G FIYV+   +L+K 
Sbjct  302  NIISSLVLLSIVAPIGVMIGYIVTETGEDNRSENIAAGVLQGLSIGSFIYVTFFEILNKE  361

Query  303  YKPQKTVAVDKPHFKFLAVLLGIGVI  226
             +  + V      +K L+ +LG GV+
Sbjct  362  LEKGRNV------WKVLSTMLGFGVV  381



>emb|CBY19542.1| unnamed protein product [Oikopleura dioica]
Length=276

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 85/164 (52%), Gaps = 13/164 (8%)
 Frame = -3

Query  696  ESH-----FLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAA  532
            ESH     F H++S+     ++F L  HS+FEG+A+G+  + AD W     + +HK   A
Sbjct  110  ESHDCDNMFEHSTSVNGIYTMVFGLSAHSLFEGLAVGLQSSAADVWTLTIVIMIHKCLFA  169

Query  531  IAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDA-TTQGKVADWIYAISMGI  355
            + MGI+ LR +       C+   F FAISS  GVAIG II+A +++    D    +   I
Sbjct  170  LIMGISALRTLTLTQSAICL---FIFAISSSAGVAIGTIIEAISSESPKMDLTVGVLESI  226

Query  354  ACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIA  223
            + G F++V    L+ KG       A+       + V++G G++A
Sbjct  227  STGTFVFVVFMELVPKGMDLHAQDALK----TVVLVMIGFGIMA  266



>emb|CBY31560.1| unnamed protein product [Oikopleura dioica]
Length=276

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 85/164 (52%), Gaps = 13/164 (8%)
 Frame = -3

Query  696  ESH-----FLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAA  532
            ESH     F H++S+     ++F L  HS+FEG+A+G+  + AD W     + +HK   A
Sbjct  110  ESHDCDNMFEHSTSVNGIYTMVFGLSAHSLFEGLAVGLQSSAADVWTLTIVIMIHKCLFA  169

Query  531  IAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDA-TTQGKVADWIYAISMGI  355
            + MGI+ LR +       C+   F FAISS  GVAIG II+A +++    D    +   I
Sbjct  170  LIMGISALRTLTLTQSAICL---FIFAISSSAGVAIGTIIEAISSESPKMDLTVGVLESI  226

Query  354  ACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIA  223
            + G F++V    L+ KG       A+       + V++G G++A
Sbjct  227  STGTFVFVVFMELVPKGMDLHAQDALK----TVVLVMIGFGIMA  266



>ref|XP_005174889.1| PREDICTED: zinc transporter 4, chloroplastic-like [Musca domestica]
Length=449

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 76/142 (54%), Gaps = 11/142 (8%)
 Frame = -3

Query  651  LIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCI  472
            ++ AL  H VFEG+AIG+ D+ +  W     V  HK+  A  +G+ L+ +   RP+L+ +
Sbjct  281  IVLALSLHEVFEGLAIGLEDSTSSVWFLFAAVSAHKLVLAFCVGVELI-VARTRPILAAV  339

Query  471  AYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQ  292
             Y+  FAI SP+GVAIG+ +   +         A+  GIACG  +YV    +LSK +   
Sbjct  340  -YTITFAIVSPIGVAIGLAVSHDSSSSEDSIPSAVLQGIACGTLLYVVFFEILSKNHAGL  398

Query  291  KTVAVDKPHFKFLAVLLGIGVI  226
                       FLA+L+G G++
Sbjct  399  GA---------FLAMLIGFGLM  411



>ref|XP_004537672.1| PREDICTED: zinc transporter ZIP1-like isoform X1 [Ceratitis capitata]
 ref|XP_004537673.1| PREDICTED: zinc transporter ZIP1-like isoform X2 [Ceratitis capitata]
 ref|XP_004537674.1| PREDICTED: zinc transporter ZIP1-like isoform X3 [Ceratitis capitata]
Length=550

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 75/151 (50%), Gaps = 12/151 (8%)
 Frame = -3

Query  678  ASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMI  499
            ASSL   L ++ AL  H +FEGIAIG+  +  D W     V  HK+  A  +G+ L+  +
Sbjct  323  ASSL-RGLFIVLALSLHELFEGIAIGLESSGTDVWFMFGAVSAHKLVLAFCVGVELI--V  379

Query  498  PNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINH  319
                 + CI Y   FA+ SP+G+ IGI+I  +          AI  G+ACG  +YV    
Sbjct  380  ARTRFVLCIVYILTFAVVSPLGIGIGILISHSEDITSPTIASAILQGLACGTLLYVVFFE  439

Query  318  LLSKGYKPQKTVAVDKPHFKFLAVLLGIGVI  226
            +LSK +            F FL +L+G  V+
Sbjct  440  ILSKNHAGL---------FAFLTLLVGFLVM  461



>ref|XP_009062372.1| hypothetical protein LOTGIDRAFT_128233 [Lottia gigantea]
 gb|ESO86976.1| hypothetical protein LOTGIDRAFT_128233 [Lottia gigantea]
Length=285

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 71/127 (56%), Gaps = 2/127 (2%)
 Frame = -3

Query  660  SLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLL  481
            ++LL+ AL FH++F+G+AIG+ +  AD W+ L  + +HK   A  +G  L +    R  L
Sbjct  138  AVLLLIALSFHTIFDGLAIGLQEQDADVWQVLVAISVHKGLVAFCLGHQLYQAYKERTKL  197

Query  480  SCIAYSFAFAISSPVGVAIGIIIDA-TTQGKVADWIYAISMGIACGVFIYVSINHLLSKG  304
            + I     F + SP+G+A+GIII +    G       A+  GIA G F+YV+   +LS  
Sbjct  198  AFILVQL-FCLMSPIGIALGIIITSGNIDGGAQTMTSAVLQGIASGTFLYVTFFEILSTA  256

Query  303  YKPQKTV  283
            +   +++
Sbjct  257  FTHGQSI  263



>ref|NP_997748.2| zinc transporter ZIP1 [Danio rerio]
 gb|AAH96852.1| Solute carrier family 39 (zinc transporter), member 1 [Danio 
rerio]
Length=302

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 91/178 (51%), Gaps = 11/178 (6%)
 Frame = -3

Query  750  NGIGTTHPQ-SQLQGCDGTESHF-LHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADA  577
            NG    HP  + L+G  G   H   HA S   S +L  +L  HSVFEG+AIG+  T A  
Sbjct  128  NGHAHGHPSVNDLEG-SGHHVHVDFHAHSSFRSFMLFLSLSLHSVFEGLAIGLQTTNAKV  186

Query  576  WKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQ  397
             +    + +HK     ++ + L++    +PL   + Y   FAI SP+G+ IGI++   T+
Sbjct  187  LEICIAILVHKSIIVFSLSVKLVQS-AVKPLW-VVLYVTVFAIMSPLGIGIGIVV-IETE  243

Query  396  GKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIA  223
             +    I A+  G+A G FIY++   +L     P +  + ++P  K L +L G  ++A
Sbjct  244  RQAGGLIQAVLEGLAAGTFIYITFLEIL-----PHELNSSERPLLKVLFLLCGFSIMA  296



>sp|P59889.1|S39A1_DANRE RecName: Full=Zinc transporter ZIP1; AltName: Full=DrZIP1; AltName: 
Full=Solute carrier family 39 member 1; AltName: Full=Zrt- 
and Irt-like protein 1; Short=ZIP-1 [Danio rerio]
 gb|AAP83180.1| zinc transporter [Danio rerio]
 emb|CAQ15498.1| solute carrier family 39 (zinc transporter), member 1 [Danio 
rerio]
Length=302

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 91/178 (51%), Gaps = 11/178 (6%)
 Frame = -3

Query  750  NGIGTTHPQ-SQLQGCDGTESHF-LHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADA  577
            NG    HP  + L+G  G   H   HA S   S +L  +L  HSVFEG+AIG+  T A  
Sbjct  128  NGHAHGHPSVNDLEG-SGHHVHVDFHAHSSFRSFMLFLSLSLHSVFEGLAIGLQTTNAKV  186

Query  576  WKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQ  397
             +    + +HK     ++ + L++    +PL   + Y   FAI SP+G+ IGI++   T+
Sbjct  187  LEICIAILVHKSIIVFSLSVKLVQS-AVKPLW-VVLYVTVFAIMSPLGIGIGIVV-IETE  243

Query  396  GKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIA  223
             +    I A+  G+A G FIY++   +L     P +  + ++P  K L +L G  ++A
Sbjct  244  RQAGGLIQAVLEGLAAGTFIYITFLEIL-----PHELNSSERPLLKVLFLLCGFSIMA  296



>gb|KDR21281.1| Zinc transporter ZIP1 [Zootermopsis nevadensis]
Length=462

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 87/164 (53%), Gaps = 7/164 (4%)
 Frame = -3

Query  705  DGTESHFLHASSLGDSL---LLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFA  535
             G  SH L+  S+  SL   L++ ALCFHS+FEG+AIG+ +T+ D W     V +H    
Sbjct  269  SGFASHTLNQESMVGSLRRFLVVVALCFHSLFEGLAIGLQETQRDVWYLFAAVIIHA--C  326

Query  534  AIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGII--IDATTQGKVADWIYAISM  361
            AI   I L  +     LL+ + Y    ++ SP+GVAIGI+  + +++ G +   + A+  
Sbjct  327  AILFCIGLELVTSGIRLLNLVLYIVTLSLVSPLGVAIGILMTVHSSSGGPLHGLVVAVLQ  386

Query  360  GIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGV  229
            GIA G+ +Y++   +L +  + +    + +  F  +   L + +
Sbjct  387  GIAGGIILYITFFEVLDREKRRESGCGIVRIVFILVGFFLMVAL  430



>ref|XP_001999675.1| GI22942 [Drosophila mojavensis]
 gb|EDW15136.1| GI22942 [Drosophila mojavensis]
Length=494

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 61/118 (52%), Gaps = 2/118 (2%)
 Frame = -3

Query  657  LLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLS  478
            L ++ AL  H +FEG+AIG+  T +  W     V  HK+  A  +G+ L+  +    L  
Sbjct  282  LFIVLALSLHELFEGMAIGLESTASSVWFMFGAVSAHKLVLAFCVGVELI--VARTRLSL  339

Query  477  CIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKG  304
             + Y   FA+ SP+G+ +GI+I     G   + + AI  G ACG  IYV    +LSK 
Sbjct  340  AVLYVLTFAVVSPLGIGLGILISHGQHGAGPNLVSAILQGFACGTLIYVVFFEILSKN  397



>ref|XP_002097626.1| GE24385 [Drosophila yakuba]
 gb|EDW97338.1| GE24385 [Drosophila yakuba]
Length=496

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 66/125 (53%), Gaps = 3/125 (2%)
 Frame = -3

Query  678  ASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMI  499
            ASSL   L ++ AL  H +FEG+AIG+  + +  W     V  HK+  A  +G+ L+  +
Sbjct  264  ASSL-RGLFIVSALSLHELFEGMAIGLESSASSVWFMFGAVSAHKLVLAFCVGVELI--V  320

Query  498  PNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINH  319
                +L  + Y   FA+ SP+G+ IGI+I+   +      + AI  G ACG  IYV    
Sbjct  321  ARTRMLLAVLYVLTFAVVSPLGIGIGILINHGQETTGPSLVSAILQGFACGTLIYVVFFE  380

Query  318  LLSKG  304
            +LSK 
Sbjct  381  ILSKN  385



>gb|AAL48543.1| RE02747p [Drosophila melanogaster]
Length=495

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 66/125 (53%), Gaps = 3/125 (2%)
 Frame = -3

Query  678  ASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMI  499
            ASSL   L ++ AL  H +FEG+AIG+  + +  W     V  HK+  A  +G+ L+  +
Sbjct  265  ASSL-RGLFIVSALSLHELFEGMAIGLESSASSVWFMFGAVSAHKLVLAFCVGVELI--V  321

Query  498  PNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINH  319
                +L  + Y   FA+ SP+G+ IGI+I+   +      + AI  G ACG  IYV    
Sbjct  322  ARTRMLLAVLYVLTFAVVSPLGIGIGILINHGEETSGPSLVSAILQGFACGTLIYVVFFE  381

Query  318  LLSKG  304
            +LSK 
Sbjct  382  ILSKN  386



>ref|NP_536747.2| Zinc/iron regulated transporter-related protein 89B [Drosophila 
melanogaster]
 gb|AAF55295.1| Zinc/iron regulated transporter-related protein 89B [Drosophila 
melanogaster]
 gb|AFA28442.1| FI18611p1 [Drosophila melanogaster]
Length=495

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 66/125 (53%), Gaps = 3/125 (2%)
 Frame = -3

Query  678  ASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMI  499
            ASSL   L ++ AL  H +FEG+AIG+  + +  W     V  HK+  A  +G+ L+  +
Sbjct  265  ASSL-RGLFIVSALSLHELFEGMAIGLESSASSVWFMFGAVSAHKLVLAFCVGVELI--V  321

Query  498  PNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINH  319
                +L  + Y   FA+ SP+G+ IGI+I+   +      + AI  G ACG  IYV    
Sbjct  322  ARTRMLLAVLYVLTFAVVSPLGIGIGILINHGEETSGPSLVSAILQGFACGTLIYVVFFE  381

Query  318  LLSKG  304
            +LSK 
Sbjct  382  ILSKN  386



>emb|CAC14874.1| zinc/iron regulated transporter-related protein 3, DZIP3 protein 
[Drosophila melanogaster]
Length=494

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 66/125 (53%), Gaps = 3/125 (2%)
 Frame = -3

Query  678  ASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMI  499
            ASSL   L ++ AL  H +FEG+AIG+  + +  W     V  HK+  A  +G+ L+  +
Sbjct  264  ASSL-RGLFIVSALSLHELFEGMAIGLESSASSVWFMFGAVSAHKLVLAFCVGVELI--V  320

Query  498  PNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINH  319
                +L  + Y   FA+ SP+G+ IGI+I+   +      + AI  G ACG  IYV    
Sbjct  321  ARTRMLLAVLYVLTFAVVSPLGIGIGILINHGQETSGPSLVSAILQGFACGTLIYVVFFE  380

Query  318  LLSKG  304
            +LSK 
Sbjct  381  ILSKN  385



>ref|XP_001980165.1| GG16992 [Drosophila erecta]
 gb|EDV49123.1| GG16992 [Drosophila erecta]
Length=494

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 66/125 (53%), Gaps = 3/125 (2%)
 Frame = -3

Query  678  ASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMI  499
            ASSL   L ++ AL  H +FEG+AIG+  + +  W     V  HK+  A  +G+ L+  +
Sbjct  266  ASSL-RGLFIVSALSLHELFEGMAIGLESSASSVWFMFGAVSAHKLVLAFCVGVELI--V  322

Query  498  PNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINH  319
                +L  + Y   FA+ SP+G+ IGI+I+   +      I AI  G ACG  IYV    
Sbjct  323  ARTRMLLAVIYVVTFAVVSPLGIGIGILINHGQETSGPSLISAILQGFACGTLIYVVFFE  382

Query  318  LLSKG  304
            +LSK 
Sbjct  383  ILSKN  387



>ref|XP_002041241.1| GM15144 [Drosophila sechellia]
 gb|EDW44889.1| GM15144 [Drosophila sechellia]
Length=494

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 66/125 (53%), Gaps = 3/125 (2%)
 Frame = -3

Query  678  ASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMI  499
            ASSL   L ++ AL  H +FEG+AIG+  + +  W     V  HK+  A  +G+ L+  +
Sbjct  264  ASSL-RGLFIVSALSLHELFEGMAIGLEGSASSVWFMFGAVSAHKLVLAFCVGVELI--V  320

Query  498  PNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINH  319
                +L  + Y   FA+ SP+G+ IGI+I+   +      + AI  G ACG  IYV    
Sbjct  321  ARTRMLLAVLYVLTFAVVSPLGIGIGILINHGQETSGPSLVSAILQGFACGTLIYVVFFE  380

Query  318  LLSKG  304
            +LSK 
Sbjct  381  ILSKN  385



>ref|XP_002072759.1| GK13772 [Drosophila willistoni]
 gb|EDW83745.1| GK13772 [Drosophila willistoni]
Length=502

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 65/124 (52%), Gaps = 3/124 (2%)
 Frame = -3

Query  678  ASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMI  499
            ASSL   L ++ AL  H +FEG+AIG+ ++ +  W     V  HK+  A  +G+ L+  +
Sbjct  277  ASSL-RGLFIVSALSLHELFEGMAIGLENSASSVWFMFGAVSAHKLVLAFCVGVELI--V  333

Query  498  PNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINH  319
                L   I Y   FAI SP+G+ IGI+I+        +   AI  G ACG  IYV    
Sbjct  334  ARTKLTLAILYVLTFAIVSPLGIGIGILINHGQNSTGPNLASAILQGFACGTLIYVVFFE  393

Query  318  LLSK  307
            +LSK
Sbjct  394  ILSK  397



>ref|XP_002103205.1| GD19087 [Drosophila simulans]
 gb|EDX12708.1| GD19087 [Drosophila simulans]
Length=496

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 66/125 (53%), Gaps = 3/125 (2%)
 Frame = -3

Query  678  ASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMI  499
            ASSL   L ++ AL  H +FEG+AIG+  + +  W     V  HK+  A  +G+ L+  +
Sbjct  266  ASSL-RGLFIVSALSLHELFEGMAIGLEGSASSVWFMFGAVSAHKLVLAFCVGVELI--V  322

Query  498  PNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINH  319
                +L  + Y   FA+ SP+G+ IGI+I+   +      + AI  G ACG  IYV    
Sbjct  323  ARTRMLLAVLYVLTFAVVSPLGIGIGILINHGQETSGPSLVSAILQGFACGTLIYVVFFE  382

Query  318  LLSKG  304
            +LSK 
Sbjct  383  ILSKN  387



>ref|XP_002053140.1| GJ23722 [Drosophila virilis]
 gb|EDW66660.1| GJ23722 [Drosophila virilis]
Length=501

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 65/124 (52%), Gaps = 3/124 (2%)
 Frame = -3

Query  678  ASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMI  499
            ASSL   L ++ AL  H +FEG+AIG+  + +  W     V  HK+  A  +G+ L+  +
Sbjct  285  ASSL-RGLFIVLALSLHELFEGMAIGLEGSASSVWFMFGAVSAHKLVLAFCVGVELI--V  341

Query  498  PNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINH  319
                L   + Y   FA+ SP+G+ +GI+I     G   + + AI  G ACG  IYV    
Sbjct  342  ARTRLSLAVLYVLTFAVVSPLGIGLGILISHGQNGGGPNLVSAILQGFACGTLIYVVFFE  401

Query  318  LLSK  307
            +LSK
Sbjct  402  ILSK  405



>ref|XP_001954870.1| GF18487 [Drosophila ananassae]
 gb|EDV43431.1| GF18487 [Drosophila ananassae]
Length=495

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 68/125 (54%), Gaps = 3/125 (2%)
 Frame = -3

Query  678  ASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMI  499
            ASSL   L ++ AL  H +FEG+AIG+  T ++ W     V  HK+  A  +G+ L+ + 
Sbjct  265  ASSL-RGLFIVSALSLHELFEGMAIGLEGTASNVWFMFGAVSAHKLVLAFCVGVELI-VA  322

Query  498  PNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINH  319
              R  L+ + Y   FA+ SP+G+ IGI+I+   +      + AI  G ACG  IYV    
Sbjct  323  RTRTTLA-VLYVLTFAVVSPLGIGIGILINHGQETSGPSLVSAILQGFACGTLIYVVFFE  381

Query  318  LLSKG  304
            +LSK 
Sbjct  382  ILSKN  386



>ref|XP_004360230.1| zinc/iron permease [Dictyostelium fasciculatum]
 gb|EGG22379.1| zinc/iron permease [Dictyostelium fasciculatum]
Length=382

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 84/150 (56%), Gaps = 8/150 (5%)
 Frame = -3

Query  657  LLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLS  478
             +L+F L  HS+FEG+A G+  T       L  V  HK+ A+ A+G++   +I +R L+ 
Sbjct  240  FILVFGLSVHSLFEGLAFGLQSTVPKILDLLVAVFSHKLLASFALGVS--TIIYSRSLVK  297

Query  477  CIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYK  298
             I   F F+ISSP+G +IGI++   +Q  + + +  I  G+A G F+Y+S+  ++ K  K
Sbjct  298  MILILFIFSISSPIGASIGIVLVDYSQ--IGNVVPPILQGLASGTFLYISLVEIIPKEIK  355

Query  297  PQKTVAVDKPHFKFLAVLLGIGVIAVVMIW  208
                   +    K L +LLG  ++AV+ IW
Sbjct  356  SDS----ENVFIKCLLLLLGWSLMAVIAIW  381



>gb|KFD55103.1| hypothetical protein M513_04021 [Trichuris suis]
Length=2579

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 46/153 (30%), Positives = 84/153 (55%), Gaps = 8/153 (5%)
 Frame = -3

Query  660  SLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLL  481
            +++L+  L  H++FEG+A+G+ +    A++    +C+HK   A ++G   LR+I  + + 
Sbjct  197  AVILVLTLSVHALFEGLAMGLINQYTTAFQIFAALCIHKSLVAFSLG---LRLISFKDVS  253

Query  480  SC--IAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSK  307
            +C  I +  AFA    +G  IGI++  + + K+A +I     GIACG F+Y+    +L  
Sbjct  254  TCTVILFCSAFASVGSLGGFIGIVLSESLRSKLAHFITGSLQGIACGTFLYIVTFEILP-  312

Query  306  GYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIW  208
             ++   + A   P  K +  L G+G IA V+ +
Sbjct  313  -HELSSSTAHLLP-VKLIFFLAGLGTIAFVLYY  343



>gb|KFD72540.1| hypothetical protein M514_04021 [Trichuris suis]
Length=2599

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 46/153 (30%), Positives = 84/153 (55%), Gaps = 8/153 (5%)
 Frame = -3

Query  660  SLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLL  481
            +++L+  L  H++FEG+A+G+ +    A++    +C+HK   A ++G   LR+I  + + 
Sbjct  197  AVILVLTLSVHALFEGLAMGLINQYTTAFQIFAALCIHKSLVAFSLG---LRLISFKDVS  253

Query  480  SC--IAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSK  307
            +C  I +  AFA    +G  IGI++  + + K+A +I     GIACG F+Y+    +L  
Sbjct  254  TCTVILFCSAFASVGSLGGFIGIVLSESLRSKLAHFITGSLQGIACGTFLYIVTFEILP-  312

Query  306  GYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIW  208
             ++   + A   P  K +  L G+G IA V+ +
Sbjct  313  -HELSSSTAHLLP-VKLIFFLAGLGTIAFVLYY  343



>emb|CEF62101.1| Zinc transporter ZIP2 [Strongyloides ratti]
Length=313

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 88/195 (45%), Gaps = 16/195 (8%)
 Frame = -3

Query  756  NFNGIGTTHPQSQLQGCD---GTESHFLHA------SSLGDSLLLIFALCFHSVFEGIAI  604
            N+    TT   +Q   C+      SH  H         +  +   I AL  HS  EG A 
Sbjct  125  NYQSTATTIRNTQADDCEIHSEGHSHSRHKYDHDEKKKIIKTFAFIGALIIHSSLEGFAF  184

Query  603  GVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAI  424
            GV  T          + +HK   + ++G+ L R   NRP+L  I   F FAI+SP+   I
Sbjct  185  GVQPTNVTIISLFIGLFVHKTVVSFSVGVRLTRCHSNRPIL-VIILVFVFAITSPIFSVI  243

Query  423  GIIIDATTQGK-VADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAV  247
            GIII ++   K + + +  + +G + G F+Y++   +L    + +     D    K LA 
Sbjct  244  GIIIQSSDMDKLLKNQLSTVFIGFSMGTFLYITFFEMLGPERENE-----DNRFSKTLAS  298

Query  246  LLGIGVIAVVMIWDT  202
             LG   IA+VMI+ +
Sbjct  299  FLGFVAIAIVMIFSS  313



>ref|XP_008274276.1| PREDICTED: zinc transporter ZIP1-like [Stegastes partitus]
Length=306

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 91/184 (49%), Gaps = 11/184 (6%)
 Frame = -3

Query  765  EGRNFNGIGTTHPQSQLQGCDGTESHF---LHASSLGDSLLLIFALCFHSVFEGIAIGVA  595
            + R+ NG G  H  +     +G+  H      A S   S +L  +L  HSVFEG+AIG+ 
Sbjct  125  DNRDRNGHGHGHGVTTSPDLEGSGHHVHADFQAHSPFRSFMLFLSLSLHSVFEGLAIGLQ  184

Query  594  DTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGII  415
            +T +   +    + +HK     ++ + L++    RPL   +AY   FA+ SP+G+AIGI 
Sbjct  185  NTDSKVLEICIAILVHKSIIVFSLSVKLVQS-AVRPLW-VVAYIGVFAVMSPLGIAIGIS  242

Query  414  IDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGI  235
            +    Q      I A+  G+A G F+Y++   +L     P +  +  +   K L +LLG 
Sbjct  243  V-VEAQLTAGALIQAVLEGLAAGTFVYITFLEIL-----PHELNSPGRQLLKALFILLGF  296

Query  234  GVIA  223
             ++A
Sbjct  297  SIMA  300



>ref|XP_010776077.1| PREDICTED: zinc transporter ZIP1-like [Notothenia coriiceps]
Length=302

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 96/197 (49%), Gaps = 21/197 (11%)
 Frame = -3

Query  783  ELQVNTEGR------NFNGIGTTH-PQSQLQGCDGTESHF-LHASSLGDSLLLIFALCFH  628
            E  V+ E R      N NG G  H     L+G  G   H    A S   S +L  +L  H
Sbjct  111  EAAVSQEERSPLMADNRNGHGHGHGTNPDLEG-SGQHVHVDFQAHSPFRSFMLFLSLSLH  169

Query  627  SVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAI  448
            SVFEG+AIG+  T +   +    + +HK     ++ + L++    RPL    AY   FA+
Sbjct  170  SVFEGLAIGLQSTDSKVLEICIAILVHKTIIVFSLSVKLVQS-AVRPLWVA-AYISVFAM  227

Query  447  SSPVGVAIGIIIDATTQGKVAD--WIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVD  274
             SP+G+AIGI   +  + K+A+   I A+  G+A G FIY++   +L     P +  +  
Sbjct  228  MSPIGIAIGI---SVMEAKLAEGALIQAVLEGLAAGTFIYITFLEIL-----PHELNSPG  279

Query  273  KPHFKFLAVLLGIGVIA  223
            K   K L +LLG  ++A
Sbjct  280  KQLLKVLFILLGFSIMA  296



>ref|XP_001990763.1| GH19543 [Drosophila grimshawi]
 gb|EDV93825.1| GH19543 [Drosophila grimshawi]
Length=494

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 61/117 (52%), Gaps = 2/117 (2%)
 Frame = -3

Query  657  LLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLS  478
            L ++ AL  H +FEG+AIG+  + +  W     V  HK+  A  +G+ L+  +    L  
Sbjct  287  LFIVLALSLHELFEGMAIGLERSASSVWFMFGAVSAHKLVLAFCVGVELI--VARTRLSL  344

Query  477  CIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSK  307
             + Y   FA+ SP+G+ +GI+I     G   + + AI  G ACG  +YV    +LSK
Sbjct  345  AVLYVLTFAVVSPLGIGLGILISHGQSGGGPNLVSAILQGFACGTLLYVVFFEILSK  401



>gb|ETE61967.1| Zinc transporter ZIP2, partial [Ophiophagus hannah]
Length=280

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 80/151 (53%), Gaps = 8/151 (5%)
 Frame = -3

Query  660  SLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLL  481
            + +L  +L FHSVFEG+AIGV     D  +    V +HK     ++ + L++   +  L 
Sbjct  137  AFILFLSLSFHSVFEGLAIGVQKETTDTIQLCLAVLIHKAIMGFSLSLKLVQ--SSTKLQ  194

Query  480  SCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGY  301
              I Y   FA+ SP+G+++GI + +   G  +    A+  G++ G F+YV+   +L    
Sbjct  195  WRILYLVVFALMSPIGISVGIGV-SLFNGDGSGLAQAVLEGVSAGTFLYVTFLEIL----  249

Query  300  KPQKTVAVDKPHFKFLAVLLGIGVIAVVMIW  208
             P +  + + P  KFL + LG  ++AV+ IW
Sbjct  250  -PYELGSHESPFTKFLFISLGFSIMAVIAIW  279



>ref|XP_002017319.1| GL21597 [Drosophila persimilis]
 gb|EDW34419.1| GL21597 [Drosophila persimilis]
Length=504

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 68/133 (51%), Gaps = 5/133 (4%)
 Frame = -3

Query  705  DGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIA  526
            D + +  L +S  G  L ++ AL  H +FEG+AIG+  + +  W     V  HK+  A  
Sbjct  264  DASSADMLTSSLRG--LFIVSALSLHELFEGMAIGLESSASSVWFMFGAVSAHKLVLAFC  321

Query  525  MGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACG  346
            +G+ L+  +        I Y   FA+ SP+G+ IGI+I +  QG   +   AI  G ACG
Sbjct  322  VGVELI--VARTRFTLAILYVLTFAVVSPLGIGIGILI-SNGQGTGPNLASAILQGFACG  378

Query  345  VFIYVSINHLLSK  307
              IYV    +LSK
Sbjct  379  TLIYVVFFEILSK  391



>emb|CDW54842.1| Fmp27 GFWDK and Apt1 and Zip domain containing pr otein [Trichuris 
trichiura]
Length=2783

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/156 (29%), Positives = 82/156 (53%), Gaps = 14/156 (9%)
 Frame = -3

Query  660  SLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLL  481
            +++L+  L  H++FEG+A+G+      A++    +C+H+   A ++G   LR+I  + + 
Sbjct  196  AIILVLTLSIHALFEGLAMGLIGQYTTAFQIFAALCIHRSLVAFSLG---LRLISFKDVS  252

Query  480  SC--IAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSK  307
            +C  I +  AFA    +G  IGI++    + K+A +I     GIACG F+Y+    +L  
Sbjct  253  TCTVILFCTAFAAVGSLGGFIGIVLSEALRSKLAHFITGSLQGIACGTFLYIVTFEIL--  310

Query  306  GYKPQKTVAVDKPHF---KFLAVLLGIGVIAVVMIW  208
               P + ++    H    K +  L G+G IA V+ +
Sbjct  311  ---PHE-LSTSTAHLLPVKLIFFLAGLGTIAFVLYY  342



>ref|XP_645880.1| zinc/iron permease [Dictyostelium discoideum AX4]
 sp|Q55EA1.1|ZNTD_DICDI RecName: Full=Protein zntD [Dictyostelium discoideum]
 gb|EAL72013.1| zinc/iron permease [Dictyostelium discoideum AX4]
Length=683

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 78/151 (52%), Gaps = 7/151 (5%)
 Frame = -3

Query  657  LLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRP-LL  481
             +L+ AL  HS+FEG+A+GV  ++   +  L  +  HKI A+ A+GI+ +     +P  L
Sbjct  538  FILVIALSIHSLFEGLAMGVQSSEIRVFDILIAIFAHKILASFALGISTITSSNEKPSFL  597

Query  480  SCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGY  301
                  F F+++SP+G  +G++I  +  G     +  I  GIA G F+YV++  ++ K  
Sbjct  598  KLFLLVFVFSLTSPIGSILGMVIVGS--GVTGSMVPPILQGIASGTFLYVAVVEIIPKEL  655

Query  300  KPQKTVAVDKPHFKFLAVLLGIGVIAVVMIW  208
                   +     K   +LLG   +AVV IW
Sbjct  656  SHDSNDIL----IKSFLLLLGFSGMAVVAIW  682



>ref|XP_002602874.1| hypothetical protein BRAFLDRAFT_243746 [Branchiostoma floridae]
 gb|EEN58886.1| hypothetical protein BRAFLDRAFT_243746, partial [Branchiostoma 
floridae]
Length=313

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 84/163 (52%), Gaps = 6/163 (4%)
 Frame = -3

Query  774  VNTEGRNFNGIGTTHPQSQLQGCDGTESH-FLHASSLGDSLLLIFALCFHSVFEGIAIGV  598
            +N E  + N +        +   D ++ H  LHAS    SLLL  A+  HSVFEGIA+G+
Sbjct  134  INNEEEDVNVMEMGEMHGGIPDSDQSDDHEHLHASLRSWSLLL--AISLHSVFEGIAVGL  191

Query  597  ADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGI  418
                A   + +  V LHK   A ++G+AL++    R   + +  S  FAI++P G+AIG 
Sbjct  192  QKETAAVLQLITAVALHKSVMAFSLGMALVQSTMGRT--TMVGLSIFFAITAPTGMAIGE  249

Query  417  IIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQK  289
               +++Q   +  +  +  G+A G F+YV+   +L+   K  +
Sbjct  250  NC-SSSQTTHSHGVSGVLTGLATGTFLYVTFLEVLAHELKSNR  291



>ref|XP_007445170.1| PREDICTED: zinc transporter ZIP2-like, partial [Python bivittatus]
Length=217

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 78/151 (52%), Gaps = 8/151 (5%)
 Frame = -3

Query  660  SLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLL  481
            + +L  +L FHSVFEG+AIGV     D  +    V +HK   + ++ + L++   +    
Sbjct  74   AFILFLSLSFHSVFEGLAIGVQKETIDTIQLCVAVLIHKAIVSFSLSLKLVQ--SSTKFQ  131

Query  480  SCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGY  301
              + Y   FA+ SP G+++GI + +   G  +    AI  G+A G F+YV+   +L    
Sbjct  132  WRMLYVVVFALMSPTGISVGIGV-SLFNGDGSGLAQAILEGVAAGTFLYVTFLEIL----  186

Query  300  KPQKTVAVDKPHFKFLAVLLGIGVIAVVMIW  208
             P +  + + P  KF  + LG  ++AV+ IW
Sbjct  187  -PYELGSHESPLTKFFFISLGFSIMAVIAIW  216



>gb|KJB55839.1| hypothetical protein B456_009G097300 [Gossypium raimondii]
Length=255

 Score = 54.3 bits (129),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 37/65 (57%), Gaps = 4/65 (6%)
 Frame = -3

Query  789  DLELQVNTEGRNFNGIGTTHPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGI  610
            ++ +QV  E     G       S+  G D     F   +S GD+LLLI ALCFHS+FEGI
Sbjct  148  EVRVQVQVE----EGRTADDEHSKDVGMDSNNPVFFKTTSFGDTLLLILALCFHSIFEGI  203

Query  609  AIGVA  595
            AIGVA
Sbjct  204  AIGVA  208


 Score = 41.2 bits (95),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = -2

Query  580  CMEGALDSLLAQNICSYSNGDSTAQNDPKSPALVLHSLLVRI  455
            CME +LD+  AQ+ CS+  GD TA++D K+   V   LL R+
Sbjct  211  CMEESLDNFTAQDFCSHCYGDCTAEDDTKAAVFVNLWLLFRL  252



>ref|XP_006628913.1| PREDICTED: zinc transporter ZIP1-like [Lepisosteus oculatus]
Length=298

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 90/174 (52%), Gaps = 12/174 (7%)
 Frame = -3

Query  732  HPQSQLQGCDGTESHF-LHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTV  556
            HP   L+   G   H   +A S   S +L  +L  HSVFEG+AIG+  T++   +    +
Sbjct  131  HPNGDLES-SGHHVHVDFNAHSSFRSFMLFLSLSLHSVFEGLAIGLQTTESKVLEICVAI  189

Query  555  CLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGII-IDATTQGKVADW  379
             +HK     ++ + L++    RPL   +AY   FA+ SP+G+A+GII I+A   G     
Sbjct  190  LIHKSIIVFSLSVKLVQS-AVRPLW-VVAYVVVFALMSPLGIAVGIIVIEAQLVG--GAL  245

Query  378  IYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVV  217
            I A+  G+A G F+Y++   +L     P +  + D    K L +LLG   +A++
Sbjct  246  IQAVLEGLAAGTFVYITFLEIL-----PHELNSPDWQLLKVLFILLGFTTMALL  294



>emb|CCT67735.1| related to ZRT1 Zinc transporter I [Fusarium fujikuroi IMI 58289]
Length=385

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 89/182 (49%), Gaps = 16/182 (9%)
 Frame = -3

Query  720  QLQGCDGT--ESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLH  547
            +LQ  DG   E+     + +   L+L F + FHSVF G+ +GVADT +D       +  H
Sbjct  208  ELQHLDGNSEETELAFKTQIAAFLILEFGVLFHSVFIGLNLGVADT-SDFDTLFPVLVFH  266

Query  546  KIFAAIAMGIALLRM-IPNR----PLLSCIAYSFAFAISSPVGVAIGIIIDATTQGK--V  388
            + F  + +G  L  +  PNR    P L C+AY     +++P+ +AIG+ I  T       
Sbjct  267  QSFEGLGIGARLSAIPFPNRLRSMPWLLCLAY----GLTTPIAIAIGLGIRKTYDNSSYT  322

Query  387  ADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAV--LLGIGVIAVVM  214
            A+ +  I   I+ G+ IY     ++++ +   +    DK    F+ V   LG G++A+V 
Sbjct  323  ANMVNGIFDSISAGILIYTGFVEMIARDFLFNRERTNDKVRLGFMIVCLFLGAGIMALVG  382

Query  213  IW  208
             W
Sbjct  383  KW  384



>ref|XP_006759834.1| PREDICTED: zinc transporter ZIP2-like [Myotis davidii]
 gb|ELK33214.1| Zinc transporter ZIP2 [Myotis davidii]
Length=304

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 89/181 (49%), Gaps = 15/181 (8%)
 Frame = -3

Query  729  PQSQLQGCDGTESHFLHASSLGDS------LLLIFALCFHSVFEGIAIGVADTKADAWKA  568
            P+ Q++    T  H  H+     S      L+L+ +L FHSVFEG+A+G+  T A   + 
Sbjct  131  PKVQMEEVSETHIHGFHSHEPSPSRKPFRALILLLSLSFHSVFEGLAVGLQTTVATTVQL  190

Query  567  LWTVCLHKIFAAIAMGIALLRM-IPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGK  391
               V  HK     ++G+ L+++    R  + CI    +FA+ SP+G+A+G+ +       
Sbjct  191  CLAVLAHKGPVVFSVGLRLVQIGTAPRWAMLCI---LSFALMSPLGIALGLAVPRGDSEG  247

Query  390  VADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMI  211
                  A+  G A G F+YV+   +L     P++  A + P  K+  V +G   +A++ +
Sbjct  248  GHGLAQAVLEGFAAGTFLYVTFLEIL-----PRELAAPEAPLLKWACVTVGFAFMALIAL  302

Query  210  W  208
            W
Sbjct  303  W  303



>ref|XP_005989801.1| PREDICTED: zinc transporter ZIP1-like [Latimeria chalumnae]
Length=311

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 80/155 (52%), Gaps = 10/155 (6%)
 Frame = -3

Query  684  LHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLR  505
             +A S   S +L+ +L  HSVFEG+AIG+ +T     +    V +HK     ++ I L++
Sbjct  160  FNAHSPFRSFVLVISLSLHSVFEGLAIGLQETNYRVLEICIAVLIHKSIIVFSLSIKLIQ  219

Query  504  MIPNRP-LLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVS  328
                 P L++CI     FA+ SP+G+A+GI +  T        +  I  G+A G F+Y++
Sbjct  220  SNARSPWLVACIV---VFAVMSPLGIAVGIGVTQTLTA-TGKLVRCILEGVAAGTFVYIT  275

Query  327  INHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIA  223
               +L     P +  + DK  +K L ++LG  V A
Sbjct  276  FLEIL-----PHELDSSDKRLWKLLFIVLGFSVTA  305



>ref|XP_001950888.1| PREDICTED: zinc transporter ZIP1-like [Acyrthosiphon pisum]
Length=394

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 86/173 (50%), Gaps = 21/173 (12%)
 Frame = -3

Query  771  NTEGRN---FNGIG-TTHPQSQLQG--CDGTESHFLHASSLGDS-------LLLIFALCF  631
            ++EGR+   F  I  T+ P S+ +   CDG ++    +  +  S       L  + AL F
Sbjct  193  SSEGRHQPTFQEIALTSRPGSERRQTMCDGADAEKQASRKVRRSAGQSYRGLFAVLALSF  252

Query  630  HSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFA  451
            H VFEG+AIG+ +   D W   + V  HK+  A  +G+ L  +   R +L  + Y   FA
Sbjct  253  HEVFEGLAIGLEERVDDTWYLFFAVATHKLIIAFCIGLELAWLETKRAIL--VVYVATFA  310

Query  450  ISSPVGVAIGIII-----DATTQGKVADWIYAISMGIACGVFIYVSINHLLSK  307
            I +PVG+AIG+++     D +  G     +  +  G+A G  +YV    +L++
Sbjct  311  IVTPVGIAIGMLLVHFGDDGSVDG-TPGLLAVVLQGLAAGTLLYVVFFEVLAR  362



>gb|KJE94254.1| solute carrier family 39 [Capsaspora owczarzaki ATCC 30864]
Length=455

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 80/168 (48%), Gaps = 21/168 (13%)
 Frame = -3

Query  654  LLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSC  475
            L   AL  HS+FEG+ +G   T++     +  V  HK   A ++G+++     NR    C
Sbjct  289  LFTIALSVHSLFEGLGMGAETTESGLLSLIVAVVAHKAIEAFSLGVSVYFAKMNRTRSLC  348

Query  474  IAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYK-  298
            I     +++ +PVG+A+G+    + QG V D I  I   +A G F+Y+S+  L+    + 
Sbjct  349  IL--IGYSLVTPVGIAVGMGAAQSAQGPVRDLIEGILTAVAAGSFLYISLIELIPSELQS  406

Query  297  --------PQKTVAVDKPH----------FKFLAVLLGIGVIAVVMIW  208
                    P+K++  D P            K L ++ G G++A++  W
Sbjct  407  NAGVPPPPPRKSIQHDSPQPWLTRKKALWIKILCLVFGWGIMALIAEW  454



>gb|ACO14718.1| Zinc transporter ZIP1 [Caligus clemensi]
Length=293

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 82/175 (47%), Gaps = 10/175 (6%)
 Frame = -3

Query  732  HPQSQLQGCDGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVC  553
            H + +    DG +       S+  S +L+ AL FHS FEG+AIG+   + D    ++ V 
Sbjct  124  HEEQESDSSDGPQEF-----SVLRSFMLLIALSFHSFFEGLAIGLQRKENDLLALVFAVM  178

Query  552  LHKIFAAIAMGIALLRM-IPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWI  376
             HK   A ++GI L R  I  +    CI     F+ +SP+G+A+G+ +    +    D  
Sbjct  179  FHKGIMAFSLGINLTRTNIVFKVFTGCI---LIFSFASPIGIAVGMGLMNLPESSARDIT  235

Query  375  YAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMI  211
                  IA G F+Y++   +L            D+   + L +LLG   +A++++
Sbjct  236  TCFLQAIAGGTFLYITFIEVLYHELSSDMREGPDR-MLRLLGILLGFACMAILLL  289



>ref|XP_008487278.1| PREDICTED: zinc transporter ZIP1-like, partial [Diaphorina citri]
Length=110

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 59/109 (54%), Gaps = 2/109 (2%)
 Frame = -3

Query  657  LLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLS  478
            LL + AL FH++FEG+A+G+     + W     +  HK+  A  +GI L+      PL+ 
Sbjct  2    LLAVLALSFHAIFEGLAVGLESRVNNVWYLFGAIATHKLVIAFCVGIELVSSRTKLPLV-  60

Query  477  CIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYV  331
             + Y   FAI +P+G+ +GI++     G   +++  +  G+A G  +YV
Sbjct  61   -LVYVATFAIVTPLGIGLGIVLSEEASGAEGNFVAVVLQGMAAGTLLYV  108



>gb|ABA29004.1| zinc transporter protein [Fusarium verticillioides]
 gb|EWG53466.1| hypothetical protein FVEG_11894 [Fusarium verticillioides 7600]
Length=385

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 89/182 (49%), Gaps = 16/182 (9%)
 Frame = -3

Query  720  QLQGCDG--TESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLH  547
            +LQ  DG   E+     + +   L+L F + FHSVF G+ +GVADT +D       +  H
Sbjct  208  ELQHLDGDSEETELAFKTQIAAFLILEFGVLFHSVFIGLNLGVADT-SDFDTLFPVLVFH  266

Query  546  KIFAAIAMGIALLRM-IPNR----PLLSCIAYSFAFAISSPVGVAIGIIIDATTQGK--V  388
            + F  + +G  L  +  PNR    P L C+AY     +++P+ +AIG+ I  T       
Sbjct  267  QSFEGLGIGARLSAIPFPNRLRSMPWLLCLAY----GLTTPIAIAIGLGIRKTYDNSSFT  322

Query  387  ADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAV--LLGIGVIAVVM  214
            A+ +  I   I+ G+ IY     ++++ +   +    DK    F+ V   LG G++A+V 
Sbjct  323  ANTVNGIFDSISAGILIYTGFVEMIARDFLFNRERTNDKVRLGFMIVCLFLGAGIMALVG  382

Query  213  IW  208
             W
Sbjct  383  KW  384



>gb|KJE94255.1| solute carrier family 39, variant [Capsaspora owczarzaki ATCC 
30864]
Length=403

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 80/168 (48%), Gaps = 21/168 (13%)
 Frame = -3

Query  654  LLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSC  475
            L   AL  HS+FEG+ +G   T++     +  V  HK   A ++G+++     NR    C
Sbjct  237  LFTIALSVHSLFEGLGMGAETTESGLLSLIVAVVAHKAIEAFSLGVSVYFAKMNRTRSLC  296

Query  474  IAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYK-  298
            I     +++ +PVG+A+G+    + QG V D I  I   +A G F+Y+S+  L+    + 
Sbjct  297  IL--IGYSLVTPVGIAVGMGAAQSAQGPVRDLIEGILTAVAAGSFLYISLIELIPSELQS  354

Query  297  --------PQKTVAVDKPH----------FKFLAVLLGIGVIAVVMIW  208
                    P+K++  D P            K L ++ G G++A++  W
Sbjct  355  NAGVPPPPPRKSIQHDSPQPWLTRKKALWIKILCLVFGWGIMALIAEW  402



>gb|EWZ82379.1| hypothetical protein FOWG_14060 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EWZ82380.1| hypothetical protein FOWG_14060 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EWZ82381.1| hypothetical protein FOWG_14060 [Fusarium oxysporum f. sp. lycopersici 
MN25]
Length=385

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 89/182 (49%), Gaps = 16/182 (9%)
 Frame = -3

Query  720  QLQGCDG--TESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLH  547
            +LQ  DG   E+     + +   L+L F + FHSVF G+ +GVADT +D       +  H
Sbjct  208  ELQHLDGDSEETELAFKTQIAAFLILEFGVLFHSVFIGLNLGVADT-SDFDTLFPVLVFH  266

Query  546  KIFAAIAMGIALLRM-IPNR----PLLSCIAYSFAFAISSPVGVAIGIIIDATTQGK--V  388
            + F  + +G  L  +  PNR    P L C+AY     +++P+ +AIG+ I  T       
Sbjct  267  QSFEGLGIGARLSAIPFPNRLRSMPWLLCLAY----GLTTPIAIAIGLGIRKTYDNSSYT  322

Query  387  ADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAV--LLGIGVIAVVM  214
            A+ +  +   I+ G+ IY     ++++ +   +    DK    F+ V   LG G++A+V 
Sbjct  323  ANLVNGVFDSISAGILIYTGFVEMIARDFLFNRERTNDKVRLGFMIVCLFLGTGIMALVG  382

Query  213  IW  208
             W
Sbjct  383  KW  384



>gb|ACI34150.1| Zinc transporter ZIP1 [Salmo salar]
Length=304

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 88/179 (49%), Gaps = 15/179 (8%)
 Frame = -3

Query  741  GTTHPQSQLQGCD--GTESHF---LHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADA  577
            G +H Q +    D  G+  H    L A S   S +L  +L  HSVFEG+AIG+  T +  
Sbjct  129  GHSHGQGKAASTDLEGSAHHVHMDLQAHSSFRSFMLFLSLSLHSVFEGLAIGLQTTDSKV  188

Query  576  WKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGI-IIDATT  400
             +    + +HK     ++ + L++     P +   AY   FA+ SP+G+A+GI +I+A  
Sbjct  189  LEICIAIVVHKSIIVFSLSVKLVQ--SEVPPMWVAAYVGVFAMMSPLGIAVGIGVIEAQL  246

Query  399  QGKVADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIA  223
               V   I AI  G+A G FIY++   +L     P +  + +    K   +LLG  V+A
Sbjct  247  AAGV--LIQAILEGMAAGTFIYITFMEIL-----PHELNSPENQLLKVFFILLGFSVMA  298



>gb|KIH49367.1| metal cation transporter, ZIP family [Ancylostoma duodenale]
Length=197

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 81/165 (49%), Gaps = 14/165 (8%)
 Frame = -3

Query  681  HASSLG-DSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLR  505
            HA S G  S+  + AL  HSV EGIA+GV D  ++      ++ +HK+  A ++G+ L R
Sbjct  6    HAHSHGVRSITFVLALSIHSVIEGIALGVGDNASETTALFLSLLVHKLIVAFSVGLQLAR  65

Query  504  MIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVA-DWIYAISMGIACGVFIYVS  328
               ++ L   +A  F FA+ SP+G  IG+ + +      + D    +  G+A G F+YV+
Sbjct  66   THAHQ-LHWVVASVFTFALMSPLGAIIGMAVQSAASNSFSKDLTVTVLQGLAVGTFLYVT  124

Query  327  INHLLSKGYKPQKTVAVDKPH---FKFLAVLLGIGVIAVVMIWDT  202
               +L            D  H    K L +L+G  +I ++ + D 
Sbjct  125  FFEVLLHER--------DNEHPNLLKLLVMLVGFSMIGLLRLVDN  161



>ref|XP_004347674.2| solute carrier family 39 [Capsaspora owczarzaki ATCC 30864]
Length=499

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 80/168 (48%), Gaps = 21/168 (13%)
 Frame = -3

Query  654  LLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLLSC  475
            L   AL  HS+FEG+ +G   T++     +  V  HK   A ++G+++     NR    C
Sbjct  333  LFTIALSVHSLFEGLGMGAETTESGLLSLIVAVVAHKAIEAFSLGVSVYFAKMNRTRSLC  392

Query  474  IAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKGYK-  298
            I     +++ +PVG+A+G+    + QG V D I  I   +A G F+Y+S+  L+    + 
Sbjct  393  IL--IGYSLVTPVGIAVGMGAAQSAQGPVRDLIEGILTAVAAGSFLYISLIELIPSELQS  450

Query  297  --------PQKTVAVDKPH----------FKFLAVLLGIGVIAVVMIW  208
                    P+K++  D P            K L ++ G G++A++  W
Sbjct  451  NAGVPPPPPRKSIQHDSPQPWLTRKKALWIKILCLVFGWGIMALIAEW  498



>gb|EWZ01178.1| hypothetical protein FOYG_00854 [Fusarium oxysporum FOSC 3-a]
 gb|EWZ01179.1| hypothetical protein FOYG_00854 [Fusarium oxysporum FOSC 3-a]
 gb|EWZ01180.1| hypothetical protein FOYG_00854 [Fusarium oxysporum FOSC 3-a]
Length=385

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 89/182 (49%), Gaps = 16/182 (9%)
 Frame = -3

Query  720  QLQGCDG--TESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLH  547
            +LQ  DG   E+     + +   L+L F + FHSVF G+ +GVADT +D       +  H
Sbjct  208  ELQHLDGDSEETELAFKTQIAAFLILEFGVLFHSVFIGLNLGVADT-SDFDTLFPVLVFH  266

Query  546  KIFAAIAMGIALLRM-IPNR----PLLSCIAYSFAFAISSPVGVAIGIIIDATTQGK--V  388
            + F  + +G  L  +  PNR    P L C+AY     +++P+ +AIG+ I  T       
Sbjct  267  QSFEGLGIGARLSAIPFPNRLRSMPWLLCLAY----GLTTPIAIAIGLGIRKTYDNSSYT  322

Query  387  ADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAV--LLGIGVIAVVM  214
            A+ +  +   I+ G+ IY     ++++ +   +    DK    F+ V   LG G++A+V 
Sbjct  323  ANLVNGVFDSISAGILIYTGFVEMIARDFLFNRERTNDKVRLGFMIVCLFLGAGIMALVG  382

Query  213  IW  208
             W
Sbjct  383  KW  384



>gb|EXK44537.1| hypothetical protein FOMG_03245 [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK44538.1| hypothetical protein FOMG_03245 [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK44539.1| hypothetical protein FOMG_03245 [Fusarium oxysporum f. sp. melonis 
26406]
Length=385

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 89/182 (49%), Gaps = 16/182 (9%)
 Frame = -3

Query  720  QLQGCDG--TESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLH  547
            +LQ  DG   E+     + +   L+L F + FHSVF G+ +GVADT +D       +  H
Sbjct  208  ELQHLDGDSEETELAFKTQIAAFLILEFGVLFHSVFIGLNLGVADT-SDFDTLFPVLVFH  266

Query  546  KIFAAIAMGIALLRM-IPNR----PLLSCIAYSFAFAISSPVGVAIGIIIDATTQGK--V  388
            + F  + +G  L  +  PNR    P L C+AY     +++P+ +AIG+ I  T       
Sbjct  267  QSFEGLGIGARLSAIPFPNRLRSMPWLLCLAY----GLTTPIAIAIGLGIRKTYDNSSYT  322

Query  387  ADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAV--LLGIGVIAVVM  214
            A+ +  +   I+ G+ IY     ++++ +   +    DK    F+ V   LG G++A+V 
Sbjct  323  ANLVNGVFDSISAGILIYTGFVEMIARDFLFNRERTNDKVRLGFMIVCLFLGAGIMALVG  382

Query  213  IW  208
             W
Sbjct  383  KW  384



>gb|EWZ47215.1| hypothetical protein FOZG_03172 [Fusarium oxysporum Fo47]
 gb|EWZ47216.1| hypothetical protein FOZG_03172 [Fusarium oxysporum Fo47]
 gb|EWZ47217.1| hypothetical protein FOZG_03172 [Fusarium oxysporum Fo47]
 gb|EXL41190.1| hypothetical protein FOCG_16556 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL41191.1| hypothetical protein FOCG_16556 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL41192.1| hypothetical protein FOCG_16556 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
Length=385

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 89/182 (49%), Gaps = 16/182 (9%)
 Frame = -3

Query  720  QLQGCDG--TESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLH  547
            +LQ  DG   E+     + +   L+L F + FHSVF G+ +GVADT +D       +  H
Sbjct  208  ELQHLDGDSEETELAFKTQIAAFLILEFGVLFHSVFIGLNLGVADT-SDFDTLFPVLVFH  266

Query  546  KIFAAIAMGIALLRM-IPNR----PLLSCIAYSFAFAISSPVGVAIGIIIDATTQGK--V  388
            + F  + +G  L  +  PNR    P L C+AY     +++P+ +AIG+ I  T       
Sbjct  267  QSFEGLGIGARLSAIPFPNRLRSMPWLLCLAY----GLTTPIAIAIGLGIRKTYDNSSYT  322

Query  387  ADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAV--LLGIGVIAVVM  214
            A+ +  +   I+ G+ IY     ++++ +   +    DK    F+ +   LG G++A+V 
Sbjct  323  ANLVNGVFDSISAGILIYTGFVEMIARDFLFNRERTNDKVRLGFMIICLFLGTGIMALVG  382

Query  213  IW  208
             W
Sbjct  383  KW  384



>gb|EXA43207.1| hypothetical protein FOVG_08222 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXA43208.1| hypothetical protein FOVG_08222 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXA43209.1| hypothetical protein FOVG_08222 [Fusarium oxysporum f. sp. pisi 
HDV247]
Length=385

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 89/182 (49%), Gaps = 16/182 (9%)
 Frame = -3

Query  720  QLQGCDG--TESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLH  547
            +LQ  DG   E+     + +   L+L F + FHSVF G+ +GVADT +D       +  H
Sbjct  208  ELQHLDGDSEETELAFKTQIAAFLILEFGVLFHSVFIGLNLGVADT-SDFDTLFPVLVFH  266

Query  546  KIFAAIAMGIALLRM-IPNR----PLLSCIAYSFAFAISSPVGVAIGIIIDATTQGK--V  388
            + F  + +G  L  +  PNR    P L C+AY     +++P+ +AIG+ I  T       
Sbjct  267  QSFEGLGIGARLSAIPFPNRLRSMPWLLCLAY----GLTTPIAIAIGLSIRKTYDNSSYT  322

Query  387  ADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAV--LLGIGVIAVVM  214
            A+ +  +   I+ G+ IY     ++++ +   +    DK    F+ +   LG G++A+V 
Sbjct  323  ANLVNGVFDSISAGILIYTGFVEMIARDFLFNRERTNDKVRLGFMIICLFLGAGIMALVG  382

Query  213  IW  208
             W
Sbjct  383  KW  384



>emb|CDQ77779.1| unnamed protein product [Oncorhynchus mykiss]
Length=323

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 80/155 (52%), Gaps = 10/155 (6%)
 Frame = -3

Query  684  LHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLR  505
            L A S   S +L F+L  HSVFEG+AIG+  T +   +    + +HK     ++ + L++
Sbjct  172  LQAHSSFRSFMLFFSLSLHSVFEGLAIGLQTTDSKVLEICIAIVVHKSIIVFSLSVKLVQ  231

Query  504  MIPNRPLLSCIAYSFAFAISSPVGVAIGI-IIDATTQGKVADWIYAISMGIACGVFIYVS  328
                 P +   AY   FA+ SP+G+A+GI +I+A     V   I AI  G+A G FIY++
Sbjct  232  --SAVPPMWVAAYVGVFAMMSPLGIAVGIGVIEAQLAAGV--LIQAILEGLAAGTFIYIT  287

Query  327  INHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIA  223
               +L     P +  + +    K   +LLG  V+A
Sbjct  288  FMEIL-----PHELNSPENQLLKVFFILLGFSVMA  317



>ref|XP_005856624.1| PREDICTED: zinc transporter ZIP2 isoform X1 [Myotis brandtii]
 gb|EPQ01629.1| Zinc transporter ZIP2 [Myotis brandtii]
Length=309

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 79/152 (52%), Gaps = 7/152 (5%)
 Frame = -3

Query  663  DSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPL  484
             +L+L+ +L FHSVFEG+A+G+  T     +    V  HK      +G+ L++ +   P 
Sbjct  164  RALILLLSLSFHSVFEGLAVGLQTTVVATVQLCLAVLAHKGLIVFGVGLRLVQ-VGTAPR  222

Query  483  LSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKG  304
             + + Y  +FA+ SP+GVAIG+ +             A+  G+A G F+YV+   +L   
Sbjct  223  WA-VFYILSFALMSPLGVAIGLAVAGGDSEGGQGLAQAVLEGVAAGTFLYVTFLEIL---  278

Query  303  YKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIW  208
              P++  A + P  K+  V +G   +A++ +W
Sbjct  279  --PRELAAPEAPMLKWACVTVGFAFMALIALW  308



>ref|XP_001359463.2| GA19939 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL28609.2| GA19939 [Drosophila pseudoobscura pseudoobscura]
Length=498

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 67/133 (50%), Gaps = 5/133 (4%)
 Frame = -3

Query  705  DGTESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIA  526
            D + +  L +S  G  L ++ AL  H +FEG+AIG+  + +  W     V  HK+  A  
Sbjct  258  DASSADMLTSSLRG--LFIVSALSLHELFEGMAIGLESSASSVWFMFGAVSAHKLVLAFC  315

Query  525  MGIALLRMIPNRPLLSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACG  346
            +G+ L+  +        I Y   FA+ SP+G+ IGI+I +  Q    +   AI  G ACG
Sbjct  316  VGVELI--VARTRFTLAILYVLTFAVVSPLGIGIGILI-SNGQETGPNLASAILQGFACG  372

Query  345  VFIYVSINHLLSK  307
              IYV    +LSK
Sbjct  373  TLIYVVFFEILSK  385



>emb|CDQ79559.1| unnamed protein product [Oncorhynchus mykiss]
Length=306

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 80/155 (52%), Gaps = 10/155 (6%)
 Frame = -3

Query  684  LHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLR  505
            L A S   S +L F+L  HSVFEG+AIG+  T +   +    + +HK     ++ + L++
Sbjct  155  LQAHSSFRSFMLFFSLSLHSVFEGLAIGLQTTDSKVLEICIAIVVHKSIIVFSLSVKLVQ  214

Query  504  MIPNRPLLSCIAYSFAFAISSPVGVAIGI-IIDATTQGKVADWIYAISMGIACGVFIYVS  328
                 P +   AY   FA+ SP+G+ +GI +I+A  Q      I AI  G+A G FIY++
Sbjct  215  --SAVPPMWVAAYVGVFAMMSPLGIGVGIGVIEA--QLAAGALIQAILEGLAAGTFIYIT  270

Query  327  INHLLSKGYKPQKTVAVDKPHFKFLAVLLGIGVIA  223
               +L     P +  + +    K L +LLG  V+A
Sbjct  271  FMEIL-----PHELNSPENQLLKVLFILLGFSVMA  300



>gb|KHJ48748.1| metal cation transporter, ZIP family [Trichuris suis]
Length=347

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 84/153 (55%), Gaps = 8/153 (5%)
 Frame = -3

Query  660  SLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPLL  481
            +++L+  L  H++FEG+A+G+ +    A++    +C+HK   A ++G   LR+I  + + 
Sbjct  197  AVILVLTLSVHALFEGLAMGLINQYTTAFQIFAALCIHKSLVAFSLG---LRLISFKDVS  253

Query  480  SC--IAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSK  307
            +C  I +  AFA    +G  IGI++  + + K+A +I     GIACG F+Y+    +L  
Sbjct  254  TCTVILFCSAFASVGSLGGFIGIVLSESLRSKLAHFITGSLQGIACGTFLYIVTFEILP-  312

Query  306  GYKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIW  208
             ++   + A   P  K +  L G+G IA V+ +
Sbjct  313  -HELSSSTAHLLP-VKLIFFLAGLGTIAFVLYY  343



>gb|EXK82348.1| hypothetical protein FOQG_13371 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXK82349.1| hypothetical protein FOQG_13371 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXK82350.1| hypothetical protein FOQG_13371 [Fusarium oxysporum f. sp. raphani 
54005]
Length=385

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 89/182 (49%), Gaps = 16/182 (9%)
 Frame = -3

Query  720  QLQGCDG--TESHFLHASSLGDSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLH  547
            +LQ  DG   E+     + +   L+L F + FHSVF G+ +GVADT +D       +  H
Sbjct  208  ELQHLDGDSEETELAFKTQIAAFLILEFGVLFHSVFIGLNLGVADT-SDFDTLFPVLVFH  266

Query  546  KIFAAIAMGIALLRM-IPNR----PLLSCIAYSFAFAISSPVGVAIGIIIDATTQGK--V  388
            + F  + +G  L  +  PNR    P L C+AY     +++P+ +AIG+ I  T       
Sbjct  267  QSFEGLGIGARLSAIPFPNRLRSMPWLLCLAY----GLTTPIAIAIGLGIRKTYDNSSYT  322

Query  387  ADWIYAISMGIACGVFIYVSINHLLSKGYKPQKTVAVDKPHFKFLAV--LLGIGVIAVVM  214
            A+ +  +   I+ G+ IY     ++++ +   +    DK    F+ +   LG G++A+V 
Sbjct  323  ANLVNGVFDSISAGILIYTGFVEMIARDFLFNRERTNDKVRLGFMIICLFLGAGIMALVG  382

Query  213  IW  208
             W
Sbjct  383  KW  384



>ref|XP_005856625.1| PREDICTED: zinc transporter ZIP2 isoform X2 [Myotis brandtii]
Length=309

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 79/152 (52%), Gaps = 7/152 (5%)
 Frame = -3

Query  663  DSLLLIFALCFHSVFEGIAIGVADTKADAWKALWTVCLHKIFAAIAMGIALLRMIPNRPL  484
             +L+L+ +L FHSVFEG+A+G+  T     +    V  HK      +G+ L++ +   P 
Sbjct  164  RALILLLSLSFHSVFEGLAVGLQTTVVATVQLCLAVLAHKGLIVFGVGLRLVQ-VGTAPR  222

Query  483  LSCIAYSFAFAISSPVGVAIGIIIDATTQGKVADWIYAISMGIACGVFIYVSINHLLSKG  304
             + + Y  +FA+ SP+GVAIG+ +             A+  G+A G F+YV+   +L   
Sbjct  223  WA-VFYILSFALMSPLGVAIGLAVAGGDSEGGQGLAQAVLEGVAAGTFLYVTFLEIL---  278

Query  303  YKPQKTVAVDKPHFKFLAVLLGIGVIAVVMIW  208
              P++  A + P  K+  V +G   +A++ +W
Sbjct  279  --PRELAAPEAPMLKWACVTVGFAFMALIALW  308



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1614230233668