BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10324

Length=1008
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004248564.1|  PREDICTED: probable protein S-acyltransferas...    261   3e-81   Solanum lycopersicum
ref|XP_006347869.1|  PREDICTED: probable protein S-acyltransferas...    260   7e-81   Solanum tuberosum [potatoes]
ref|XP_010325709.1|  PREDICTED: probable protein S-acyltransferas...    259   1e-80   Solanum lycopersicum
ref|XP_009616135.1|  PREDICTED: probable protein S-acyltransferas...    256   3e-79   Nicotiana tomentosiformis
ref|XP_009610572.1|  PREDICTED: probable protein S-acyltransferas...    256   5e-79   Nicotiana tomentosiformis
ref|XP_006364242.1|  PREDICTED: probable protein S-acyltransferas...    255   5e-79   Solanum tuberosum [potatoes]
ref|XP_009791941.1|  PREDICTED: probable protein S-acyltransferas...    251   2e-77   Nicotiana sylvestris
gb|EYU31985.1|  hypothetical protein MIMGU_mgv1a010704mg                248   2e-76   Erythranthe guttata [common monkey flower]
ref|XP_011090630.1|  PREDICTED: probable protein S-acyltransferas...    248   4e-76   Sesamum indicum [beniseed]
ref|XP_007052067.1|  DHHC-type zinc finger family protein isoform 2     245   9e-75   
ref|XP_007134881.1|  hypothetical protein PHAVU_010G083900g             243   2e-74   Phaseolus vulgaris [French bean]
emb|CDO97688.1|  unnamed protein product                                243   3e-74   Coffea canephora [robusta coffee]
gb|KHG00286.1|  hypothetical protein F383_19583                         243   4e-74   Gossypium arboreum [tree cotton]
ref|XP_007218730.1|  hypothetical protein PRUPE_ppa009076mg             243   5e-74   Prunus persica
ref|XP_003521795.1|  PREDICTED: probable protein S-acyltransferas...    241   1e-73   Glycine max [soybeans]
ref|XP_009346814.1|  PREDICTED: probable protein S-acyltransferas...    240   1e-73   Pyrus x bretschneideri [bai li]
gb|KDO85815.1|  hypothetical protein CISIN_1g021813mg                   239   2e-73   Citrus sinensis [apfelsine]
ref|XP_011469137.1|  PREDICTED: probable protein S-acyltransferas...    241   2e-73   Fragaria vesca subsp. vesca
ref|XP_002320722.2|  hypothetical protein POPTR_0014s06480g             239   3e-73   
ref|XP_004506505.1|  PREDICTED: probable S-acyltransferase At3g60...    240   4e-73   Cicer arietinum [garbanzo]
ref|XP_010544651.1|  PREDICTED: probable protein S-acyltransferas...    240   6e-73   Tarenaya hassleriana [spider flower]
ref|XP_002511714.1|  zinc finger protein, putative                      239   7e-73   Ricinus communis
gb|KFK37316.1|  hypothetical protein AALP_AA4G241200                    239   9e-73   Arabis alpina [alpine rockcress]
gb|KJB41112.1|  hypothetical protein B456_007G090900                    238   9e-73   Gossypium raimondii
ref|XP_011469138.1|  PREDICTED: probable protein S-acyltransferas...    239   9e-73   Fragaria vesca subsp. vesca
ref|XP_009338113.1|  PREDICTED: probable protein S-acyltransferas...    239   1e-72   Pyrus x bretschneideri [bai li]
gb|KDO85814.1|  hypothetical protein CISIN_1g021813mg                   239   1e-72   Citrus sinensis [apfelsine]
ref|XP_008393352.1|  PREDICTED: probable protein S-acyltransferas...    239   1e-72   
ref|XP_006291552.1|  hypothetical protein CARUB_v10017708mg             239   1e-72   Capsella rubella
gb|KJB41110.1|  hypothetical protein B456_007G090900                    239   1e-72   Gossypium raimondii
ref|XP_011034295.1|  PREDICTED: probable protein S-acyltransferas...    239   1e-72   Populus euphratica
ref|XP_010413516.1|  PREDICTED: probable protein S-acyltransferas...    239   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010469144.1|  PREDICTED: probable protein S-acyltransferas...    239   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_012083578.1|  PREDICTED: probable protein S-acyltransferas...    238   2e-72   Jatropha curcas
ref|XP_010524364.1|  PREDICTED: probable protein S-acyltransferas...    238   2e-72   Tarenaya hassleriana [spider flower]
ref|XP_006445267.1|  hypothetical protein CICLE_v10021302mg             238   3e-72   Citrus clementina [clementine]
ref|XP_010056317.1|  PREDICTED: probable protein S-acyltransferas...    237   3e-72   Eucalyptus grandis [rose gum]
ref|XP_003605089.1|  Palmitoyltransferase pfa3                          237   4e-72   
gb|AES87286.2|  DHHC-type zinc finger protein                           237   4e-72   Medicago truncatula
gb|KJB09889.1|  hypothetical protein B456_001G174100                    238   4e-72   Gossypium raimondii
gb|KJB09890.1|  hypothetical protein B456_001G174100                    237   4e-72   Gossypium raimondii
gb|ERN13328.1|  hypothetical protein AMTR_s00041p00097340               237   6e-72   Amborella trichopoda
ref|XP_006851861.2|  PREDICTED: probable protein S-acyltransferas...    237   7e-72   Amborella trichopoda
ref|XP_010255627.1|  PREDICTED: probable protein S-acyltransferas...    237   9e-72   Nelumbo nucifera [Indian lotus]
ref|XP_010098912.1|  putative S-acyltransferase                         236   2e-71   Morus notabilis
emb|CDX71777.1|  BnaC08g30970D                                          235   3e-71   
ref|XP_003517050.1|  PREDICTED: probable protein S-acyltransferas...    235   3e-71   Glycine max [soybeans]
emb|CBI38870.3|  unnamed protein product                                235   3e-71   Vitis vinifera
ref|XP_002279896.1|  PREDICTED: probable protein S-acyltransferas...    235   3e-71   Vitis vinifera
ref|XP_008232660.1|  PREDICTED: probable protein S-acyltransferas...    243   4e-71   Prunus mume [ume]
ref|XP_002302535.2|  zinc finger family protein                         235   5e-71   
ref|XP_010508175.1|  PREDICTED: probable protein S-acyltransferas...    234   7e-71   
ref|XP_008343300.1|  PREDICTED: probable protein S-acyltransferas...    234   8e-71   Malus domestica [apple tree]
ref|XP_011017489.1|  PREDICTED: probable protein S-acyltransferas...    234   8e-71   Populus euphratica
ref|XP_002878349.1|  zinc finger family protein                         234   9e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_004133913.1|  PREDICTED: probable protein S-acyltransferas...    234   1e-70   Cucumis sativus [cucumbers]
ref|XP_008438165.1|  PREDICTED: probable protein S-acyltransferas...    233   2e-70   Cucumis melo [Oriental melon]
ref|NP_191639.2|  DHHC-type zinc finger family protein                  233   3e-70   Arabidopsis thaliana [mouse-ear cress]
emb|CDY52347.1|  BnaA09g38960D                                          233   3e-70   Brassica napus [oilseed rape]
ref|XP_007052066.1|  DHHC-type zinc finger family protein isoform 1     233   3e-70   
ref|XP_010276626.1|  PREDICTED: probable protein S-acyltransferas...    232   4e-70   Nelumbo nucifera [Indian lotus]
gb|ACU19432.1|  unknown                                                 232   4e-70   Glycine max [soybeans]
ref|XP_010692246.1|  PREDICTED: probable protein S-acyltransferas...    232   6e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009143136.1|  PREDICTED: probable protein S-acyltransferas...    231   1e-69   Brassica rapa
gb|KHN29455.1|  Putative S-acyltransferase                              231   1e-69   Glycine soja [wild soybean]
ref|XP_006587892.1|  PREDICTED: probable protein S-acyltransferas...    231   2e-69   Glycine max [soybeans]
ref|XP_006602748.1|  PREDICTED: probable protein S-acyltransferas...    231   2e-69   Glycine max [soybeans]
ref|XP_006397719.1|  hypothetical protein EUTSA_v10001560mg             231   2e-69   Eutrema salsugineum [saltwater cress]
gb|KHN40573.1|  Putative S-acyltransferase                              231   5e-69   Glycine soja [wild soybean]
ref|XP_009138811.1|  PREDICTED: probable protein S-acyltransferas...    229   6e-69   Brassica rapa
emb|CDY51805.1|  BnaC04g53110D                                          229   1e-68   Brassica napus [oilseed rape]
ref|XP_010518152.1|  PREDICTED: probable protein S-acyltransferas...    228   1e-68   Camelina sativa [gold-of-pleasure]
emb|CDX74736.1|  BnaA05g04820D                                          228   2e-68   
gb|KHG30156.1|  hypothetical protein F383_14468                         228   3e-68   Gossypium arboreum [tree cotton]
emb|CDX89079.1|  BnaA04g01070D                                          227   3e-68   
emb|CDX71345.1|  BnaC07g06240D                                          226   4e-68   
ref|XP_006602749.1|  PREDICTED: probable protein S-acyltransferas...    226   8e-68   Glycine max [soybeans]
ref|XP_003552340.1|  PREDICTED: probable protein S-acyltransferas...    226   1e-67   Glycine max [soybeans]
ref|XP_010506482.1|  PREDICTED: probable protein S-acyltransferas...    224   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010053896.1|  PREDICTED: probable protein S-acyltransferas...    224   6e-67   Eucalyptus grandis [rose gum]
ref|XP_003579517.1|  PREDICTED: probable protein S-acyltransferas...    224   6e-67   Brachypodium distachyon [annual false brome]
ref|XP_002446206.1|  hypothetical protein SORBIDRAFT_06g004040          223   2e-66   Sorghum bicolor [broomcorn]
ref|XP_009761491.1|  PREDICTED: probable protein S-acyltransferas...    217   2e-66   Nicotiana sylvestris
ref|XP_004952412.1|  PREDICTED: probable S-acyltransferase At3g60...    220   4e-66   Setaria italica
ref|XP_004492612.1|  PREDICTED: probable S-acyltransferase At3g60...    222   4e-66   Cicer arietinum [garbanzo]
gb|KDO85816.1|  hypothetical protein CISIN_1g021813mg                   218   7e-66   Citrus sinensis [apfelsine]
ref|XP_002882009.1|  hypothetical protein ARALYDRAFT_903981             219   7e-66   Arabidopsis lyrata subsp. lyrata
ref|XP_006402542.1|  hypothetical protein EUTSA_v10006120mg             219   7e-66   Eutrema salsugineum [saltwater cress]
gb|ABK24332.1|  unknown                                                 218   6e-65   Picea sitchensis
gb|KFK35280.1|  hypothetical protein AALP_AA5G264300                    216   7e-65   Arabis alpina [alpine rockcress]
ref|XP_009116762.1|  PREDICTED: probable protein S-acyltransferas...    215   1e-64   Brassica rapa
ref|XP_009143135.1|  PREDICTED: probable protein S-acyltransferas...    217   2e-64   
gb|EMT07089.1|  Putative S-acyltransferase                              214   3e-63   
ref|XP_009362134.1|  PREDICTED: probable protein S-acyltransferas...    214   5e-63   Pyrus x bretschneideri [bai li]
ref|NP_001169109.1|  palmitoyltransferase ZDHHC20                       214   5e-63   Zea mays [maize]
gb|KCW78272.1|  hypothetical protein EUGRSUZ_D02456                     210   8e-63   Eucalyptus grandis [rose gum]
dbj|BAJ93966.1|  predicted protein                                      214   9e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008345376.1|  PREDICTED: probable protein S-acyltransferas...    214   2e-62   
ref|NP_001148846.1|  palmitoyltransferase ZDHHC20                       212   4e-62   Zea mays [maize]
gb|KHG01247.1|  hypothetical protein F383_23406                         209   4e-62   Gossypium arboreum [tree cotton]
gb|AHA84213.1|  palmitoyltransferase                                    203   1e-61   Phaseolus vulgaris [French bean]
ref|XP_004975099.1|  PREDICTED: probable S-acyltransferase At3g60...    210   2e-61   Setaria italica
ref|XP_008354779.1|  PREDICTED: uncharacterized protein LOC103418427    208   3e-61   
ref|XP_009399491.1|  PREDICTED: probable protein S-acyltransferas...    209   3e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008798535.1|  PREDICTED: probable protein S-acyltransferas...    201   6e-61   Phoenix dactylifera
ref|XP_007209402.1|  hypothetical protein PRUPE_ppa009226mg             208   8e-61   Prunus persica
ref|XP_010108133.1|  putative S-acyltransferase                         208   1e-60   Morus notabilis
ref|XP_008238650.1|  PREDICTED: probable protein S-acyltransferas...    207   1e-60   Prunus mume [ume]
gb|KJB49335.1|  hypothetical protein B456_008G114100                    204   1e-60   Gossypium raimondii
ref|XP_008437153.1|  PREDICTED: probable protein S-acyltransferas...    208   1e-60   Cucumis melo [Oriental melon]
ref|XP_004147573.1|  PREDICTED: probable protein S-acyltransferas...    208   1e-60   Cucumis sativus [cucumbers]
gb|KJB49337.1|  hypothetical protein B456_008G114100                    203   1e-60   Gossypium raimondii
gb|KCW78273.1|  hypothetical protein EUGRSUZ_D02456                     205   2e-60   Eucalyptus grandis [rose gum]
ref|XP_006477282.1|  PREDICTED: probable protein S-acyltransferas...    207   3e-60   Citrus sinensis [apfelsine]
ref|XP_009398464.1|  PREDICTED: probable protein S-acyltransferas...    206   1e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006652138.1|  PREDICTED: probable protein S-acyltransferas...    203   1e-59   Oryza brachyantha
ref|XP_010918308.1|  PREDICTED: probable protein S-acyltransferas...    198   2e-59   Elaeis guineensis
gb|EPS68199.1|  hypothetical protein M569_06570                         199   3e-59   Genlisea aurea
gb|ABF99421.1|  DHHC zinc finger domain containing protein, expre...    201   5e-59   Oryza sativa Japonica Group [Japonica rice]
gb|KJB09891.1|  hypothetical protein B456_001G174100                    197   8e-59   Gossypium raimondii
gb|ACU18884.1|  unknown                                                 197   1e-58   Glycine max [soybeans]
ref|XP_002267258.3|  PREDICTED: probable protein S-acyltransferas...    202   1e-58   Vitis vinifera
gb|KDO63755.1|  hypothetical protein CISIN_1g021223mg                   202   1e-58   Citrus sinensis [apfelsine]
ref|XP_007039984.1|  DHHC-type zinc finger family protein               202   2e-58   
ref|NP_001051618.1|  Os03g0804300                                       199   2e-58   
gb|KGN50197.1|  hypothetical protein Csa_5G158530                       202   2e-58   Cucumis sativus [cucumbers]
ref|XP_003635680.2|  PREDICTED: probable protein S-acyltransferas...    202   2e-58   Vitis vinifera
ref|XP_009389071.1|  PREDICTED: probable protein S-acyltransferas...    202   3e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010662159.1|  PREDICTED: probable protein S-acyltransferas...    202   3e-58   Vitis vinifera
gb|KDO63753.1|  hypothetical protein CISIN_1g021223mg                   201   5e-58   Citrus sinensis [apfelsine]
ref|XP_006440415.1|  hypothetical protein CICLE_v10021242mg             200   2e-57   Citrus clementina [clementine]
emb|CDX94118.1|  BnaC07g37520D                                          199   3e-57   
gb|EEE60128.1|  hypothetical protein OsJ_13009                          195   3e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009362135.1|  PREDICTED: probable protein S-acyltransferas...    196   3e-57   
gb|EEC76365.1|  hypothetical protein OsI_13959                          199   3e-57   Oryza sativa Indica Group [Indian rice]
ref|XP_009137276.1|  PREDICTED: probable protein S-acyltransferas...    198   7e-57   Brassica rapa
emb|CDX98764.1|  BnaA03g45490D                                          197   1e-56   
ref|XP_002304438.2|  hypothetical protein POPTR_0003s11520g             196   1e-56   Populus trichocarpa [western balsam poplar]
gb|KJB37585.1|  hypothetical protein B456_006G211800                    196   2e-56   Gossypium raimondii
gb|AFW57919.1|  palmitoyltransferase ZDHHC20, mRNA                      194   3e-56   
ref|XP_010433998.1|  PREDICTED: probable protein S-acyltransferas...    196   6e-56   Camelina sativa [gold-of-pleasure]
dbj|BAJ34112.1|  unnamed protein product                                196   6e-56   Eutrema halophilum
ref|XP_011463771.1|  PREDICTED: probable protein S-acyltransferas...    195   8e-56   Fragaria vesca subsp. vesca
ref|XP_011033891.1|  PREDICTED: probable protein S-acyltransferas...    194   1e-55   Populus euphratica
gb|KJB49338.1|  hypothetical protein B456_008G114100                    186   2e-55   Gossypium raimondii
ref|XP_011029092.1|  PREDICTED: probable protein S-acyltransferas...    194   2e-55   Populus euphratica
gb|KJB37584.1|  hypothetical protein B456_006G211800                    194   3e-55   Gossypium raimondii
ref|XP_010540019.1|  PREDICTED: probable protein S-acyltransferas...    194   3e-55   Tarenaya hassleriana [spider flower]
ref|XP_006413626.1|  hypothetical protein EUTSA_v10024722mg             195   3e-55   
ref|XP_012066562.1|  PREDICTED: probable protein S-acyltransferas...    193   6e-55   Jatropha curcas
gb|KHG16541.1|  hypothetical protein F383_02611                         193   6e-55   Gossypium arboreum [tree cotton]
ref|XP_001781101.1|  predicted protein                                  191   3e-54   
ref|NP_567668.1|  DHHC-type zinc finger family protein                  191   3e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008776787.1|  PREDICTED: probable protein S-acyltransferas...    184   4e-53   Phoenix dactylifera
ref|XP_002535239.1|  zinc finger protein, putative                      186   1e-52   
ref|XP_009136109.1|  PREDICTED: probable protein S-acyltransferas...    186   2e-52   Brassica rapa
ref|XP_009136132.1|  PREDICTED: probable protein S-acyltransferas...    186   2e-52   Brassica rapa
gb|KFK28858.1|  hypothetical protein AALP_AA7G057700                    186   3e-52   Arabis alpina [alpine rockcress]
emb|CDX82967.1|  BnaC01g14170D                                          186   3e-52   
ref|XP_010448848.1|  PREDICTED: probable protein S-acyltransferas...    186   4e-52   Camelina sativa [gold-of-pleasure]
ref|XP_004515766.1|  PREDICTED: probable S-acyltransferase At3g60...    184   1e-51   Cicer arietinum [garbanzo]
ref|NP_001190801.1|  sterol 4-alpha methyl oxidase 1-3                  190   2e-51   
ref|XP_010439292.1|  PREDICTED: probable protein S-acyltransferas...    182   5e-51   Camelina sativa [gold-of-pleasure]
ref|XP_006283414.1|  hypothetical protein CARUB_v10004463mg             188   9e-51   
ref|XP_010910146.1|  PREDICTED: probable protein S-acyltransferas...    170   9e-51   Elaeis guineensis
gb|AAM65313.1|  unknown                                                 180   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006440414.1|  hypothetical protein CICLE_v10021242mg             178   9e-50   
ref|NP_001154264.1|  DHHC-type zinc finger family protein               178   4e-49   
ref|XP_002994078.1|  hypothetical protein SELMODRAFT_449300             177   7e-49   Selaginella moellendorffii
ref|XP_006368710.1|  hypothetical protein POPTR_0001s08000g             176   1e-48   
ref|XP_002989117.1|  hypothetical protein SELMODRAFT_184354             174   8e-48   
emb|CAB82684.1|  putative protein                                       164   5e-47   Arabidopsis thaliana [mouse-ear cress]
gb|KJB37583.1|  hypothetical protein B456_006G211800                    177   7e-47   Gossypium raimondii
emb|CDY71422.1|  BnaAnng37380D                                          166   4e-46   Brassica napus [oilseed rape]
ref|XP_009351330.1|  PREDICTED: probable protein S-acyltransferas...    158   1e-45   Pyrus x bretschneideri [bai li]
ref|XP_006830293.2|  PREDICTED: probable protein S-acyltransferas...    167   3e-45   Amborella trichopoda
ref|XP_004306624.1|  PREDICTED: probable protein S-acyltransferas...    167   5e-45   Fragaria vesca subsp. vesca
gb|KCW73003.1|  hypothetical protein EUGRSUZ_E01439                     145   1e-44   Eucalyptus grandis [rose gum]
gb|ERM97709.1|  hypothetical protein AMTR_s00121p00069490               167   2e-44   Amborella trichopoda
gb|KJB25654.1|  hypothetical protein B456_004G202600                    165   2e-44   Gossypium raimondii
gb|ADE76560.1|  unknown                                                 163   1e-43   Picea sitchensis
ref|XP_010267425.1|  PREDICTED: probable protein S-acyltransferas...    162   2e-43   Nelumbo nucifera [Indian lotus]
ref|XP_008376192.1|  PREDICTED: probable protein S-acyltransferas...    162   3e-43   Malus domestica [apple tree]
emb|CAA16560.1|  predicted protein                                      160   5e-43   Arabidopsis thaliana [mouse-ear cress]
gb|KHG08036.1|  hypothetical protein F383_35334                         160   1e-42   Gossypium arboreum [tree cotton]
gb|KJB25653.1|  hypothetical protein B456_004G202600                    160   1e-42   Gossypium raimondii
ref|XP_009401747.1|  PREDICTED: probable protein S-acyltransferas...    160   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002867753.1|  hypothetical protein ARALYDRAFT_329352             158   3e-42   
ref|XP_008233069.1|  PREDICTED: probable protein S-acyltransferas...    160   3e-42   Prunus mume [ume]
ref|XP_010267431.1|  PREDICTED: probable protein S-acyltransferas...    158   8e-42   
ref|XP_011039097.1|  PREDICTED: probable protein S-acyltransferas...    158   9e-42   Populus euphratica
ref|XP_002263621.1|  PREDICTED: probable protein S-acyltransferas...    158   1e-41   Vitis vinifera
ref|XP_008779828.1|  PREDICTED: probable protein S-acyltransferas...    157   2e-41   Phoenix dactylifera
ref|XP_009366621.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    155   2e-40   Pyrus x bretschneideri [bai li]
gb|KJB09587.1|  hypothetical protein B456_001G151300                    154   2e-40   Gossypium raimondii
ref|XP_007051453.1|  DHHC-type zinc finger family protein               154   2e-40   
ref|XP_006657677.1|  PREDICTED: probable protein S-acyltransferas...    153   2e-40   Oryza brachyantha
ref|XP_006657678.1|  PREDICTED: probable protein S-acyltransferas...    152   3e-40   Oryza brachyantha
ref|XP_010691320.1|  PREDICTED: probable protein S-acyltransferas...    153   8e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011039088.1|  PREDICTED: probable protein S-acyltransferas...    152   2e-39   Populus euphratica
ref|NP_567193.2|  putative S-acyltransferase                            152   2e-39   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA40775.1|  TPA: hypothetical protein ZEAMMB73_782285              149   3e-39   
gb|KJB25655.1|  hypothetical protein B456_004G202600                    149   3e-39   Gossypium raimondii
ref|XP_010422733.1|  PREDICTED: probable protein S-acyltransferas...    151   4e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010456165.1|  PREDICTED: probable protein S-acyltransferas...    151   4e-39   
ref|XP_011029093.1|  PREDICTED: probable protein S-acyltransferas...    141   5e-39   Populus euphratica
ref|XP_006288366.1|  hypothetical protein CARUB_v10001614mg             150   5e-39   Capsella rubella
ref|XP_007218830.1|  hypothetical protein PRUPE_ppa010169mg             150   6e-39   
emb|CDX74374.1|  BnaA03g26730D                                          150   6e-39   
ref|XP_002872926.1|  zinc ion binding protein                           150   7e-39   Arabidopsis lyrata subsp. lyrata
gb|EEE67131.1|  hypothetical protein OsJ_24176                          150   9e-39   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81995.1|  hypothetical protein OsI_25930                          150   9e-39   Oryza sativa Indica Group [Indian rice]
gb|KFK30666.1|  hypothetical protein AALP_AA6G012100                    150   1e-38   Arabis alpina [alpine rockcress]
gb|ACF85839.1|  unknown                                                 149   1e-38   Zea mays [maize]
ref|XP_002462839.1|  hypothetical protein SORBIDRAFT_02g032840          149   1e-38   Sorghum bicolor [broomcorn]
ref|XP_006360644.1|  PREDICTED: probable protein S-acyltransferas...    150   2e-38   Solanum tuberosum [potatoes]
ref|XP_009134494.1|  PREDICTED: probable protein S-acyltransferas...    149   3e-38   Brassica rapa
ref|XP_011082342.1|  PREDICTED: probable protein S-acyltransferas...    149   3e-38   Sesamum indicum [beniseed]
ref|XP_010428132.1|  PREDICTED: probable protein S-acyltransferas...    149   3e-38   Camelina sativa [gold-of-pleasure]
ref|XP_003560239.2|  PREDICTED: probable protein S-acyltransferas...    149   5e-38   Brachypodium distachyon [annual false brome]
ref|XP_004240115.1|  PREDICTED: probable protein S-acyltransferas...    148   6e-38   Solanum lycopersicum
ref|XP_006396329.1|  hypothetical protein EUTSA_v10028856mg             148   6e-38   Eutrema salsugineum [saltwater cress]
ref|XP_004957652.1|  PREDICTED: probable S-acyltransferase At4g00...    147   1e-37   Setaria italica
tpg|DAA40774.1|  TPA: hypothetical protein ZEAMMB73_782285              145   2e-37   
gb|KJB09588.1|  hypothetical protein B456_001G151300                    144   3e-37   Gossypium raimondii
dbj|BAK01014.1|  predicted protein                                      145   1e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010919145.1|  PREDICTED: probable protein S-acyltransferas...    145   1e-36   
gb|KJB49336.1|  hypothetical protein B456_008G114100                    123   2e-36   Gossypium raimondii
emb|CDY07150.1|  BnaCnng01650D                                          143   2e-36   
ref|XP_002320223.1|  hypothetical protein POPTR_0014s09980g             144   3e-36   
emb|CBI25933.3|  unnamed protein product                                139   4e-36   Vitis vinifera
ref|XP_001419536.1|  predicted protein                                  144   5e-36   Ostreococcus lucimarinus CCE9901
ref|XP_008779824.1|  PREDICTED: probable protein S-acyltransferas...    144   5e-36   Phoenix dactylifera
ref|XP_011082343.1|  PREDICTED: probable protein S-acyltransferas...    142   7e-36   
gb|KDO86584.1|  hypothetical protein CISIN_1g021385mg                   142   9e-36   Citrus sinensis [apfelsine]
emb|CDY51717.1|  BnaA09g52040D                                          142   1e-35   Brassica napus [oilseed rape]
ref|XP_006288365.1|  hypothetical protein CARUB_v10001614mg             139   1e-35   
ref|XP_009111388.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    142   1e-35   Brassica rapa
ref|XP_010238650.1|  PREDICTED: probable protein S-acyltransferas...    142   1e-35   
gb|KDO86583.1|  hypothetical protein CISIN_1g021385mg                   142   1e-35   Citrus sinensis [apfelsine]
ref|XP_006491350.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    141   2e-35   
ref|XP_011082344.1|  PREDICTED: probable protein S-acyltransferas...    139   2e-35   
ref|XP_010054971.1|  PREDICTED: probable protein S-acyltransferas...    141   2e-35   Eucalyptus grandis [rose gum]
gb|KDO86582.1|  hypothetical protein CISIN_1g021385mg                   141   2e-35   Citrus sinensis [apfelsine]
gb|KJB09590.1|  hypothetical protein B456_001G151300                    139   3e-35   Gossypium raimondii
emb|CDP08628.1|  unnamed protein product                                136   2e-34   Coffea canephora [robusta coffee]
ref|XP_004133790.1|  PREDICTED: probable protein S-acyltransferas...    137   8e-34   Cucumis sativus [cucumbers]
ref|XP_002529972.1|  zinc finger protein, putative                      134   1e-33   
ref|XP_008437841.1|  PREDICTED: probable protein S-acyltransferas...    136   2e-33   Cucumis melo [Oriental melon]
ref|XP_011650657.1|  PREDICTED: probable protein S-acyltransferas...    136   2e-33   Cucumis sativus [cucumbers]
ref|XP_008437835.1|  PREDICTED: probable protein S-acyltransferas...    135   4e-33   
ref|XP_003056659.1|  predicted protein                                  135   5e-33   Micromonas pusilla CCMP1545
gb|KCW71456.1|  hypothetical protein EUGRSUZ_E00018                     131   2e-32   Eucalyptus grandis [rose gum]
ref|XP_012083120.1|  PREDICTED: probable protein S-acyltransferas...    133   2e-32   Jatropha curcas
emb|CDX91862.1|  BnaC03g31640D                                          132   3e-32   
emb|CEF99024.1|  Zinc finger, DHHC-type, palmitoyltransferase           130   5e-31   Ostreococcus tauri
ref|XP_007510851.1|  predicted protein                                  131   6e-31   Bathycoccus prasinos
gb|EYU32291.1|  hypothetical protein MIMGU_mgv1a010611mg                129   7e-31   Erythranthe guttata [common monkey flower]
ref|XP_009775888.1|  PREDICTED: probable protein S-acyltransferas...    125   8e-31   Nicotiana sylvestris
ref|NP_001059593.2|  Os07g0467800                                       125   1e-30   
ref|XP_003081166.1|  DHHC-type Zn-finger proteins (ISS)                 130   1e-30   
ref|XP_006444754.1|  hypothetical protein CICLE_v10021463mg             125   2e-30   
ref|XP_006444755.1|  hypothetical protein CICLE_v10021463mg             127   2e-30   
ref|XP_010556619.1|  PREDICTED: probable protein S-acyltransferas...    127   3e-30   Tarenaya hassleriana [spider flower]
ref|XP_006444756.1|  hypothetical protein CICLE_v10021463mg             127   3e-30   
ref|XP_006444753.1|  hypothetical protein CICLE_v10021463mg             127   3e-30   
ref|XP_009607103.1|  PREDICTED: probable protein S-acyltransferas...    126   4e-30   
ref|XP_004494854.1|  PREDICTED: probable S-acyltransferase At4g00...    127   1e-29   
ref|NP_001132254.1|  hypothetical protein                               121   2e-29   
ref|XP_003626591.1|  Palmitoyltransferase PFA4                          125   2e-29   Medicago truncatula
ref|XP_007147347.1|  hypothetical protein PHAVU_006G116400g             123   9e-29   Phaseolus vulgaris [French bean]
gb|KEH24697.1|  DHHC-type zinc finger protein                           120   2e-28   Medicago truncatula
emb|CCW28739.1|  putative zinc finger containing protein                122   6e-28   Arachis duranensis
gb|AAB62854.1|  A_TM018A10.8 gene product                               119   8e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CBI29012.3|  unnamed protein product                                115   3e-27   Vitis vinifera
ref|XP_007147348.1|  hypothetical protein PHAVU_006G116400g             114   2e-26   Phaseolus vulgaris [French bean]
ref|XP_009775889.1|  PREDICTED: probable protein S-acyltransferas...    111   1e-25   Nicotiana sylvestris
ref|XP_011402359.1|  putative protein S-acyltransferase 14              113   4e-25   Auxenochlorella protothecoides
ref|XP_009526359.1|  hypothetical protein PHYSODRAFT_331293             112   9e-25   Phytophthora sojae
ref|XP_001946472.2|  PREDICTED: palmitoyltransferase ZDHHC15-like...    112   1e-24   
ref|XP_002955185.1|  hypothetical protein VOLCADRAFT_83102              112   1e-24   
ref|XP_008183299.1|  PREDICTED: palmitoyltransferase ZDHHC15-like...    112   1e-24   
ref|XP_008183297.1|  PREDICTED: palmitoyltransferase ZDHHC15-like...    112   2e-24   
ref|XP_011196582.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    112   2e-24   
ref|XP_011196580.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    112   2e-24   
ref|XP_011196584.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    111   2e-24   
ref|XP_008183298.1|  PREDICTED: palmitoyltransferase ZDHHC15-like...    111   2e-24   
ref|XP_005647462.1|  zf-DHHC-domain-containing protein                  110   3e-24   
ref|XP_011664112.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    110   3e-24   
ref|XP_011196585.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    110   4e-24   
ref|XP_004521126.1|  PREDICTED: LOW QUALITY PROTEIN: palmitoyltra...    110   4e-24   
ref|XP_011196583.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    110   4e-24   
ref|XP_011209774.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    110   6e-24   
ref|XP_011209770.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    110   7e-24   
ref|XP_011209771.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    110   7e-24   
ref|XP_011209772.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    110   9e-24   
ref|XP_011209775.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    109   1e-23   
ref|XP_011209773.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    109   1e-23   
ref|XP_011870631.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    108   2e-23   
ref|XP_011870634.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    108   2e-23   
ref|XP_315027.4|  AGAP004938-PA                                         108   2e-23   
ref|XP_011870630.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    108   2e-23   
ref|XP_011870633.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    108   2e-23   
ref|XP_011870627.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    108   2e-23   
ref|XP_011870629.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    108   3e-23   
ref|XP_011870632.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    107   3e-23   
gb|EFX88381.1|  hypothetical protein DAPPUDRAFT_311398                  107   4e-23   
ref|XP_001654678.1|  AAEL010581-PA                                      107   5e-23   
ref|XP_011870628.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    107   6e-23   
ref|XP_011870626.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    107   6e-23   
ref|XP_011870624.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    107   6e-23   
ref|XP_011148506.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    107   7e-23   
gb|KFB48082.1|  AGAP004938-PA-like protein                              107   7e-23   
gb|EFN88907.1|  Palmitoyltransferase ZDHHC2                             107   7e-23   
ref|XP_011148491.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    107   7e-23   
ref|XP_011148524.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    106   8e-23   
ref|XP_011870625.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    107   9e-23   
ref|XP_011148499.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    106   9e-23   
gb|KJA28514.1|  hypothetical protein HYPSUDRAFT_129104                  107   1e-22   
ref|XP_001694595.1|  predicted protein                                  106   1e-22   
ref|XP_011148474.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    106   1e-22   
ref|XP_011148482.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    106   1e-22   
gb|EFZ20798.1|  hypothetical protein SINV_04370                         105   2e-22   
gb|KIP11142.1|  hypothetical protein PHLGIDRAFT_125039                  107   2e-22   
ref|XP_007391026.1|  hypothetical protein PHACADRAFT_84866              105   2e-22   
ref|XP_011148457.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    106   2e-22   
ref|XP_011155434.1|  PREDICTED: palmitoyltransferase ZDHHC2             105   2e-22   
ref|XP_011630340.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    105   2e-22   
ref|XP_011148466.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    106   2e-22   
ref|XP_001846318.1|  zinc finger protein                                106   2e-22   
ref|XP_011630336.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    105   2e-22   
ref|XP_011253748.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    105   2e-22   
ref|XP_011630337.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    105   3e-22   
ref|XP_011630339.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    104   3e-22   
ref|XP_011290230.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    105   3e-22   
ref|XP_001900929.1|  Zinc finger DHHC domain containing protein 2       105   3e-22   
gb|EJY73117.1|  DHHC zinc finger domain containing protein              104   4e-22   
gb|KDQ15704.1|  hypothetical protein BOTBODRAFT_285774                  106   4e-22   
ref|XP_011695868.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    104   4e-22   
ref|XP_011695862.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    104   4e-22   
ref|XP_011290229.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    105   5e-22   
ref|XP_011695870.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    104   5e-22   
ref|XP_011695866.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    104   5e-22   
ref|XP_011335755.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    104   5e-22   
ref|XP_007378834.1|  zf-DHHC-domain-containing protein                  103   5e-22   
ref|XP_002931837.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    104   5e-22   
ref|XP_011630338.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    104   5e-22   
gb|EJY69064.1|  DHHC zinc finger domain containing protein              105   6e-22   
ref|XP_011695863.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    104   6e-22   
ref|XP_011695869.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    103   6e-22   
ref|XP_011630334.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    104   6e-22   
ref|XP_011335758.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    103   7e-22   
ref|XP_011630335.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    104   7e-22   
ref|XP_003521821.1|  PREDICTED: probable protein S-acyltransferas...    103   7e-22   
ref|XP_011335756.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    103   7e-22   
ref|XP_011335752.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    103   8e-22   
ref|NP_724869.2|  CG1407, isoform C                                     102   8e-22   
ref|XP_011335757.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    103   9e-22   
ref|XP_011335753.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    103   9e-22   
ref|XP_011055513.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    103   9e-22   
ref|XP_011055506.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    103   1e-21   
gb|EJY69892.1|  DHHC zinc finger domain containing protein              105   1e-21   
ref|XP_011055512.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    103   1e-21   
ref|XP_011055511.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    103   1e-21   
ref|XP_011695860.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    103   1e-21   
ref|XP_011695865.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    103   1e-21   
ref|XP_011055508.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    103   1e-21   
ref|XP_007337392.1|  zf-DHHC-domain-containing protein                  104   1e-21   
ref|XP_011664114.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    102   1e-21   
ref|XP_011055510.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    103   1e-21   
ref|XP_011253754.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    102   1e-21   
ref|XP_011055507.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    103   1e-21   
ref|XP_011695864.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    103   1e-21   
ref|XP_011253749.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    103   1e-21   
ref|XP_011695859.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    103   2e-21   
ref|XP_011055509.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    102   2e-21   
ref|XP_001969112.1|  GG25240                                            103   2e-21   
ref|XP_011253750.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    102   2e-21   
ref|NP_001260843.1|  CG1407, isoform D                                  102   2e-21   
ref|XP_011253753.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    102   2e-21   
ref|XP_011335754.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    102   2e-21   
ref|XP_008032452.1|  palmitoyltransferase PFA4                          103   2e-21   
ref|NP_610544.1|  CG1407, isoform B                                     102   2e-21   
ref|XP_005845554.1|  hypothetical protein CHLNCDRAFT_136705             102   2e-21   
ref|XP_011055505.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    102   2e-21   
ref|XP_011055502.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    102   2e-21   
ref|XP_011335750.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    102   2e-21   
ref|XP_011335751.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    102   2e-21   
ref|XP_011664110.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    102   2e-21   
ref|XP_011055503.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    102   3e-21   
ref|XP_011664113.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    102   3e-21   
gb|KFV97983.1|  Palmitoyltransferase ZDHHC2                           99.8    3e-21   
gb|KII93606.1|  hypothetical protein PLICRDRAFT_100276                  103   3e-21   
ref|XP_009541091.1|  hypothetical protein HETIRDRAFT_166687             101   3e-21   
ref|NP_001089258.1|  palmitoyltransferase ZDHHC15                       102   3e-21   
ref|XP_011253752.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    102   3e-21   
ref|XP_002063518.1|  GK21953                                            102   3e-21   
ref|XP_009384072.1|  PREDICTED: probable protein S-acyltransferas...    101   3e-21   
gb|KIJ53486.1|  hypothetical protein M422DRAFT_154773                   103   4e-21   
ref|XP_006988499.1|  PREDICTED: probable palmitoyltransferase ZDH...    101   4e-21   
ref|XP_002004700.1|  GI19459                                            102   4e-21   
ref|NP_724868.2|  CG1407, isoform A                                     102   4e-21   
ref|XP_011253747.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    102   4e-21   
ref|XP_002089881.1|  GE21863                                            103   4e-21   
ref|XP_002033178.1|  GM20560                                            102   4e-21   
ref|NP_001286262.1|  CG1407, isoform E                                  102   5e-21   
ref|NP_001286263.1|  CG1407, isoform F                                  102   5e-21   
ref|XP_002080851.1|  GD26013                                            102   5e-21   
ref|NP_001286264.1|  CG1407, isoform G                                  102   5e-21   
emb|CCF53550.1|  related to PFA4-Palmitoyltransferase (N-terminal...    103   5e-21   
ref|XP_003764500.1|  PREDICTED: probable palmitoyltransferase ZDH...    101   5e-21   
emb|CDP06594.1|  unnamed protein product                                100   5e-21   
gb|KDR23346.1|  Palmitoyltransferase ZDHHC2                             101   7e-21   
ref|XP_002412002.1|  zinc finger protein, putative                      101   7e-21   
emb|CDY44698.1|  BnaA05g29080D                                        98.6    7e-21   
emb|CEG81496.1|  Putative Palmitoyltransferase                          101   8e-21   
gb|EMS65746.1|  hypothetical protein TRIUR3_17127                     80.1    8e-21   
ref|XP_008475268.1|  PREDICTED: palmitoyltransferase ZDHHC15            100   9e-21   
ref|XP_007252360.1|  PREDICTED: probable palmitoyltransferase ZDH...    100   9e-21   
ref|XP_003738155.1|  PREDICTED: palmitoyltransferase ZDHHC2-like        101   9e-21   
ref|XP_002016305.1|  GL11511                                            100   9e-21   
gb|KIY73495.1|  zf-DHHC-domain-containing protein                       101   1e-20   
gb|KDR85697.1|  hypothetical protein GALMADRAFT_53290                   100   1e-20   
ref|XP_008893057.1|  hypothetical protein, variant                    99.8    1e-20   
gb|KIM31573.1|  hypothetical protein M408DRAFT_64111                    101   1e-20   
ref|XP_005355479.1|  PREDICTED: probable palmitoyltransferase ZDH...    100   1e-20   
gb|ETI45440.1|  hypothetical protein F443_09987                         100   1e-20   
ref|XP_006620545.1|  PREDICTED: palmitoyltransferase ZDHHC15-like...    100   1e-20   
ref|XP_006561434.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    100   1e-20   
emb|CDY41618.1|  BnaC05g43550D                                        99.8    1e-20   
gb|ETP43356.1|  hypothetical protein F442_09890                         100   1e-20   
ref|XP_006561437.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  99.8    1e-20   
ref|XP_002884727.1|  zinc finger family protein                       99.8    1e-20   
gb|ETP43357.1|  hypothetical protein, variant                         99.8    1e-20   
ref|XP_008893056.1|  hypothetical protein PPTG_01490                  99.8    1e-20   
gb|ETL38812.1|  hypothetical protein L916_09696                         100   1e-20   
ref|XP_006561438.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  99.8    1e-20   
ref|XP_010521600.1|  PREDICTED: probable protein S-acyltransferas...  99.8    1e-20   
ref|XP_008325574.1|  PREDICTED: palmitoyltransferase ZDHHC15            100   1e-20   
gb|ETK85385.1|  hypothetical protein L915_09790                         100   1e-20   
ref|XP_006561433.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    100   1e-20   
ref|XP_006620540.1|  PREDICTED: palmitoyltransferase ZDHHC15-like...    100   1e-20   
gb|KIM47503.1|  hypothetical protein M413DRAFT_62143                    101   1e-20   
ref|XP_001341243.3|  PREDICTED: probable palmitoyltransferase ZDH...    100   1e-20   
ref|XP_006407688.1|  hypothetical protein EUTSA_v10021264mg           99.8    1e-20   
ref|XP_007271137.1|  zf-DHHC-domain-containing protein                99.8    1e-20   
ref|XP_006561436.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  99.8    1e-20   
ref|XP_011552401.1|  PREDICTED: palmitoyltransferase ZDHHC2-like        100   1e-20   
dbj|BAM20685.1|  zinc finger protein                                  99.8    1e-20   
gb|KDN49126.1|  hypothetical protein RSAG8_02479                        101   2e-20   
ref|XP_001986877.1|  GH20289                                            101   2e-20   
ref|XP_008928033.1|  PREDICTED: palmitoyltransferase ZDHHC15            100   2e-20   
gb|KIM23222.1|  hypothetical protein M408DRAFT_77784                  99.4    2e-20   
ref|XP_011019840.1|  PREDICTED: probable protein S-acyltransferas...  98.6    2e-20   
emb|CDY07918.1|  BnaC03g36050D                                        99.4    2e-20   
gb|KFP73662.1|  Palmitoyltransferase ZDHHC15                          96.3    2e-20   
emb|CBK23342.2|  unnamed protein product                              97.8    2e-20   
ref|XP_012145573.1|  PREDICTED: palmitoyltransferase ZDHHC2-like ...  99.8    2e-20   
emb|CBN81884.1|  Probable palmitoyltransferase ZDHHC20                  100   2e-20   
ref|XP_011019839.1|  PREDICTED: probable protein S-acyltransferas...  99.4    2e-20   
ref|XP_012145569.1|  PREDICTED: palmitoyltransferase ZDHHC2-like ...  99.8    2e-20   
ref|XP_004541019.1|  PREDICTED: palmitoyltransferase ZDHHC15-like...  99.4    2e-20   
ref|XP_009877265.1|  PREDICTED: palmitoyltransferase ZDHHC15-like     96.3    2e-20   
ref|XP_001959523.1|  GF12009                                          99.8    2e-20   
ref|XP_007360680.1|  zf-DHHC-domain-containing protein                  100   2e-20   
ref|XP_007307660.1|  zf-DHHC-domain-containing protein                99.4    2e-20   
gb|KFW85870.1|  Palmitoyltransferase ZDHHC15                          99.0    2e-20   
ref|XP_004715954.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  99.4    2e-20   
ref|XP_002195966.2|  PREDICTED: palmitoyltransferase ZDHHC15          99.8    2e-20   
ref|XP_002309068.1|  zinc finger family protein                       99.0    2e-20   
ref|XP_007325192.1|  hypothetical protein AGABI1DRAFT_67210             100   2e-20   
ref|XP_003705399.2|  PREDICTED: palmitoyltransferase ZDHHC15-like...  99.8    2e-20   
gb|KFU89295.1|  Palmitoyltransferase ZDHHC15                          99.0    2e-20   
ref|XP_012145566.1|  PREDICTED: palmitoyltransferase ZDHHC15-like...  99.8    2e-20   
ref|XP_003697900.1|  PREDICTED: palmitoyltransferase ZDHHC15-like       100   2e-20   
ref|XP_012145565.1|  PREDICTED: palmitoyltransferase ZDHHC15-like...  99.8    2e-20   
ref|XP_012145570.1|  PREDICTED: palmitoyltransferase ZDHHC2-like ...  99.4    2e-20   
ref|XP_005338665.1|  PREDICTED: probable palmitoyltransferase ZDH...  99.8    2e-20   
ref|XP_003402132.1|  PREDICTED: palmitoyltransferase ZDHHC2-like ...  99.4    2e-20   
gb|KFP77504.1|  putative palmitoyltransferase ZDHHC20                 99.4    2e-20   
ref|XP_006561432.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  99.4    2e-20   
gb|KFQ21151.1|  Palmitoyltransferase ZDHHC15                          98.2    2e-20   
ref|XP_009135059.1|  PREDICTED: probable protein S-acyltransferas...  99.0    3e-20   
ref|XP_006620541.1|  PREDICTED: palmitoyltransferase ZDHHC15-like...  99.4    3e-20   
ref|XP_006620539.1|  PREDICTED: palmitoyltransferase ZDHHC15-like...  99.8    3e-20   
ref|XP_005355480.1|  PREDICTED: probable palmitoyltransferase ZDH...  99.8    3e-20   
ref|XP_006561431.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  99.8    3e-20   
ref|XP_012145568.1|  PREDICTED: palmitoyltransferase ZDHHC2-like ...  99.4    3e-20   
gb|KIW03977.1|  hypothetical protein PV09_04810                         100   3e-20   
ref|XP_003402134.1|  PREDICTED: palmitoyltransferase ZDHHC2-like ...  99.4    3e-20   
ref|XP_010047860.1|  PREDICTED: probable protein S-acyltransferas...  98.6    3e-20   
ref|XP_008546169.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...  99.0    3e-20   
emb|CDX73971.1|  BnaA03g30760D                                        98.6    3e-20   
ref|XP_003446001.2|  PREDICTED: palmitoyltransferase ZDHHC15-like...  99.0    3e-20   
ref|XP_004541018.1|  PREDICTED: palmitoyltransferase ZDHHC15-like...  99.0    3e-20   
ref|XP_006781619.1|  PREDICTED: palmitoyltransferase ZDHHC15-like     99.0    3e-20   
ref|XP_003489535.1|  PREDICTED: palmitoyltransferase ZDHHC2-like      99.4    3e-20   
ref|XP_009683733.1|  PREDICTED: palmitoyltransferase ZDHHC15          98.6    3e-20   
gb|KFK38323.1|  hypothetical protein AALP_AA3G098900                  98.6    3e-20   
ref|XP_012145562.1|  PREDICTED: palmitoyltransferase ZDHHC15-like...  99.8    3e-20   



>ref|XP_004248564.1| PREDICTED: probable protein S-acyltransferase 14 [Solanum lycopersicum]
Length=308

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = +2

Query  419   PAVAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTD  598
             P++A  VG  D L+AL V+ LFHCLLVMLLW YFSVVFTDPG VPPNWRP LDEERG+TD
Sbjct  48    PSLASSVGFLDVLIALSVLVLFHCLLVMLLWCYFSVVFTDPGSVPPNWRPELDEERGETD  107

Query  599   PLTASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  778
             PLT SEFG+ P D+   RIRFC+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL
Sbjct  108   PLTTSEFGASPADSGNPRIRFCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  167

Query  779   NYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsv  958
             NYKYFLLFLFYTFLETT+VTLSLLP F+AFF D +IPG+ G LATTFLAFVLNLAFALSV
Sbjct  168   NYKYFLLFLFYTFLETTVVTLSLLPQFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSV  227

Query  959   lGFLIMHISLVSRNTT  1006
             LGFLIMHISLVS NTT
Sbjct  228   LGFLIMHISLVSGNTT  243


 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/51 (94%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            MYRSGAVMAWNVF+FCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP LA
Sbjct  1    MYRSGAVMAWNVFRFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPSLA  51



>ref|XP_006347869.1| PREDICTED: probable protein S-acyltransferase 14-like [Solanum 
tuberosum]
Length=309

 Score =   260 bits (665),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = +2

Query  419   PAVAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTD  598
             P +  G G+ D L+AL V+ LFHCLLVMLLWSYFSVVFTDPG VPPNW+P LDEER DTD
Sbjct  48    PTLISGSGILDALIALAVLVLFHCLLVMLLWSYFSVVFTDPGSVPPNWKPDLDEERDDTD  107

Query  599   PLTASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  778
             PLTASEFG+ P D+   R+RFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL
Sbjct  108   PLTASEFGASPADSTNPRVRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  167

Query  779   NYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsv  958
             NYKYFLLFLFYTFLETT+VTL+LLP F+AFF D +IPG+ G LATTFLAFV NLAFALSV
Sbjct  168   NYKYFLLFLFYTFLETTVVTLALLPQFIAFFSDGEIPGTPGTLATTFLAFVFNLAFALSV  227

Query  959   lGFLIMHISLVSRNTT  1006
             LGFLIMHISLV+ NTT
Sbjct  228   LGFLIMHISLVAGNTT  243


 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            MYRSG VMAWNVF+FCTALRGLGSIMILLVLGVVGVTYY VVLT+YGP L
Sbjct  1    MYRSGTVMAWNVFRFCTALRGLGSIMILLVLGVVGVTYYAVVLTSYGPTL  50



>ref|XP_010325709.1| PREDICTED: probable protein S-acyltransferase 14 [Solanum lycopersicum]
Length=309

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = +2

Query  419   PAVAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTD  598
             P++  G G+ D L+AL V+ LFHCLLVMLLWSYFSVVFTDPG VPPNW+P LDEER DTD
Sbjct  48    PSLVSGSGILDALIALAVLVLFHCLLVMLLWSYFSVVFTDPGSVPPNWKPDLDEERSDTD  107

Query  599   PLTASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  778
             PLT SEFG+ P D+   R+RFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL
Sbjct  108   PLTTSEFGASPADSTNPRVRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  167

Query  779   NYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsv  958
             NYKYFLLFLFYTFLETTLVTL+LLP F+AFF D +IPG+ G LATTFLAFV NLAFALSV
Sbjct  168   NYKYFLLFLFYTFLETTLVTLALLPQFIAFFSDGEIPGTPGTLATTFLAFVFNLAFALSV  227

Query  959   lGFLIMHISLVSRNTT  1006
             LGFLIMHISLV+ NTT
Sbjct  228   LGFLIMHISLVAGNTT  243


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            MYRSG VMAWNVF+FCTALRGLGSIMILLVLGVVGVTYY VVLT+YGP L
Sbjct  1    MYRSGTVMAWNVFRFCTALRGLGSIMILLVLGVVGVTYYAVVLTSYGPSL  50



>ref|XP_009616135.1| PREDICTED: probable protein S-acyltransferase 14 [Nicotiana tomentosiformis]
Length=309

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 172/196 (88%), Gaps = 0/196 (0%)
 Frame = +2

Query  419   PAVAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTD  598
             P++  G G+ D  +AL V+ALFHCLLVMLLWSYFSV+FTDPG VP +W P LDEERGDTD
Sbjct  48    PSLVSGGGILDAFIALSVLALFHCLLVMLLWSYFSVIFTDPGSVPQSWNPVLDEERGDTD  107

Query  599   PLTASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  778
             PLTASEFG+ P D A  RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL
Sbjct  108   PLTASEFGASPADPANPRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  167

Query  779   NYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsv  958
             NYKYFLLFLFYTFLETT+VTL+LLP F+AFF D +IPG+   LATTFLAFV NLAFALSV
Sbjct  168   NYKYFLLFLFYTFLETTVVTLALLPQFIAFFSDGEIPGTPSTLATTFLAFVFNLAFALSV  227

Query  959   lGFLIMHISLVSRNTT  1006
             LGFLIMHISLV+ NTT
Sbjct  228   LGFLIMHISLVAGNTT  243


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            MYRSG VMAWNVF+FCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MYRSGTVMAWNVFRFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPSL  50



>ref|XP_009610572.1| PREDICTED: probable protein S-acyltransferase 14 [Nicotiana tomentosiformis]
Length=308

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = +2

Query  419   PAVAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTD  598
             P++A   G+ D L+A  V+ +FHCLL+MLLW YFSVVFTDPG VPPNWRP LDEERG+ D
Sbjct  48    PSLASSGGLLDALIAFLVLIIFHCLLLMLLWCYFSVVFTDPGSVPPNWRPELDEERGEAD  107

Query  599   PLTASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  778
             PLTASEFG+ P D+   RIRFC+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL
Sbjct  108   PLTASEFGASPADSGNPRIRFCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  167

Query  779   NYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsv  958
             NYKYFLLFLFYTFLETT+VTLSLLP F+AFF D +IPG+ G LATTFLAFVLNLAFALSV
Sbjct  168   NYKYFLLFLFYTFLETTVVTLSLLPQFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSV  227

Query  959   lGFLIMHISLVSRNTT  1006
             LGFLIMHISLV+ NTT
Sbjct  228   LGFLIMHISLVAGNTT  243


 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            MYRSGAVMAWNVF+FCTALRGLGSIMILLV+GVVGVTYY VVLTNYGP LA
Sbjct  1    MYRSGAVMAWNVFRFCTALRGLGSIMILLVMGVVGVTYYAVVLTNYGPSLA  51



>ref|XP_006364242.1| PREDICTED: probable protein S-acyltransferase 14-like [Solanum 
tuberosum]
Length=308

 Score =   255 bits (652),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 172/196 (88%), Gaps = 0/196 (0%)
 Frame = +2

Query  419   PAVAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTD  598
             P++    G  D L+AL V+ LFHCLLVMLLW YFSVVFTDPG VPPNWRP LDEERG+ D
Sbjct  48    PSLTSSGGFLDVLIALSVLVLFHCLLVMLLWCYFSVVFTDPGSVPPNWRPELDEERGEAD  107

Query  599   PLTASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  778
             PLT SEFG+ P D+  +RIRFC+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL
Sbjct  108   PLTTSEFGASPADSGNTRIRFCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  167

Query  779   NYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsv  958
             NYKYFLLFLFYTFLETT+VTLSLLP F+AFF D +IPG+ G LATTFLAFVLNLAFALSV
Sbjct  168   NYKYFLLFLFYTFLETTVVTLSLLPQFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSV  227

Query  959   lGFLIMHISLVSRNTT  1006
             LGFLIMH+SLVS NTT
Sbjct  228   LGFLIMHMSLVSGNTT  243


 Score = 62.8 bits (151),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            MYRSGAVMAWNVF+FCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L 
Sbjct  1    MYRSGAVMAWNVFRFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPSLT  51



>ref|XP_009791941.1| PREDICTED: probable protein S-acyltransferase 14 [Nicotiana sylvestris]
Length=309

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 171/196 (87%), Gaps = 0/196 (0%)
 Frame = +2

Query  419   PAVAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTD  598
             P++  G G+ D  +A+ V+A+FHCLLVMLLWSYFSV+FTDPG VP +W P LDEERGDTD
Sbjct  48    PSLVSGGGILDAFIAVAVLAIFHCLLVMLLWSYFSVIFTDPGSVPQSWNPVLDEERGDTD  107

Query  599   PLTASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  778
             PLTASEFG+ P D A  RIR CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL
Sbjct  108   PLTASEFGASPADPANPRIRICKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  167

Query  779   NYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsv  958
             NYKYFLLFLFYTFLETT+VTL+LLP F+AFF D +IPG+   LATTFLAFV NLAFALSV
Sbjct  168   NYKYFLLFLFYTFLETTVVTLALLPQFIAFFSDGEIPGTPSTLATTFLAFVFNLAFALSV  227

Query  959   lGFLIMHISLVSRNTT  1006
             LGFLIMHISLV+ NTT
Sbjct  228   LGFLIMHISLVAGNTT  243


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            MYRSG VMAWNVF+FCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MYRSGTVMAWNVFRFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPSL  50



>gb|EYU31985.1| hypothetical protein MIMGU_mgv1a010704mg [Erythranthe guttata]
Length=304

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 172/193 (89%), Gaps = 3/193 (2%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
              +  G  D+L+A  V+ LFHCLLVMLLWSYFSVVFTDPG VPPNWRPA+DEERGD+DPLT
Sbjct  49    GLAAGGLDSLIAFIVLILFHCLLVMLLWSYFSVVFTDPGGVPPNWRPAVDEERGDSDPLT  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
             ASEF   PP++   RIRFC+KCNQLKPPRCHHCSVCGRC+LKMDH CVWVVNCVGALNYK
Sbjct  109   ASEF---PPESENGRIRFCRKCNQLKPPRCHHCSVCGRCILKMDHLCVWVVNCVGALNYK  165

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYTFLETTLVTLSLLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GF
Sbjct  166   YFLLFLFYTFLETTLVTLSLLPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVMGF  225

Query  968   LIMHISLVSRNTT  1006
             LIMHISLV+ NTT
Sbjct  226   LIMHISLVAGNTT  238


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            MYRSGAVMAWNVFKFCTALRGLGSIMILLVLGVVGV+YY VV+TNYGP LA
Sbjct  1    MYRSGAVMAWNVFKFCTALRGLGSIMILLVLGVVGVSYYAVVITNYGPGLA  51



>ref|XP_011090630.1| PREDICTED: probable protein S-acyltransferase 14 [Sesamum indicum]
Length=302

 Score =   248 bits (632),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 173/198 (87%), Gaps = 3/198 (2%)
 Frame = +2

Query  413   SSPAVAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGD  592
             +S    +  G  D+L+A  V+ LFHCLLVMLLWSYFSVVFTDPG VPPNWRPA+DEERGD
Sbjct  44    TSYGPGLAAGGLDSLLAFVVLVLFHCLLVMLLWSYFSVVFTDPGGVPPNWRPAVDEERGD  103

Query  593   TDPLTASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVG  772
             +DPLT +EF +   D+   RIRFC+KCNQLKPPRCHHCSVCGRC+LKMDHHCVWVVNCVG
Sbjct  104   SDPLTGTEFQA---DSENGRIRFCRKCNQLKPPRCHHCSVCGRCILKMDHHCVWVVNCVG  160

Query  773   ALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafal  952
             ALNYKYFLLFLFYTFLETTLVTLSLLP+F+AFF D DIPG+ G LATTFLAFVLNLAFAL
Sbjct  161   ALNYKYFLLFLFYTFLETTLVTLSLLPHFIAFFSDGDIPGTPGSLATTFLAFVLNLAFAL  220

Query  953   svlGFLIMHISLVSRNTT  1006
             SV+GFLIMHISLV+ NTT
Sbjct  221   SVMGFLIMHISLVTANTT  238


 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            MYRSGAVMAWNVFKFCTALRGLGSIMILLVLG+VGV+YY VV+T+YGP LA
Sbjct  1    MYRSGAVMAWNVFKFCTALRGLGSIMILLVLGIVGVSYYAVVITSYGPGLA  51



>ref|XP_007052067.1| DHHC-type zinc finger family protein isoform 2 [Theobroma cacao]
 gb|EOX96224.1| DHHC-type zinc finger family protein isoform 2 [Theobroma cacao]
Length=336

 Score =   245 bits (626),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D++ A+ V+ LFHCLLVMLLWSYFSVV TDPG VPPNWRPA+DEERG+ DPL  SEF
Sbjct  53    GGLDSITAVVVLILFHCLLVMLLWSYFSVVLTDPGSVPPNWRPAMDEERGEVDPLNGSEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
               L  D +  RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   NGLQSDPSNQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET+LVTL+LLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMH
Sbjct  173   FLFYTFLETSLVTLALLPHFIAFFSDEEIPGTPGILATTFLAFVLNLAFALSVLGFLIMH  232

Query  980   ISLVSRNTT  1006
             ISLV+ NTT
Sbjct  233   ISLVAANTT  241


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVL NYGP L
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYSVVLNNYGPAL  50



>ref|XP_007134881.1| hypothetical protein PHAVU_010G083900g [Phaseolus vulgaris]
 gb|ESW06875.1| hypothetical protein PHAVU_010G083900g [Phaseolus vulgaris]
Length=304

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 169/193 (88%), Gaps = 1/193 (1%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G  D+LVAL V+ LFH LLVMLLWSYFSVVFTDPG VPPNWRP +DEERG+ DPL 
Sbjct  49    ALSAGGLDSLVALLVLILFHSLLVMLLWSYFSVVFTDPGSVPPNWRPTIDEERGEADPLV  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
              +EF ++  D  Q RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  109   GTEFSNVQTDPNQ-RIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  167

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYTFLETTLVT SLLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGF
Sbjct  168   YFLLFLFYTFLETTLVTASLLPHFIAFFSDGEIPGTPGSLATTFLAFVLNLAFALSVLGF  227

Query  968   LIMHISLVSRNTT  1006
             LIMHISLV+ NTT
Sbjct  228   LIMHISLVAANTT  240


 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSGA MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L+
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPALS  51



>emb|CDO97688.1| unnamed protein product [Coffea canephora]
Length=300

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+L+A+ V+ LFH LLVMLLWSYFSVVFTDPG VPPNWRP LDEERGDTDPLT SEF
Sbjct  46    GDLDSLIAVAVLILFHSLLVMLLWSYFSVVFTDPGSVPPNWRPELDEERGDTDPLTESEF  105

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
             G+   D    R+R+C+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  106   GTASSDPVNLRVRYCRKCNQFKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  165

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET+L TL+LLP+F+AFF D +I G+ G+LATTFLAFVLNLAFALSVLGFLIMH
Sbjct  166   FLFYTFLETSLATLALLPHFVAFFSDGEIAGTPGNLATTFLAFVLNLAFALSVLGFLIMH  225

Query  980   ISLVSRNTT  1006
             ISLV+ NTT
Sbjct  226   ISLVAANTT  234



>gb|KHG00286.1| hypothetical protein F383_19583 [Gossypium arboreum]
Length=307

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+L A+ V+ LFHCLLVMLLWSYFSVV TDPG +P NWRPALDEERG+ DPL  SEF
Sbjct  53    GGLDSLTAVVVLILFHCLLVMLLWSYFSVVLTDPGSIPANWRPALDEERGEADPLNGSEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
               L  + +  RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   NGLQTNPSNQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET+LVTL+LLP+F+AFF DV+IPG+ G LATTFL+FVLNLAFALSVLGFLIMH
Sbjct  173   FLFYTFLETSLVTLALLPHFIAFFSDVEIPGTPGTLATTFLSFVLNLAFALSVLGFLIMH  232

Query  980   ISLVSRNTT  1006
             ISLV+ NTT
Sbjct  233   ISLVAANTT  241


 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGSIMILLVLGVVGV+YY VVLTN+GP L
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLVLGVVGVSYYSVVLTNFGPAL  50



>ref|XP_007218730.1| hypothetical protein PRUPE_ppa009076mg [Prunus persica]
 ref|XP_008232661.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Prunus 
mume]
 gb|EMJ19929.1| hypothetical protein PRUPE_ppa009076mg [Prunus persica]
Length=307

 Score =   243 bits (619),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G  D+L+AL V+ LFHCLLVMLLWSYFSVV TDPG VPPNWRPA+DEERG+ DPLT
Sbjct  49    ALYNGGLDSLIALVVLILFHCLLVMLLWSYFSVVLTDPGCVPPNWRPAVDEERGEADPLT  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
              S+F  L  D +  RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  109   GSDFSGLQTDPSNQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  168

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYTFLET++VTLSLLP+F++FF + +IPG+   LATTFLAFVLNLAFALSVLGF
Sbjct  169   YFLLFLFYTFLETSVVTLSLLPHFISFFSEGEIPGTPSTLATTFLAFVLNLAFALSVLGF  228

Query  968   LIMHISLVSRNTT  1006
             LIMHISLV+ NTT
Sbjct  229   LIMHISLVAANTT  241


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSG  MAWNVFKFCTALRGLGS+MILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MHRSGVTMAWNVFKFCTALRGLGSVMILLVLGVVGVTYYTVVLTNYGPAL  50



>ref|XP_003521795.1| PREDICTED: probable protein S-acyltransferase 14-like isoform 
X1 [Glycine max]
 gb|KHN35648.1| Putative S-acyltransferase [Glycine soja]
Length=304

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 169/193 (88%), Gaps = 1/193 (1%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G  D+LVAL V+ LFH LLVMLLWSYFSVVFTDPG VPPNW+P +DEERG+ DPL 
Sbjct  49    ALYAGGLDSLVALAVLILFHSLLVMLLWSYFSVVFTDPGSVPPNWKPTIDEERGEADPLV  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
              +EF +LP D    R+R+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  109   GTEFSNLPSD-PNPRVRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  167

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYTFLETTLVT SLLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGF
Sbjct  168   YFLLFLFYTFLETTLVTASLLPHFIAFFSDGEIPGTPGSLATTFLAFVLNLAFALSVLGF  227

Query  968   LIMHISLVSRNTT  1006
             LIMHISLV+ NTT
Sbjct  228   LIMHISLVAANTT  240


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGSIMILLVLGVVG TYY VVLTNYGP L
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLVLGVVGATYYAVVLTNYGPAL  50



>ref|XP_009346814.1| PREDICTED: probable protein S-acyltransferase 14 [Pyrus x bretschneideri]
Length=263

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+L+A+ V+ LFHCLLVMLLWSYFSVV TDPG VPPNWRPA+DEERG+ DPLT  +F
Sbjct  53    GGLDSLIAVAVLILFHCLLVMLLWSYFSVVLTDPGGVPPNWRPAVDEERGEADPLTGLDF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
               L PD +  RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   NGLQPDPSNQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET++V LSLLP+F+ FF + +IPG+   LATTFLAFVLNLAFALSVLGFL+MH
Sbjct  173   FLFYTFLETSVVALSLLPHFILFFSEGEIPGTPSTLATTFLAFVLNLAFALSVLGFLVMH  232

Query  980   ISLVSRNTT  1006
             ISLV+ NTT
Sbjct  233   ISLVAANTT  241


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSG  MAWNVFKFCTALRGLGS+MILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MHRSGVAMAWNVFKFCTALRGLGSVMILLVLGVVGVTYYTVVLTNYGPAL  50



>gb|KDO85815.1| hypothetical protein CISIN_1g021813mg [Citrus sinensis]
Length=246

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D++ A+ V+ LFHCLLVMLLWSYFSVV TD G VPPNWRPALDEERG+ DPL ASEF
Sbjct  53    GGLDSVTAVAVLILFHCLLVMLLWSYFSVVLTDAGSVPPNWRPALDEERGEADPLNASEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
                  D    RIR+C+KCNQLKPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   SGAQSDPLNPRIRYCRKCNQLKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FL YTFLET+LVTLSLLP+F++FF + +IPG+ G LATTFLAFVLNLAFALSVLGFLIMH
Sbjct  173   FLLYTFLETSLVTLSLLPHFISFFSEGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMH  232

Query  980   ISLVSRNTT  1006
             ISLVS NTT
Sbjct  233   ISLVSANTT  241


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPAL  50



>ref|XP_011469137.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=319

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G  D+L+A+ V+ LFH LLVMLLWSYFSVV TDPG VPPNWRPA+DEERG+ DPL 
Sbjct  49    ALYAGGLDSLIAIVVLILFHSLLVMLLWSYFSVVLTDPGGVPPNWRPAVDEERGEADPLN  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
              SEF  L  D +  R+R+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  109   GSEFSDLQTDPSNQRVRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  168

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYTFLETT+VTL LLP+F+AFF + +IPG+ G LATTFLAFVLNLAFALSVLGF
Sbjct  169   YFLLFLFYTFLETTVVTLCLLPHFIAFFSEGEIPGTPGTLATTFLAFVLNLAFALSVLGF  228

Query  968   LIMHISLVSRNTT  1006
             LIMHISLV+ NTT
Sbjct  229   LIMHISLVAANTT  241


 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGS+MILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSVMILLVLGVVGVTYYTVVLTNYGPAL  50



>ref|XP_002320722.2| hypothetical protein POPTR_0014s06480g [Populus trichocarpa]
 gb|EEE99037.2| hypothetical protein POPTR_0014s06480g [Populus trichocarpa]
Length=272

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+LV+L V+  FH LLVMLLWSYFSVV TDPG VPPNWRPA+DEERG+ DPL  SEF
Sbjct  53    GGIDSLVSLAVLIPFHSLLVMLLWSYFSVVLTDPGSVPPNWRPAIDEERGEADPLNGSEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
               +  D +  RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   SGVQSDQSNQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET+LVTLSL P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMH
Sbjct  173   FLFYTFLETSLVTLSLSPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMH  232

Query  980   ISLVSRNTT  1006
             ISLVS NTT
Sbjct  233   ISLVSANTT  241


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RS AVMAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVL NYGP L
Sbjct  1    MHRSRAVMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLNNYGPAL  50



>ref|XP_004506505.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cicer arietinum]
Length=305

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G FD L+A+ V+ LFH LLVMLLWSYFSVVF DPG VPPNWRP +DEE G+ DPL  SEF
Sbjct  53    GGFDFLIAILVLILFHTLLVMLLWSYFSVVFIDPGSVPPNWRPTIDEETGEADPLVGSEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
              ++  D +  RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   SNVQCDPSNQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLETTLVT SLLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMH
Sbjct  173   FLFYTFLETTLVTASLLPHFIAFFSDGEIPGTPGSLATTFLAFVLNLAFALSVLGFLIMH  232

Query  980   ISLVSRNTT  1006
             ISLV+ NTT
Sbjct  233   ISLVAANTT  241


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VV++NY P L
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVVSNYVPAL  50



>ref|XP_010544651.1| PREDICTED: probable protein S-acyltransferase 14 [Tarenaya hassleriana]
Length=305

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+LVAL ++ +FH LLVMLLWSYFSVVFTDPG VPPNWRP+ DEERG+ DPL + EF
Sbjct  53    GGLDSLVALGILIMFHSLLVMLLWSYFSVVFTDPGAVPPNWRPSTDEERGEADPLNSLEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
             G L PD++  R+RFC+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   GGLQPDSSNQRLRFCRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET LVTL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMH
Sbjct  173   FLFYTFLETALVTLVLMPHFVAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMH  232

Query  980   ISLVSRNTT  1006
             ISLV+ NTT
Sbjct  233   ISLVAANTT  241


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VV +NYGP L
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVWSNYGPAL  50



>ref|XP_002511714.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF50383.1| zinc finger protein, putative [Ricinus communis]
Length=307

 Score =   239 bits (611),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G FD+  AL V+  FHCLLVMLLWSYFSVV TDPG VPPNWRPA+DEERG+ DPL 
Sbjct  49    ALQDGGFDSCTALAVLIPFHCLLVMLLWSYFSVVLTDPGGVPPNWRPAIDEERGEADPLN  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
              S+F  +  D++  RIR+C+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  109   GSDFSGVLTDSSNQRIRYCRKCNQQKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  168

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYTFLET+LVTLSLLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGF
Sbjct  169   YFLLFLFYTFLETSLVTLSLLPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVLGF  228

Query  968   LIMHISLVSRNTT  1006
             LIMHISLVS NTT
Sbjct  229   LIMHISLVSANTT  241


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPAL  50



>gb|KFK37316.1| hypothetical protein AALP_AA4G241200 [Arabis alpina]
Length=307

 Score =   239 bits (611),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G   +L A  +I LFH LL MLLWSYFSVVFTDPG+VPPNWRP  DEERG++DPL 
Sbjct  49    ALSDGGLGSLAAFAIILLFHFLLGMLLWSYFSVVFTDPGVVPPNWRPVSDEERGESDPLN  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
             + EFG L PD++  R RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  109   SLEFGGLLPDSSNQRTRFCRKCNQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  168

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFL YTF+ETTLVTL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GF
Sbjct  169   YFLLFLLYTFMETTLVTLLLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGF  228

Query  968   LIMHISLVSRNTT  1006
             LIMHISLV+ NTT
Sbjct  229   LIMHISLVAANTT  241


 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG  MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VV TNYGP L+
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVWTNYGPALS  51



>gb|KJB41112.1| hypothetical protein B456_007G090900 [Gossypium raimondii]
Length=285

 Score =   238 bits (608),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G F++L A  ++  FHC L+MLLWSYFSVV TDPG VPPNWRPA+DEERG+ DPL  SEF
Sbjct  53    GGFNSLTAAVILFFFHCFLIMLLWSYFSVVLTDPGSVPPNWRPAMDEERGEADPLNGSEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
                 PD    RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYKYFLL
Sbjct  113   NGSQPDPLNQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAQNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET+LVT++LLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMH
Sbjct  173   FLFYTFLETSLVTMALLPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMH  232

Query  980   ISLVSRNTT  1006
             ISLVS NTT
Sbjct  233   ISLVSANTT  241


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALR LGSIMILLVLGVVGVTYY VV TNYGP L
Sbjct  1    MHRSGATMAWNVFKFCTALRALGSIMILLVLGVVGVTYYSVVFTNYGPAL  50



>ref|XP_011469138.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=307

 Score =   239 bits (610),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G  D+L+A+ V+ LFH LLVMLLWSYFSVV TDPG VPPNWRPA+DEERG+ DPL 
Sbjct  49    ALYAGGLDSLIAIVVLILFHSLLVMLLWSYFSVVLTDPGGVPPNWRPAVDEERGEADPLN  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
              SEF  L  D +  R+R+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  109   GSEFSDLQTDPSNQRVRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  168

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYTFLETT+VTL LLP+F+AFF + +IPG+ G LATTFLAFVLNLAFALSVLGF
Sbjct  169   YFLLFLFYTFLETTVVTLCLLPHFIAFFSEGEIPGTPGTLATTFLAFVLNLAFALSVLGF  228

Query  968   LIMHISLVSRNTT  1006
             LIMHISLV+ NTT
Sbjct  229   LIMHISLVAANTT  241


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGS+MILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSVMILLVLGVVGVTYYTVVLTNYGPAL  50



>ref|XP_009338113.1| PREDICTED: probable protein S-acyltransferase 14 [Pyrus x bretschneideri]
Length=307

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+LVA+ V+ LFHCLLVMLLWSYFSVV TDPG VPPNWRPA+DEERG+ DPLT  +F
Sbjct  53    GGLDSLVAVAVLILFHCLLVMLLWSYFSVVLTDPGGVPPNWRPAVDEERGEADPLTGLDF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
               L PD +  RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   NGLQPDPSNQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET++V LSLLP+F+ FF + +IPG+   LATTFLAFVLNLAFALSVLGFL+MH
Sbjct  173   FLFYTFLETSVVALSLLPHFILFFSEGEIPGTPSTLATTFLAFVLNLAFALSVLGFLVMH  232

Query  980   ISLVSRNTT  1006
             ISLV+ NTT
Sbjct  233   ISLVAANTT  241


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSG  MAWNVFKFCTALRGLGS+MILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MHRSGVAMAWNVFKFCTALRGLGSVMILLVLGVVGVTYYTVVLTNYGPAL  50



>gb|KDO85814.1| hypothetical protein CISIN_1g021813mg [Citrus sinensis]
Length=295

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D++ A+ V+ LFHCLLVMLLWSYFSVV TD G VPPNWRPALDEERG+ DPL ASEF
Sbjct  53    GGLDSVTAVAVLILFHCLLVMLLWSYFSVVLTDAGSVPPNWRPALDEERGEADPLNASEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
                  D    RIR+C+KCNQLKPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   SGAQSDPLNPRIRYCRKCNQLKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FL YTFLET+LVTLSLLP+F++FF + +IPG+ G LATTFLAFVLNLAFALSVLGFLIMH
Sbjct  173   FLLYTFLETSLVTLSLLPHFISFFSEGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMH  232

Query  980   ISLVSRNTT  1006
             ISLVS NTT
Sbjct  233   ISLVSANTT  241


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPAL  50



>ref|XP_008393352.1| PREDICTED: probable protein S-acyltransferase 14 [Malus domestica]
Length=307

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+L+A+ V+ LFHCLLVMLLWSYFSVV TDPG VPPNWRPA+DEERG+ DPLT S+F
Sbjct  53    GGLDSLIAVAVLILFHCLLVMLLWSYFSVVLTDPGGVPPNWRPAVDEERGEADPLTGSDF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
               L PD +  RIR+C+KCNQLKP RCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYF L
Sbjct  113   NGLQPDPSNQRIRYCRKCNQLKPARCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFXL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET++VTLSLLP+F+ FF + +IPG+   LATTFLAFVLNLAFALSVLGFL+MH
Sbjct  173   FLFYTFLETSVVTLSLLPHFILFFSEGEIPGTPSTLATTFLAFVLNLAFALSVLGFLVMH  232

Query  980   ISLVSRNTT  1006
             ISLV+ NTT
Sbjct  233   ISLVAANTT  241


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSG  MAWNVFKFCTALRGLGS+MILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MHRSGVAMAWNVFKFCTALRGLGSVMILLVLGVVGVTYYTVVLTNYGPAL  50



>ref|XP_006291552.1| hypothetical protein CARUB_v10017708mg [Capsella rubella]
 gb|EOA24450.1| hypothetical protein CARUB_v10017708mg [Capsella rubella]
Length=306

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G  D+L AL ++ LFH LL MLLWSYFSVVFTDPG VPPNWRP+ DEERG++DPL 
Sbjct  50    ALAQGGLDSLAALTILILFHFLLAMLLWSYFSVVFTDPGAVPPNWRPSTDEERGESDPLN  109

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
             + EF  L PD++  R+RFC+KCNQLKP RCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  110   SLEFVGLQPDSSNPRVRFCRKCNQLKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  169

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYTFLET+LVTL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GF
Sbjct  170   YFLLFLFYTFLETSLVTLVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGF  229

Query  968   LIMHISLVSRNTT  1006
             LIMHISLV+ NTT
Sbjct  230   LIMHISLVAGNTT  242


 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGP  411
            M+RSG  MAWN+FKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP
Sbjct  1    MHRSGTAMAWNIFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGP  48



>gb|KJB41110.1| hypothetical protein B456_007G090900 [Gossypium raimondii]
 gb|KJB41111.1| hypothetical protein B456_007G090900 [Gossypium raimondii]
Length=307

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G F++L A  ++  FHC L+MLLWSYFSVV TDPG VPPNWRPA+DEERG+ DPL  SEF
Sbjct  53    GGFNSLTAAVILFFFHCFLIMLLWSYFSVVLTDPGSVPPNWRPAMDEERGEADPLNGSEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
                 PD    RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYKYFLL
Sbjct  113   NGSQPDPLNQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAQNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET+LVT++LLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMH
Sbjct  173   FLFYTFLETSLVTMALLPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMH  232

Query  980   ISLVSRNTT  1006
             ISLVS NTT
Sbjct  233   ISLVSANTT  241


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALR LGSIMILLVLGVVGVTYY VV TNYGP L
Sbjct  1    MHRSGATMAWNVFKFCTALRALGSIMILLVLGVVGVTYYSVVFTNYGPAL  50



>ref|XP_011034295.1| PREDICTED: probable protein S-acyltransferase 14 [Populus euphratica]
Length=307

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+L++L V+  FH LLVMLLWSYFSVV TDPG VPPNWRPA+DEERG+ DPL  SEF
Sbjct  53    GGIDSLISLVVLIPFHSLLVMLLWSYFSVVLTDPGSVPPNWRPAIDEERGEADPLNGSEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
               +  D +  RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   SGVQSDQSNQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET+LVTLSL P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMH
Sbjct  173   FLFYTFLETSLVTLSLSPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMH  232

Query  980   ISLVSRNTT  1006
             ISLVS NTT
Sbjct  233   ISLVSANTT  241


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RS AVMAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVL NYGP L
Sbjct  1    MHRSRAVMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLNNYGPAL  50



>ref|XP_010413516.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=307

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 170/194 (88%), Gaps = 1/194 (1%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G  D+L AL ++ LFH LL MLLWSYFSVVFTDPG+VPPNWRP+ DEERG++DPL 
Sbjct  50    ALSQGGLDSLAALTILILFHFLLAMLLWSYFSVVFTDPGVVPPNWRPSTDEERGESDPLN  109

Query  608   ASEF-GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNY  784
             + EF G  PPD++  R+RFC+KCNQLKP RCHHCSVCGRCVLKMDHHCVWVVNCVGALNY
Sbjct  110   SLEFVGLQPPDSSNPRVRFCRKCNQLKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGALNY  169

Query  785   KYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlG  964
             KYFLLFLFYTFLETTLVTL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+G
Sbjct  170   KYFLLFLFYTFLETTLVTLVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMG  229

Query  965   FLIMHISLVSRNTT  1006
             FLIMHISLV+ NTT
Sbjct  230   FLIMHISLVAGNTT  243


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGP  411
            M+RSG  MAWNVFKFCTALRGLGSIMILLV GVVGVTYY VVLTNYGP
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILLVFGVVGVTYYAVVLTNYGP  48



>ref|XP_010469144.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=307

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 172/197 (87%), Gaps = 2/197 (1%)
 Frame = +2

Query  419   PAVAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTD  598
             PA    VG+ D+L AL ++ LFH LL MLLWSYFSVVFTDPG+VPPNWRP+ DEERG++D
Sbjct  48    PAALSQVGL-DSLAALTILILFHFLLAMLLWSYFSVVFTDPGVVPPNWRPSTDEERGESD  106

Query  599   PLTASEF-GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA  775
             PL + EF G  PPD++  R+RFC+KCNQLKP RCHHCSVCGRCVLKMDHHCVWVVNCVGA
Sbjct  107   PLNSLEFVGLQPPDSSNPRVRFCRKCNQLKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGA  166

Query  776   LNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafals  955
             LNYKYFLLFLFYTFLETTLVTL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALS
Sbjct  167   LNYKYFLLFLFYTFLETTLVTLVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALS  226

Query  956   vlGFLIMHISLVSRNTT  1006
             V+GFLIMHISLV+ NTT
Sbjct  227   VMGFLIMHISLVAGNTT  243


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGP  411
            M+RSG  MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGP  48



>ref|XP_012083578.1| PREDICTED: probable protein S-acyltransferase 14 [Jatropha curcas]
 gb|KDP28757.1| hypothetical protein JCGZ_14528 [Jatropha curcas]
Length=307

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D++ AL V+  FHCLLVMLLWSYFSVV TDPG VPPNWRPA+DEER + DPL  S+F
Sbjct  53    GGLDSVTALAVLIPFHCLLVMLLWSYFSVVLTDPGSVPPNWRPAVDEERSEADPLNGSDF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
               L  D++  RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   SGLATDSSNQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET+LVTLSLLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMH
Sbjct  173   FLFYTFLETSLVTLSLLPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMH  232

Query  980   ISLVSRNTT  1006
              SLVS NTT
Sbjct  233   TSLVSANTT  241


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPAL  50



>ref|XP_010524364.1| PREDICTED: probable protein S-acyltransferase 14 [Tarenaya hassleriana]
Length=307

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+LVAL ++ LFH LL+MLLWSYFSVVF DPG VPPNWRPA DEERG+ DPL + EF
Sbjct  53    GGVDSLVALAILLLFHSLLMMLLWSYFSVVFADPGSVPPNWRPATDEERGEADPLNSMEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
             G +  D++  RIRFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   GGIQSDSSNPRIRFCRKCNQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLETTLVTL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMH
Sbjct  173   FLFYTFLETTLVTLVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMH  232

Query  980   ISLVSRNTT  1006
             ISLV+ NTT
Sbjct  233   ISLVAANTT  241


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPAL  50



>ref|XP_006445267.1| hypothetical protein CICLE_v10021302mg [Citrus clementina]
 ref|XP_006490917.1| PREDICTED: probable protein S-acyltransferase 14-like [Citrus 
sinensis]
 gb|ESR58507.1| hypothetical protein CICLE_v10021302mg [Citrus clementina]
 gb|KDO85813.1| hypothetical protein CISIN_1g021813mg [Citrus sinensis]
Length=307

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D++ A+ V+ LFHCLLVMLLWSYFSVV TD G VPPNWRPALDEERG+ DPL ASEF
Sbjct  53    GGLDSVTAVAVLILFHCLLVMLLWSYFSVVLTDAGSVPPNWRPALDEERGEADPLNASEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
                  D    RIR+C+KCNQLKPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   SGAQSDPLNPRIRYCRKCNQLKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FL YTFLET+LVTLSLLP+F++FF + +IPG+ G LATTFLAFVLNLAFALSVLGFLIMH
Sbjct  173   FLLYTFLETSLVTLSLLPHFISFFSEGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMH  232

Query  980   ISLVSRNTT  1006
             ISLVS NTT
Sbjct  233   ISLVSANTT  241


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPAL  50



>ref|XP_010056317.1| PREDICTED: probable protein S-acyltransferase 14 [Eucalyptus 
grandis]
Length=307

 Score =   237 bits (604),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+ VAL V+ LFHCLLVMLLWSYFSVV TDPG +PPNWRP++DEERG++DPL   +F
Sbjct  53    GGVDSFVALGVLILFHCLLVMLLWSYFSVVLTDPGGIPPNWRPSVDEERGESDPLNGLDF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
               L  D +  RIRFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   SVLQSDPSHRRIRFCRKCNQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET++VTLSLLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFL+MH
Sbjct  173   FLFYTFLETSVVTLSLLPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVLGFLVMH  232

Query  980   ISLVSRNTT  1006
             ISLVS NTT
Sbjct  233   ISLVSANTT  241


 Score = 63.9 bits (154),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            MYRSGAVMAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MYRSGAVMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPNL  50



>ref|XP_003605089.1| Palmitoyltransferase pfa3 [Medicago truncatula]
Length=292

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 155/189 (82%), Gaps = 6/189 (3%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G FD+L+A+ V+ LFH LLVMLLWSYFSVVF DPG VPPNWRP +DEERG+ DPL  SEF
Sbjct  46    GGFDSLIAVLVLILFHALLVMLLWSYFSVVFIDPGSVPPNWRPTIDEERGEEDPLVGSEF  105

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
              ++  D +  RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNY +   
Sbjct  106   SNVQCDPSNQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYNF---  162

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
                   L T+LVT SLLP+F+AFF D +IPG+   LATTFLAFVLNLAFALSV+GFLIMH
Sbjct  163   ---ILSLSTSLVTASLLPHFIAFFSDGEIPGTPSSLATTFLAFVLNLAFALSVMGFLIMH  219

Query  980   ISLVSRNTT  1006
             ISLV+ NTT
Sbjct  220   ISLVAANTT  228



>gb|AES87286.2| DHHC-type zinc finger protein [Medicago truncatula]
Length=299

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 155/189 (82%), Gaps = 6/189 (3%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G FD+L+A+ V+ LFH LLVMLLWSYFSVVF DPG VPPNWRP +DEERG+ DPL  SEF
Sbjct  53    GGFDSLIAVLVLILFHALLVMLLWSYFSVVFIDPGSVPPNWRPTIDEERGEEDPLVGSEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
              ++  D +  RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNY +   
Sbjct  113   SNVQCDPSNQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYNF---  169

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
                   L T+LVT SLLP+F+AFF D +IPG+   LATTFLAFVLNLAFALSV+GFLIMH
Sbjct  170   ---ILSLSTSLVTASLLPHFIAFFSDGEIPGTPSSLATTFLAFVLNLAFALSVMGFLIMH  226

Query  980   ISLVSRNTT  1006
             ISLV+ NTT
Sbjct  227   ISLVAANTT  235


 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VV+TNY P L
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVITNYVPSL  50



>gb|KJB09889.1| hypothetical protein B456_001G174100 [Gossypium raimondii]
 gb|KJB09892.1| hypothetical protein B456_001G174100 [Gossypium raimondii]
Length=304

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 166/189 (88%), Gaps = 3/189 (2%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+L A+ V+ LFHCLLVMLLWSYFSVV TDPG +P NWRPALDEERG+ DPL  SEF
Sbjct  53    GGLDSLTAVVVLILFHCLLVMLLWSYFSVVLTDPGSIPANWRPALDEERGEADPLNGSEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
                P   +  RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   NVNP---SNQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  169

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET+LVTL+LLP+F+AFF DV+IPG+ G LATTFL+FVLNLAFALSVLGFLIMH
Sbjct  170   FLFYTFLETSLVTLALLPHFIAFFSDVEIPGTPGTLATTFLSFVLNLAFALSVLGFLIMH  229

Query  980   ISLVSRNTT  1006
             ISLV+ NTT
Sbjct  230   ISLVAANTT  238


 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGSIMILLVLGVVGV+YY VVLTN+GP L
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLVLGVVGVSYYSVVLTNFGPAL  50



>gb|KJB09890.1| hypothetical protein B456_001G174100 [Gossypium raimondii]
Length=297

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 166/189 (88%), Gaps = 3/189 (2%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+L A+ V+ LFHCLLVMLLWSYFSVV TDPG +P NWRPALDEERG+ DPL  SEF
Sbjct  46    GGLDSLTAVVVLILFHCLLVMLLWSYFSVVLTDPGSIPANWRPALDEERGEADPLNGSEF  105

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
                P   +  RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  106   NVNP---SNQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  162

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET+LVTL+LLP+F+AFF DV+IPG+ G LATTFL+FVLNLAFALSVLGFLIMH
Sbjct  163   FLFYTFLETSLVTLALLPHFIAFFSDVEIPGTPGTLATTFLSFVLNLAFALSVLGFLIMH  222

Query  980   ISLVSRNTT  1006
             ISLV+ NTT
Sbjct  223   ISLVAANTT  231



>gb|ERN13328.1| hypothetical protein AMTR_s00041p00097340 [Amborella trichopoda]
Length=305

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 169/196 (86%), Gaps = 7/196 (4%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D ++AL V+ LFH LL MLLWSYFSVVFTDPG VPPNWRP +DEERG+  PL +SEF
Sbjct  46    GGLDVVIALAVLILFHGLLAMLLWSYFSVVFTDPGGVPPNWRPVIDEERGENVPLASSEF  105

Query  620   G-------SLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  778
                     S+  D++ SRIR+C+KCNQ+KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGAL
Sbjct  106   SGQTMLQSSVLVDSSNSRIRYCRKCNQMKPPRCHHCSVCGRCILKMDHHCVWVVNCVGAL  165

Query  779   NYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsv  958
             NYKYFLLFLFYTFLETTLV++SLLPNF+AFF D +IPG+AG LATTFLAFVLNLAFALSV
Sbjct  166   NYKYFLLFLFYTFLETTLVSISLLPNFIAFFSDNEIPGTAGTLATTFLAFVLNLAFALSV  225

Query  959   lGFLIMHISLVSRNTT  1006
             LGFLIMHISLVS NTT
Sbjct  226   LGFLIMHISLVSGNTT  241



>ref|XP_006851861.2| PREDICTED: probable protein S-acyltransferase 14 [Amborella trichopoda]
Length=312

 Score =   237 bits (605),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 169/196 (86%), Gaps = 7/196 (4%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D ++AL V+ LFH LL MLLWSYFSVVFTDPG VPPNWRP +DEERG+  PL +SEF
Sbjct  53    GGLDVVIALAVLILFHGLLAMLLWSYFSVVFTDPGGVPPNWRPVIDEERGENVPLASSEF  112

Query  620   G-------SLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  778
                     S+  D++ SRIR+C+KCNQ+KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGAL
Sbjct  113   SGQTMLQSSVLVDSSNSRIRYCRKCNQMKPPRCHHCSVCGRCILKMDHHCVWVVNCVGAL  172

Query  779   NYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsv  958
             NYKYFLLFLFYTFLETTLV++SLLPNF+AFF D +IPG+AG LATTFLAFVLNLAFALSV
Sbjct  173   NYKYFLLFLFYTFLETTLVSISLLPNFIAFFSDNEIPGTAGTLATTFLAFVLNLAFALSV  232

Query  959   lGFLIMHISLVSRNTT  1006
             LGFLIMHISLVS NTT
Sbjct  233   LGFLIMHISLVSGNTT  248


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSG +MAWNVFKFCTALRGLGS+MILLVLGVVGVTYY VV+TNYGP L
Sbjct  1    MHRSGVLMAWNVFKFCTALRGLGSVMILLVLGVVGVTYYAVVITNYGPSL  50



>ref|XP_010255627.1| PREDICTED: probable protein S-acyltransferase 14 [Nelumbo nucifera]
Length=316

 Score =   237 bits (604),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 166/198 (84%), Gaps = 9/198 (5%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D++ AL V+ LFH LLVMLLWSYFSVV TDPG VPPNWRP LDEERG+ DPLT  EF
Sbjct  53    GGLDSITALAVLILFHGLLVMLLWSYFSVVLTDPGSVPPNWRPTLDEERGENDPLTGIEF  112

Query  620   GS---------LPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVG  772
             G+         + PD A  R R+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVG
Sbjct  113   GAAGAGLQQSAMLPDPANPRFRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVG  172

Query  773   ALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafal  952
             ALNYKYFLLFLFYTFLETTLVTLSLLP+F+AFF D +IPG+ G LATTFL FVLNLAFAL
Sbjct  173   ALNYKYFLLFLFYTFLETTLVTLSLLPHFIAFFSDGEIPGTPGTLATTFLTFVLNLAFAL  232

Query  953   svlGFLIMHISLVSRNTT  1006
             SV+GFLIMHISLV+ NTT
Sbjct  233   SVMGFLIMHISLVAANTT  250


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGAVMAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VV+TNY P L
Sbjct  1    MHRSGAVMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVITNYVPAL  50



>ref|XP_010098912.1| putative S-acyltransferase [Morus notabilis]
 gb|EXB76214.1| putative S-acyltransferase [Morus notabilis]
Length=308

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT-ASE  616
             G   +L++L V+  FHCLLVMLLWSYFSVV TDPG VPPNWRPA+DEERG+ DPL   SE
Sbjct  53    GGLYSLISLAVLIFFHCLLVMLLWSYFSVVLTDPGSVPPNWRPAVDEERGEADPLNNGSE  112

Query  617   FGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfl  796
             F SL  + +  RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFL
Sbjct  113   FTSLQAEPSNQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFL  172

Query  797   lflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIM  976
             LFLFYTFLET+LVTL+LLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIM
Sbjct  173   LFLFYTFLETSLVTLALLPHFIAFFSDDEIPGTPGTLATTFLAFVLNLAFALSVLGFLIM  232

Query  977   HISLVSRNTT  1006
             HISLV+ NTT
Sbjct  233   HISLVAANTT  242


 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSG  MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MHRSGVAMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPAL  50



>emb|CDX71777.1| BnaC08g30970D [Brassica napus]
Length=305

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G  D+ VAL ++ LFH LL MLLWSYFSVVFTDPG VP NWRPA DEERG++DPLT
Sbjct  49    ALSQGGVDSFVALTILVLFHVLLAMLLWSYFSVVFTDPGAVPANWRPASDEERGESDPLT  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
             + EF  L  D++  R+RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  109   SLEFVGLQTDSSNPRVRFCRKCNQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  168

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYTFLETTLVTL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GF
Sbjct  169   YFLLFLFYTFLETTLVTLVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGF  228

Query  968   LIMHISLVSRNTT  1006
             LIMHISLV+ NTT
Sbjct  229   LIMHISLVAGNTT  241


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG  MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L+
Sbjct  1    MHRSGTAMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPALS  51



>ref|XP_003517050.1| PREDICTED: probable protein S-acyltransferase 14-like isoform 
1 [Glycine max]
 gb|KHN40156.1| Putative S-acyltransferase [Glycine soja]
Length=304

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 167/193 (87%), Gaps = 1/193 (1%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G  D+LVAL V+ LFH LLVMLLWSYFSVVFTDPG VPPNW+P +DEERG+ DPL 
Sbjct  49    ALYAGGLDSLVALAVLILFHSLLVMLLWSYFSVVFTDPGSVPPNWKPMIDEERGEADPLV  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
              +EF ++  D  Q R+R+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  109   GTEFSNVLSDPNQ-RVRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  167

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
              FLLFLFYTFLETTLVT SLLP+F+ FF D +IPG+ G LATTFLAFVLNLAFALSVLGF
Sbjct  168   CFLLFLFYTFLETTLVTASLLPHFITFFSDGEIPGTPGSLATTFLAFVLNLAFALSVLGF  227

Query  968   LIMHISLVSRNTT  1006
             LIMHISLV+ NTT
Sbjct  228   LIMHISLVAANTT  240


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPAL  50



>emb|CBI38870.3| unnamed protein product [Vitis vinifera]
Length=300

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G   +++A+ V+ LFH LLVMLLWSYFSVV TDPG VPPNWRP +DEERG+ DPLT S+F
Sbjct  46    GGLTSVIAVAVLILFHGLLVMLLWSYFSVVLTDPGGVPPNWRPIMDEERGEGDPLTGSDF  105

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
             G  P D ++ R+R+C+KC+Q+KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLL
Sbjct  106   GVSPADASKQRVRYCRKCSQMKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLL  165

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET+LVTLSLLP+F+AFF + +IPGS G LATTFLAFVLNLAFALSV+GFLIMH
Sbjct  166   FLFYTFLETSLVTLSLLPHFIAFFTEGEIPGSPGTLATTFLAFVLNLAFALSVMGFLIMH  225

Query  980   ISLVSRNTT  1006
             IS+V+ NTT
Sbjct  226   ISMVAANTT  234



>ref|XP_002279896.1| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
 ref|XP_010661650.1| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
 emb|CAN80505.1| hypothetical protein VITISV_010744 [Vitis vinifera]
Length=307

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G   +++A+ V+ LFH LLVMLLWSYFSVV TDPG VPPNWRP +DEERG+ DPLT S+F
Sbjct  53    GGLTSVIAVAVLILFHGLLVMLLWSYFSVVLTDPGGVPPNWRPIMDEERGEGDPLTGSDF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
             G  P D ++ R+R+C+KC+Q+KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   GVSPADASKQRVRYCRKCSQMKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET+LVTLSLLP+F+AFF + +IPGS G LATTFLAFVLNLAFALSV+GFLIMH
Sbjct  173   FLFYTFLETSLVTLSLLPHFIAFFTEGEIPGSPGTLATTFLAFVLNLAFALSVMGFLIMH  232

Query  980   ISLVSRNTT  1006
             IS+V+ NTT
Sbjct  233   ISMVAANTT  241


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGAVMAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLT+YGP L
Sbjct  1    MHRSGAVMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTSYGPAL  50



>ref|XP_008232660.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Prunus 
mume]
Length=581

 Score =   243 bits (619),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G  D+L+AL V+ LFHCLLVMLLWSYFSVV TDPG VPPNWRPA+DEERG+ DPLT
Sbjct  323   ALYNGGLDSLIALVVLILFHCLLVMLLWSYFSVVLTDPGCVPPNWRPAVDEERGEADPLT  382

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
              S+F  L  D +  RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  383   GSDFSGLQTDPSNQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  442

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYTFLET++VTLSLLP+F++FF + +IPG+   LATTFLAFVLNLAFALSVLGF
Sbjct  443   YFLLFLFYTFLETSVVTLSLLPHFISFFSEGEIPGTPSTLATTFLAFVLNLAFALSVLGF  502

Query  968   LIMHISLVSRNTT  1006
             LIMHISLV+ NTT
Sbjct  503   LIMHISLVAANTT  515



>ref|XP_002302535.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE81808.2| zinc finger family protein [Populus trichocarpa]
Length=310

 Score =   235 bits (599),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+L +L V+  FH LLVMLLWSYFSVV TDPG VPPNWRPA+DEERG+ DPL  SE 
Sbjct  53    GDIDSLFSLAVLITFHSLLVMLLWSYFSVVLTDPGSVPPNWRPAIDEERGEADPLNGSEC  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
               +  D    RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   SGVQSDQLNQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET+LVTLSLLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMH
Sbjct  173   FLFYTFLETSLVTLSLLPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMH  232

Query  980   ISLVSRNTT  1006
             ISLVS NTT
Sbjct  233   ISLVSANTT  241


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RS AVMAWNVFKFCTALRGLGSIMILLVLGVV VTYY VVL NYGP L
Sbjct  1    MHRSRAVMAWNVFKFCTALRGLGSIMILLVLGVVVVTYYAVVLNNYGPAL  50



>ref|XP_010508175.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
 ref|XP_010508176.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=309

 Score =   234 bits (598),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 166/195 (85%), Gaps = 2/195 (1%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEER--GDTDP  601
             A+  G  D+L AL +I LFH LL MLLWSYFSVVFTDPG+VPPNWR A DEE+  G++DP
Sbjct  49    ALSAGWLDSLAALSIILLFHFLLAMLLWSYFSVVFTDPGVVPPNWRLASDEEQRGGESDP  108

Query  602   LTASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALN  781
             L + EFG L PD++  R RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALN
Sbjct  109   LNSLEFGGLHPDSSNQRTRFCRKCNQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALN  168

Query  782   YKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvl  961
             YKYFLLFL YTFLETTLV L L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+
Sbjct  169   YKYFLLFLLYTFLETTLVILLLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVM  228

Query  962   GFLIMHISLVSRNTT  1006
             GFLIMHISLVS NTT
Sbjct  229   GFLIMHISLVSANTT  243


 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG  MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VV TNYGP L+
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVWTNYGPALS  51



>ref|XP_008343300.1| PREDICTED: probable protein S-acyltransferase 14 [Malus domestica]
Length=307

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+L+A+ V+ +FHCLLVMLLWSYFSVV TDPG VPPNWRPA+DEERG  DPLT S+F
Sbjct  53    GGLDSLIAVGVLIIFHCLLVMLLWSYFSVVLTDPGGVPPNWRPAVDEERGQADPLTWSDF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
               L PD +  RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVV+CVGALNYKYFLL
Sbjct  113   NGLQPDPSNLRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVHCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET++VTLSLLP+ ++FF + +IPG+   LATTFLAFVLNLAFALSVLGFLIMH
Sbjct  173   FLFYTFLETSVVTLSLLPHLISFFNEGEIPGTPSTLATTFLAFVLNLAFALSVLGFLIMH  232

Query  980   ISLVSRNTT  1006
             ISLV+ NTT
Sbjct  233   ISLVAANTT  241


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSG  MAWNVFKFC  LRGLGS+MILLVLGVVGVTYY VV TNYGP L
Sbjct  1    MHRSGVAMAWNVFKFCIVLRGLGSVMILLVLGVVGVTYYTVVFTNYGPAL  50



>ref|XP_011017489.1| PREDICTED: probable protein S-acyltransferase 14 [Populus euphratica]
Length=307

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+LV+L V+  FH LLVMLLWSYFSVV TDPG VPPNWRPA+DEERG+ D L  SE 
Sbjct  53    GDIDSLVSLAVLITFHSLLVMLLWSYFSVVLTDPGSVPPNWRPAIDEERGEADALNGSEC  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
               +  D    RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   SGVQSDQLNQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET+LVTLSLLP+F+AFF D +IPG+ G LATTFLAFV+NLAFALSVLGFLIMH
Sbjct  173   FLFYTFLETSLVTLSLLPHFIAFFSDGEIPGTPGTLATTFLAFVINLAFALSVLGFLIMH  232

Query  980   ISLVSRNTT  1006
             ISLVS NTT
Sbjct  233   ISLVSANTT  241


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RS AVMAWNVFKFCTALRGLGSIMILLVLGVV VTYY VVL NYGP L
Sbjct  1    MHRSRAVMAWNVFKFCTALRGLGSIMILLVLGVVVVTYYAVVLNNYGPAL  50



>ref|XP_002878349.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54608.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=306

 Score =   234 bits (597),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 169/194 (87%), Gaps = 1/194 (1%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G  D+L AL ++ LFH LL MLLWSYFSVVFTDPG+VPPNWRP+ DEERG++DPL 
Sbjct  49    ALSQGGLDSLAALTILILFHFLLAMLLWSYFSVVFTDPGVVPPNWRPSTDEERGESDPLN  108

Query  608   ASEFGSLPPDTAQS-RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNY  784
             + EF  L  D++ + R+RFC+KCNQLKP RCHHCSVCGRCVLKMDHHCVWVVNCVGALNY
Sbjct  109   SLEFVGLQADSSSNPRVRFCRKCNQLKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGALNY  168

Query  785   KYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlG  964
             KYFLLFLFYTFLETTLVT+ L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+G
Sbjct  169   KYFLLFLFYTFLETTLVTMVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMG  228

Query  965   FLIMHISLVSRNTT  1006
             FLIMHISLV+ NTT
Sbjct  229   FLIMHISLVAGNTT  242


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG  MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L+
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPALS  51



>ref|XP_004133913.1| PREDICTED: probable protein S-acyltransferase 14 [Cucumis sativus]
 gb|KGN56601.1| hypothetical protein Csa_3G126160 [Cucumis sativus]
Length=307

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+L+A  V+  FHCLLVMLLWSYFSVV TDPG VPPNWRPA+DEER + DPL   EF
Sbjct  53    GGLDSLIAFAVLISFHCLLVMLLWSYFSVVLTDPGSVPPNWRPAVDEERAEGDPLNTMEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
               L P+ +  RIR+C+KCN LKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   SILHPELSNQRIRYCRKCNHLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FL YTFLET++VTLSLLP+F+AFF + +IPG+   LATTF+AFVLNLAFALSV+GFLIMH
Sbjct  173   FLLYTFLETSVVTLSLLPHFIAFFSEGEIPGTPSTLATTFIAFVLNLAFALSVMGFLIMH  232

Query  980   ISLVSRNTT  1006
             ISLV+ NTT
Sbjct  233   ISLVAANTT  241


 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSG  MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MHRSGPAMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPAL  50



>ref|XP_008438165.1| PREDICTED: probable protein S-acyltransferase 14 [Cucumis melo]
Length=307

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+L+AL V+  FHCLLVMLLWSYFSVV TDPG VPPNWRP +DEER + DPL   EF
Sbjct  53    GGLDSLIALAVLISFHCLLVMLLWSYFSVVLTDPGSVPPNWRPVVDEERAEGDPLNTMEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
               L P+ +  RIR+C+KCN LKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   SILHPELSNQRIRYCRKCNHLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FL YTFLET++VTLSLLP+F+AFF + +IPG+   LATTF+AFVLNLAFALSV+GFLIMH
Sbjct  173   FLLYTFLETSVVTLSLLPHFIAFFSEGEIPGTPSTLATTFIAFVLNLAFALSVMGFLIMH  232

Query  980   ISLVSRNTT  1006
             ISLV+ NTT
Sbjct  233   ISLVAANTT  241


 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSG  MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MHRSGPAMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPAL  50



>ref|NP_191639.2| DHHC-type zinc finger family protein [Arabidopsis thaliana]
 sp|Q8VYP5.1|ZDH14_ARATH RecName: Full=Probable protein S-acyltransferase 14; AltName: 
Full=Probable palmitoyltransferase At3g60800; AltName: Full=Zinc 
finger DHHC domain-containing protein At3g60800 [Arabidopsis 
thaliana]
 gb|AAL49877.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20224.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01138.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE80109.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
Length=307

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 169/195 (87%), Gaps = 2/195 (1%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G  D+L AL ++ LFH LL MLLWSYFSVVFTDPG+VPPNWRP+ DEERG++DPL 
Sbjct  49    ALSQGGLDSLAALTILILFHFLLAMLLWSYFSVVFTDPGVVPPNWRPSTDEERGESDPLN  108

Query  608   ASEFGSLPPDTAQS--RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALN  781
             + +F  L  D++ S  R+RFC+KCNQLKP RCHHCSVCGRCVLKMDHHCVWVVNCVGALN
Sbjct  109   SLDFVGLQSDSSSSNPRVRFCRKCNQLKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGALN  168

Query  782   YKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvl  961
             YKYFLLFLFYTFLETTLVTL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+
Sbjct  169   YKYFLLFLFYTFLETTLVTLVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVM  228

Query  962   GFLIMHISLVSRNTT  1006
             GFLIMHISLV+ NTT
Sbjct  229   GFLIMHISLVAGNTT  243


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG  MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L+
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPALS  51



>emb|CDY52347.1| BnaA09g38960D [Brassica napus]
Length=305

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G  D+  AL ++ LFH LL MLLWSYFSVVFTDPG VP NWRPA DEERG++DPLT
Sbjct  49    ALSQGGVDSFAALTILVLFHFLLAMLLWSYFSVVFTDPGAVPANWRPAADEERGESDPLT  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
             + EF  L  D++  R+RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  109   SLEFVGLQTDSSNPRVRFCRKCNQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  168

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYTFLETTLVTL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GF
Sbjct  169   YFLLFLFYTFLETTLVTLVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGF  228

Query  968   LIMHISLVSRNTT  1006
             LIMH+SLV+ NTT
Sbjct  229   LIMHMSLVAGNTT  241


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG  MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L+
Sbjct  1    MHRSGTAMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPALS  51



>ref|XP_007052066.1| DHHC-type zinc finger family protein isoform 1 [Theobroma cacao]
 gb|EOX96223.1| DHHC-type zinc finger family protein isoform 1 [Theobroma cacao]
Length=353

 Score =   233 bits (593),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 164/189 (87%), Gaps = 3/189 (2%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D++ A+ V+ LFHCLLVMLLWSYFSVV TDPG VPPNWRPA+DEERG+ DPL  SEF
Sbjct  53    GGLDSITAVVVLILFHCLLVMLLWSYFSVVLTDPGSVPPNWRPAMDEERGEVDPLNGSEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
               L  D +  RIR+C+KCNQLKPPRCHH   CGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   NGLQSDPSNQRIRYCRKCNQLKPPRCHH---CGRCVLKMDHHCVWVVNCVGALNYKYFLL  169

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET+LVTL+LLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMH
Sbjct  170   FLFYTFLETSLVTLALLPHFIAFFSDEEIPGTPGILATTFLAFVLNLAFALSVLGFLIMH  229

Query  980   ISLVSRNTT  1006
             ISLV+ NTT
Sbjct  230   ISLVAANTT  238


 Score = 61.2 bits (147),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVL NYGP L
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYSVVLNNYGPAL  50



>ref|XP_010276626.1| PREDICTED: probable protein S-acyltransferase 14 [Nelumbo nucifera]
 ref|XP_010276634.1| PREDICTED: probable protein S-acyltransferase 14 [Nelumbo nucifera]
Length=316

 Score =   232 bits (592),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 165/198 (83%), Gaps = 9/198 (5%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G   ++ AL V+ LFH LLVMLLWSYFSVV TDPG VPPNWRP +DEERG+ DPLT  EF
Sbjct  53    GGLGSMTALAVLILFHGLLVMLLWSYFSVVLTDPGGVPPNWRPTIDEERGEGDPLTGIEF  112

Query  620   GS---------LPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVG  772
             G+         + PD A  R+R+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVG
Sbjct  113   GATGAGLQQSAVLPDPANPRVRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVG  172

Query  773   ALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafal  952
             ALNYKYFLLFL YTFLETTLVTLSLLP+F+AFF D +IPG+ G LATTFL FVLNLAFAL
Sbjct  173   ALNYKYFLLFLLYTFLETTLVTLSLLPHFVAFFSDGEIPGTPGTLATTFLTFVLNLAFAL  232

Query  953   svlGFLIMHISLVSRNTT  1006
             SV+GFLIMH+SLV+ NTT
Sbjct  233   SVMGFLIMHVSLVAANTT  250


 Score = 61.6 bits (148),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSG VMAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VV+TNYGP L
Sbjct  1    MHRSGVVMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVITNYGPAL  50



>gb|ACU19432.1| unknown [Glycine max]
Length=307

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+ +G  DTL++  V+ LFHCLLVMLLW YF+VVF DPG VPPNW+PA DEERG+ DPL 
Sbjct  49    ALFLGGLDTLISFVVLILFHCLLVMLLWCYFAVVFMDPGTVPPNWKPAADEERGEVDPLN  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
               E  +L  D+A  R R+C+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  109   GVELSNLQSDSANQRFRYCRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  168

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFL YTFLETTLVT+SLLP+F  +F D +IPG+ G LATTFL FVLNLAF+LSVLGF
Sbjct  169   YFLLFLVYTFLETTLVTISLLPHFKTYFSDGEIPGTPGTLATTFLTFVLNLAFSLSVLGF  228

Query  968   LIMHISLVSRNTT  1006
             L++H+SLV+ NTT
Sbjct  229   LVLHVSLVASNTT  241


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            MYRSGA MAWNVF+FCTALRGLGSIMIL+VLGVVGVTYY VVLTN+GP L
Sbjct  1    MYRSGAGMAWNVFRFCTALRGLGSIMILMVLGVVGVTYYAVVLTNFGPAL  50



>ref|XP_010692246.1| PREDICTED: probable protein S-acyltransferase 14 [Beta vulgaris 
subsp. vulgaris]
Length=307

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  DTL ++ V+  FH LL MLLWSYFSVVFTDPG VP NWRP++DEERG+ DPLTAS+F
Sbjct  53    GGLDTLTSIVVLIPFHGLLAMLLWSYFSVVFTDPGGVPSNWRPSVDEERGENDPLTASDF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
               +  D + +++R C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   SGVQSDPSHTKVRACRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLETT+VT+SLLP F+AFF D +IPGS   LATTFLAFVLNLAFALSV+GFLIMH
Sbjct  173   FLFYTFLETTVVTISLLPQFIAFFSDGEIPGSPSSLATTFLAFVLNLAFALSVMGFLIMH  232

Query  980   ISLVSRNTT  1006
             ISLV+ NTT
Sbjct  233   ISLVAANTT  241


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            MYRSG VMAWNVF+FCTALRGLGSIMILLVLGVVGVTYY VVLT+YGP L
Sbjct  1    MYRSGTVMAWNVFRFCTALRGLGSIMILLVLGVVGVTYYAVVLTSYGPAL  50



>ref|XP_009143136.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Brassica 
rapa]
Length=309

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 168/200 (84%), Gaps = 2/200 (1%)
 Frame = +2

Query  413   SSPAVAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEER--  586
             +S   A+ VG  ++L AL VI LFH LL MLLWSYFSVVFTDPG+VPPNWRPA DEE   
Sbjct  44    TSYGPALSVGGLESLAALVVILLFHFLLGMLLWSYFSVVFTDPGVVPPNWRPASDEEEQE  103

Query  587   GDTDPLTASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNC  766
             G+ DPL   EFG L P+ +  R RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNC
Sbjct  104   GECDPLNGLEFGGLQPEASNQRTRFCRKCNQHKPPRCHHCSVCGRCVLKMDHHCVWVVNC  163

Query  767   VGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlaf  946
             VGALNYKYFLLFLFYTFLETTLVTL L+P+F+AFF + +IPG+ G LATTFLAFVLNLAF
Sbjct  164   VGALNYKYFLLFLFYTFLETTLVTLLLMPHFIAFFSEEEIPGTPGTLATTFLAFVLNLAF  223

Query  947   alsvlGFLIMHISLVSRNTT  1006
             ALSV+GFLIMHISLVS NTT
Sbjct  224   ALSVMGFLIMHISLVSANTT  243


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG  MAWNVFKFCTALRGLGSIMIL+VLG+VGV+YY VV T+YGP L+
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILMVLGIVGVSYYAVVWTSYGPALS  51



>gb|KHN29455.1| Putative S-acyltransferase [Glycine soja]
Length=307

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+ +G  DTL++  V+ LFHCLLVMLLW YF+VVF DPG VPPNW+PA DEERG+ DPL 
Sbjct  49    ALFLGGLDTLISFVVLILFHCLLVMLLWCYFAVVFMDPGTVPPNWKPAADEERGEVDPLN  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
               E  +L  D A  R R+C+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  109   GVELSNLQSDPANQRFRYCRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  168

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFL YTFLETTLVT+SLLP+F  +F D +IPG+ G LATTFL FVLNLAF+LSVLGF
Sbjct  169   YFLLFLVYTFLETTLVTISLLPHFKTYFSDGEIPGTPGTLATTFLTFVLNLAFSLSVLGF  228

Query  968   LIMHISLVSRNTT  1006
             L++H+SLV+ NTT
Sbjct  229   LVLHVSLVASNTT  241


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            MYRSGA MAWNVF+FCTALRGLGSIMIL+VLGVVGVTYY VVLTN+GP L
Sbjct  1    MYRSGAGMAWNVFRFCTALRGLGSIMILMVLGVVGVTYYAVVLTNFGPAL  50



>ref|XP_006587892.1| PREDICTED: probable protein S-acyltransferase 14-like [Glycine 
max]
Length=307

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+ +G  DTL++  V+ LFHCLLVMLLW YF+VVF DPG VPPNW+PA DEERG+ DPL 
Sbjct  49    ALFLGGLDTLISFVVLILFHCLLVMLLWCYFAVVFMDPGTVPPNWKPAADEERGEVDPLN  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
               E  +L  D A  R R+C+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  109   GVELSNLQSDPANQRFRYCRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  168

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFL YTFLETTLVT+SLLP+F  +F D +IPG+ G LATTFL FVLNLAF+LSVLGF
Sbjct  169   YFLLFLVYTFLETTLVTISLLPHFKTYFSDGEIPGTPGTLATTFLTFVLNLAFSLSVLGF  228

Query  968   LIMHISLVSRNTT  1006
             L++H+SLV+ NTT
Sbjct  229   LVLHVSLVASNTT  241


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            MYRSGA MAWNVF+FCTALRGLGSIMIL+VLGVVGVTYY VVLTN+GP L
Sbjct  1    MYRSGAGMAWNVFRFCTALRGLGSIMILMVLGVVGVTYYAVVLTNFGPAL  50



>ref|XP_006602748.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Glycine 
max]
Length=307

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+ VG  DTL++  V+ LFHCLLVMLLW YF+VVFTDPG VPPNW+PA+DEERG+ DPL 
Sbjct  49    ALFVGGLDTLISFVVLILFHCLLVMLLWCYFAVVFTDPGTVPPNWKPAVDEERGEVDPLN  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
               E  +L  DT+  R R+C+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYK
Sbjct  109   GVELSNLQSDTSNQRFRYCRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGASNYK  168

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYT LETT+VT+SLLP+F  FF D +IPG+ G LATTFL FVLNLAF+LSVLGF
Sbjct  169   YFLLFLFYTLLETTIVTISLLPHFKTFFTDEEIPGTPGTLATTFLTFVLNLAFSLSVLGF  228

Query  968   LIMHISLVSRNTT  1006
             L++H+SLV+ NTT
Sbjct  229   LVLHMSLVASNTT  241


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            MYRSGA MAWNVF+FCTALRGLGSIMIL+VLGVVGVTYY VVLTN+GP L
Sbjct  1    MYRSGAGMAWNVFRFCTALRGLGSIMILMVLGVVGVTYYAVVLTNFGPAL  50



>ref|XP_006397719.1| hypothetical protein EUTSA_v10001560mg [Eutrema salsugineum]
 gb|ESQ39172.1| hypothetical protein EUTSA_v10001560mg [Eutrema salsugineum]
Length=308

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 166/194 (86%), Gaps = 1/194 (1%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEE-RGDTDPL  604
             A+  G  D+L AL +I LFH LL MLLWSYFSVVFTDPG+V PNWR A DEE RG++DPL
Sbjct  49    ALSDGGLDSLAALTIIILFHFLLAMLLWSYFSVVFTDPGVVSPNWRSASDEEQRGESDPL  108

Query  605   TASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNY  784
              + EFG L PD++  R RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNY
Sbjct  109   NSLEFGGLQPDSSNQRTRFCRKCNQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNY  168

Query  785   KYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlG  964
             KYFLLFL YTFLETTLVTL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+G
Sbjct  169   KYFLLFLLYTFLETTLVTLLLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMG  228

Query  965   FLIMHISLVSRNTT  1006
             FLIMHISLV+ NTT
Sbjct  229   FLIMHISLVAANTT  242


 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG  MAWNVF+FCT LRGLGSIMILLVLGVVGVTYY VV TNYGP L+
Sbjct  1    MHRSGTTMAWNVFQFCTVLRGLGSIMILLVLGVVGVTYYAVVWTNYGPALS  51



>gb|KHN40573.1| Putative S-acyltransferase [Glycine soja]
Length=371

 Score =   231 bits (590),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+ VG  DTL++  V+ LFHCLLVMLLW YF+VVFTDPG VPPNW+PA+DEERG+ DPL 
Sbjct  113   ALFVGGLDTLISFVVLILFHCLLVMLLWCYFAVVFTDPGTVPPNWKPAVDEERGEVDPLN  172

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
               E  +L  DT+  R R+C+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYK
Sbjct  173   GVELSNLQSDTSNQRFRYCRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGASNYK  232

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYT LETT+VT+SLLP+F  FF D +IPG+ G LATTFL FVLNLAF+LSVLGF
Sbjct  233   YFLLFLFYTLLETTIVTISLLPHFKTFFTDEEIPGTPGTLATTFLTFVLNLAFSLSVLGF  292

Query  968   LIMHISLVSRNTT  1006
             L++H+SLV+ NTT
Sbjct  293   LVLHMSLVASNTT  305


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  250  CTDLLIMYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            C+   I  +SGA MAWNVF+FCTALRGLGSIMIL+VLGVVGVTYY VVLTN+GP L
Sbjct  59   CSASGITAKSGAGMAWNVFRFCTALRGLGSIMILMVLGVVGVTYYAVVLTNFGPAL  114



>ref|XP_009138811.1| PREDICTED: probable protein S-acyltransferase 14 [Brassica rapa]
Length=300

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 165/193 (85%), Gaps = 5/193 (3%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G FD+  AL ++ LFH LL MLLWSYFSVVFTDPG VPPNWRP+ DEERG++DPL 
Sbjct  49    ALSQGGFDSFTALTILLLFHFLLAMLLWSYFSVVFTDPGSVPPNWRPSTDEERGESDPLN  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
             + EF     D +  R+RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  109   SLEF-----DNSNPRVRFCRKCNQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  163

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYTFLETTLVTL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GF
Sbjct  164   YFLLFLFYTFLETTLVTLVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGF  223

Query  968   LIMHISLVSRNTT  1006
             LIMHISLV+ NTT
Sbjct  224   LIMHISLVAGNTT  236


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG  MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L+
Sbjct  1    MHRSGTAMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPALS  51



>emb|CDY51805.1| BnaC04g53110D [Brassica napus]
Length=309

 Score =   229 bits (583),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 165/195 (85%), Gaps = 2/195 (1%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEER--GDTDP  601
             A+ VG  D+L AL VI LFH LL MLLWSYFSVVFTDPG+VPPNWRPA DEE   G+ DP
Sbjct  49    ALSVGGLDSLAALVVILLFHFLLGMLLWSYFSVVFTDPGVVPPNWRPASDEEEQEGECDP  108

Query  602   LTASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALN  781
             L + EFG L PD +  R RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA N
Sbjct  109   LNSLEFGGLQPDASNQRTRFCRKCNQHKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGARN  168

Query  782   YKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvl  961
             YKYFLLFLFYTFLETTLVTL L+P+F+AFF + +IPG+   LATTFLAFVLNLAFALSV+
Sbjct  169   YKYFLLFLFYTFLETTLVTLLLMPHFIAFFSEEEIPGTPSTLATTFLAFVLNLAFALSVM  228

Query  962   GFLIMHISLVSRNTT  1006
             GFLIMHISLV+ NTT
Sbjct  229   GFLIMHISLVAANTT  243


 Score = 60.1 bits (144),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG  MAWNVFKFCTALRGLGSIMILLVLG+VGVTYY VV TNYGP L+
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILLVLGIVGVTYYAVVWTNYGPALS  51



>ref|XP_010518152.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
 ref|XP_010518153.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=309

 Score =   228 bits (581),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 167/195 (86%), Gaps = 2/195 (1%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEER--GDTDP  601
             A+  G  D+L AL +I LFH LL MLLWSYFSVVFTDPG+VPPNWR A DEE+  G++DP
Sbjct  49    ALSAGGLDSLAALAIILLFHFLLAMLLWSYFSVVFTDPGVVPPNWRLASDEEQRGGESDP  108

Query  602   LTASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALN  781
             L + EFG L PD++  R RFC+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWVV+CVGALN
Sbjct  109   LNSLEFGGLHPDSSNQRTRFCRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVVSCVGALN  168

Query  782   YKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvl  961
             YKYFLLFL YTFLETTLVTL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+
Sbjct  169   YKYFLLFLLYTFLETTLVTLLLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVM  228

Query  962   GFLIMHISLVSRNTT  1006
             GFLIMHISLVS NTT
Sbjct  229   GFLIMHISLVSSNTT  243


 Score = 60.1 bits (144),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG  MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VV TNYGP L+
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVWTNYGPALS  51



>emb|CDX74736.1| BnaA05g04820D [Brassica napus]
Length=309

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 167/200 (84%), Gaps = 2/200 (1%)
 Frame = +2

Query  413   SSPAVAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEER--  586
             +S   A+ VG  ++L AL VI LFH LL MLLWSYFSVVFTDPG+VPPNWRPA DEE   
Sbjct  44    TSYGPALSVGGLESLAALVVILLFHFLLGMLLWSYFSVVFTDPGVVPPNWRPASDEEEQE  103

Query  587   GDTDPLTASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNC  766
             G+ DPL   EFG L P+ +  R RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNC
Sbjct  104   GECDPLNGLEFGGLQPEASNQRTRFCRKCNQHKPPRCHHCSVCGRCVLKMDHHCVWVVNC  163

Query  767   VGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlaf  946
             VGALNYKYFLLFLFYTFLETTLVTL L+P+F+AFF + +IPG+   LATTFLAFVLNLAF
Sbjct  164   VGALNYKYFLLFLFYTFLETTLVTLLLMPHFIAFFSEEEIPGTPSTLATTFLAFVLNLAF  223

Query  947   alsvlGFLIMHISLVSRNTT  1006
             ALSV+GFLIMHISLV+ NTT
Sbjct  224   ALSVMGFLIMHISLVAANTT  243


 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG  MAWNVFKFCTALRGLGSIMIL+VLG+VGV+YY VV T+YGP L+
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILMVLGIVGVSYYAVVWTSYGPALS  51



>gb|KHG30156.1| hypothetical protein F383_14468 [Gossypium arboreum]
Length=314

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 161/196 (82%), Gaps = 7/196 (4%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G F++L A  ++  FHC LVMLLWSYFSVV TDPG VPPNWRPALDEERG+ DPL  SEF
Sbjct  53    GGFNSLTAAVILFFFHCFLVMLLWSYFSVVLTDPGSVPPNWRPALDEERGEADPLNGSEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSV-------CGRCVLKMDHHCVWVVNCVGAL  778
                 PD    RIR+C+KCNQLKPPRCHHCS         GRCVLKMDHHCVWVVNCVGA 
Sbjct  113   NGSQPDPLNQRIRYCRKCNQLKPPRCHHCSFRINIIVSGGRCVLKMDHHCVWVVNCVGAQ  172

Query  779   NYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsv  958
             NYKYFLLFLFYTFLET+LVT++LLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV
Sbjct  173   NYKYFLLFLFYTFLETSLVTMALLPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSV  232

Query  959   lGFLIMHISLVSRNTT  1006
             LGFLIMHISLVS NTT
Sbjct  233   LGFLIMHISLVSANTT  248


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALR LGSIMILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MHRSGATMAWNVFKFCTALRALGSIMILLVLGVVGVTYYSVVLTNYGPAL  50



>emb|CDX89079.1| BnaA04g01070D [Brassica napus]
Length=300

 Score =   227 bits (579),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 5/193 (3%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G FD+L AL ++ LFH LL MLLWSYFSVVFTDPG VPPNWRP+ DEERG++DPL 
Sbjct  49    ALSQGGFDSLSALTILLLFHFLLAMLLWSYFSVVFTDPGSVPPNWRPSTDEERGESDPLN  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
             + EF     D +  R+RFC+KCNQ KP RCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  109   SLEF-----DNSNPRVRFCRKCNQPKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  163

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFL YTFLETTLVTL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GF
Sbjct  164   YFLLFLLYTFLETTLVTLVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGF  223

Query  968   LIMHISLVSRNTT  1006
             LIMHISLV+ NTT
Sbjct  224   LIMHISLVAGNTT  236


 Score = 60.5 bits (145),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG  MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L+
Sbjct  1    MHRSGTAMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPALS  51



>emb|CDX71345.1| BnaC07g06240D [Brassica napus]
Length=300

 Score =   226 bits (577),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 164/193 (85%), Gaps = 5/193 (3%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G FD+  AL ++ LFH LL MLLWSYFSVV TDPG+VPPNWRPA DEERG++DPL 
Sbjct  49    ALSQGGFDSFTALTILLLFHFLLAMLLWSYFSVVLTDPGVVPPNWRPASDEERGESDPLN  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
             + EF     D +  R+RFC+KCNQ KP RCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  109   SLEF-----DNSNLRVRFCRKCNQPKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  163

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYTFLETTLVTL L+P+F+AFF D +IPG+ G LATTFL+FVLNLAFALSV+GF
Sbjct  164   YFLLFLFYTFLETTLVTLVLMPHFIAFFSDEEIPGTPGTLATTFLSFVLNLAFALSVMGF  223

Query  968   LIMHISLVSRNTT  1006
             LIMHISLV+ NTT
Sbjct  224   LIMHISLVAGNTT  236


 Score = 60.5 bits (145),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG  MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L+
Sbjct  1    MHRSGTAMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPALS  51



>ref|XP_006602749.1| PREDICTED: probable protein S-acyltransferase 14 isoform X3 [Glycine 
max]
Length=287

 Score =   226 bits (576),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 161/195 (83%), Gaps = 2/195 (1%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+ VG  DTL++  V+ LFHCLLVMLLW YF+VVFTDPG VPPNW+PA+DEERG+ DPL 
Sbjct  49    ALFVGGLDTLISFVVLILFHCLLVMLLWCYFAVVFTDPGTVPPNWKPAVDEERGEVDPLN  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
               E  +L  DT+  R R+C+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYK
Sbjct  109   GVELSNLQSDTSNQRFRYCRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGASNYK  168

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlatt--flafvlnlafalsvl  961
             YFLLFLFYT LETT+VT+SLLP+F  FF D +IPG+ G LATT    A VLNLAF+LSVL
Sbjct  169   YFLLFLFYTLLETTIVTISLLPHFKTFFTDEEIPGTPGTLATTFLTFAAVLNLAFSLSVL  228

Query  962   GFLIMHISLVSRNTT  1006
             GFL++H+SLV+ NTT
Sbjct  229   GFLVLHMSLVASNTT  243


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            MYRSGA MAWNVF+FCTALRGLGSIMIL+VLGVVGVTYY VVLTN+GP L
Sbjct  1    MYRSGAGMAWNVFRFCTALRGLGSIMILMVLGVVGVTYYAVVLTNFGPAL  50



>ref|XP_003552340.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Glycine 
max]
Length=309

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 161/195 (83%), Gaps = 2/195 (1%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+ VG  DTL++  V+ LFHCLLVMLLW YF+VVFTDPG VPPNW+PA+DEERG+ DPL 
Sbjct  49    ALFVGGLDTLISFVVLILFHCLLVMLLWCYFAVVFTDPGTVPPNWKPAVDEERGEVDPLN  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
               E  +L  DT+  R R+C+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYK
Sbjct  109   GVELSNLQSDTSNQRFRYCRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGASNYK  168

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlatt--flafvlnlafalsvl  961
             YFLLFLFYT LETT+VT+SLLP+F  FF D +IPG+ G LATT    A VLNLAF+LSVL
Sbjct  169   YFLLFLFYTLLETTIVTISLLPHFKTFFTDEEIPGTPGTLATTFLTFAAVLNLAFSLSVL  228

Query  962   GFLIMHISLVSRNTT  1006
             GFL++H+SLV+ NTT
Sbjct  229   GFLVLHMSLVASNTT  243


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            MYRSGA MAWNVF+FCTALRGLGSIMIL+VLGVVGVTYY VVLTN+GP L
Sbjct  1    MYRSGAGMAWNVFRFCTALRGLGSIMILMVLGVVGVTYYAVVLTNFGPAL  50



>ref|XP_010506482.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=309

 Score =   224 bits (572),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 166/195 (85%), Gaps = 2/195 (1%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEER--GDTDP  601
             A+  G  D+L AL +I LFH LL MLLWSYFSVVFTDPG+VPPNWR A DEE+  G++D 
Sbjct  49    ALSAGGLDSLAALAIILLFHFLLAMLLWSYFSVVFTDPGVVPPNWRLASDEEQRGGESDL  108

Query  602   LTASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALN  781
             L + EFG L PD++  R RFC+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWV+NCVGALN
Sbjct  109   LNSLEFGGLHPDSSNQRTRFCRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVLNCVGALN  168

Query  782   YKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvl  961
             YKYFLLFL YTFLETTLVTL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+
Sbjct  169   YKYFLLFLLYTFLETTLVTLLLMPHFVAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVM  228

Query  962   GFLIMHISLVSRNTT  1006
             GFLIMHISLVS NTT
Sbjct  229   GFLIMHISLVSGNTT  243


 Score = 60.1 bits (144),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG  MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VV TNYGP L+
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVWTNYGPALS  51



>ref|XP_010053896.1| PREDICTED: probable protein S-acyltransferase 14 [Eucalyptus 
grandis]
 gb|KCW78271.1| hypothetical protein EUGRSUZ_D02456 [Eucalyptus grandis]
Length=307

 Score =   224 bits (570),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 167/202 (83%), Gaps = 3/202 (1%)
 Frame = +2

Query  401   ITGRSSPAVAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDE  580
             +T      +  GVG    L+AL V+ LFH LLVMLLWSYFSVVFTDPG VPPNWRP++DE
Sbjct  43    VTSYGPALLGGGVGA---LIALAVLVLFHGLLVMLLWSYFSVVFTDPGSVPPNWRPSIDE  99

Query  581   ERGDTDPLTASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVV  760
             ERG++DPLT  +   L  D +  RIR+C+KC+  KPPRCHHCSVCGRCVLKMDHHCVWVV
Sbjct  100   ERGESDPLTLPDSSGLQSDPSNPRIRYCRKCDHFKPPRCHHCSVCGRCVLKMDHHCVWVV  159

Query  761   NCVGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnl  940
             NCVGALNYKYFLLFLFYTFLET++VTL+LLP+F+AFF D DIP + G LATTFL+FVLNL
Sbjct  160   NCVGALNYKYFLLFLFYTFLETSVVTLALLPHFIAFFTDGDIPDTPGTLATTFLSFVLNL  219

Query  941   afalsvlGFLIMHISLVSRNTT  1006
             AF+LSV GFLI+H+SLV+ NTT
Sbjct  220   AFSLSVFGFLILHMSLVAANTT  241


 Score = 59.3 bits (142),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGSIMIL+VLGVVGVTYY VV+T+YGP L
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSIMILVVLGVVGVTYYSVVVTSYGPAL  50



>ref|XP_003579517.1| PREDICTED: probable protein S-acyltransferase 14 [Brachypodium 
distachyon]
Length=315

 Score =   224 bits (572),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 162/197 (82%), Gaps = 7/197 (4%)
 Frame = +2

Query  437   VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASE  616
             VG   T+ AL V+ LFH LL MLLW YFSVVFTDPG VPPNW    DEERG+T PL++SE
Sbjct  53    VGGTSTIPALAVLLLFHFLLGMLLWCYFSVVFTDPGSVPPNWNLDFDEERGETAPLSSSE  112

Query  617   FGS-------LPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA  775
             F S       +  DT   R+R+C+KCNQLKPPRCHHCSVCGRC+LKMDHHCVWVVNCVGA
Sbjct  113   FSSQMNSQQSMVSDTGNPRMRYCRKCNQLKPPRCHHCSVCGRCILKMDHHCVWVVNCVGA  172

Query  776   LNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafals  955
             LNYKYFLLFLFYTFLETTLVTLSLLP F+AFF D+DIPGS   LATTFL FVLNLAF+LS
Sbjct  173   LNYKYFLLFLFYTFLETTLVTLSLLPQFIAFFSDIDIPGSPAALATTFLTFVLNLAFSLS  232

Query  956   vlGFLIMHISLVSRNTT  1006
             +LGFLIMH+SLVS NTT
Sbjct  233   ILGFLIMHVSLVSANTT  249


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  MYRS-GAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RS G  MAWNVF+FCTALRGLGSIMILLVL +VGVTYY VVL NYGP+L
Sbjct  1    MHRSAGVAMAWNVFRFCTALRGLGSIMILLVLAIVGVTYYAVVLCNYGPVL  51



>ref|XP_002446206.1| hypothetical protein SORBIDRAFT_06g004040 [Sorghum bicolor]
 gb|EES10534.1| hypothetical protein SORBIDRAFT_06g004040 [Sorghum bicolor]
Length=316

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 162/204 (79%), Gaps = 10/204 (5%)
 Frame = +2

Query  419   PAVAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTD  598
             PA+  G G   TL A  V+ LFH LL MLLWSYFSVVFTDPG VPPNW    D ERG+T 
Sbjct  49    PALLTGGGT--TLAAFAVLLLFHFLLAMLLWSYFSVVFTDPGSVPPNWNLDFDVERGETA  106

Query  599   PLTASEFGSLPP--------DTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVW  754
             PL  SEF S           +TA  R+R+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVW
Sbjct  107   PLATSEFSSQMNSQQSVALGNTANPRVRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVW  166

Query  755   VVNCVGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvl  934
             VVNCVGALNYKYFLLFLFYTFLETTLVTLSLLP+F+AFF DV+IPGS   LATTFL FVL
Sbjct  167   VVNCVGALNYKYFLLFLFYTFLETTLVTLSLLPHFIAFFSDVEIPGSPAALATTFLTFVL  226

Query  935   nlafalsvlGFLIMHISLVSRNTT  1006
             NLAF+LSV GF+IMHISLVS NTT
Sbjct  227   NLAFSLSVFGFMIMHISLVSANTT  250


 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  MYRS-GAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            MYRS G  MAWNVF+FCTALRGLGSIMILLVL +VGVTYY VVL NYGP L
Sbjct  1    MYRSAGVAMAWNVFRFCTALRGLGSIMILLVLAIVGVTYYAVVLCNYGPAL  51



>ref|XP_009761491.1| PREDICTED: probable protein S-acyltransferase 14 [Nicotiana sylvestris]
Length=182

 Score =   217 bits (553),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  419  PAVAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTD  598
            P++A   G+ D  +A  V+ +FHCLLVMLLW YFSVVFTDPG VPPNWRP LDEERG+ D
Sbjct  48   PSLASSGGLLDAFIAFLVLVIFHCLLVMLLWCYFSVVFTDPGSVPPNWRPELDEERGEAD  107

Query  599  PLTASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  778
            PLTASEFG+ P D+   RIRFC+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL
Sbjct  108  PLTASEFGASPADSGNPRIRFCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  167

Query  779  NYKY  790
            NYKY
Sbjct  168  NYKY  171


 Score = 63.5 bits (153),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            MYRSGAVMAWNVF+FCTALRGLGSIMILLV+GVVGVTYY +VLTNYGP LA
Sbjct  1    MYRSGAVMAWNVFRFCTALRGLGSIMILLVMGVVGVTYYAIVLTNYGPSLA  51



>ref|XP_004952412.1| PREDICTED: probable S-acyltransferase At3g60800-like isoform 
X1 [Setaria italica]
 ref|XP_004952413.1| PREDICTED: probable S-acyltransferase At3g60800-like isoform 
X2 [Setaria italica]
Length=317

 Score =   220 bits (561),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 164/204 (80%), Gaps = 8/204 (4%)
 Frame = +2

Query  419   PAVAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTD  598
             P +    G  D LVAL V+ LFH LL MLLWSYFSVVFTDPG VPPNWRP +DEE G+T 
Sbjct  48    PVLLAATGALDALVALVVLVLFHFLLAMLLWSYFSVVFTDPGGVPPNWRPDVDEESGETA  107

Query  599   PLTASEFGSLP--------PDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVW  754
             PL+ +EF  L          DT   RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVW
Sbjct  108   PLSTAEFSDLMNSQQSMALSDTGSPRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVW  167

Query  755   VVNCVGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvl  934
             VVNCVGALNYK+FLLFL YTFLET LVTLSLLP+F+AFF DV+IPG+ G LATTFL FVL
Sbjct  168   VVNCVGALNYKFFLLFLLYTFLETALVTLSLLPHFIAFFSDVEIPGTPGALATTFLTFVL  227

Query  935   nlafalsvlGFLIMHISLVSRNTT  1006
             NLAF LSVLGF+IMH+SLVS NTT
Sbjct  228   NLAFTLSVLGFMIMHVSLVSGNTT  251


 Score = 60.1 bits (144),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSG  MAWNVFKFCTALRGLGS+MILLVLG+VGVTYY +VL NYGP+L
Sbjct  1    MHRSGTAMAWNVFKFCTALRGLGSVMILLVLGIVGVTYYALVLCNYGPVL  50



>ref|XP_004492612.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cicer arietinum]
Length=307

 Score =   222 bits (566),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G   +L +L V+ LFHCLLVM+LWSYF+VVFTDPGIVPPNW+P++DEERG+ DPL 
Sbjct  49    ALYFGGIGSLTSLTVLILFHCLLVMVLWSYFAVVFTDPGIVPPNWKPSVDEERGEADPLN  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
               E  +L  D +   +R+C+KC+Q KP RCHHCSVCGRCVLKMDHHCVWVVNC+GALNYK
Sbjct  109   GLELSNLQSDASNKNVRYCRKCSQPKPARCHHCSVCGRCVLKMDHHCVWVVNCIGALNYK  168

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYTF ETTLVTLSLLPNF  FF D +IPG+ G LATTFLAFVLN+AF LSVL F
Sbjct  169   YFLLFLFYTFFETTLVTLSLLPNFKTFFDDGEIPGTPGTLATTFLAFVLNVAFVLSVLRF  228

Query  968   LIMHISLVSRNTT  1006
             LI+H+SLV+ NTT
Sbjct  229   LIIHVSLVAANTT  241


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSG VMAWNVFKFCT+LRGLG +MI+  LG+VGVTYY VVLTNYGP L
Sbjct  1    MHRSGVVMAWNVFKFCTSLRGLGYVMIIFFLGIVGVTYYAVVLTNYGPAL  50



>gb|KDO85816.1| hypothetical protein CISIN_1g021813mg [Citrus sinensis]
Length=245

 Score =   218 bits (555),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = +2

Query  440  GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
            G  D++ A+ V+ LFHCLLVMLLWSYFSVV TD G VPPNWRPALDEERG+ DPL ASEF
Sbjct  53   GGLDSVTAVAVLILFHCLLVMLLWSYFSVVLTDAGSVPPNWRPALDEERGEADPLNASEF  112

Query  620  GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
                 D    RIR+C+KCNQLKPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113  SGAQSDPLNPRIRYCRKCNQLKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLL  172

Query  800  flfytflettlvtlSLLPNFLAFFGDVDIPGSAG  901
            FL YTFLET+LVTLSLLP+F++FF + +IPG+ G
Sbjct  173  FLLYTFLETSLVTLSLLPHFISFFSEGEIPGTPG  206


 Score = 61.6 bits (148),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPAL  50



>ref|XP_002882009.1| hypothetical protein ARALYDRAFT_903981 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58268.1| hypothetical protein ARALYDRAFT_903981 [Arabidopsis lyrata subsp. 
lyrata]
Length=308

 Score =   219 bits (557),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEE-RGDTDPLTASE  616
             G   +L A  +I LFH LL MLLWSYFSVVFTDPG+VPPNWR A DEE RG++D L + E
Sbjct  53    GGLGSLAAFAIIILFHFLLAMLLWSYFSVVFTDPGVVPPNWRLASDEEQRGESDALNSLE  112

Query  617   FGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfl  796
             F  L PD++  R RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVV+CVGALNYKYFL
Sbjct  113   FCVLQPDSSNQRTRFCRKCNQPKPPRCHHCSVCGRCVLKMDHHCVWVVSCVGALNYKYFL  172

Query  797   lflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIM  976
             LFL YTFLETTLVTL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIM
Sbjct  173   LFLLYTFLETTLVTLLLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIM  232

Query  977   HISLVSRNTT  1006
             HISLV+ NTT
Sbjct  233   HISLVAANTT  242


 Score = 60.5 bits (145),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG  MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VV TNYGP L+
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVWTNYGPTLS  51



>ref|XP_006402542.1| hypothetical protein EUTSA_v10006120mg [Eutrema salsugineum]
 gb|ESQ43995.1| hypothetical protein EUTSA_v10006120mg [Eutrema salsugineum]
Length=305

 Score =   219 bits (558),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G  D+L A  ++ LFH LL MLLWSYFSVVFTDPG+VPPNWRPA+DEERG++DPL 
Sbjct  49    ALSQGGLDSLAAFSILILFHLLLGMLLWSYFSVVFTDPGVVPPNWRPAIDEERGESDPLN  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
             + EF  L PD +  RIRFC+KCNQ KP RCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  109   SLEFVGLQPDLSNPRIRFCRKCNQPKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  168

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYTFLETTLVTL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GF
Sbjct  169   YFLLFLFYTFLETTLVTLVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGF  228

Query  968   LIMHISLVSRNTT  1006
             LIMHISLV+ NTT
Sbjct  229   LIMHISLVAGNTT  241


 Score = 60.5 bits (145),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG  MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L+
Sbjct  1    MHRSGTAMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPALS  51



>gb|ABK24332.1| unknown [Picea sitchensis]
Length=316

 Score =   218 bits (554),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 163/202 (81%), Gaps = 9/202 (4%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G  +   A F++ LFH LL MLLWSYF+VV TDPG VPPNWR   DEERG+T PLT
Sbjct  49    ALQSGGLEAAGAFFILILFHALLGMLLWSYFAVVLTDPGGVPPNWRANTDEERGETLPLT  108

Query  608   ASEFGS----LPP-----DTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVV  760
             +SEFG     L P     D + SRIR+C+KCNQ+KPPRCHHCSVCGRC+LKMDHHCVWVV
Sbjct  109   SSEFGGPGLGLQPQMNLKDPSYSRIRYCRKCNQMKPPRCHHCSVCGRCILKMDHHCVWVV  168

Query  761   NCVGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnl  940
             NCVGA NYK+FLLFLFYTF ETTLVTL+LLP+F+AFF + +I G+ G LATTFL FVLNL
Sbjct  169   NCVGARNYKFFLLFLFYTFFETTLVTLALLPHFIAFFSEEEISGTPGSLATTFLGFVLNL  228

Query  941   afalsvlGFLIMHISLVSRNTT  1006
             AFALSVLGFLIMHISLV+ NTT
Sbjct  229   AFALSVLGFLIMHISLVAGNTT  250


 Score = 58.9 bits (141),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M RSG VMAWNVFKFCTALRGLGS+MILLVLG+VGVTYY +V+TNYGP L
Sbjct  1    MQRSGIVMAWNVFKFCTALRGLGSVMILLVLGIVGVTYYAIVITNYGPAL  50



>gb|KFK35280.1| hypothetical protein AALP_AA5G264300 [Arabis alpina]
Length=305

 Score =   216 bits (551),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G  D+LVAL ++ LFH LL MLLWSYFSVVFTDPG+VP NWRP+ DEERG++DPLT
Sbjct  49    ALSQGGLDSLVALTILILFHLLLGMLLWSYFSVVFTDPGVVPTNWRPSSDEERGESDPLT  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
             + EF  L  D++  R+RFC+KCNQ KP RCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  109   SLEFVGLQTDSSNPRVRFCRKCNQPKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  168

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYTFL TTLVTL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GF
Sbjct  169   YFLLFLFYTFLATTLVTLVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGF  228

Query  968   LIMHISLVSRNTT  1006
             LIMHISLV+ NTT
Sbjct  229   LIMHISLVAGNTT  241


 Score = 59.7 bits (143),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG  MAWNVFKFCTAL+GLGSIMILLVLGVVGVTYY VVLTNYGP L+
Sbjct  1    MHRSGTTMAWNVFKFCTALKGLGSIMILLVLGVVGVTYYAVVLTNYGPALS  51



>ref|XP_009116762.1| PREDICTED: probable protein S-acyltransferase 14 [Brassica rapa]
Length=305

 Score =   215 bits (547),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G  D+  AL ++ LFH LL MLLWSYFSVVFTDPG VP NWRPA DEERG++DPLT
Sbjct  49    ALSQGGVDSFAALTILVLFHLLLAMLLWSYFSVVFTDPGAVPANWRPAADEERGESDPLT  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
             + EF  L  D++  R+RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK
Sbjct  109   SLEFVGLQTDSSNPRVRFCRKCNQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  168

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYTFLETTLVTL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GF
Sbjct  169   YFLLFLFYTFLETTLVTLVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGF  228

Query  968   LIMHISLVSRNTT  1006
             LIMH+SLV+ NTT
Sbjct  229   LIMHMSLVAGNTT  241


 Score = 60.5 bits (145),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG  MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L+
Sbjct  1    MHRSGTAMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPALS  51



>ref|XP_009143135.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Brassica 
rapa]
Length=337

 Score =   217 bits (552),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 152/228 (67%), Positives = 168/228 (74%), Gaps = 30/228 (13%)
 Frame = +2

Query  413   SSPAVAVGVGVFDTLVALFVIALFHCL----------------------------LVMLL  508
             +S   A+ VG  ++L AL VI LFH L                            L MLL
Sbjct  44    TSYGPALSVGGLESLAALVVILLFHFLVNPFHRFLESFVLLLKKLIIKMCVCVVKLGMLL  103

Query  509   WSYFSVVFTDPGIVPPNWRPALDEER--GDTDPLTASEFGSLPPDTAQSRIRFCKKCNQL  682
             WSYFSVVFTDPG+VPPNWRPA DEE   G+ DPL   EFG L P+ +  R RFC+KCNQ 
Sbjct  104   WSYFSVVFTDPGVVPPNWRPASDEEEQEGECDPLNGLEFGGLQPEASNQRTRFCRKCNQH  163

Query  683   KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLPNFL  862
             KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL L+P+F+
Sbjct  164   KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLLLMPHFI  223

Query  863   AFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             AFF + +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLVS NTT
Sbjct  224   AFFSEEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVSANTT  271


 Score = 58.2 bits (139),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG  MAWNVFKFCTALRGLGSIMIL+VLG+VGV+YY VV T+YGP L+
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILMVLGIVGVSYYAVVWTSYGPALS  51



>gb|EMT07089.1| Putative S-acyltransferase [Aegilops tauschii]
Length=308

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 156/183 (85%), Gaps = 8/183 (4%)
 Frame = +2

Query  482   FHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGS-LPP-------D  637
             FH LL MLLWSYFSVVFTDPG VPPNW    DEERG+T PL++S+F S + P       D
Sbjct  60    FHFLLAMLLWSYFSVVFTDPGSVPPNWNLDFDEERGETAPLSSSDFNSQMNPQQSMATGD  119

Query  638   TAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytf  817
             T   R+R+C+KCNQLKPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTF
Sbjct  120   TGNPRMRYCRKCNQLKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTF  179

Query  818   lettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSR  997
             LETTLVTLSLLP+F+AFF DV+IPGS   LATTFL FVLNLAF+LSVLGF+IMHISLVS 
Sbjct  180   LETTLVTLSLLPHFIAFFSDVEIPGSPSALATTFLTFVLNLAFSLSVLGFMIMHISLVSG  239

Query  998   NTT  1006
             NTT
Sbjct  240   NTT  242



>ref|XP_009362134.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Pyrus 
x bretschneideri]
Length=301

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 154/189 (81%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  + ++A  ++ LFH LLVMLLWSYF+VV TDPG VPPNWRPA+DEE GD  PL  S+ 
Sbjct  46    GGVNFVIAFPLLILFHFLLVMLLWSYFNVVLTDPGRVPPNWRPAIDEETGDEAPLVGSDQ  105

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
              ++  D A  +IRFC+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLL
Sbjct  106   STMVSDPANQKIRFCRKCNHYKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLL  165

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLETTLVTLSL   F+AFF + +IPG+ G +A +F+ FVLN AFALSV GF+IMH
Sbjct  166   FLFYTFLETTLVTLSLFKYFMAFFTEEEIPGTLGTVAASFITFVLNFAFALSVFGFMIMH  225

Query  980   ISLVSRNTT  1006
             +SLV+ NTT
Sbjct  226   LSLVASNTT  234



>ref|NP_001169109.1| palmitoyltransferase ZDHHC20 [Zea mays]
 gb|ACN31678.1| unknown [Zea mays]
 tpg|DAA38384.1| TPA: palmitoyltransferase ZDHHC20 [Zea mays]
Length=312

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 163/204 (80%), Gaps = 10/204 (5%)
 Frame = +2

Query  419   PAVAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTD  598
             PA+  G G   TL AL V+ LFH LL MLLWSYFSVV TDPG VPPNW    D ERG+T 
Sbjct  49    PALLTGGGT--TLAALAVLLLFHFLLAMLLWSYFSVVLTDPGSVPPNWNLDFDAERGETA  106

Query  599   PLTASEFGSLPP--------DTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVW  754
             PLT+SEF S           +TA  R R+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVW
Sbjct  107   PLTSSEFSSQMNSQQSVALGNTANPRARYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVW  166

Query  755   VVNCVGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvl  934
             VVNCVGALNYKYFLLFLFYTFLETTLVTLSLLP+F+AFF D++IPGS   LATTFL FVL
Sbjct  167   VVNCVGALNYKYFLLFLFYTFLETTLVTLSLLPHFIAFFSDIEIPGSPAALATTFLTFVL  226

Query  935   nlafalsvlGFLIMHISLVSRNTT  1006
             NLAF+LSV GF+IMHISLVS NTT
Sbjct  227   NLAFSLSVFGFMIMHISLVSANTT  250


 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  MYRS-GAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            MYRS G  MAWNVF+FCTALRGLGSIMILLVL +VGVTYY VVL NYGP L
Sbjct  1    MYRSAGVAMAWNVFRFCTALRGLGSIMILLVLAIVGVTYYAVVLCNYGPAL  51



>gb|KCW78272.1| hypothetical protein EUGRSUZ_D02456 [Eucalyptus grandis]
Length=283

 Score =   210 bits (534),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 166/229 (72%), Gaps = 30/229 (13%)
 Frame = +2

Query  401   ITGRSSPAVAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDE  580
             +T      +  GVG    L+AL V+ LFH LLVMLLWSYFSVVFTDPG VPPNWRP++DE
Sbjct  43    VTSYGPALLGGGVG---ALIALAVLVLFHGLLVMLLWSYFSVVFTDPGSVPPNWRPSIDE  99

Query  581   ERGDTDPLTASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVV  760
             ERG++DPLT  +   L  D +  RIR+C+KC+  KPPRCHHCSVCGRCVLKMDHHCVWVV
Sbjct  100   ERGESDPLTLPDSSGLQSDPSNPRIRYCRKCDHFKPPRCHHCSVCGRCVLKMDHHCVWVV  159

Query  761   NCVGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattfl------  922
             NCVGALNYKYFLLFLFYTFLET++VTL+LLP+F+AFF D DIP + G LATTFL      
Sbjct  160   NCVGALNYKYFLLFLFYTFLETSVVTLALLPHFIAFFTDGDIPDTPGTLATTFLSFGKVN  219

Query  923   ---------------------afvlnlafalsvlGFLIMHISLVSRNTT  1006
                                  + VLNLAF+LSV GFLI+H+SLV+ NTT
Sbjct  220   TTVCDLHLHLVFLELIMFFCWSLVLNLAFSLSVFGFLILHMSLVAANTT  268


 Score = 59.3 bits (142),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGSIMIL+VLGVVGVTYY VV+T+YGP L
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSIMILVVLGVVGVTYYSVVVTSYGPAL  50



>dbj|BAJ93966.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89372.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=316

 Score =   214 bits (544),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 156/183 (85%), Gaps = 8/183 (4%)
 Frame = +2

Query  482   FHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGS-LPP-------D  637
             FH LL MLLWSYFSVVFTDPG VPPNW    DEERG+T PL++S+F S + P       D
Sbjct  68    FHFLLAMLLWSYFSVVFTDPGSVPPNWNLDFDEERGETAPLSSSDFNSQMNPQQSMALGD  127

Query  638   TAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytf  817
             T   R+R+C+KCNQLKPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTF
Sbjct  128   TGNPRMRYCRKCNQLKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTF  187

Query  818   lettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSR  997
             LETTLVTLSLLP+F+AFF DV+IPG+   LATTFL FVLNLAF+LSVLGF+IMHISLVS 
Sbjct  188   LETTLVTLSLLPHFIAFFSDVEIPGTPSALATTFLTFVLNLAFSLSVLGFMIMHISLVSG  247

Query  998   NTT  1006
             NTT
Sbjct  248   NTT  250


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  MYRS-GAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RS G  MAWNVF+FCTALRGLGSIMILLVL +VGVTYY VVL NYGP L
Sbjct  1    MHRSAGVAMAWNVFRFCTALRGLGSIMILLVLAIVGVTYYAVVLCNYGPAL  51



>ref|XP_008345376.1| PREDICTED: probable protein S-acyltransferase 14 [Malus domestica]
Length=334

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 154/189 (81%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  + ++A  ++ LFH LLVMLLWSYF+VV TDPG VPPNWRPA+DEE GD  PL  S+ 
Sbjct  79    GGVNFVIAFPLLILFHFLLVMLLWSYFNVVLTDPGRVPPNWRPAIDEETGDEAPLVGSDQ  138

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
              ++  D A  +IRFC+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLL
Sbjct  139   STMVSDPANQKIRFCRKCNHYKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLL  198

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLETTLVTLSL   F+AFF + +IPG+ G +A +F+ FVLN AFALSV GF+IMH
Sbjct  199   FLFYTFLETTLVTLSLFKYFMAFFTEEEIPGTLGTVAASFITFVLNFAFALSVFGFMIMH  258

Query  980   ISLVSRNTT  1006
             +SLV+ NTT
Sbjct  259   LSLVASNTT  267



>ref|NP_001148846.1| palmitoyltransferase ZDHHC20 [Zea mays]
 gb|ACF83769.1| unknown [Zea mays]
 gb|ACG33116.1| palmitoyltransferase ZDHHC20 [Zea mays]
Length=316

 Score =   212 bits (539),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 162/205 (79%), Gaps = 12/205 (6%)
 Frame = +2

Query  419   PAVAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTD  598
             PA+  G G   TL AL V+  FH LL MLLWSYFSVVFTDPG VPPNW    D E G+T 
Sbjct  49    PALFTGGGT--TLAALAVLLSFHFLLAMLLWSYFSVVFTDPGSVPPNWNLDFDVEMGETA  106

Query  599   PLTASEFGSLPPDTAQS---------RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCV  751
             PL +SE  S   ++ QS         R+R+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCV
Sbjct  107   PLASSELCS-QMNSQQSVALGNMTNPRVRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCV  165

Query  752   WVVNCVGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafv  931
             WVVNCVGALNYKYFLLFLFYTFLETTLVTLSLLP+F+AFF D +IPGS   LATTFL FV
Sbjct  166   WVVNCVGALNYKYFLLFLFYTFLETTLVTLSLLPHFIAFFSDAEIPGSPAALATTFLTFV  225

Query  932   lnlafalsvlGFLIMHISLVSRNTT  1006
             LNLAF+LSVLGF+IMHISLVS NTT
Sbjct  226   LNLAFSLSVLGFMIMHISLVSANTT  250


 Score = 55.1 bits (131),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  MYRS-GAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            MYRS G  MAWNVF+FCTALRGLGSIMILLVL +VGVTYY VVL NYGP L
Sbjct  1    MYRSAGVAMAWNVFRFCTALRGLGSIMILLVLAIVGVTYYAVVLCNYGPAL  51



>gb|KHG01247.1| hypothetical protein F383_23406 [Gossypium arboreum]
Length=235

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  500   MLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPDTAQSRIRFCKKCNQ  679
             MLLWSY +VV TD G VPPNW+PA DEERG+ DPL  SEF  L P  +  RIR+C+KCNQ
Sbjct  1     MLLWSYLTVVLTDSGTVPPNWKPAWDEERGEVDPLNESEFDGLQPALSSRRIRYCRKCNQ  60

Query  680   LKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLPNF  859
              KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+LVTL+L  +F
Sbjct  61    FKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLVTLALFSHF  120

Query  860   LAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             LAFF D +IPG+A  LATTFL+FVLNLAFALSV GFLIMH+SLVS NTT
Sbjct  121   LAFFSDEEIPGTAATLATTFLSFVLNLAFALSVFGFLIMHVSLVSANTT  169



>gb|AHA84213.1| palmitoyltransferase [Phaseolus vulgaris]
Length=304

 Score =   203 bits (517),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 151/194 (78%), Gaps = 3/194 (2%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G  D+LVAL V+ LFH LLVMLLWSYFSVVFTDPG VPPNWRP +DEER + DPL 
Sbjct  49    ALSAGGLDSLVALLVLILFHSLLVMLLWSYFSVVFTDPGSVPPNWRPTIDEERREADPLV  108

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDH-HCVWVVNCVGALNY  784
              +EF ++  D  Q RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDH  CV    C G+   
Sbjct  109   GTEFNNVQTDPNQ-RIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHPLCVGSQLCWGS-KL  166

Query  785   KYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlG  964
             + F   L   FL TTLVT SLLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLG
Sbjct  167   QVFPSLLSTLFLSTTLVTASLLPHFIAFFSDGEIPGTPGSLATTFLAFVLNLAFALSVLG  226

Query  965   FLIMHISLVSRNTT  1006
             FLIMHISLV+ NTT
Sbjct  227   FLIMHISLVAANTT  240


 Score = 62.4 bits (150),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSGA MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L+
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPALS  51



>ref|XP_004975099.1| PREDICTED: probable S-acyltransferase At3g60800-like [Setaria 
italica]
Length=316

 Score =   210 bits (535),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 153/184 (83%), Gaps = 10/184 (5%)
 Frame = +2

Query  482   FHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPDTAQS----  649
             FH LL MLLWSYFSVVFTDPG VPPNW    D E G+T PL +SEF S   ++ QS    
Sbjct  68    FHFLLAMLLWSYFSVVFTDPGSVPPNWNLDFDAEMGETAPLASSEFSS-QMNSQQSVALG  126

Query  650   -----RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  814
                  R+R+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYT
Sbjct  127   SMGNPRVRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYT  186

Query  815   flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  994
             FLETTLVTLSLLP+F+AFF D+DIPGS   LATTFL FVLNLAF+LSVLGF+IMHISLVS
Sbjct  187   FLETTLVTLSLLPHFIAFFSDIDIPGSPAALATTFLTFVLNLAFSLSVLGFMIMHISLVS  246

Query  995   RNTT  1006
              NTT
Sbjct  247   ANTT  250


 Score = 54.7 bits (130),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  MYRS-GAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            MYRS G  MAWNVF+FCTALRGLGSIMILLVL +VGVTYY VVL NYGP L
Sbjct  1    MYRSAGVAMAWNVFRFCTALRGLGSIMILLVLVIVGVTYYAVVLCNYGPAL  51



>ref|XP_008354779.1| PREDICTED: uncharacterized protein LOC103418427 [Malus domestica]
Length=822

 Score =   208 bits (530),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +2

Query  440  GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
            G  D+L+A+ V+ +FHCLLVMLLWSYFSVV TDPG VPPNWRPA+DEERG  DPLT S+F
Sbjct  53   GGLDSLIAVGVLIIFHCLLVMLLWSYFSVVLTDPGGVPPNWRPAVDEERGQADPLTWSDF  112

Query  620  GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKY  790
              L PD +  RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVV+CVGALNYKY
Sbjct  113  NGLQPDPSNLRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVHCVGALNYKY  169


 Score = 55.8 bits (133),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSG  MAWNVFKFC  LRGLGS+MILLVLGVVGVTYY VV TNYGP L
Sbjct  1    MHRSGVAMAWNVFKFCIVLRGLGSVMILLVLGVVGVTYYTVVFTNYGPAL  50



>ref|XP_009399491.1| PREDICTED: probable protein S-acyltransferase 14 [Musa acuminata 
subsp. malaccensis]
Length=315

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 166/204 (81%), Gaps = 11/204 (5%)
 Frame = +2

Query  425   VAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPL  604
             V + VG  D+L+AL V+  FH LL +LLWSYFSVVF DPG VP NW+P  DEE G+T PL
Sbjct  50    VLLSVGGVDSLMALAVLVPFHVLLGLLLWSYFSVVFRDPGRVPSNWKPPADEEIGETAPL  109

Query  605   TASEF----------GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVW  754
             T+ EF          G L  DT    IR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHC+W
Sbjct  110   TSLEFSNHILNLQQLGRLE-DTGSQMIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCIW  168

Query  755   VVNCVGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvl  934
             VVNCVGALNYK+FLLFLFYTFLETTLVTLSL P+F+AFF DV+IPG+ G LATTFLAFVL
Sbjct  169   VVNCVGALNYKFFLLFLFYTFLETTLVTLSLFPHFIAFFKDVEIPGTPGKLATTFLAFVL  228

Query  935   nlafalsvlGFLIMHISLVSRNTT  1006
             NLAFALSVLGFLIMHI+LV+RNTT
Sbjct  229   NLAFALSVLGFLIMHITLVARNTT  252


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  MYRSGAV-MAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M RS AV MAWNVFKFCTALR LGS+MILLVLG+VGV+YY VV  NYGP+L
Sbjct  1    MRRSVAVVMAWNVFKFCTALRALGSLMILLVLGIVGVSYYAVVAANYGPVL  51



>ref|XP_008798535.1| PREDICTED: probable protein S-acyltransferase 14 [Phoenix dactylifera]
Length=317

 Score =   201 bits (512),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 145/175 (83%), Gaps = 9/175 (5%)
 Frame = +2

Query  509   WSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLP---------PDTAQSRIRF  661
             WSYFSVV TDPG +PPNW+P +DEERG+  PL +SEFG+            D+   R+R+
Sbjct  77    WSYFSVVLTDPGSIPPNWKPTVDEERGEEAPLNSSEFGNQILTYQQSANLADSGSPRVRY  136

Query  662   CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  841
             C+KC+QLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK+FLLFL YTFLETTLVTL
Sbjct  137   CRKCSQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKFFLLFLLYTFLETTLVTL  196

Query  842   SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             SLLPNF+AFF D +I G+ G LATTFL FVLNLAFALSVLGFLIMHISLV  NTT
Sbjct  197   SLLPNFIAFFSDAEIAGTPGTLATTFLTFVLNLAFALSVLGFLIMHISLVGGNTT  251


 Score = 61.6 bits (148),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGP  411
            M+RSGAVMAWNVFKFCTALRGLGS+MILLVLG+VGVTYY VV+TNYGP
Sbjct  1    MHRSGAVMAWNVFKFCTALRGLGSVMILLVLGIVGVTYYAVVVTNYGP  48



>ref|XP_007209402.1| hypothetical protein PRUPE_ppa009226mg [Prunus persica]
 gb|EMJ10601.1| hypothetical protein PRUPE_ppa009226mg [Prunus persica]
Length=301

 Score =   208 bits (530),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 153/193 (79%), Gaps = 0/193 (0%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G    ++A  ++ LFH LLVMLLWSYF+VV  DPG+VPPNWRPA DEE GD  PL 
Sbjct  42    AIFGGGLSAVIAFPLLILFHFLLVMLLWSYFNVVLNDPGVVPPNWRPANDEEGGDGAPLV  101

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
              S+  +L  D A  ++RFC+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYK
Sbjct  102   GSDQSTLVSDPANQKVRFCRKCNHFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYK  161

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYTFLETTLVTLSL   F+AFF + ++ G+ G +A +F+ FVLN AFALSV GF
Sbjct  162   YFLLFLFYTFLETTLVTLSLFKYFMAFFTEEEVIGTLGTVAASFITFVLNFAFALSVFGF  221

Query  968   LIMHISLVSRNTT  1006
             +IMH+SLV+ NTT
Sbjct  222   MIMHLSLVASNTT  234



>ref|XP_010108133.1| putative S-acyltransferase [Morus notabilis]
 gb|EXC17865.1| putative S-acyltransferase [Morus notabilis]
Length=307

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 146/181 (81%), Gaps = 6/181 (3%)
 Frame = +2

Query  482   FHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFG------SLPPDTA  643
             FH LLVMLLWSYFSVV TDPG VPPNWRP  DEERG+ D L  SE+       +   D  
Sbjct  60    FHSLLVMLLWSYFSVVLTDPGGVPPNWRPVTDEERGEADSLVESEYNGSDLASNRLDDLD  119

Query  644   QSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytfle  823
               R+RFC+KCNQ KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGA NYKYFLLFLFYTFLE
Sbjct  120   HQRVRFCQKCNQFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGAFNYKYFLLFLFYTFLE  179

Query  824   ttlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNT  1003
             TT+VTLSLLP F+AFF + +IPG+ G LA TF+ F+LN AFALSV+GFLIMH+SLV  NT
Sbjct  180   TTVVTLSLLPYFIAFFTEGEIPGTPGTLAATFITFILNFAFALSVMGFLIMHLSLVGANT  239

Query  1004  T  1006
             T
Sbjct  240   T  240



>ref|XP_008238650.1| PREDICTED: probable protein S-acyltransferase 14 [Prunus mume]
Length=301

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 153/193 (79%), Gaps = 0/193 (0%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G    ++A  ++ LFH LLVMLLWSYF+VV  DPG+VPPNWRPA DEE GD  PL 
Sbjct  42    AILGGGLSAVIAFPLLILFHFLLVMLLWSYFNVVLNDPGVVPPNWRPANDEEGGDGAPLV  101

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
              S+  +L  D A  ++RFC+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYK
Sbjct  102   GSDQSTLVSDPANQKVRFCRKCNHFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYK  161

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYTFLETTLVTLSL   F+AFF + ++ G+ G +A +F+ FVLN AFALSV GF
Sbjct  162   YFLLFLFYTFLETTLVTLSLFKYFMAFFTEEEVIGTLGTVAASFITFVLNFAFALSVFGF  221

Query  968   LIMHISLVSRNTT  1006
             +IMH+SLV+ NTT
Sbjct  222   MIMHLSLVASNTT  234



>gb|KJB49335.1| hypothetical protein B456_008G114100 [Gossypium raimondii]
Length=307

 Score =   204 bits (518),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G   + +A+ V+ LFH LLV+LLWSYF+VV TD G VPPNW+PA DEERG+ DPL  SEF
Sbjct  53    GGLHSFIAVVVLILFHFLLVLLLWSYFTVVLTDSGTVPPNWKPASDEERGEVDPLNESEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
               L PD +  RIR+C KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   DGLQPDLSSQRIRYCWKCNQFKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET+LVTL+L  +FLAFF D +IPG+   LATTFL+FVLNLAFALSV GFLIMH
Sbjct  173   FLFYTFLETSLVTLALFSHFLAFFSDEEIPGTTATLATTFLSFVLNLAFALSVFGFLIMH  232

Query  980   ISLVSRNTT  1006
             +SLVS NTT
Sbjct  233   VSLVSANTT  241


 Score = 58.2 bits (139),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSG  MAWNVFKFCT LRGLGSIMILLVLGVVGVTYY VV TNYGP L
Sbjct  1    MHRSGTTMAWNVFKFCTVLRGLGSIMILLVLGVVGVTYYAVVFTNYGPAL  50



>ref|XP_008437153.1| PREDICTED: probable protein S-acyltransferase 14 [Cucumis melo]
Length=310

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 146/179 (82%), Gaps = 9/179 (5%)
 Frame = +2

Query  497   VMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF---------GSLPPDTAQS  649
             VMLLWSYFSVV T+PG VPP WRP  DEE+GD DPL ASE+         G++P D++  
Sbjct  65    VMLLWSYFSVVLTNPGFVPPYWRPESDEEKGDADPLMASEYNGPGAGPEQGTMPSDSSNQ  124

Query  650   RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflett  829
             ++RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYKYFLLFLFYTFLETT
Sbjct  125   KVRFCRKCNQFKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAKNYKYFLLFLFYTFLETT  184

Query  830   lvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             LVT+SLLP FLAFF D DI G+ G LA  F+ F+LNL FALSV+GFLI+H+SLV  NTT
Sbjct  185   LVTVSLLPYFLAFFSDGDITGTPGSLAAIFITFILNLTFALSVMGFLILHVSLVVANTT  243



>ref|XP_004147573.1| PREDICTED: probable protein S-acyltransferase 14 [Cucumis sativus]
Length=310

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 159/198 (80%), Gaps = 9/198 (5%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  ++L A  V+ LFH LLVMLLWSYFSVV T+PG VPP WRP  DEE+GD DPL ASE+
Sbjct  46    GGLNSLTAFLVLLLFHSLLVMLLWSYFSVVLTNPGFVPPFWRPESDEEKGDADPLMASEY  105

Query  620   ---------GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVG  772
                      G++P D++  ++RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVG
Sbjct  106   NGPGAGPEQGTMPSDSSNQKVRFCRKCNQFKPPRCHHCSVCGRCVLKMDHHCVWVVNCVG  165

Query  773   ALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafal  952
             A NYKYFLLFLFYTFLETTLVTLSLLP FLAFF D DI G+ G LA  F+ F+LNL FAL
Sbjct  166   AKNYKYFLLFLFYTFLETTLVTLSLLPYFLAFFSDGDITGTPGSLAAIFITFILNLTFAL  225

Query  953   svlGFLIMHISLVSRNTT  1006
             SV+GFLI+H+SLV+ NTT
Sbjct  226   SVMGFLILHVSLVAANTT  243



>gb|KJB49337.1| hypothetical protein B456_008G114100 [Gossypium raimondii]
Length=285

 Score =   203 bits (517),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G   + +A+ V+ LFH LLV+LLWSYF+VV TD G VPPNW+PA DEERG+ DPL  SEF
Sbjct  53    GGLHSFIAVVVLILFHFLLVLLLWSYFTVVLTDSGTVPPNWKPASDEERGEVDPLNESEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
               L PD +  RIR+C KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113   DGLQPDLSSQRIRYCWKCNQFKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  172

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLET+LVTL+L  +FLAFF D +IPG+   LATTFL+FVLNLAFALSV GFLIMH
Sbjct  173   FLFYTFLETSLVTLALFSHFLAFFSDEEIPGTTATLATTFLSFVLNLAFALSVFGFLIMH  232

Query  980   ISLVSRNTT  1006
             +SLVS NTT
Sbjct  233   VSLVSANTT  241


 Score = 58.2 bits (139),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSG  MAWNVFKFCT LRGLGSIMILLVLGVVGVTYY VV TNYGP L
Sbjct  1    MHRSGTTMAWNVFKFCTVLRGLGSIMILLVLGVVGVTYYAVVFTNYGPAL  50



>gb|KCW78273.1| hypothetical protein EUGRSUZ_D02456 [Eucalyptus grandis]
Length=235

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +2

Query  500   MLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPDTAQSRIRFCKKCNQ  679
             MLLWSYFSVVFTDPG VPPNWRP++DEERG++DPLT  +   L  D +  RIR+C+KC+ 
Sbjct  1     MLLWSYFSVVFTDPGSVPPNWRPSIDEERGESDPLTLPDSSGLQSDPSNPRIRYCRKCDH  60

Query  680   LKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLPNF  859
              KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET++VTL+LLP+F
Sbjct  61    FKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSVVTLALLPHF  120

Query  860   LAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             +AFF D DIP + G LATTFL+FVLNLAF+LSV GFLI+H+SLV+ NTT
Sbjct  121   IAFFTDGDIPDTPGTLATTFLSFVLNLAFSLSVFGFLILHMSLVAANTT  169



>ref|XP_006477282.1| PREDICTED: probable protein S-acyltransferase 14-like isoform 
X1 [Citrus sinensis]
 ref|XP_006477283.1| PREDICTED: probable protein S-acyltransferase 14-like isoform 
X2 [Citrus sinensis]
Length=316

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 161/218 (74%), Gaps = 16/218 (7%)
 Frame = +2

Query  401   ITGRSSPAVAVG-------VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPN  559
             I G S  AVAV        +G  D++ ALFV+ LFH LLVML+WSYFSVV TDPG VPPN
Sbjct  35    IIGVSYYAVAVAKYGPALFLGGLDSITALFVLFLFHSLLVMLVWSYFSVVITDPGGVPPN  94

Query  560   WRPALDEERGDTDPLTASEFGSLPPDTAQSR---------IRFCKKCNQLKPPRCHHCSV  712
             W P LDEE GD      S+ G +     QS          IRFC+KCNQ KPPRCHHCSV
Sbjct  95    WIPNLDEESGDAGQWAGSDNGGVDLGANQSAMLIEPKHQGIRFCQKCNQFKPPRCHHCSV  154

Query  713   CGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPG  892
             C RC+LKMDHHCVWVVNCVGA NYKYFLLFLFYTFLETTLVT+SLLP F+A F D +IP 
Sbjct  155   CRRCILKMDHHCVWVVNCVGAFNYKYFLLFLFYTFLETTLVTVSLLPIFIALFTDDEIPE  214

Query  893   SAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             S G+LA +F+ FVLNLAFALS+LGFLIMHISLV+ NTT
Sbjct  215   SPGNLAASFITFVLNLAFALSILGFLIMHISLVAGNTT  252



>ref|XP_009398464.1| PREDICTED: probable protein S-acyltransferase 14 [Musa acuminata 
subsp. malaccensis]
Length=314

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 167/202 (83%), Gaps = 10/202 (5%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+G G  D+L+AL V+ LFH LL +LLWSYFSVVFTDPG VPPNW+P +DEE G+  PLT
Sbjct  50    ALGAGGIDSLLALAVLILFHVLLGLLLWSYFSVVFTDPGSVPPNWKPTIDEEIGENAPLT  109

Query  608   ASEF---------GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVV  760
               +F         G L  +T    IR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVV
Sbjct  110   NLDFSNHILNLQQGHLA-ETGNPTIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVV  168

Query  761   NCVGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnl  940
             NCVGALNYK+FLLFLFYTFLETTLVTLSL P+F+AFF DV+IPG+ G LATTFL FVLNL
Sbjct  169   NCVGALNYKFFLLFLFYTFLETTLVTLSLFPHFIAFFKDVEIPGTPGTLATTFLTFVLNL  228

Query  941   afalsvlGFLIMHISLVSRNTT  1006
             AFALSVLGFLIMH+SLV++NTT
Sbjct  229   AFALSVLGFLIMHVSLVAKNTT  250


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = +1

Query  268  MYRSGAV-MAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            M+RSG V MAWNVFKFCTALR  GS+MILLVLG+VGV+YY VV+ NYGP L 
Sbjct  1    MHRSGPVVMAWNVFKFCTALRAFGSLMILLVLGIVGVSYYAVVVANYGPALG  52



>ref|XP_006652138.1| PREDICTED: probable protein S-acyltransferase 14-like [Oryza 
brachyantha]
Length=316

 Score =   203 bits (517),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 146/174 (84%), Gaps = 8/174 (5%)
 Frame = +2

Query  509   WSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGS--------LPPDTAQSRIRFC  664
             WSYFSVVFTDPG VPPNW    DEERG+T PL+ S+F S           DT  SR R+C
Sbjct  77    WSYFSVVFTDPGSVPPNWNLDFDEERGETVPLSGSDFTSQMNSQQSMAHNDTGHSRARYC  136

Query  665   KKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlS  844
             +KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLS
Sbjct  137   RKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLS  196

Query  845   LLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             LLP+F+AFF D+DIPGS   LATTFL FVLNLAF+LSVLGF+IMH+SLVS NTT
Sbjct  197   LLPHFIAFFSDIDIPGSPAALATTFLTFVLNLAFSLSVLGFMIMHVSLVSANTT  250


 Score = 55.1 bits (131),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  MYRS-GAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RS GA MAWNVF+FCTALRGLGSIMILLVL +VGVTYY VVL NYGP L
Sbjct  1    MHRSAGAAMAWNVFRFCTALRGLGSIMILLVLSIVGVTYYAVVLCNYGPAL  51



>ref|XP_010918308.1| PREDICTED: probable protein S-acyltransferase 14 [Elaeis guineensis]
Length=317

 Score =   198 bits (504),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 143/175 (82%), Gaps = 9/175 (5%)
 Frame = +2

Query  509   WSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLP---------PDTAQSRIRF  661
             WSYFSVV TDPG VPPNW+P +DEERG+  PL + +FG+            D+   RIR+
Sbjct  77    WSYFSVVLTDPGSVPPNWKPTVDEERGEEAPLNSPDFGNQILSYQQSANLADSGSPRIRY  136

Query  662   CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  841
             C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK+FLLFL YTFLETTLVTL
Sbjct  137   CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKFFLLFLLYTFLETTLVTL  196

Query  842   SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             SLLPN +A F D +IPG+ G LATTFL FVLNLAFALSVLGFLIMHISLV  NTT
Sbjct  197   SLLPNSIALFSDAEIPGTPGTLATTFLTFVLNLAFALSVLGFLIMHISLVGGNTT  251


 Score = 59.7 bits (143),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGP  411
            M+RSGAVMAWNVFKFCTALRGLGSIMILLVLG+VGVTYY VV+T YGP
Sbjct  1    MHRSGAVMAWNVFKFCTALRGLGSIMILLVLGIVGVTYYAVVVTTYGP  48



>gb|EPS68199.1| hypothetical protein M569_06570, partial [Genlisea aurea]
Length=315

 Score =   199 bits (505),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 160/189 (85%), Gaps = 4/189 (2%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+LV++ V+ LFH LL MLLWSYFSVVFTDPG VPPNW P +D E GDT+ L A E 
Sbjct  70    GGMDSLVSILVLILFHLLLWMLLWSYFSVVFTDPGSVPPNWGPEVDVESGDTEALAAVEL  129

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
                 P+  ++R RFC+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYKYFLL
Sbjct  130   ----PENVENRPRFCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGARNYKYFLL  185

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFLETT+V LSLLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMH
Sbjct  186   FLFYTFLETTVVALSLLPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMH  245

Query  980   ISLVSRNTT  1006
             ++LV+ NTT
Sbjct  246   MTLVAANTT  254


 Score = 58.5 bits (140),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  265  IMYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            IM RSG  MAWNVF+FCTALRGLGSIMILLVLGVVGV+YY VV++NYGP LA
Sbjct  17   IMCRSGTAMAWNVFRFCTALRGLGSIMILLVLGVVGVSYYAVVISNYGPGLA  68



>gb|ABF99421.1| DHHC zinc finger domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=256

 Score =   201 bits (510),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 144/174 (83%), Gaps = 8/174 (5%)
 Frame = +2

Query  509   WSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGS--------LPPDTAQSRIRFC  664
             WSYFSVVFTDPG VPPNW    DEERG+T PL+  +F S           DT   R R+C
Sbjct  77    WSYFSVVFTDPGSVPPNWNLDFDEERGETAPLSGLDFNSQVNSQQSIAHNDTGHPRARYC  136

Query  665   KKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlS  844
             +KCNQ+KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLS
Sbjct  137   RKCNQMKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLS  196

Query  845   LLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             LLP+F+AFF D+DIPGS   LATTFL FVLNLAF+LSVLGF+IMH+SLVS NTT
Sbjct  197   LLPHFIAFFSDIDIPGSPAALATTFLTFVLNLAFSLSVLGFMIMHVSLVSANTT  250


 Score = 55.8 bits (133),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  MYRS-GAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RS GA MAWNVF+FCTALRGLGSIMILLVL +VGVTYY VV+ NYGP L
Sbjct  1    MHRSAGATMAWNVFRFCTALRGLGSIMILLVLSIVGVTYYAVVVYNYGPAL  51



>gb|KJB09891.1| hypothetical protein B456_001G174100 [Gossypium raimondii]
Length=230

 Score =   197 bits (500),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 98/117 (84%), Gaps = 3/117 (3%)
 Frame = +2

Query  440  GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
            G  D+L A+ V+ LFHCLLVMLLWSYFSVV TDPG +P NWRPALDEERG+ DPL  SEF
Sbjct  53   GGLDSLTAVVVLILFHCLLVMLLWSYFSVVLTDPGSIPANWRPALDEERGEADPLNGSEF  112

Query  620  GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKY  790
               P   +  RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKY
Sbjct  113  NVNP---SNQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKY  166


 Score = 59.3 bits (142),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSGA MAWNVFKFCTALRGLGSIMILLVLGVVGV+YY VVLTN+GP L
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLVLGVVGVSYYSVVLTNFGPAL  50



>gb|ACU18884.1| unknown [Glycine max]
Length=179

 Score =   197 bits (501),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  428  AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
            A+ VG  DTL++  V+ LFHCLLVMLLW YF+VVFTDPG VPPNW+PA+DEERG+ DPL 
Sbjct  49   ALFVGGLDTLISFVVLILFHCLLVMLLWCYFAVVFTDPGTVPPNWKPAVDEERGEVDPLN  108

Query  608  ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
              E  +L  DT+  R R+C+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYK
Sbjct  109  GVELSNLQSDTSNQRFRYCRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGASNYK  168

Query  788  Y  790
            Y
Sbjct  169  Y  169


 Score = 58.5 bits (140),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            MYRSGA MAWNVF+FCTALRGLGSIMIL+VLGV GVTYY VVLTN+GP L
Sbjct  1    MYRSGAGMAWNVFRFCTALRGLGSIMILMVLGVAGVTYYAVVLTNFGPAL  50



>ref|XP_002267258.3| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
Length=294

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 149/184 (81%), Gaps = 9/184 (5%)
 Frame = +2

Query  482   FHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFG---------SLPP  634
             FH LLVMLLWSYFSVV TDPG VP NW+P +DEE+GD DPL  SE           ++  
Sbjct  60    FHSLLVMLLWSYFSVVSTDPGGVPLNWKPMVDEEKGDVDPLLGSEHTGVGLGVDQENMVA  119

Query  635   DTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  814
             + A   +RFC+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGA NYKYFLLFLFYT
Sbjct  120   NPASEAVRFCRKCNLFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGAKNYKYFLLFLFYT  179

Query  815   flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  994
             FLETTLVTLSLLP+F+AFF D +IPG+ G +A TFL FVLNLAFALSVLGFLIMHISLV+
Sbjct  180   FLETTLVTLSLLPHFIAFFSDGEIPGTPGTIAATFLTFVLNLAFALSVLGFLIMHISLVA  239

Query  995   RNTT  1006
              NTT
Sbjct  240   ANTT  243



>gb|KDO63755.1| hypothetical protein CISIN_1g021223mg [Citrus sinensis]
Length=289

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 159/218 (73%), Gaps = 16/218 (7%)
 Frame = +2

Query  401   ITGRSSPAVAVG-------VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPN  559
             I G S  AVAV        +G  D++ ALFV+ LFH LLVML+WSYFSVV TDPG VPPN
Sbjct  35    IIGVSYYAVAVAKYGPALFLGGLDSITALFVLFLFHSLLVMLVWSYFSVVITDPGGVPPN  94

Query  560   WRPALDEERGDTDPLTASEFGSLPPDTAQSR---------IRFCKKCNQLKPPRCHHCSV  712
             W P LDEE G       S+   +     QS          +RFC+KCNQ KPPRCHHCSV
Sbjct  95    WIPNLDEESGGAGQWAGSDNDGVDLGANQSAMLIEPKHQGVRFCQKCNQFKPPRCHHCSV  154

Query  713   CGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPG  892
             C RC+LKMDHHCVWVVNCVGA NYKYFLLFLFYTFLETTLVT+SLLP F+A F D +IP 
Sbjct  155   CRRCILKMDHHCVWVVNCVGAFNYKYFLLFLFYTFLETTLVTVSLLPIFIALFTDDEIPE  214

Query  893   SAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             S G+LA +F+ FVLNLAFALS+LGFLIMHISLV+ NTT
Sbjct  215   SPGNLAASFITFVLNLAFALSILGFLIMHISLVAGNTT  252



>ref|XP_007039984.1| DHHC-type zinc finger family protein [Theobroma cacao]
 gb|EOY24485.1| DHHC-type zinc finger family protein [Theobroma cacao]
Length=312

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 152/199 (76%), Gaps = 9/199 (5%)
 Frame = +2

Query  437   VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASE  616
             +G FD L A+ VI LFH LLVM++WSYF+VV TDPG VPPNW+P  DEE+G+ DPL +  
Sbjct  47    LGGFDALSAVAVIFLFHFLLVMVIWSYFAVVLTDPGGVPPNWKPPRDEEKGEVDPLVSFS  106

Query  617   FGS---------LPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCV  769
             +GS         +P D+    IRFC+KCNQ KPPR HHCSVC RC+LKMDHHCVWVVNCV
Sbjct  107   YGSPELGSNQSAVPGDSPNQDIRFCRKCNQFKPPRTHHCSVCKRCILKMDHHCVWVVNCV  166

Query  770   GALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafa  949
             GALNYKYFLLFLFYTFL  TL +LSLL  F+ FF D +I  + G LA TF+ FVLN+AFA
Sbjct  167   GALNYKYFLLFLFYTFLGATLSSLSLLRVFIEFFNDGEIAETPGTLAATFITFVLNIAFA  226

Query  950   lsvlGFLIMHISLVSRNTT  1006
             LS+LGFLIMHI+LV  NTT
Sbjct  227   LSILGFLIMHITLVGANTT  245



>ref|NP_001051618.1| Os03g0804300 [Oryza sativa Japonica Group]
 gb|AAS07218.1| putative zinc finger protein [Oryza sativa Japonica Group]
 gb|ABF99420.1| DHHC zinc finger domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13532.1| Os03g0804300 [Oryza sativa Japonica Group]
Length=316

 Score =   199 bits (506),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 144/174 (83%), Gaps = 8/174 (5%)
 Frame = +2

Query  509   WSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGS--------LPPDTAQSRIRFC  664
             WSYFSVVFTDPG VPPNW    DEERG+T PL+  +F S           DT   R R+C
Sbjct  77    WSYFSVVFTDPGSVPPNWNLDFDEERGETAPLSGLDFNSQVNSQQSIAHNDTGHPRARYC  136

Query  665   KKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlS  844
             +KCNQ+KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLS
Sbjct  137   RKCNQMKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLS  196

Query  845   LLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             LLP+F+AFF D+DIPGS   LATTFL FVLNLAF+LSVLGF+IMH+SLVS NTT
Sbjct  197   LLPHFIAFFSDIDIPGSPAALATTFLTFVLNLAFSLSVLGFMIMHVSLVSANTT  250


 Score = 55.8 bits (133),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  MYRS-GAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RS GA MAWNVF+FCTALRGLGSIMILLVL +VGVTYY VV+ NYGP L
Sbjct  1    MHRSAGATMAWNVFRFCTALRGLGSIMILLVLSIVGVTYYAVVVYNYGPAL  51



>gb|KGN50197.1| hypothetical protein Csa_5G158530 [Cucumis sativus]
Length=316

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 156/208 (75%), Gaps = 15/208 (7%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G  ++L A  V+ LFH LLVMLLWSYFSVV T+PG VPP WRP  DEE+GD DPL 
Sbjct  42    ALFRGGLNSLTAFLVLLLFHSLLVMLLWSYFSVVLTNPGFVPPFWRPESDEEKGDADPLM  101

Query  608   ASEF---------GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVV  760
             ASE+         G++P D++  ++RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVV
Sbjct  102   ASEYNGPGAGPEQGTMPSDSSNQKVRFCRKCNQFKPPRCHHCSVCGRCVLKMDHHCVWVV  161

Query  761   NCVGALNYKYf------llflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattfl  922
             NCVGA NY +       L   FYTFLETTLVTLSLLP FLAFF D DI G+ G LA  F+
Sbjct  162   NCVGAKNYNFTNHLILFLFMQFYTFLETTLVTLSLLPYFLAFFSDGDITGTPGSLAAIFI  221

Query  923   afvlnlafalsvlGFLIMHISLVSRNTT  1006
              F+LNL FALSV+GFLI+H+SLV+ NTT
Sbjct  222   TFILNLTFALSVMGFLILHVSLVAANTT  249



>ref|XP_003635680.2| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
Length=324

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 149/184 (81%), Gaps = 9/184 (5%)
 Frame = +2

Query  482   FHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF---------GSLPP  634
             FH LLVMLLWSYFSVV TDPG VP NW+P +DEE+GD DPL  SE           ++  
Sbjct  60    FHSLLVMLLWSYFSVVSTDPGGVPLNWKPMVDEEKGDVDPLLGSEHTGVGLGVDQENMVA  119

Query  635   DTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  814
             + A   +RFC+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGA NYKYFLLFLFYT
Sbjct  120   NPASEAVRFCRKCNLFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGAKNYKYFLLFLFYT  179

Query  815   flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  994
             FLETTLVTLSLLP+F+AFF D +IPG+ G +A TFL FVLNLAFALSVLGFLIMHISLV+
Sbjct  180   FLETTLVTLSLLPHFIAFFSDGEIPGTPGTIAATFLTFVLNLAFALSVLGFLIMHISLVA  239

Query  995   RNTT  1006
              NTT
Sbjct  240   ANTT  243



>ref|XP_009389071.1| PREDICTED: probable protein S-acyltransferase 14 [Musa acuminata 
subsp. malaccensis]
Length=315

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 168/219 (77%), Gaps = 17/219 (8%)
 Frame = +2

Query  401   ITGRSSPAVAVGV--------GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPP  556
             I G S  AV V +        G  D+L+A+ V+  FH LL +LLW+YFSVV TDPG VPP
Sbjct  33    IVGVSYYAVVVAIYGPALLTAGWLDSLLAVGVLVPFHLLLGLLLWAYFSVVITDPGSVPP  92

Query  557   NWRPALDEERGDTDPLTASEFGSL---------PPDTAQSRIRFCKKCNQLKPPRCHHCS  709
             +W+P +DEE G+T PL  SEF S            DT   RIR+C+KCNQLKPPRCHHCS
Sbjct  93    HWKPVIDEEEGETAPLANSEFTSHILNLQQPGPVADTGSPRIRYCRKCNQLKPPRCHHCS  152

Query  710   VCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIP  889
             VCGRCVLKMDHHCVWVVNCVGALNYK+FLLFLFYTFLETTLVT+SL P+F+AFF DV+IP
Sbjct  153   VCGRCVLKMDHHCVWVVNCVGALNYKFFLLFLFYTFLETTLVTVSLFPHFIAFFKDVEIP  212

Query  890   GSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             G+ G LA TF+ FVLNLAFALSVLGFL+MHISLV +NTT
Sbjct  213   GTPGTLAATFITFVLNLAFALSVLGFLVMHISLVMKNTT  251



>ref|XP_010662159.1| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
Length=310

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 149/184 (81%), Gaps = 9/184 (5%)
 Frame = +2

Query  482   FHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF---------GSLPP  634
             FH LLVMLLWSYFSVV TDPG VP NW+P +DEE+GD DPL  SE           ++  
Sbjct  60    FHSLLVMLLWSYFSVVSTDPGGVPLNWKPMVDEEKGDVDPLLGSEHTGVGLGVDQENMVA  119

Query  635   DTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  814
             + A   +RFC+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGA NYKYFLLFLFYT
Sbjct  120   NPASEAVRFCRKCNLFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGAKNYKYFLLFLFYT  179

Query  815   flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  994
             FLETTLVTLSLLP+F+AFF D +IPG+ G +A TFL FVLNLAFALSVLGFLIMHISLV+
Sbjct  180   FLETTLVTLSLLPHFIAFFSDGEIPGTPGTIAATFLTFVLNLAFALSVLGFLIMHISLVA  239

Query  995   RNTT  1006
              NTT
Sbjct  240   ANTT  243



>gb|KDO63753.1| hypothetical protein CISIN_1g021223mg [Citrus sinensis]
 gb|KDO63754.1| hypothetical protein CISIN_1g021223mg [Citrus sinensis]
Length=316

 Score =   201 bits (512),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 159/218 (73%), Gaps = 16/218 (7%)
 Frame = +2

Query  401   ITGRSSPAVAVG-------VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPN  559
             I G S  AVAV        +G  D++ ALFV+ LFH LLVML+WSYFSVV TDPG VPPN
Sbjct  35    IIGVSYYAVAVAKYGPALFLGGLDSITALFVLFLFHSLLVMLVWSYFSVVITDPGGVPPN  94

Query  560   WRPALDEERGDTDPLTASEFGSLPPDTAQSR---------IRFCKKCNQLKPPRCHHCSV  712
             W P LDEE G       S+   +     QS          +RFC+KCNQ KPPRCHHCSV
Sbjct  95    WIPNLDEESGGAGQWAGSDNDGVDLGANQSAMLIEPKHQGVRFCQKCNQFKPPRCHHCSV  154

Query  713   CGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPG  892
             C RC+LKMDHHCVWVVNCVGA NYKYFLLFLFYTFLETTLVT+SLLP F+A F D +IP 
Sbjct  155   CRRCILKMDHHCVWVVNCVGAFNYKYFLLFLFYTFLETTLVTVSLLPIFIALFTDDEIPE  214

Query  893   SAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             S G+LA +F+ FVLNLAFALS+LGFLIMHISLV+ NTT
Sbjct  215   SPGNLAASFITFVLNLAFALSILGFLIMHISLVAGNTT  252



>ref|XP_006440415.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
 ref|XP_006440416.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
 gb|ESR53655.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
 gb|ESR53656.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
Length=315

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 160/217 (74%), Gaps = 11/217 (5%)
 Frame = +2

Query  383   MSLSSPITGRSSPAVAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNW  562
             +S  + +  +  PA+ +G    D++ ALFV+ LFH LLVML+WSYFSVV TDPG VPPNW
Sbjct  37    VSYYAVVVAKYGPALFLGG--LDSITALFVLFLFHSLLVMLVWSYFSVVITDPGGVPPNW  94

Query  563   RPALDEERGDTDPLTASEFGSLPPDTAQSR---------IRFCKKCNQLKPPRCHHCSVC  715
              P LDEE G       S+   +     QS          +RFC+KCNQ KPPRCHHCSVC
Sbjct  95    IPNLDEESGGAGQWAGSDNDGVDLGANQSAMLIEPKHQGVRFCQKCNQFKPPRCHHCSVC  154

Query  716   GRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGS  895
              RC+LKMDHHCVWVVNCVGA NYKYFLLFLFYTFLETTLVT+SLLP F+A F D +IP S
Sbjct  155   RRCILKMDHHCVWVVNCVGAFNYKYFLLFLFYTFLETTLVTVSLLPIFIALFTDDEIPES  214

Query  896   AGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
              G+LA +F+ FVLNLAFALS+LGFLIMHISLV+ NTT
Sbjct  215   PGNLAASFITFVLNLAFALSILGFLIMHISLVAGNTT  251



>emb|CDX94118.1| BnaC07g37520D [Brassica napus]
Length=305

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 151/193 (78%), Gaps = 3/193 (2%)
 Frame = +2

Query  437   VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASE  616
             +G  D+ +AL V+ALFH LLVMLLWSYFSVV TDPG VPP WRP LD E+GD +    +E
Sbjct  45    LGGLDSFIALLVLALFHFLLVMLLWSYFSVVVTDPGGVPPGWRPELDIEKGDGNEAAIAE  104

Query  617   FGSLP-PDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYf  793
                L   D++   +R C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK F
Sbjct  105   ASPLSVGDSSSHIVRHCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGARNYKSF  164

Query  794   llflfytflettlvtlSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGF  967
             LLFLFYTFLETT+V +SL P FL FF  GD +I  S G LA TF+AF+LN+AFALSVLGF
Sbjct  165   LLFLFYTFLETTVVAVSLFPAFLVFFTDGDDEITVSLGSLAATFIAFILNIAFALSVLGF  224

Query  968   LIMHISLVSRNTT  1006
             LIMHI LV+RNTT
Sbjct  225   LIMHIMLVARNTT  237



>gb|EEE60128.1| hypothetical protein OsJ_13009 [Oryza sativa Japonica Group]
Length=180

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 143/173 (83%), Gaps = 8/173 (5%)
 Frame = +2

Query  512   SYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGS--------LPPDTAQSRIRFCK  667
             SYFSVVFTDPG VPPNW    DEERG+T PL+  +F S           DT   R R+C+
Sbjct  2     SYFSVVFTDPGSVPPNWNLDFDEERGETAPLSGLDFNSQVNSQQSIAHNDTGHPRARYCR  61

Query  668   KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSL  847
             KCNQ+KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLSL
Sbjct  62    KCNQMKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLSL  121

Query  848   LPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             LP+F+AFF D+DIPGS   LATTFL FVLNLAF+LSVLGF+IMH+SLVS NTT
Sbjct  122   LPHFIAFFSDIDIPGSPAALATTFLTFVLNLAFSLSVLGFMIMHVSLVSANTT  174



>ref|XP_009362135.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Pyrus 
x bretschneideri]
Length=220

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = +2

Query  440  GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
            G  + ++A  ++ LFH LLVMLLWSYF+VV TDPG VPPNWRPA+DEE GD  PL  S+ 
Sbjct  46   GGVNFVIAFPLLILFHFLLVMLLWSYFNVVLTDPGRVPPNWRPAIDEETGDEAPLVGSDQ  105

Query  620  GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
             ++  D A  +IRFC+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLL
Sbjct  106  STMVSDPANQKIRFCRKCNHYKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLL  165

Query  800  flfytflettlvtlSLLPNFLAFFGDVDIPGSAG  901
            FLFYTFLETTLVTLSL   F+AFF + +IPG+ G
Sbjct  166  FLFYTFLETTLVTLSLFKYFMAFFTEEEIPGTLG  199



>gb|EEC76365.1| hypothetical protein OsI_13959 [Oryza sativa Indica Group]
Length=308

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 144/174 (83%), Gaps = 8/174 (5%)
 Frame = +2

Query  509   WSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGS--------LPPDTAQSRIRFC  664
             WSYFSVVFTDPG VPPNW    DEERG+T PL+  +F S           DT   R R+C
Sbjct  69    WSYFSVVFTDPGSVPPNWNLDFDEERGETAPLSGLDFNSQVNSQQSIAHNDTGHPRARYC  128

Query  665   KKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlS  844
             +KCNQ+KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLS
Sbjct  129   RKCNQMKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLS  188

Query  845   LLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             LLP+F+AFF D+DIPGS   LATTFL FVLNLAF+LSVLGF+IMH+SLVS NTT
Sbjct  189   LLPHFIAFFSDIDIPGSPAALATTFLTFVLNLAFSLSVLGFMIMHVSLVSANTT  242



>ref|XP_009137276.1| PREDICTED: probable protein S-acyltransferase 13 [Brassica rapa]
Length=305

 Score =   198 bits (503),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 151/193 (78%), Gaps = 3/193 (2%)
 Frame = +2

Query  437   VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASE  616
             +G  D+ +AL V+ALFH LLVM+LWSYFSVV TDPG VPP WRP LD E+GD +    +E
Sbjct  45    LGGLDSFIALLVLALFHFLLVMVLWSYFSVVVTDPGGVPPGWRPELDIEKGDGNEAAIAE  104

Query  617   FGSLP-PDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYf  793
                L   D++   +R C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK F
Sbjct  105   ASPLSVGDSSSHIVRHCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGARNYKSF  164

Query  794   llflfytflettlvtlSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGF  967
             LLFLFYTFLETT+V +SL P FL FF  GD +I  S G LA TF+AF+LN+AFALSVLGF
Sbjct  165   LLFLFYTFLETTVVAVSLFPAFLVFFTDGDDEITVSLGSLAATFIAFILNIAFALSVLGF  224

Query  968   LIMHISLVSRNTT  1006
             LIMHI LV+RNTT
Sbjct  225   LIMHIMLVARNTT  237



>emb|CDX98764.1| BnaA03g45490D [Brassica napus]
Length=305

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 151/193 (78%), Gaps = 3/193 (2%)
 Frame = +2

Query  437   VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASE  616
             +G  D+ +AL V+ALFH LLVM+LWSYFSVV TDPG VPP WRP LD E+GD +    +E
Sbjct  45    LGGLDSFIALLVLALFHFLLVMVLWSYFSVVVTDPGGVPPGWRPELDIEKGDGNEAAIAE  104

Query  617   FGSLP-PDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYf  793
                L   D++   +R C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK F
Sbjct  105   ASPLSVGDSSSHIVRHCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGARNYKSF  164

Query  794   llflfytflettlvtlSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGF  967
             LLFLFYTFLETT+V +SL P FL FF  GD +I  S G LA TF+AF+LN+AFALSVLGF
Sbjct  165   LLFLFYTFLETTVVAVSLFPAFLVFFTDGDDEITVSLGSLAATFIAFILNIAFALSVLGF  224

Query  968   LIMHISLVSRNTT  1006
             LIMHI LV+RNTT
Sbjct  225   LIMHIMLVARNTT  237



>ref|XP_002304438.2| hypothetical protein POPTR_0003s11520g [Populus trichocarpa]
 gb|EEE79417.2| hypothetical protein POPTR_0003s11520g [Populus trichocarpa]
Length=318

 Score =   196 bits (499),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 152/198 (77%), Gaps = 9/198 (5%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTA---  610
             G  D+ VA  V+ LFH LLVMLLWSYF+ V TDPG VPPNWRP++DEE GD DPL     
Sbjct  54    GGLDSFVAFLVLVLFHSLLVMLLWSYFTTVLTDPGGVPPNWRPSIDEESGDADPLVGLGY  113

Query  611   --SEFGSLPPDT----AQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVG  772
               ++ G   P T    A  ++R C+KCNQ KPPRCHHCSVCGRC+LKMDHHCVWVVNCVG
Sbjct  114   EGTDLGLNQPATFGEPANPQLRVCRKCNQCKPPRCHHCSVCGRCILKMDHHCVWVVNCVG  173

Query  773   ALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafal  952
             ALNYKYFLLFLFYTFL TTLVTLSLL  F+AFF D  I G+ G L  TF+ FVLNL+FAL
Sbjct  174   ALNYKYFLLFLFYTFLLTTLVTLSLLRLFIAFFTDGVINGTPGTLVATFVTFVLNLSFAL  233

Query  953   svlGFLIMHISLVSRNTT  1006
             S++GFL+MHISLV  NTT
Sbjct  234   SIMGFLVMHISLVLGNTT  251


 Score = 52.0 bits (123),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  MYRSG-AVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M +SG +VMAWNVFKFCTALR LGSIMI+LVLG++GVTYYV+V+ NYGP L
Sbjct  1    MQKSGKSVMAWNVFKFCTALRALGSIMIVLVLGIIGVTYYVIVVANYGPAL  51



>gb|KJB37585.1| hypothetical protein B456_006G211800 [Gossypium raimondii]
Length=270

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 148/197 (75%), Gaps = 7/197 (4%)
 Frame = +2

Query  437   VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASE  616
             +G F+T  A+ V+ +FH LLVM++W Y SVV TDPG VPPNWRP  DEE+GD DPL  S 
Sbjct  45    LGSFETFFAIVVLIVFHSLLVMVMWCYSSVVVTDPGGVPPNWRPLTDEEKGDADPLVGSG  104

Query  617   FGSLPPDTAQS-------RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA  775
             +GS   D  QS        IRFC KC Q KPPR HHCSVC RC+LKMDHHCVWVVNCVGA
Sbjct  105   YGSAQLDPKQSATVAVSQEIRFCHKCKQFKPPRAHHCSVCRRCILKMDHHCVWVVNCVGA  164

Query  776   LNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafals  955
             LNYKYFLLFLFYTFLETTLV+L LL  F+ FF + +I  + G LA TF+ FVLN+AF LS
Sbjct  165   LNYKYFLLFLFYTFLETTLVSLLLLRVFMEFFNEGEIDETPGSLAATFITFVLNIAFTLS  224

Query  956   vlGFLIMHISLVSRNTT  1006
             +LGFLIMHI+LV  NT+
Sbjct  225   ILGFLIMHITLVGANTS  241



>gb|AFW57919.1| palmitoyltransferase ZDHHC20, mRNA [Zea mays]
Length=243

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 147/178 (83%), Gaps = 10/178 (6%)
 Frame = +2

Query  500   MLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPDTAQS---------R  652
             MLLWSYFSVVFTDPG VPPNW    D E G+T PL +SE  S   ++ QS         R
Sbjct  1     MLLWSYFSVVFTDPGSVPPNWNLDFDVEMGETAPLASSELCS-QMNSQQSVALGNMTNPR  59

Query  653   IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettl  832
             +R+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTL
Sbjct  60    VRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTL  119

Query  833   vtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             VTLSLLP+F+AFF D +IPGS   LATTFL FVLNLAF+LSVLGF+IMHISLVS NTT
Sbjct  120   VTLSLLPHFIAFFSDAEIPGSPAALATTFLTFVLNLAFSLSVLGFMIMHISLVSANTT  177



>ref|XP_010433998.1| PREDICTED: probable protein S-acyltransferase 13 [Camelina sativa]
Length=305

 Score =   196 bits (497),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 155/198 (78%), Gaps = 5/198 (3%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALD-EERGDTDPL  604
             A+  G FD+ VAL V+ALFH LLVMLLWSYFSVV TDPG VP  WRP LD E+ GD +  
Sbjct  42    ALLTGGFDSSVALLVLALFHFLLVMLLWSYFSVVVTDPGGVPTGWRPELDIEKSGDGNQN  101

Query  605   TASEFG-SLP-PDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  778
                E   SL   D++   +R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA+
Sbjct  102   LIGEANPSLSVGDSSNHGVRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAM  161

Query  779   NYKYfllflfytflettlvtlSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafal  952
             NYK FLLFLFYTFLETTLV +SLLP FL FF  GD DI  S G LA TF+AFVLN+AFAL
Sbjct  162   NYKSFLLFLFYTFLETTLVAISLLPVFLVFFSDGDGDITVSPGSLAATFVAFVLNIAFAL  221

Query  953   svlGFLIMHISLVSRNTT  1006
             SVLGFLIMHI LV+RNTT
Sbjct  222   SVLGFLIMHIMLVARNTT  239



>dbj|BAJ34112.1| unnamed protein product [Thellungiella halophila]
Length=304

 Score =   196 bits (497),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 153/196 (78%), Gaps = 4/196 (2%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGD-TDPL  604
             A+ +G FD+LVAL V+ LFH LL+MLLWSYFSVV TDPG VPP WRP LD E+ +   P 
Sbjct  42    ALLLGGFDSLVALLVLGLFHFLLIMLLWSYFSVVVTDPGGVPPGWRPELDIEKNEGNQPA  101

Query  605   TASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNY  784
              A +  S+   ++   +R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA+NY
Sbjct  102   IADQSLSVGGSSSHG-VRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAMNY  160

Query  785   KYfllflfytflettlvtlSLLPNFLAFFGD--VDIPGSAGDlattflafvlnlafalsv  958
             K FLLFLFYTFLETT+V  SL P FL FF D   DI  S G LA TF+AFVLN+AFALSV
Sbjct  161   KSFLLFLFYTFLETTVVATSLFPVFLVFFTDEEADITVSPGSLAATFVAFVLNIAFALSV  220

Query  959   lGFLIMHISLVSRNTT  1006
             LGFLIMHI LV+RN+T
Sbjct  221   LGFLIMHILLVARNST  236



>ref|XP_011463771.1| PREDICTED: probable protein S-acyltransferase 14 [Fragaria vesca 
subsp. vesca]
Length=310

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 153/198 (77%), Gaps = 9/198 (5%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D L+AL ++ LFH LLVMLLWSYF V+ TDPG VP NWRP +DEE G   PL  SE+
Sbjct  46    GGIDALIALPLLILFHFLLVMLLWSYFYVLVTDPGGVPLNWRPEIDEEAGQGAPLVESEY  105

Query  620   GS---------LPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVG  772
                        +  D A  ++RFC+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVG
Sbjct  106   SGAGLVSNQSVMAFDPANQKVRFCRKCNHFKPPRCHHCSVCGRCILKMDHHCVWVVNCVG  165

Query  773   ALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafal  952
             ALNYKYFLLFLFYTFLETTLVTLSLL  F+AFF D +I G+ G +A +F+ FVLNLAF+L
Sbjct  166   ALNYKYFLLFLFYTFLETTLVTLSLLRYFMAFFTDQEISGTLGTVAASFITFVLNLAFSL  225

Query  953   svlGFLIMHISLVSRNTT  1006
             SVLGF+IMHISLV+ NTT
Sbjct  226   SVLGFMIMHISLVAANTT  243



>ref|XP_011033891.1| PREDICTED: probable protein S-acyltransferase 14 [Populus euphratica]
Length=318

 Score =   194 bits (492),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 149/198 (75%), Gaps = 9/198 (5%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+ VA  ++ LFH LLVMLLWSYF+ V TDPG VPPNWRP++DEE GD DPL    +
Sbjct  54    GGLDSFVAFLILVLFHSLLVMLLWSYFTTVLTDPGGVPPNWRPSIDEESGDADPLVGLGY  113

Query  620   GSLP---------PDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVG  772
               +           + A  ++R C+KCNQ KPPRCHHCSVCGRC+LKMDHHCVWVVNCVG
Sbjct  114   EGMDLGLNQLATFGEPANPQLRVCRKCNQFKPPRCHHCSVCGRCILKMDHHCVWVVNCVG  173

Query  773   ALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafal  952
             ALNYKYFLLFLFYTFL TTLVTLSLL  F+AFF D  I G+ G L  TF+ FVLNL+FAL
Sbjct  174   ALNYKYFLLFLFYTFLLTTLVTLSLLRLFIAFFTDGVINGTPGTLVATFVTFVLNLSFAL  233

Query  953   svlGFLIMHISLVSRNTT  1006
             S++GF +MHISLV  NTT
Sbjct  234   SIMGFRVMHISLVLGNTT  251


 Score = 52.0 bits (123),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  MYRSG-AVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M +SG +VMAWNVFKFCTALR LGSIMI+LVLG++GVTYYV+V+ NYGP L
Sbjct  1    MQKSGKSVMAWNVFKFCTALRALGSIMIVLVLGIIGVTYYVIVVANYGPAL  51



>gb|KJB49338.1| hypothetical protein B456_008G114100 [Gossypium raimondii]
Length=232

 Score =   186 bits (473),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = +2

Query  440  GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
            G   + +A+ V+ LFH LLV+LLWSYF+VV TD G VPPNW+PA DEERG+ DPL  SEF
Sbjct  53   GGLHSFIAVVVLILFHFLLVLLLWSYFTVVLTDSGTVPPNWKPASDEERGEVDPLNESEF  112

Query  620  GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
              L PD +  RIR+C KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL
Sbjct  113  DGLQPDLSSQRIRYCWKCNQFKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLL  172

Query  800  flfytflettlvtlSLLPNFLAFFGDVDIPG  892
            FLFYTFLET+LVTL+L  +FLAFF D +IPG
Sbjct  173  FLFYTFLETSLVTLALFSHFLAFFSDEEIPG  203


 Score = 58.2 bits (139),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSG  MAWNVFKFCT LRGLGSIMILLVLGVVGVTYY VV TNYGP L
Sbjct  1    MHRSGTTMAWNVFKFCTVLRGLGSIMILLVLGVVGVTYYAVVFTNYGPAL  50



>ref|XP_011029092.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Populus 
euphratica]
Length=310

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 144/198 (73%), Gaps = 9/198 (5%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+ VAL V+ LFH LLVMLLWSYF+   TDPG VPP+WRP++DEE GD DPL     
Sbjct  46    GGLDSFVALLVLVLFHSLLVMLLWSYFTTCLTDPGGVPPSWRPSIDEESGDADPLVGLAH  105

Query  620   GSLPPDTAQS---------RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVG  772
                  D  QS         R R C+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVG
Sbjct  106   EGTGLDLNQSAMLGEPANPRTRVCRKCNWFKPPRCHHCSVCGRCILKMDHHCVWVVNCVG  165

Query  773   ALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafal  952
             ALNYKYFLLFLFYTFL TTLVT SLLP F+AF    +  G+   L  TF+ FVLNL+FAL
Sbjct  166   ALNYKYFLLFLFYTFLVTTLVTSSLLPKFIAFLTVGEKNGTPETLVATFVTFVLNLSFAL  225

Query  953   svlGFLIMHISLVSRNTT  1006
             S++GFLIMHISLV  NTT
Sbjct  226   SIMGFLIMHISLVLGNTT  243



>gb|KJB37584.1| hypothetical protein B456_006G211800 [Gossypium raimondii]
 gb|KJB37586.1| hypothetical protein B456_006G211800 [Gossypium raimondii]
Length=308

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 148/197 (75%), Gaps = 7/197 (4%)
 Frame = +2

Query  437   VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASE  616
             +G F+T  A+ V+ +FH LLVM++W Y SVV TDPG VPPNWRP  DEE+GD DPL  S 
Sbjct  45    LGSFETFFAIVVLIVFHSLLVMVMWCYSSVVVTDPGGVPPNWRPLTDEEKGDADPLVGSG  104

Query  617   FGSLPPDTAQS-------RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA  775
             +GS   D  QS        IRFC KC Q KPPR HHCSVC RC+LKMDHHCVWVVNCVGA
Sbjct  105   YGSAQLDPKQSATVAVSQEIRFCHKCKQFKPPRAHHCSVCRRCILKMDHHCVWVVNCVGA  164

Query  776   LNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafals  955
             LNYKYFLLFLFYTFLETTLV+L LL  F+ FF + +I  + G LA TF+ FVLN+AF LS
Sbjct  165   LNYKYFLLFLFYTFLETTLVSLLLLRVFMEFFNEGEIDETPGSLAATFITFVLNIAFTLS  224

Query  956   vlGFLIMHISLVSRNTT  1006
             +LGFLIMHI+LV  NT+
Sbjct  225   ILGFLIMHITLVGANTS  241



>ref|XP_010540019.1| PREDICTED: probable protein S-acyltransferase 13 [Tarenaya hassleriana]
Length=307

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 153/199 (77%), Gaps = 6/199 (3%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGD-TDPL  604
             A+ VG F + VA+ V+ALFH LL MLLWSYFSVV TDPG VPP WRP LD E+ D + P 
Sbjct  42    ALLVGGFGSFVAVLVLALFHFLLAMLLWSYFSVVVTDPGGVPPGWRPELDIEKSDPSQPG  101

Query  605   TASEFGSLP-PDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALN  781
              +    SL   D     +R+C+KCNQ KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGA+N
Sbjct  102   NSEASQSLAVADPLSHGVRYCRKCNQYKPPRCHHCSVCGRCILKMDHHCVWVVNCVGAMN  161

Query  782   YKYfllflfytflettlvtlSLLPNFLAFFGD----VDIPGSAGDlattflafvlnlafa  949
             YKYFLLFLF+TFLETTLV +SLL  FL FF D    +D   S G LA TF+AFVLNLAFA
Sbjct  162   YKYFLLFLFFTFLETTLVAVSLLHVFLVFFTDGDTEIDTTISPGTLAVTFVAFVLNLAFA  221

Query  950   lsvlGFLIMHISLVSRNTT  1006
             LS+LGFLIMH+ LV+RNTT
Sbjct  222   LSILGFLIMHLMLVARNTT  240



>ref|XP_006413626.1| hypothetical protein EUTSA_v10024722mg [Eutrema salsugineum]
 gb|ESQ55079.1| hypothetical protein EUTSA_v10024722mg [Eutrema salsugineum]
Length=599

 Score =   195 bits (495),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 153/196 (78%), Gaps = 4/196 (2%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGD-TDPL  604
             A+ +G FD+LVAL V+ LFH LL+MLLWSYFSVV TDPG VPP WRP LD E+ +   P 
Sbjct  337   ALLLGGFDSLVALLVLGLFHFLLIMLLWSYFSVVVTDPGGVPPGWRPELDIEKNEGNQPA  396

Query  605   TASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNY  784
              A +  S+   ++   +R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA+NY
Sbjct  397   IADQSLSVGGSSSHG-VRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAMNY  455

Query  785   KYfllflfytflettlvtlSLLPNFLAFFGD--VDIPGSAGDlattflafvlnlafalsv  958
             K FLLFLFYTFLETT+V  SL P FL FF D   DI  S G LA TF+AFVLN+AFALSV
Sbjct  456   KSFLLFLFYTFLETTVVATSLFPVFLVFFTDEEADITVSPGSLAATFVAFVLNIAFALSV  515

Query  959   lGFLIMHISLVSRNTT  1006
             LGFLIMHI LV+RN+T
Sbjct  516   LGFLIMHILLVARNST  531


 Score = 48.5 bits (114),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  271  YRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            Y     MAWNVFKFCTALR LGSIMIL+V+G++G TYY VV+ NYGP L
Sbjct  290  YDYPRTMAWNVFKFCTALRALGSIMILVVIGIIGFTYYAVVVANYGPAL  338



>ref|XP_012066562.1| PREDICTED: probable protein S-acyltransferase 14 [Jatropha curcas]
 gb|KDP42560.1| hypothetical protein JCGZ_24334 [Jatropha curcas]
Length=316

 Score =   193 bits (491),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 137/172 (80%), Gaps = 6/172 (3%)
 Frame = +2

Query  509   WSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT------ASEFGSLPPDTAQSRIRFCKK  670
             WSYF+ V TDPG VPPNWRP++DEERG+TD L        S+  S+  + A  R RFC+K
Sbjct  78    WSYFTTVLTDPGGVPPNWRPSIDEERGETDALMEHGANLGSDRSSVLGEPANQRTRFCRK  137

Query  671   CNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLL  850
             CNQ KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYF LFL YTFLETTLVTLSLL
Sbjct  138   CNQFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFFLFLVYTFLETTLVTLSLL  197

Query  851   PNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
               F+AFF D +I G+ G L  TF+ FVLNL+FALSV+GFLIMHISL+  NTT
Sbjct  198   RLFIAFFADGEISGTPGSLVATFITFVLNLSFALSVMGFLIMHISLILANTT  249



>gb|KHG16541.1| hypothetical protein F383_02611 [Gossypium arboreum]
Length=308

 Score =   193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 148/197 (75%), Gaps = 7/197 (4%)
 Frame = +2

Query  437   VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASE  616
             +G F+T  A+ V+ +FH LLVM++W Y SVV TDPG VPPNWRP  DEE+GD DPL  S 
Sbjct  45    LGGFETFFAIVVLIVFHSLLVMVMWCYSSVVVTDPGGVPPNWRPLTDEEKGDADPLVGSS  104

Query  617   FGSLPPDTAQS-------RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA  775
             +GS   D  QS        IRFC KC Q KPPR HHCSVC RC+LKMDHHCVWVVNCVGA
Sbjct  105   YGSAQLDPKQSAMVAASQEIRFCHKCKQFKPPRAHHCSVCRRCILKMDHHCVWVVNCVGA  164

Query  776   LNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafals  955
             LNYKYFLLFLFYTFLETTLV+L LL  F+ FF + ++  + G LA TF+ FVLN+AF LS
Sbjct  165   LNYKYFLLFLFYTFLETTLVSLLLLRVFMEFFMEGEVDETPGSLAATFITFVLNIAFMLS  224

Query  956   vlGFLIMHISLVSRNTT  1006
             +LGFLIMHI+LV  NT+
Sbjct  225   ILGFLIMHITLVGANTS  241



>ref|XP_001781101.1| predicted protein [Physcomitrella patens]
 gb|EDQ54049.1| predicted protein, partial [Physcomitrella patens]
Length=306

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 147/194 (76%), Gaps = 5/194 (3%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGD--TDPLTAS  613
             G  D   A  V+ LFH LL MLLW YFSVVFTDPG VPP+WRP+  EE  +  + PLT +
Sbjct  47    GGSDAFTAFLVLFLFHALLAMLLWCYFSVVFTDPGGVPPSWRPSSSEEDLEVPSLPLTQN  106

Query  614   ---EFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNY  784
                +   +P  +   R R+C+KC+Q KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGA NY
Sbjct  107   SSHDSAKIPTMSQSGRARYCRKCSQYKPPRCHHCSVCGRCILKMDHHCVWVVNCVGACNY  166

Query  785   KYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlG  964
             KYFLLFLFYT LET++VT+SLLP F+AFFGDV+     G L  TFL FVLN+AFALSVLG
Sbjct  167   KYFLLFLFYTLLETSVVTVSLLPAFIAFFGDVEETAIPGSLVATFLGFVLNMAFALSVLG  226

Query  965   FLIMHISLVSRNTT  1006
             FLIMHISLV  NTT
Sbjct  227   FLIMHISLVGGNTT  240



>ref|NP_567668.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
 sp|Q94C49.1|ZDH18_ARATH RecName: Full=Probable protein S-acyltransferase 13; AltName: 
Full=Probable palmitoyltransferase At4g22750; AltName: Full=Zinc 
finger DHHC domain-containing protein At4g22750 [Arabidopsis 
thaliana]
 gb|AAK59683.1| unknown protein [Arabidopsis thaliana]
 gb|AAL33803.1| unknown protein [Arabidopsis thaliana]
 gb|AEE84651.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
Length=302

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 152/195 (78%), Gaps = 4/195 (2%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+ +G  D+L+++ V+A FH LL+MLLWSYFSVV TDPG VP  WRP LD E+ + +   
Sbjct  42    ALLIGGVDSLLSVLVLAFFHFLLIMLLWSYFSVVVTDPGGVPTGWRPELDIEKSEGNQAL  101

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
               E  +   D++   +R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK
Sbjct  102   IGE--ASVGDSSSHGVRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGANNYK  159

Query  788   YfllflfytflettlvtlSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvl  961
              FLLFLFYTFLETT+V +SLLP FL FF  GD DI  S G LA +F+AFVLN+AFALSVL
Sbjct  160   SFLLFLFYTFLETTVVAVSLLPIFLVFFSDGDGDITVSPGSLAASFVAFVLNIAFALSVL  219

Query  962   GFLIMHISLVSRNTT  1006
             GFLIMHI LV+RNTT
Sbjct  220   GFLIMHIMLVARNTT  234



>ref|XP_008776787.1| PREDICTED: probable protein S-acyltransferase 14 [Phoenix dactylifera]
Length=317

 Score =   184 bits (467),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 143/175 (82%), Gaps = 9/175 (5%)
 Frame = +2

Query  509   WSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLP---------PDTAQSRIRF  661
             WSYFSVV TDPG +PPNW+P +DEERG+  PL   EFG+            D+   RIR+
Sbjct  77    WSYFSVVLTDPGSIPPNWKPTVDEERGEEAPLNGLEFGNQSLSFQQSVNLADSGSPRIRY  136

Query  662   CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  841
             C+KCNQLKPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYK+FLLFLFYTFLETTLVTL
Sbjct  137   CRKCNQLKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKFFLLFLFYTFLETTLVTL  196

Query  842   SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
              LL NF+ FF D +IPG+ G LATTFL FVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  197   LLLQNFITFFSDAEIPGTPGTLATTFLTFVLNLAFALSVLGFLIMHISLVAGNTT  251


 Score = 52.8 bits (125),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGP  411
            M RS  VMAWNVF+FCT+LRGLGS+MIL+VLG+VGVTYY VV+TNYGP
Sbjct  1    MQRSETVMAWNVFRFCTSLRGLGSVMILIVLGIVGVTYYAVVVTNYGP  48



>ref|XP_002535239.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF27145.1| zinc finger protein, putative [Ricinus communis]
Length=261

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 141/182 (77%), Gaps = 11/182 (6%)
 Frame = +2

Query  494   LVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPDTAQ---------  646
             LVMLLWSYF+ V TDPG VPPNWRP++DEERG+ DPL   E G       Q         
Sbjct  13    LVMLLWSYFATVLTDPGGVPPNWRPSIDEERGEADPLMRIEHGDANSGLNQFTILGKPDD  72

Query  647   SRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflet  826
              R+RFC+KCNQ KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET
Sbjct  73    QRMRFCRKCNQFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET  132

Query  827   tlvtlSLLPNFLAFFGDVD--IPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRN  1000
             TLVTLSLL  F+AFF D D  +  + G L  TF+ FVLNL+FALSV+GFLIMHISLV  N
Sbjct  133   TLVTLSLLRLFVAFFTDSDAEVTETPGILVATFITFVLNLSFALSVVGFLIMHISLVLAN  192

Query  1001  TT  1006
             T+
Sbjct  193   TS  194



>ref|XP_009136109.1| PREDICTED: probable protein S-acyltransferase 13 [Brassica rapa]
Length=301

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 152/193 (79%), Gaps = 7/193 (4%)
 Frame = +2

Query  437   VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASE  616
             +G FD+L+AL V+ALFH LL+MLLWSYFSVV TDPG VPP WRP LD E+ D +     E
Sbjct  45    LGGFDSLLALLVLALFHFLLIMLLWSYFSVVVTDPGGVPPGWRPELDIEKSDGN----QE  100

Query  617   FGSLP-PDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYf  793
             + SL   D++   +R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK F
Sbjct  101   YSSLTVGDSSSHIVRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAKNYKSF  160

Query  794   llflfytflettlvtlSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGF  967
             LLFLFYTFLETT+V +SL P FL FF  GD D+  S G LA TF+AFVLN+ FALSVLGF
Sbjct  161   LLFLFYTFLETTVVAISLFPVFLVFFTDGDSDVTVSPGSLAATFVAFVLNITFALSVLGF  220

Query  968   LIMHISLVSRNTT  1006
             LIMHI LV RNTT
Sbjct  221   LIMHIMLVIRNTT  233



>ref|XP_009136132.1| PREDICTED: probable protein S-acyltransferase 13 [Brassica rapa]
Length=302

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 152/193 (79%), Gaps = 7/193 (4%)
 Frame = +2

Query  437   VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASE  616
             +G FD+L+AL V+ALFH LL+MLLWSYFSVV TDPG VPP WRP LD E+ D +     E
Sbjct  45    LGGFDSLLALLVLALFHFLLIMLLWSYFSVVVTDPGGVPPGWRPELDIEKSDGN----QE  100

Query  617   FGSLP-PDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYf  793
             + SL   D++   +R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK F
Sbjct  101   YSSLTVGDSSSHIVRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAKNYKSF  160

Query  794   llflfytflettlvtlSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGF  967
             LLFLFYTFLETT+V +SL P FL FF  GD D+  S G LA TF+AFVLN+ FALSVLGF
Sbjct  161   LLFLFYTFLETTVVAISLFPVFLVFFTDGDSDVTVSPGSLAATFVAFVLNITFALSVLGF  220

Query  968   LIMHISLVSRNTT  1006
             LIMHI LV RNTT
Sbjct  221   LIMHIMLVIRNTT  233



>gb|KFK28858.1| hypothetical protein AALP_AA7G057700 [Arabis alpina]
Length=304

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 152/193 (79%), Gaps = 3/193 (2%)
 Frame = +2

Query  437   VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASE  616
             +G FD+L+AL V+ LFH LLVML+WSYFSVV TDPG VPP WRP LD E+ + +     E
Sbjct  45    LGGFDSLLALLVLGLFHFLLVMLVWSYFSVVVTDPGGVPPGWRPELDIEKSEGNQQAIVE  104

Query  617   FGSLP-PDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYf  793
                +   D++   +R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA+NYK F
Sbjct  105   ANPISVGDSSSHIVRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAMNYKSF  164

Query  794   llflfytflettlvtlSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGF  967
             LLFLFYTFLETTLV +SLLP FL FF  GD DI  S G LA TF+AFVLN+AFALSVLGF
Sbjct  165   LLFLFYTFLETTLVAVSLLPVFLVFFSDGDDDITVSPGSLAATFVAFVLNIAFALSVLGF  224

Query  968   LIMHISLVSRNTT  1006
             LIMHI LV RNTT
Sbjct  225   LIMHIMLVRRNTT  237



>emb|CDX82967.1| BnaC01g14170D [Brassica napus]
Length=583

 Score =   186 bits (473),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 152/193 (79%), Gaps = 7/193 (4%)
 Frame = +2

Query  437   VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASE  616
             +G FD+L+AL V+ALFH LL+MLLWSYFSVV TDPG VPP WRP LD E+ D +     E
Sbjct  346   LGGFDSLLALLVLALFHFLLIMLLWSYFSVVVTDPGGVPPGWRPELDIEKSDGN----QE  401

Query  617   FGSLP-PDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYf  793
             + SL   D++   +R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK F
Sbjct  402   YSSLTVGDSSSHIVRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAKNYKSF  461

Query  794   llflfytflettlvtlSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGF  967
             LLFLFYTFLETT+V +SL P FL FF  GD D+  S G LA TF+AFVLN+ FALSVLGF
Sbjct  462   LLFLFYTFLETTVVAISLFPVFLVFFTDGDSDVTVSPGSLAATFVAFVLNITFALSVLGF  521

Query  968   LIMHISLVSRNTT  1006
             LIMHI LV RNTT
Sbjct  522   LIMHIMLVIRNTT  534


 Score = 47.4 bits (111),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  277  SGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            S   MAWNVFK+CTALR LGSIMIL+V+G++G TYY +V+ NYGP L
Sbjct  298  SSRAMAWNVFKYCTALRALGSIMILVVIGIIGFTYYALVVANYGPSL  344



>ref|XP_010448848.1| PREDICTED: probable protein S-acyltransferase 13 [Camelina sativa]
Length=304

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 155/197 (79%), Gaps = 4/197 (2%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G FD+LVAL V+ALFH LLVMLLWSYFSVV TDPG VP  WRP LD E+ D +   
Sbjct  42    ALLTGGFDSLVALLVLALFHFLLVMLLWSYFSVVVTDPGGVPTGWRPELDIEKSDGNQTL  101

Query  608   ASEFG-SLP-PDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALN  781
               E   SL   D++   +R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA+N
Sbjct  102   IGEANPSLSVGDSSTHGVRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAMN  161

Query  782   YKYfllflfytflettlvtlSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafals  955
             YK FLLFLFYTFLETTLV +SLLP FL FF  GD DI  S G LA TF+AFVLN+AFALS
Sbjct  162   YKSFLLFLFYTFLETTLVAISLLPVFLVFFSDGDGDITVSPGSLAATFVAFVLNIAFALS  221

Query  956   vlGFLIMHISLVSRNTT  1006
             VLGFLIMHI LV+RNTT
Sbjct  222   VLGFLIMHIMLVARNTT  238



>ref|XP_004515766.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cicer arietinum]
Length=299

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 136/189 (72%), Gaps = 12/189 (6%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G   ++ A  V+ +FH LLVMLLWSYFSVVFTDPG VP NWRP + +  GD D       
Sbjct  56    GRIQSISAFIVLLIFHALLVMLLWSYFSVVFTDPGRVPLNWRPKICKNIGDDDSYD----  111

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
                       RIR+C+KCNQ KPPRCHHCS CGRC+LKMDHHC+WVVNCVGALNYKYFLL
Sbjct  112   --------DQRIRYCRKCNQFKPPRCHHCSSCGRCILKMDHHCIWVVNCVGALNYKYFLL  163

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYT LET LVT+SL P   AFF D D+  S   LA +F+AF  NL F LS+LGFLIMH
Sbjct  164   FLFYTLLETALVTVSLFPYVKAFFSDEDVFVSLTTLAVSFIAFAFNLVFVLSILGFLIMH  223

Query  980   ISLVSRNTT  1006
             +SLV+ NTT
Sbjct  224   VSLVATNTT  232



>ref|NP_001190801.1| sterol 4-alpha methyl oxidase 1-3 [Arabidopsis thaliana]
 gb|AEE84650.1| sterol 4-alpha methyl oxidase 1-3 [Arabidopsis thaliana]
Length=581

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 152/195 (78%), Gaps = 4/195 (2%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+ +G  D+L+++ V+A FH LL+MLLWSYFSVV TDPG VP  WRP LD E+ + +   
Sbjct  321   ALLIGGVDSLLSVLVLAFFHFLLIMLLWSYFSVVVTDPGGVPTGWRPELDIEKSEGNQAL  380

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
               E  +   D++   +R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK
Sbjct  381   IGE--ASVGDSSSHGVRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGANNYK  438

Query  788   YfllflfytflettlvtlSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvl  961
              FLLFLFYTFLETT+V +SLLP FL FF  GD DI  S G LA +F+AFVLN+AFALSVL
Sbjct  439   SFLLFLFYTFLETTVVAVSLLPIFLVFFSDGDGDITVSPGSLAASFVAFVLNIAFALSVL  498

Query  962   GFLIMHISLVSRNTT  1006
             GFLIMHI LV+RNTT
Sbjct  499   GFLIMHIMLVARNTT  513



>ref|XP_010439292.1| PREDICTED: probable protein S-acyltransferase 13 [Camelina sativa]
Length=305

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 154/194 (79%), Gaps = 5/194 (3%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALD-EERGDTDPLTASE  616
             G FD+LVAL V+ALFH LLVMLLWSYFSVV TDPG VP  WRP LD E+ GD +     E
Sbjct  46    GGFDSLVALLVLALFHFLLVMLLWSYFSVVVTDPGGVPTGWRPELDIEKSGDGNQNLIGE  105

Query  617   FG-SLP-PDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKY  790
                SL   D++   +R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA+NYK 
Sbjct  106   ANPSLSVGDSSNHGVRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAMNYKS  165

Query  791   fllflfytflettlvtlSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlG  964
             FLLFLFYTFLETTLV +SLLP FL FF  GD DI  S G LA TF+AFVLN+AFALSVLG
Sbjct  166   FLLFLFYTFLETTLVAISLLPVFLVFFGDGDGDITVSPGSLAATFVAFVLNIAFALSVLG  225

Query  965   FLIMHISLVSRNTT  1006
             FLIMHI LV+RNTT
Sbjct  226   FLIMHIMLVARNTT  239



>ref|XP_006283414.1| hypothetical protein CARUB_v10004463mg [Capsella rubella]
 gb|EOA16312.1| hypothetical protein CARUB_v10004463mg [Capsella rubella]
Length=574

 Score =   188 bits (478),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 153/194 (79%), Gaps = 4/194 (2%)
 Frame = +2

Query  437   VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASE  616
             +G FD+LVAL V+ALFH LLVMLLWSYFSVV TDPG VP  WRP LD E+ D +  +   
Sbjct  315   IGGFDSLVALLVLALFHFLLVMLLWSYFSVVVTDPGGVPTGWRPELDIEKSDGNQHSTGV  374

Query  617   FGSLPP--DTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKY  790
                 P   D++   +R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA+NYK 
Sbjct  375   ANQAPSVGDSSSHGVRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAMNYKA  434

Query  791   fllflfytflettlvtlSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlG  964
             FLLFLFYTFLETT+V +SLLP FL FF  GD DI  S G LA TF+AFVLN+AFALSVLG
Sbjct  435   FLLFLFYTFLETTVVAISLLPVFLVFFSDGDGDITVSPGSLAATFVAFVLNIAFALSVLG  494

Query  965   FLIMHISLVSRNTT  1006
             FLIMHI LV+RNTT
Sbjct  495   FLIMHIMLVARNTT  508



>ref|XP_010910146.1| PREDICTED: probable protein S-acyltransferase 14 [Elaeis guineensis]
Length=317

 Score =   170 bits (431),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 138/175 (79%), Gaps = 9/175 (5%)
 Frame = +2

Query  509   WSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLP---------PDTAQSRIRF  661
             W YFSVV TDPG VPPNW+P +DEERG+  PL   EF +            D+   R R+
Sbjct  77    WCYFSVVLTDPGSVPPNWKPTVDEERGEETPLNNLEFTNQILSFQQSANLADSGSPRTRY  136

Query  662   CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  841
             C+KCN LKPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYK+FLLFLFYTFLETTLVTL
Sbjct  137   CRKCNHLKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKFFLLFLFYTFLETTLVTL  196

Query  842   SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
              LL NF+  F D ++PG+ G LATTFL FVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  197   LLLSNFITLFSDEEVPGTPGTLATTFLTFVLNLAFALSVLGFLIMHISLVAGNTT  251


 Score = 58.5 bits (140),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGP  411
            M RSGAVMAWNVF+FCTALRGLGS+MILLVLG+VGVTYY VV+TNYGP
Sbjct  1    MQRSGAVMAWNVFRFCTALRGLGSVMILLVLGIVGVTYYAVVVTNYGP  48



>gb|AAM65313.1| unknown [Arabidopsis thaliana]
Length=302

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 153/195 (78%), Gaps = 4/195 (2%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+ +G  D+L+++ V+ALFH LL+MLLWSYFSVV TDPG VP  WRP LD E+ + +   
Sbjct  42    ALLIGGVDSLLSVLVLALFHFLLIMLLWSYFSVVVTDPGGVPTGWRPELDIEKSEGNQAL  101

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
               E  +   D++   +R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK
Sbjct  102   IGE--ASVGDSSSHGVRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGANNYK  159

Query  788   YfllflfytflettlvtlSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvl  961
              FLLFLFYTFLETT+V +SLLP FL FF  GD DI  S G LA +F+AFVLN+AFALSVL
Sbjct  160   SFLLFLFYTFLETTVVAVSLLPIFLVFFSDGDGDITVSPGSLAASFVAFVLNIAFALSVL  219

Query  962   GFLIMHISLVSRNTT  1006
             GFLIMHI LV+RNTT
Sbjct  220   GFLIMHIMLVARNTT  234



>ref|XP_006440414.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
 gb|ESR53654.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
 gb|KDO63756.1| hypothetical protein CISIN_1g021223mg [Citrus sinensis]
Length=253

 Score =   178 bits (451),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 138/180 (77%), Gaps = 9/180 (5%)
 Frame = +2

Query  494   LVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPDTAQSR-------  652
             LVML+WSYFSVV TDPG VPPNW P LDEE G       S+   +     QS        
Sbjct  10    LVMLVWSYFSVVITDPGGVPPNWIPNLDEESGGAGQWAGSDNDGVDLGANQSAMLIEPKH  69

Query  653   --IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflet  826
               +RFC+KCNQ KPPRCHHCSVC RC+LKMDHHCVWVVNCVGA NYKYFLLFLFYTFLET
Sbjct  70    QGVRFCQKCNQFKPPRCHHCSVCRRCILKMDHHCVWVVNCVGAFNYKYFLLFLFYTFLET  129

Query  827   tlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             TLVT+SLLP F+A F D +IP S G+LA +F+ FVLNLAFALS+LGFLIMHISLV+ NTT
Sbjct  130   TLVTVSLLPIFIALFTDDEIPESPGNLAASFITFVLNLAFALSILGFLIMHISLVAGNTT  189



>ref|NP_001154264.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
 gb|AEE84652.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
Length=324

 Score =   178 bits (452),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 152/217 (70%), Gaps = 26/217 (12%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCL----------------------LVMLLWSYFSVVFTDP  541
             A+ +G  D+L+++ V+A FH L                      L+MLLWSYFSVV TDP
Sbjct  42    ALLIGGVDSLLSVLVLAFFHFLWAQSSLACGFTFVLSTFELPRILIMLLWSYFSVVVTDP  101

Query  542   GIVPPNWRPALDEERGDTDPLTASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGR  721
             G VP  WRP LD E+ + +     E  +   D++   +R+C+KCNQ KPPR HHCSVCGR
Sbjct  102   GGVPTGWRPELDIEKSEGNQALIGE--ASVGDSSSHGVRYCRKCNQYKPPRSHHCSVCGR  159

Query  722   CVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLPNFLAFF--GDVDIPGS  895
             C+LKMDHHCVWVVNCVGA NYK FLLFLFYTFLETT+V +SLLP FL FF  GD DI  S
Sbjct  160   CILKMDHHCVWVVNCVGANNYKSFLLFLFYTFLETTVVAVSLLPIFLVFFSDGDGDITVS  219

Query  896   AGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
              G LA +F+AFVLN+AFALSVLGFLIMHI LV+RNTT
Sbjct  220   PGSLAASFVAFVLNIAFALSVLGFLIMHIMLVARNTT  256



>ref|XP_002994078.1| hypothetical protein SELMODRAFT_449300 [Selaginella moellendorffii]
 gb|EFJ04865.1| hypothetical protein SELMODRAFT_449300 [Selaginella moellendorffii]
Length=313

 Score =   177 bits (450),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 147/196 (75%), Gaps = 13/196 (7%)
 Frame = +2

Query  458   VALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPA---LDEERGDT--DPLTASEFG  622
             VA  VI  FH LL M+LW YF+VVFTDPG VP +W+PA    D E  +T    L A+   
Sbjct  52    VAALVIVAFHLLLAMVLWCYFAVVFTDPGSVPSDWKPASANEDMEAQNTLLSSLPANSAA  111

Query  623   SLPPDTAQ-------SRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALN  781
              L   T Q       SR+RFC+KC Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA N
Sbjct  112   VLTAPTTQMSTSLDSSRMRFCRKCCQFKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGARN  171

Query  782   YKYfllflfytflettlvtlSLLPNFLAFFGDV-DIPGSAGDlattflafvlnlafalsv  958
             YK FLLFLFYTFLET+LV+LSLLP+F+AFF D  D P   G LATTFLAFVL+LAFALSV
Sbjct  172   YKAFLLFLFYTFLETSLVSLSLLPHFIAFFTDADDEPALPGTLATTFLAFVLDLAFALSV  231

Query  959   lGFLIMHISLVSRNTT  1006
             LGFLIMHISLV+ NTT
Sbjct  232   LGFLIMHISLVAGNTT  247



>ref|XP_006368710.1| hypothetical protein POPTR_0001s08000g [Populus trichocarpa]
 gb|ERP65279.1| hypothetical protein POPTR_0001s08000g [Populus trichocarpa]
Length=304

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 147/211 (70%), Gaps = 19/211 (9%)
 Frame = +2

Query  431   VGVGVFDTLVALFVIALFHCLL----------VMLLWSYFSVVFTDPGIVPPNWRPALDE  580
             +GV  +  +VA +  ALFH  L          VMLLWSYF+ V TDPG VPPNWRP++DE
Sbjct  27    IGVTYYVIVVANYGPALFHGGLDSFVALLVLLVMLLWSYFTTVLTDPGGVPPNWRPSIDE  86

Query  581   ERGDTDPLTASEFGSLPPDTAQS---------RIRFCKKCNQLKPPRCHHCSVCGRCVLK  733
             E GD DPL          D  QS         R R C+KCN  KPPRCHHCSVCGRC+LK
Sbjct  87    ESGDADPLVGLAHEGTGLDLNQSAMLGEPANPRTRACRKCNWFKPPRCHHCSVCGRCILK  146

Query  734   MDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlat  913
             MDHHCVWVVNCVGALNYKYFLLFLFYTFL TTLVTLSLLP FLAFF   +  G+   L  
Sbjct  147   MDHHCVWVVNCVGALNYKYFLLFLFYTFLVTTLVTLSLLPQFLAFFTVGEKNGTPETLVA  206

Query  914   tflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             TF+ FVLNL+FALS++GFLIMHISLV  NTT
Sbjct  207   TFVTFVLNLSFALSIMGFLIMHISLVLGNTT  237



>ref|XP_002989117.1| hypothetical protein SELMODRAFT_184354 [Selaginella moellendorffii]
 gb|EFJ09911.1| hypothetical protein SELMODRAFT_184354 [Selaginella moellendorffii]
Length=314

 Score =   174 bits (442),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 146/197 (74%), Gaps = 14/197 (7%)
 Frame = +2

Query  458   VALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPA----LDEERGDT--DPLTASEF  619
             VA  VI  FH LL M+LW YF+VVFTDPG VP +W+PA     D E  +T    L A+  
Sbjct  52    VAALVIVAFHLLLAMVLWCYFAVVFTDPGSVPSDWKPASANEEDMEAQNTLLSSLPANSA  111

Query  620   GSLPPDTAQS-------RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  778
               L   T Q        R+RFC+KC Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA 
Sbjct  112   AVLTAPTTQMSTSLDSPRMRFCRKCCQFKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAR  171

Query  779   NYKYfllflfytflettlvtlSLLPNFLAFFGDV-DIPGSAGDlattflafvlnlafals  955
             NYK FLLFLFYTFLET+LV+LSLLP+F+AFF D  D P   G LATTFLAFVL+LAFALS
Sbjct  172   NYKAFLLFLFYTFLETSLVSLSLLPHFIAFFTDADDEPALPGTLATTFLAFVLDLAFALS  231

Query  956   vlGFLIMHISLVSRNTT  1006
             VLGFLIMHISLV+ NTT
Sbjct  232   VLGFLIMHISLVAGNTT  248



>emb|CAB82684.1| putative protein [Arabidopsis thaliana]
Length=273

 Score =   164 bits (416),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 143/193 (74%), Gaps = 25/193 (13%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+  G  D+L AL ++ LFH LL MLLWSYFSVVFTDPG+VPPNWRP+ DEERG++DPL 
Sbjct  42    ALSQGGLDSLAALTILILFHFLLAMLLWSYFSVVFTDPGVVPPNWRPSTDEERGESDPLN  101

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
             + +F  L  D++ S  R                         MDHHCVWVVNCVGALNYK
Sbjct  102   SLDFVGLQSDSSSSNPR-------------------------MDHHCVWVVNCVGALNYK  136

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             YFLLFLFYTFLETTLVTL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GF
Sbjct  137   YFLLFLFYTFLETTLVTLVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGF  196

Query  968   LIMHISLVSRNTT  1006
             LIMHISLV+ NTT
Sbjct  197   LIMHISLVAGNTT  209


 Score = 52.0 bits (123),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +1

Query  289  MAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPILA  420
            MAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L+
Sbjct  1    MAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPALS  44



>gb|KJB37583.1| hypothetical protein B456_006G211800 [Gossypium raimondii]
Length=523

 Score =   177 bits (448),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 135/178 (76%), Gaps = 7/178 (4%)
 Frame = +2

Query  494   LVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPDTAQS-------R  652
             LVM++W Y SVV TDPG VPPNWRP  DEE+GD DPL  S +GS   D  QS        
Sbjct  279   LVMVMWCYSSVVVTDPGGVPPNWRPLTDEEKGDADPLVGSGYGSAQLDPKQSATVAVSQE  338

Query  653   IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettl  832
             IRFC KC Q KPPR HHCSVC RC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTL
Sbjct  339   IRFCHKCKQFKPPRAHHCSVCRRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTL  398

Query  833   vtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             V+L LL  F+ FF + +I  + G LA TF+ FVLN+AF LS+LGFLIMHI+LV  NT+
Sbjct  399   VSLLLLRVFMEFFNEGEIDETPGSLAATFITFVLNIAFTLSILGFLIMHITLVGANTS  456



>emb|CDY71422.1| BnaAnng37380D, partial [Brassica napus]
Length=186

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 122/158 (77%), Gaps = 7/158 (4%)
 Frame = +2

Query  437  VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASE  616
            +G FD+L+AL V+ALFH LL+MLLWSYFSVV TDPG VPP WRP LD E+ D +     E
Sbjct  27   LGGFDSLLALLVLALFHFLLIMLLWSYFSVVVTDPGGVPPGWRPELDIEKSDGN----QE  82

Query  617  FGSLP-PDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYf  793
            + SL   D++   +R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK F
Sbjct  83   YSSLTVGDSSSHIVRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAKNYKSF  142

Query  794  llflfytflettlvtlSLLPNFLAFF--GDVDIPGSAG  901
            LLFLFYTFLETT+V +SL P FL FF  GD D+  S G
Sbjct  143  LLFLFYTFLETTVVAISLFPVFLVFFTDGDSDVTVSPG  180



>ref|XP_009351330.1| PREDICTED: probable protein S-acyltransferase 14, partial [Pyrus 
x bretschneideri]
Length=148

 Score =   158 bits (399),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +2

Query  440  GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
            G  D+L+A+ V+ +FHCLLVMLLWSYFSVV TDPG VPPNWRPA+DEERG+ DPLT  +F
Sbjct  53   GGLDSLIAVGVLIIFHCLLVMLLWSYFSVVLTDPGGVPPNWRPAVDEERGEADPLTWLDF  112

Query  620  GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCV  727
              L PD +  RIR+C+KCNQLKPPRCHHCSVCGRCV
Sbjct  113  NGLQPDPSNQRIRYCRKCNQLKPPRCHHCSVCGRCV  148


 Score = 53.5 bits (127),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSG  MAWNVFKFC  LRGLGS+MILLVLGVVGVTYY VV TNYGP L
Sbjct  1    MHRSGVAMAWNVFKFCIVLRGLGSVMILLVLGVVGVTYYTVVFTNYGPAL  50



>ref|XP_006830293.2| PREDICTED: probable protein S-acyltransferase 12 [Amborella trichopoda]
 ref|XP_011629393.1| PREDICTED: probable protein S-acyltransferase 12 [Amborella trichopoda]
Length=308

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 144/201 (72%), Gaps = 12/201 (6%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDT-DPLTASE  616
             G F   +++F++ +FH LL ML+WSY  VVFTDPG VP NWR  LDEE  +T     +S+
Sbjct  47    GGFRAAISIFILVIFHFLLAMLIWSYCMVVFTDPGSVPENWRRLLDEENPETVASANSSD  106

Query  617   F-------GSLPPDTAQSRIR---FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNC  766
             F        +  P T+ +R     +C +C   KPPRCHHCSVC RCVLKMDHHCVWVVNC
Sbjct  107   FVAPIVRSSAWSPSTSMARTSEGGYCGRCQNNKPPRCHHCSVCQRCVLKMDHHCVWVVNC  166

Query  767   VGALNYKYfllflfytflettlvtlSLLPNFLAFFGDV-DIPGSAGDlattflafvlnla  943
             VGA NYK+FLLFL YTFLETTL TL LLP+F+ FFG+  +  GS G+LA +FL FVLNLA
Sbjct  167   VGAGNYKFFLLFLMYTFLETTLDTLVLLPHFIEFFGEAKNRSGSPGNLAISFLTFVLNLA  226

Query  944   falsvlGFLIMHISLVSRNTT  1006
             FALS+LGFLIMH SL+  NTT
Sbjct  227   FALSLLGFLIMHASLLLSNTT  247



>ref|XP_004306624.1| PREDICTED: probable protein S-acyltransferase 12 [Fragaria vesca 
subsp. vesca]
 ref|XP_011468902.1| PREDICTED: probable protein S-acyltransferase 12 [Fragaria vesca 
subsp. vesca]
 ref|XP_011468903.1| PREDICTED: probable protein S-acyltransferase 12 [Fragaria vesca 
subsp. vesca]
Length=308

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 141/200 (71%), Gaps = 11/200 (6%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDT-DPLTASE  616
             G F + +A+ ++ LFH LLVMLLW YF VVFTDPG VP NW+P   EE  +    LT+SE
Sbjct  46    GGFHSFLAISIVVLFHFLLVMLLWCYFMVVFTDPGSVPENWKPLTQEEILEAGSSLTSSE  105

Query  617   ------FGSLPPDTAQSR---IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCV  769
                   F S+     Q R   + +C +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCV
Sbjct  106   ITAPEAFTSMHSTDGQERRPEVAYCSRCQNAKPPRCHHCSVCQRCVLKMDHHCVWVVNCV  165

Query  770   GALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlaf  946
             GA NYK FLLFL YTFLETT+ TL LLPNF+ FF +     ++ G+LA  F+ FVLNLAF
Sbjct  166   GATNYKSFLLFLLYTFLETTMNTLVLLPNFINFFSEAKSHSTSPGNLAVVFVTFVLNLAF  225

Query  947   alsvlGFLIMHISLVSRNTT  1006
             +LS+L F++MHISL+S NTT
Sbjct  226   SLSLLCFVVMHISLLSSNTT  245



>gb|KCW73003.1| hypothetical protein EUGRSUZ_E01439 [Eucalyptus grandis]
Length=164

 Score =   145 bits (366),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 81/105 (77%), Gaps = 1/105 (1%)
 Frame = +2

Query  440  GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
            G  D+ VAL V+ LFHCLLVMLLWSYFSVV TDPG +PPNWRP++DEERG++DPL   +F
Sbjct  53   GGVDSFVALGVLILFHCLLVMLLWSYFSVVLTDPGGIPPNWRPSVDEERGESDPLNGLDF  112

Query  620  GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVW  754
              L  D +  RIRFC+KCNQ KPPRCHHCSVC +C   + + C++
Sbjct  113  SVLQSDPSHRRIRFCRKCNQPKPPRCHHCSVC-QCFYIIQYFCLF  156


 Score = 63.2 bits (152),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            MYRSGAVMAWNVFKFCTALRGLGSIMILLVLGVVGVTYY VVLTNYGP L
Sbjct  1    MYRSGAVMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPNL  50



>gb|ERM97709.1| hypothetical protein AMTR_s00121p00069490, partial [Amborella 
trichopoda]
Length=367

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 144/201 (72%), Gaps = 12/201 (6%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDT-DPLTASE  616
             G F   +++F++ +FH LL ML+WSY  VVFTDPG VP NWR  LDEE  +T     +S+
Sbjct  106   GGFRAAISIFILVIFHFLLAMLIWSYCMVVFTDPGSVPENWRRLLDEENPETVASANSSD  165

Query  617   F-------GSLPPDTAQSRIR---FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNC  766
             F        +  P T+ +R     +C +C   KPPRCHHCSVC RCVLKMDHHCVWVVNC
Sbjct  166   FVAPIVRSSAWSPSTSMARTSEGGYCGRCQNNKPPRCHHCSVCQRCVLKMDHHCVWVVNC  225

Query  767   VGALNYKYfllflfytflettlvtlSLLPNFLAFFGDV-DIPGSAGDlattflafvlnla  943
             VGA NYK+FLLFL YTFLETTL TL LLP+F+ FFG+  +  GS G+LA +FL FVLNLA
Sbjct  226   VGAGNYKFFLLFLMYTFLETTLDTLVLLPHFIEFFGEAKNRSGSPGNLAISFLTFVLNLA  285

Query  944   falsvlGFLIMHISLVSRNTT  1006
             FALS+LGFLIMH SL+  NTT
Sbjct  286   FALSLLGFLIMHASLLLSNTT  306



>gb|KJB25654.1| hypothetical protein B456_004G202600 [Gossypium raimondii]
Length=292

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 142/198 (72%), Gaps = 9/198 (5%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G FDTL+A+  + LFH LLVM+LW+Y +VV TDPG VP NWRP  +EE+GD DPL    +
Sbjct  28    GGFDTLIAVAFLFLFHLLLVMVLWTYATVVLTDPGGVPLNWRPLREEEKGDADPLVGLGY  87

Query  620   G---------SLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVG  772
             G         ++P D     I FC KCN+LKPPR HHCS+C RC+LKMDHHC WV NCVG
Sbjct  88    GIAKIGTNQSAVPGDFKNLDIGFCLKCNRLKPPRAHHCSICNRCILKMDHHCGWVANCVG  147

Query  773   ALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafal  952
             ALNYK FLLFLFYTFL   LV L+LL  F+  F D ++  + G LA TF+AFVLNLAFA+
Sbjct  148   ALNYKSFLLFLFYTFLAEILVCLALLRVFMEIFNDDEVDLTPGKLAATFIAFVLNLAFAV  207

Query  953   svlGFLIMHISLVSRNTT  1006
             SVLGFLIMHI+LV  N T
Sbjct  208   SVLGFLIMHITLVGANRT  225



>gb|ADE76560.1| unknown [Picea sitchensis]
Length=309

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 141/200 (71%), Gaps = 16/200 (8%)
 Frame = +2

Query  449   DTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSL  628
             D +VA F++ +FH LLVML+W YF VV TDPG VP NWRP +DEE  +   +  S   SL
Sbjct  49    DAIVAFFIVLVFHILLVMLIWCYFMVVMTDPGSVPRNWRPIVDEEAAEAQTMPIS--ASL  106

Query  629   PP--DTAQSR-----------IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCV  769
             P   +TA  +           +R+C KC  +KPPR HHC VC RC+LKMDHHCVWVVNCV
Sbjct  107   PSVSNTACPQPLVGGMAQIPGLRYCVKCENIKPPRSHHCRVCQRCILKMDHHCVWVVNCV  166

Query  770   GALNYKYfllflfytflettlvtlSLLPNFLAFF-GDVDIPGSAGDlattflafvlnlaf  946
             GA NYK+FLLFL YTFL TTL T  LLP F+ FF G  +  GS+  LATTFLAF+LN+AF
Sbjct  167   GARNYKFFLLFLLYTFLATTLDTFVLLPCFINFFKGFQNRTGSSSGLATTFLAFILNVAF  226

Query  947   alsvlGFLIMHISLVSRNTT  1006
             ALS+LGFLIMH SLVS NTT
Sbjct  227   ALSLLGFLIMHASLVSSNTT  246



>ref|XP_010267425.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267426.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267427.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267428.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267429.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267430.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
Length=306

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 140/198 (71%), Gaps = 9/198 (5%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G   +++++ ++  FH LL++L WSY  VVF DPG VP NWRP + EE  +T  +  S +
Sbjct  46    GGLRSVLSISIVTTFHLLLILLTWSYLMVVFQDPGSVPENWRPVMQEENMETSSMALSGY  105

Query  620   --------GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA  775
                      + P +  +  + +C +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA
Sbjct  106   VDPESRNSTASPSEGGRQAVGYCSRCQNSKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGA  165

Query  776   LNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafal  952
              NYK+FLLFL YTFLETTL TL LLP+F+ FFGD     ++ G+LA TFLAFV+NLAFAL
Sbjct  166   QNYKFFLLFLLYTFLETTLDTLVLLPHFIKFFGDAKSRSTSPGNLALTFLAFVINLAFAL  225

Query  953   svlGFLIMHISLVSRNTT  1006
             S++ FLIMH SL+S NTT
Sbjct  226   SLICFLIMHASLLSSNTT  243



>ref|XP_008376192.1| PREDICTED: probable protein S-acyltransferase 12 [Malus domestica]
Length=308

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 142/202 (70%), Gaps = 15/202 (7%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDT-DPLTASE  616
             G   + +A F+I +FH LLVMLLW YF VVF DPG VP NW+P +DEE  +    LT SE
Sbjct  46    GGVHSFLAFFIIVMFHILLVMLLWGYFMVVFKDPGSVPENWKPLIDEENLEAGSSLTLSE  105

Query  617   FGSLPPDTAQS-----------RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVN  763
               ++ P+   S           ++++C  C   KPPRCHHCSVC RCVLKMDHHCVWVVN
Sbjct  106   --NIEPEAFTSTQSSGGGERRPQVQYCSPCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVN  163

Query  764   CVGALNYKYfllflfytflettlvtlSLLPNFLAFFGD-VDIPGSAGDlattflafvlnl  940
             CVGA NYK+FLLFL YTFLETT+ TL LLPNF+ FF + +D   S G LA  FLAFVLNL
Sbjct  164   CVGARNYKFFLLFLLYTFLETTMDTLVLLPNFIDFFSEAMDHSESPGHLAVVFLAFVLNL  223

Query  941   afalsvlGFLIMHISLVSRNTT  1006
             AFALS+L F++MH SL+S NTT
Sbjct  224   AFALSLLCFVVMHASLLSSNTT  245



>emb|CAA16560.1| predicted protein [Arabidopsis thaliana]
 emb|CAB79230.1| predicted protein [Arabidopsis thaliana]
Length=820

 Score =   160 bits (406),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 117/193 (61%), Gaps = 26/193 (13%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+ +G  D+L+++ V+A FH LL+MLLWSYFSVV TDPG VP  WRP LD E+ + +   
Sbjct  566   ALLIGGVDSLLSVLVLAFFHFLLIMLLWSYFSVVVTDPGGVPTGWRPELDIEKSEGNQAL  625

Query  608   ASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
               E  +   D++   +R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK
Sbjct  626   IGE--ASVGDSSSHGVRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGANNYK  683

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
                    +     TL   S     L+ F  ++I  +                    VLGF
Sbjct  684   ------SFLLFLNTLTLPSDSKTSLSCFPVLNIAFALS------------------VLGF  719

Query  968   LIMHISLVSRNTT  1006
             LIMHI LV+RNTT
Sbjct  720   LIMHIMLVARNTT  732


 Score = 42.4 bits (98),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  283  AVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
              MAWNVFKFCTALR LGSIMIL+V+G++G TYY VV+ NYGP L
Sbjct  523  PTMAWNVFKFCTALRALGSIMILIVIGIIGFTYYAVVVVNYGPAL  567



>gb|KHG08036.1| hypothetical protein F383_35334 [Gossypium arboreum]
Length=303

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 127/198 (64%), Gaps = 16/198 (8%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G FDTL+A+  + LFH LLVM+LW+Y +VV TDPG VP NWRP  +EE+GD DPL    +
Sbjct  46    GGFDTLIAVAFLFLFHLLLVMVLWTYATVVLTDPGGVPLNWRPLREEEKGDADPLVGLGY  105

Query  620   G---------SLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVG  772
             G         ++P D     I FC KCN+LKPPR HHCS+C RC+LKMDHHC WV NCVG
Sbjct  106   GIAKIGTNQSAVPGDFKNLDIGFCLKCNRLKPPRAHHCSICNRCILKMDHHCGWVANCVG  165

Query  773   ALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafal  952
             ALNYK FLLFLFYT L   LV L+LL  F+  F D ++  + G                +
Sbjct  166   ALNYKSFLLFLFYTSLAAILVCLALLRVFMEIFNDDEVDLTPGK-------LAATFIAFV  218

Query  953   svlGFLIMHISLVSRNTT  1006
             SVLGFLIMHI+LV  N T
Sbjct  219   SVLGFLIMHITLVGANRT  236



>gb|KJB25653.1| hypothetical protein B456_004G202600 [Gossypium raimondii]
Length=285

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 128/198 (65%), Gaps = 16/198 (8%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G FDTL+A+  + LFH LLVM+LW+Y +VV TDPG VP NWRP  +EE+GD DPL    +
Sbjct  28    GGFDTLIAVAFLFLFHLLLVMVLWTYATVVLTDPGGVPLNWRPLREEEKGDADPLVGLGY  87

Query  620   G---------SLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVG  772
             G         ++P D     I FC KCN+LKPPR HHCS+C RC+LKMDHHC WV NCVG
Sbjct  88    GIAKIGTNQSAVPGDFKNLDIGFCLKCNRLKPPRAHHCSICNRCILKMDHHCGWVANCVG  147

Query  773   ALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafal  952
             ALNYK FLLFLFYTFL   LV L+LL  F+  F D ++  + G                +
Sbjct  148   ALNYKSFLLFLFYTFLAEILVCLALLRVFMEIFNDDEVDLTPGK-------LAATFIAFV  200

Query  953   svlGFLIMHISLVSRNTT  1006
             SVLGFLIMHI+LV  N T
Sbjct  201   SVLGFLIMHITLVGANRT  218



>ref|XP_009401747.1| PREDICTED: probable protein S-acyltransferase 12 [Musa acuminata 
subsp. malaccensis]
Length=313

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 139/197 (71%), Gaps = 12/197 (6%)
 Frame = +2

Query  452   TLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGD-TDPLTASEF---  619
             +++A  +I +FH LL +L+WSYF VVF DPG VP NWRP LDEE  + T   T S++   
Sbjct  54    SVLASVIIVVFHLLLALLIWSYFMVVFHDPGAVPANWRPLLDEESLERTASATLSDYIAP  113

Query  620   -----GSLPPDTAQSR--IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  778
                   S PP+  + R    +C +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA 
Sbjct  114   ETRASTSSPPEGIERRPNTGYCARCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGAR  173

Query  779   NYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafals  955
             NYK+FLLFL YTFLET L T  LLPNF+ FFGD     S+ G+LA TFLAFVLNLAFALS
Sbjct  174   NYKFFLLFLIYTFLETILDTFVLLPNFVKFFGDARKHSSSPGNLAVTFLAFVLNLAFALS  233

Query  956   vlGFLIMHISLVSRNTT  1006
             +L F+ MH SLV  NTT
Sbjct  234   LLCFVGMHTSLVLSNTT  250



>ref|XP_002867753.1| hypothetical protein ARALYDRAFT_329352 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44012.1| hypothetical protein ARALYDRAFT_329352 [Arabidopsis lyrata subsp. 
lyrata]
Length=777

 Score =   158 bits (400),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 124/195 (64%), Gaps = 26/195 (13%)
 Frame = +2

Query  428   AVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLT  607
             A+ +G  D+L+AL V+ALFH LL+MLLWSYFSVV TDPG VP  WRP LD E+ D +   
Sbjct  523   ALLIGGVDSLLALLVLALFHFLLIMLLWSYFSVVVTDPGGVPTGWRPELDVEKSDGNQAL  582

Query  608   ASEFGSLPPDTAQSR--IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALN  781
               E  S       S   +R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA+N
Sbjct  583   IGEANSSLSVGDSSSHGVRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAMN  642

Query  782   YKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvl  961
             YK                      +FL F   + +P  +    +     VLN+AFALSVL
Sbjct  643   YK----------------------SFLLFLNTLRLPSDSKS--SFSCFPVLNIAFALSVL  678

Query  962   GFLIMHISLVSRNTT  1006
             GFLIMHI LV+RNTT
Sbjct  679   GFLIMHIMLVARNTT  693


 Score = 42.4 bits (98),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  283  AVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
              MAWNVFKFCTALR LGSIMIL+V+G++G TYY VV+ NYGP L
Sbjct  480  PTMAWNVFKFCTALRALGSIMILIVIGIIGFTYYAVVVVNYGPAL  524



>ref|XP_008233069.1| PREDICTED: probable protein S-acyltransferase 12 [Prunus mume]
 ref|XP_008233070.1| PREDICTED: probable protein S-acyltransferase 12 [Prunus mume]
 ref|XP_008233071.1| PREDICTED: probable protein S-acyltransferase 12 [Prunus mume]
Length=308

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 142/202 (70%), Gaps = 15/202 (7%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDT-DPLTASE  616
             G   + +A F+I +FH LL+MLLWSYF VVF DPG VP NW+P  +EE  +    LT SE
Sbjct  46    GGLHSFLAFFIIIMFHFLLIMLLWSYFMVVFKDPGSVPDNWKPLTEEEVLEAGSSLTLSE  105

Query  617   FGSLPPD------TAQSRIR-----FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVN  763
               S+ P+      +A  R R     +C +C   KPPRCHHCSVC RCVLKMDHHCVWVVN
Sbjct  106   --SIEPEAFTSTHSADGRERRPQVGYCSRCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVN  163

Query  764   CVGALNYKYfllflfytflettlvtlSLLPNFLAFFGDV-DIPGSAGDlattflafvlnl  940
             CVGA NYK+FLLFL YTFLETT+ T  LLP+F+ FF +  +   S G+LA  FL FVLNL
Sbjct  164   CVGARNYKFFLLFLLYTFLETTMDTFILLPSFIDFFSEAKNHSTSPGNLAVIFLTFVLNL  223

Query  941   afalsvlGFLIMHISLVSRNTT  1006
             AFALS+L F++MH+SL+S NTT
Sbjct  224   AFALSLLCFVVMHVSLLSSNTT  245



>ref|XP_010267431.1| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Nelumbo 
nucifera]
Length=296

 Score =   158 bits (400),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 131/197 (66%), Gaps = 17/197 (9%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G   +++++ ++  FH LL++L WSY  VVF DPG VP NWRP + EE  +T  +  S +
Sbjct  46    GGLRSVLSISIVTTFHLLLILLTWSYLMVVFQDPGSVPENWRPVMQEENMETSSMALSGY  105

Query  620   --------GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA  775
                      + P +  +  + +C +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA
Sbjct  106   VDPESRNSTASPSEGGRQAVGYCSRCQNSKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGA  165

Query  776   LNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafals  955
              NYK+FLLFL YTFLETTL TL LLP+F+ FFGD     ++          V+NLAFALS
Sbjct  166   QNYKFFLLFLLYTFLETTLDTLVLLPHFIKFFGDAKSRSTS---------PVINLAFALS  216

Query  956   vlGFLIMHISLVSRNTT  1006
             ++ FLIMH SL+S NTT
Sbjct  217   LICFLIMHASLLSSNTT  233



>ref|XP_011039097.1| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Populus 
euphratica]
Length=298

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 129/186 (69%), Gaps = 1/186 (1%)
 Frame = +2

Query  452   TLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLP  631
             +++A  +I +FH LL+MLLWSYF VV  DPG VP NWR  L EE  +T          + 
Sbjct  50    SVLASAIIVIFHFLLIMLLWSYFMVVSKDPGSVPENWRAVLPEEALETGSSLNDRSECVV  109

Query  632   PDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfy  811
                   R  FC  C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FLLFL Y
Sbjct  110   ATDGLDRRAFCNHCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKFFLLFLLY  169

Query  812   tflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISL  988
             TF+ TT+ TL+LLP F+ FFG      S+ GDLA  FLAFVLNLAFALS+L FL+MH SL
Sbjct  170   TFMVTTMDTLALLPGFINFFGKAKNHSSSPGDLAVIFLAFVLNLAFALSLLCFLVMHASL  229

Query  989   VSRNTT  1006
             VS NTT
Sbjct  230   VSSNTT  235



>ref|XP_002263621.1| PREDICTED: probable protein S-acyltransferase 12 [Vitis vinifera]
 emb|CBI38696.3| unnamed protein product [Vitis vinifera]
Length=308

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 144/203 (71%), Gaps = 15/203 (7%)
 Frame = +2

Query  437   VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASE  616
             VG  D++++  +I +FH LL++L W YF VVF DPG VP NWRP  +E   +  P+T+S+
Sbjct  45    VGGLDSVLSFAIIVVFHILLILLTWCYFMVVFRDPGSVPENWRPVSEEYNLEEGPMTSSD  104

Query  617   FGSLPPDTAQSR------------IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVV  760
                + P+T  S             + +C +C   KPPRCHHCSVC RCVLKMDHHCVWVV
Sbjct  105   --CVVPETLNSTWSSSDGQERRPAVGYCIQCQNGKPPRCHHCSVCQRCVLKMDHHCVWVV  162

Query  761   NCVGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPG-SAGDlattflafvln  937
             NCVGA NYK+FLLFL YTFLETTL TL+LLP+F+ FFG+      S G+L+  FLAFV+N
Sbjct  163   NCVGACNYKFFLLFLLYTFLETTLDTLALLPSFINFFGEAKNHSVSPGNLSIIFLAFVIN  222

Query  938   lafalsvlGFLIMHISLVSRNTT  1006
             LAFALS+L F++MH+SL+S NTT
Sbjct  223   LAFALSLLCFIVMHVSLLSSNTT  245



>ref|XP_008779828.1| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Phoenix 
dactylifera]
Length=315

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 142/204 (70%), Gaps = 16/204 (8%)
 Frame = +2

Query  437   VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDT-DPLTAS  613
             VG   +++AL ++ +FH LL +L+WSYF VVF DPG VP NWRP L+EE  +    +T S
Sbjct  51    VGGLVSVLALAIVIVFHLLLALLIWSYFMVVFVDPGSVPLNWRPTLEEENLEIGSSVTLS  110

Query  614   EFGSLPPDTAQS------------RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWV  757
             ++  + P+T  S             I +C +C+  KPPRCHHCSVC RCVLKMDHHCVWV
Sbjct  111   DY--VAPETRASAWPSSEGLERRPTIGYCSRCHNSKPPRCHHCSVCQRCVLKMDHHCVWV  168

Query  758   VNCVGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvl  934
             VNCVGA NYK FLLFL YTFLET L  ++LLP F+ FFGD     S+ G LA TFLAFVL
Sbjct  169   VNCVGARNYKCFLLFLLYTFLETVLDAVALLPRFVKFFGDARNHNSSPGKLAVTFLAFVL  228

Query  935   nlafalsvlGFLIMHISLVSRNTT  1006
             NLAFALS+L F+IMH SLV  NTT
Sbjct  229   NLAFALSLLCFVIMHTSLVLSNTT  252



>ref|XP_009366621.1| PREDICTED: LOW QUALITY PROTEIN: probable protein S-acyltransferase 
12 [Pyrus x bretschneideri]
Length=303

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 136/196 (69%), Gaps = 10/196 (5%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALD-------EERGDTD  598
             G   + +A FVI +FH LLVMLLWSYF +VF DP  VP NW+P ++        E  + +
Sbjct  46    GGVHSFLAFFVIVMFHILLVMLLWSYFMIVFKDPASVPENWKPLMEAGSSLTLSENIEPE  105

Query  599   PLTASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAL  778
               T+++        AQ  +R+C +C   KPP CHHCSVC RCVLKMDHHCVWVVNCVGA 
Sbjct  106   AFTSTQSSGGGERLAQ--VRYCSRCQNGKPPXCHHCSVCQRCVLKMDHHCVWVVNCVGAR  163

Query  779   NYKYfllflfytflettlvtlSLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafals  955
             NYK+FLLFL YTFLETT+ TL LLPNF+ FF + +D   S G LA  FLAFV+NLAFA S
Sbjct  164   NYKFFLLFLLYTFLETTMDTLVLLPNFIDFFSEAMDHSESPGHLAVVFLAFVVNLAFAPS  223

Query  956   vlGFLIMHISLVSRNT  1003
             +L F++MH SL+S NT
Sbjct  224   LLCFVVMHASLLSSNT  239



>gb|KJB09587.1| hypothetical protein B456_001G151300 [Gossypium raimondii]
 gb|KJB09589.1| hypothetical protein B456_001G151300 [Gossypium raimondii]
Length=295

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 133/193 (69%), Gaps = 10/193 (5%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDT-DPLTASE  616
             G FD+ ++  ++ +FH LLV+LLWSY  VV  DPG VP NWR    EE  +    L A+E
Sbjct  46    GGFDSFLSFTIVIIFHVLLVLLLWSYIRVVLKDPGSVPENWRAVSGEESLEVGTSLAAAE  105

Query  617   FGSLPPDTAQSRIR---FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
                   D  + R R   +C  C   KPPRCHHCS+C RCVLKMDHHCVWVVNCVGA NYK
Sbjct  106   ------DGFERRSRGGGYCIHCQNGKPPRCHHCSICQRCVLKMDHHCVWVVNCVGACNYK  159

Query  788   YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGF  967
             +FLLFL YTFLETT+VT+ LLP+F+ FFG+     SA   A  FLAFVLN AFALS+L F
Sbjct  160   FFLLFLLYTFLETTMVTIVLLPSFINFFGEAKNHSSAAKSAIIFLAFVLNFAFALSLLCF  219

Query  968   LIMHISLVSRNTT  1006
             ++MH SL+S NTT
Sbjct  220   VVMHASLLSSNTT  232



>ref|XP_007051453.1| DHHC-type zinc finger family protein [Theobroma cacao]
 gb|EOX95610.1| DHHC-type zinc finger family protein [Theobroma cacao]
Length=294

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 132/190 (69%), Gaps = 5/190 (3%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G F + ++  +I  FH LL++LLWSYF VVF DPG VP NWRP   EE  +      S F
Sbjct  46    GGFHSFLSFAIIITFHVLLILLLWSYFRVVFKDPGSVPGNWRPVSPEENLEV----GSSF  101

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
              +      +SR  +C  C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FLL
Sbjct  102   AAADDGLERSRGGYCSHCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKFFLL  161

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIM  976
             FL YTFLETT+ T+ LLP+F+ FF +     S   +LA  FLAFVLNLAFALS+L FL+M
Sbjct  162   FLLYTFLETTMDTIVLLPSFINFFDEAKNHSSTPANLAIIFLAFVLNLAFALSLLCFLVM  221

Query  977   HISLVSRNTT  1006
             H SL+S NTT
Sbjct  222   HASLLSSNTT  231



>ref|XP_006657677.1| PREDICTED: probable protein S-acyltransferase 12-like isoform 
X1 [Oryza brachyantha]
Length=248

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 122/172 (71%), Gaps = 3/172 (2%)
 Frame = +2

Query  500   MLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF--GSLPPDTAQSRIRFCKKC  673
             M++W Y  VVFTDPG VP NWR   +E+  D +    S+    + P    QS  R+C +C
Sbjct  1     MIIWCYLMVVFTDPGAVPENWRHTSEEDDIDVNSRIISDNWDATYPASDGQSAQRYCSRC  60

Query  674   NQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLP  853
                KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYKYFLLFL YTF+ET L  L LLP
Sbjct  61    QNGKPPRCHHCSVCNRCVLKMDHHCVWVVNCVGARNYKYFLLFLVYTFIETVLDILVLLP  120

Query  854   NFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             NF+ FF D     S+ GD+A  FLAFVLNLAFALS++ F+ MH SLV+RNTT
Sbjct  121   NFIEFFRDESKRSSSPGDIAILFLAFVLNLAFALSLVCFIGMHTSLVTRNTT  172



>ref|XP_006657678.1| PREDICTED: probable protein S-acyltransferase 12-like isoform 
X2 [Oryza brachyantha]
Length=235

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 122/172 (71%), Gaps = 3/172 (2%)
 Frame = +2

Query  500   MLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF--GSLPPDTAQSRIRFCKKC  673
             M++W Y  VVFTDPG VP NWR   +E+  D +    S+    + P    QS  R+C +C
Sbjct  1     MIIWCYLMVVFTDPGAVPENWRHTSEEDDIDVNSRIISDNWDATYPASDGQSAQRYCSRC  60

Query  674   NQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLP  853
                KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYKYFLLFL YTF+ET L  L LLP
Sbjct  61    QNGKPPRCHHCSVCNRCVLKMDHHCVWVVNCVGARNYKYFLLFLVYTFIETVLDILVLLP  120

Query  854   NFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             NF+ FF D     S+ GD+A  FLAFVLNLAFALS++ F+ MH SLV+RNTT
Sbjct  121   NFIEFFRDESKRSSSPGDIAILFLAFVLNLAFALSLVCFIGMHTSLVTRNTT  172



>ref|XP_010691320.1| PREDICTED: probable protein S-acyltransferase 12 [Beta vulgaris 
subsp. vulgaris]
Length=310

 Score =   153 bits (387),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 130/189 (69%), Gaps = 3/189 (2%)
 Frame = +2

Query  449   DTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDE--ERGDTDPLTASEFG  622
               ++A F+++LFH LL++L WSY  VVF DPG VP NW P LD   E G +    AS + 
Sbjct  54    QAVLAAFIVSLFHVLLILLTWSYLMVVFQDPGSVPQNWSPVLDGNLEEGTSSSSLASPWP  113

Query  623   SLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllf  802
             +      +S   +C +C   +PPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FLLF
Sbjct  114   ASNGSERRSTAGYCSRCQSARPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKFFLLF  173

Query  803   lfytflettlvtlSLLPNFLAFFGDVDI-PGSAGDlattflafvlnlafalsvlGFLIMH  979
             L YTFLET L T +LLP  +  FG+      S G+L+ T LAFVLNLAFALS+L F+IMH
Sbjct  174   LIYTFLETVLDTFALLPRIITLFGEAKKHSASPGNLSVTVLAFVLNLAFALSLLCFVIMH  233

Query  980   ISLVSRNTT  1006
              +LV  NTT
Sbjct  234   ATLVWSNTT  242



>ref|XP_011039088.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Populus 
euphratica]
Length=307

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 126/195 (65%), Gaps = 10/195 (5%)
 Frame = +2

Query  452   TLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLP  631
             +++A  +I +FH LL+MLLWSYF VV  DPG VP NWR  L EE  +T          + 
Sbjct  50    SVLASAIIVIFHFLLIMLLWSYFMVVSKDPGSVPENWRAVLPEEALETGSSLNDRSECVV  109

Query  632   PDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfl-----  796
                   R  FC  C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FL     
Sbjct  110   ATDGLDRRAFCNHCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKFFLLFLLS  169

Query  797   ----lflfytflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvl  961
                     YTF+ TT+ TL+LLP F+ FFG      S+ GDLA  FLAFVLNLAFALS+L
Sbjct  170   TSFFSLKLYTFMVTTMDTLALLPGFINFFGKAKNHSSSPGDLAVIFLAFVLNLAFALSLL  229

Query  962   GFLIMHISLVSRNTT  1006
              FL+MH SLVS NTT
Sbjct  230   CFLVMHASLVSSNTT  244



>ref|NP_567193.2| putative S-acyltransferase [Arabidopsis thaliana]
 sp|Q5M757.1|ZDH15_ARATH RecName: Full=Probable protein S-acyltransferase 12; AltName: 
Full=Probable palmitoyltransferase At4g00840; AltName: Full=Zinc 
finger DHHC domain-containing protein At4g00840 [Arabidopsis 
thaliana]
 gb|AAV91337.1| At4g00840 [Arabidopsis thaliana]
 gb|AAW39012.1| At4g00840 [Arabidopsis thaliana]
 dbj|BAF01156.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE81944.1| putative S-acyltransferase [Arabidopsis thaliana]
Length=291

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 132/190 (69%), Gaps = 9/190 (5%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G    L AL +I +FH LL+MLLWSYF+ VFTDPG VP ++R     E G  D L A   
Sbjct  47    GALSALAAL-IIFVFHFLLIMLLWSYFTTVFTDPGSVPEHFR----REMGGGDSLEA---  98

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
             G+     A   + +C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLL
Sbjct  99    GTSTDQGAFGSLGYCTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLL  158

Query  800   flfytflettlvtlSLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIM  976
             FLFYTFLET L  + LLP+F+ FF   +    S G LA+  LAFVLN AF LS+L F++M
Sbjct  159   FLFYTFLETMLDVIVLLPSFIEFFSQAIKHSSSPGKLASLVLAFVLNFAFVLSLLCFVVM  218

Query  977   HISLVSRNTT  1006
             HISL+S NTT
Sbjct  219   HISLLSSNTT  228



>tpg|DAA40775.1| TPA: hypothetical protein ZEAMMB73_782285 [Zea mays]
Length=236

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 123/176 (70%), Gaps = 10/176 (6%)
 Frame = +2

Query  482   FHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPDTAQSRIRF  661
             FH LL M+LW Y   VFTDPG VP NWR   D E       ++S       D  +S  R+
Sbjct  64    FHILLAMILWCYLMAVFTDPGAVPENWRH--DAEDSGNPSFSSS-------DEQESAPRY  114

Query  662   CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  841
             C +C   KPPRCHHCSVC RCVLKMDHHC+WVVNCVGA NYKYFLLFL YTF+ET L TL
Sbjct  115   CSRCQNGKPPRCHHCSVCNRCVLKMDHHCIWVVNCVGARNYKYFLLFLVYTFIETVLDTL  174

Query  842   SLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
              LLPNF+ FF D     S+ GD+A  FLAFVLNLAFALS+L F+ MH SLV+RNTT
Sbjct  175   VLLPNFIEFFQDEHRRSSSPGDIAILFLAFVLNLAFALSLLCFIGMHASLVTRNTT  230



>gb|KJB25655.1| hypothetical protein B456_004G202600 [Gossypium raimondii]
Length=238

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 113/178 (63%), Gaps = 16/178 (9%)
 Frame = +2

Query  500   MLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFG---------SLPPDTAQSR  652
             M+LW+Y +VV TDPG VP NWRP  +EE+GD DPL    +G         ++P D     
Sbjct  1     MVLWTYATVVLTDPGGVPLNWRPLREEEKGDADPLVGLGYGIAKIGTNQSAVPGDFKNLD  60

Query  653   IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettl  832
             I FC KCN+LKPPR HHCS+C RC+LKMDHHC WV NCVGALNYK FLLFLFYTFL   L
Sbjct  61    IGFCLKCNRLKPPRAHHCSICNRCILKMDHHCGWVANCVGALNYKSFLLFLFYTFLAEIL  120

Query  833   vtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             V L+LL  F+  F D ++  + G                +SVLGFLIMHI+LV  N T
Sbjct  121   VCLALLRVFMEIFNDDEVDLTPGK-------LAATFIAFVSVLGFLIMHITLVGANRT  171



>ref|XP_010422733.1| PREDICTED: probable protein S-acyltransferase 12 [Camelina sativa]
Length=291

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 131/190 (69%), Gaps = 9/190 (5%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G   TL A+ +I +FH LL+MLLWSYF+ VFTDPG VP  +R     E G  D L A   
Sbjct  47    GALSTL-AILIIFVFHFLLIMLLWSYFATVFTDPGSVPERFR----REMGGGDSLEA---  98

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
             G+     A   + +C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLL
Sbjct  99    GTSTDQGAFGSLGYCTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLL  158

Query  800   flfytflettlvtlSLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIM  976
             FLFYTF ET L  + LLP+F+ FF   V    S G LA+  LAFVLN AF LS+L F++M
Sbjct  159   FLFYTFFETLLDVIVLLPSFIEFFSQAVKHSSSPGKLASLVLAFVLNFAFVLSLLCFVVM  218

Query  977   HISLVSRNTT  1006
             H+SL+S NTT
Sbjct  219   HLSLLSSNTT  228



>ref|XP_010456165.1| PREDICTED: probable protein S-acyltransferase 12 [Camelina sativa]
Length=291

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 130/184 (71%), Gaps = 8/184 (4%)
 Frame = +2

Query  458   VALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPD  637
             +A+ +I +FH LL+MLLWSYF+ VFTDPG VP ++R     E G  D L A   G+    
Sbjct  52    LAILIIFVFHFLLIMLLWSYFATVFTDPGSVPEHFR----REMGGGDSLEA---GTSTDQ  104

Query  638   TAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytf  817
              A   + +C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFLFYTF
Sbjct  105   GAFGSLGYCTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLFYTF  164

Query  818   lettlvtlSLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  994
              ET L  + LLP+F+ FF   V    S G LA+  LAFVLN AF LS+L F++MH+SL+S
Sbjct  165   FETLLDVIVLLPSFIEFFSQAVKHSSSPGKLASLVLAFVLNFAFVLSLLCFVVMHLSLLS  224

Query  995   RNTT  1006
              NTT
Sbjct  225   SNTT  228



>ref|XP_011029093.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Populus 
euphratica]
Length=271

 Score =   141 bits (355),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 124/189 (66%), Gaps = 30/189 (16%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D+ VAL V+ LFH LLVMLLWSYF+   TDPG VPP+WRP++DEE GD DPL     
Sbjct  46    GGLDSFVALLVLVLFHSLLVMLLWSYFTTCLTDPGGVPPSWRPSIDEESGDADPLVG---  102

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
                                       H     GRC+LKMDHHCVWVVNCVGALNYKYFLL
Sbjct  103   ------------------------LAHE---GGRCILKMDHHCVWVVNCVGALNYKYFLL  135

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FLFYTFL TTLVT SLLP F+AF    +  G+   L  TF+ FVLNL+FALS++GFLIMH
Sbjct  136   FLFYTFLVTTLVTSSLLPKFIAFLTVGEKNGTPETLVATFVTFVLNLSFALSIMGFLIMH  195

Query  980   ISLVSRNTT  1006
             ISLV  NTT
Sbjct  196   ISLVLGNTT  204


 Score = 48.9 bits (115),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +1

Query  289  MAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            MAWNVFKFCTALR LGSIMI+LVLG++G+TYYV+V+ NYGP L
Sbjct  1    MAWNVFKFCTALRALGSIMIVLVLGIIGITYYVIVVANYGPAL  43



>ref|XP_006288366.1| hypothetical protein CARUB_v10001614mg [Capsella rubella]
 gb|EOA21264.1| hypothetical protein CARUB_v10001614mg [Capsella rubella]
Length=291

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 131/184 (71%), Gaps = 8/184 (4%)
 Frame = +2

Query  458   VALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPD  637
             +A+ +I  FH LL+MLLWSYFS VFTDPG VP ++R     E G  D L A   G+    
Sbjct  52    LAILIIFTFHFLLIMLLWSYFSTVFTDPGSVPEHFR----REMGGGDNLEA---GTSTDQ  104

Query  638   TAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytf  817
              A   + +C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFLFYTF
Sbjct  105   GAFGSLGYCTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLFYTF  164

Query  818   lettlvtlSLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  994
             LET L  + LLP+F+ FF   +    S G LA+  LAFVLNLAF LS+L F++MH+SL+S
Sbjct  165   LETMLDVIVLLPSFIEFFSQAIKHSSSPGKLASLVLAFVLNLAFVLSLLCFVVMHLSLLS  224

Query  995   RNTT  1006
              NTT
Sbjct  225   SNTT  228



>ref|XP_007218830.1| hypothetical protein PRUPE_ppa010169mg [Prunus persica]
 gb|EMJ20029.1| hypothetical protein PRUPE_ppa010169mg [Prunus persica]
Length=261

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 109/160 (68%), Gaps = 14/160 (9%)
 Frame = +2

Query  440  GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDT-DPLTASE  616
            G   + +A F+I LFH LL+MLLWSYF VVF DPG VP NW+P  +EE  +    LT SE
Sbjct  91   GGLHSFLAFFIIILFHFLLIMLLWSYFMVVFKDPGSVPNNWKPLTEEEVLEAGSSLTLSE  150

Query  617  FGSLPPD------TAQSRIR-----FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVN  763
              S+ P+      +A  R R     +C +C   KPPRCHHCSVC RCVLKMDHHCVWVVN
Sbjct  151  --SIEPEAFTSTHSADGRERRPQVGYCSRCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVN  208

Query  764  CVGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVD  883
            CVGA NYK+FLLFL YTFLETT+ T  LLPNF+ FF +  
Sbjct  209  CVGARNYKFFLLFLLYTFLETTMDTFILLPNFIDFFSEAK  248



>emb|CDX74374.1| BnaA03g26730D [Brassica napus]
Length=291

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 132/184 (72%), Gaps = 8/184 (4%)
 Frame = +2

Query  458   VALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPD  637
             +A  +I+LFH LLVMLLWSYF+VVFTDPG VP ++R     E G  + L A   G+    
Sbjct  52    LACLIISLFHFLLVMLLWSYFTVVFTDPGSVPEHFR----RELGGGESLEA---GTSTDQ  104

Query  638   TAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytf  817
              A   + +C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFL YTF
Sbjct  105   GAFGSLCYCPKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLLYTF  164

Query  818   lettlvtlSLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  994
             LET L  + LLP+F+ FF   +    S G LA+  LAFVLNLAF LS+L F++MH+SL+S
Sbjct  165   LETMLDVVVLLPSFIKFFSQAIKHSSSPGKLASLVLAFVLNLAFVLSLLCFVVMHLSLLS  224

Query  995   RNTT  1006
              NTT
Sbjct  225   TNTT  228



>ref|XP_002872926.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49185.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata]
Length=291

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 132/190 (69%), Gaps = 9/190 (5%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G    L AL +I +FH LL+MLLWSYF+ VFTDPG VP  +R     E G  D L A   
Sbjct  47    GALSALAAL-IIFVFHFLLIMLLWSYFTTVFTDPGSVPEYFR----REMGGGDNLEA---  98

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
             G+     A   + +C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLL
Sbjct  99    GTSTDQGAFGSLGYCTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLL  158

Query  800   flfytflettlvtlSLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIM  976
             FLFYTFLET L  + LLP+F+ FF   +    S G LA+  LAFVLNLAF LS+L F++M
Sbjct  159   FLFYTFLETMLDVIVLLPSFIEFFSQAIKHSSSPGKLASLVLAFVLNLAFVLSLLCFVVM  218

Query  977   HISLVSRNTT  1006
             H+SL+S NTT
Sbjct  219   HLSLLSSNTT  228



>gb|EEE67131.1| hypothetical protein OsJ_24176 [Oryza sativa Japonica Group]
Length=303

 Score =   150 bits (379),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 124/178 (70%), Gaps = 3/178 (2%)
 Frame = +2

Query  482   FHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF--GSLPPDTAQSRI  655
             FH LL M++W Y  VVFTDPG VP NWR A +E+    +  T S     + P    QS  
Sbjct  63    FHLLLAMIIWCYLMVVFTDPGAVPENWRHASEEDGIGVNSRTISYNWDATYPNPEGQSAQ  122

Query  656   RFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlv  835
             ++C +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYKYFLLFL YTF+ET L 
Sbjct  123   KYCSRCQNGKPPRCHHCSVCNRCVLKMDHHCVWVVNCVGARNYKYFLLFLVYTFVETVLD  182

Query  836   tlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             TL LLP F+ FF D     S+ GD+A  F+ FVLNLAFALS+L F+ MH SLV+ NTT
Sbjct  183   TLVLLPYFIEFFRDESRRSSSPGDIAILFVTFVLNLAFALSLLCFIGMHASLVTSNTT  240



>gb|EEC81995.1| hypothetical protein OsI_25930 [Oryza sativa Indica Group]
Length=304

 Score =   150 bits (379),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 124/178 (70%), Gaps = 3/178 (2%)
 Frame = +2

Query  482   FHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF--GSLPPDTAQSRI  655
             FH LL M++W Y  VVFTDPG VP NWR A +E+    +  T S     + P    QS  
Sbjct  64    FHLLLAMIIWCYLMVVFTDPGAVPENWRHASEEDGIGVNSRTISYNWDATYPNPEGQSAQ  123

Query  656   RFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlv  835
             ++C +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYKYFLLFL YTF+ET L 
Sbjct  124   KYCSRCQNGKPPRCHHCSVCNRCVLKMDHHCVWVVNCVGARNYKYFLLFLVYTFVETVLD  183

Query  836   tlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             TL LLP F+ FF D     S+ GD+A  F+ FVLNLAFALS+L F+ MH SLV+ NTT
Sbjct  184   TLVLLPYFIEFFRDESRRSSSPGDIAILFITFVLNLAFALSLLCFIGMHASLVTSNTT  241



>gb|KFK30666.1| hypothetical protein AALP_AA6G012100 [Arabis alpina]
Length=289

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 130/184 (71%), Gaps = 10/184 (5%)
 Frame = +2

Query  458   VALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPD  637
             +AL +I +FH LL+MLLWSY   VFTDPG VP ++R  L +     +      FGSL   
Sbjct  52    LALLIIVVFHFLLIMLLWSYLITVFTDPGSVPEHFRRELGDNLEAGNSNDQGGFGSLG--  109

Query  638   TAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytf  817
                    +C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFLFYTF
Sbjct  110   -------YCPKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLFYTF  162

Query  818   lettlvtlSLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  994
             LET L  + LLP+F+ FFG  +    S G+LA+  LAFVLNLAF LS+L F++MHISL+S
Sbjct  163   LETMLDIVVLLPSFIKFFGQAIKHSSSPGNLASLVLAFVLNLAFVLSLLCFVVMHISLLS  222

Query  995   RNTT  1006
              NTT
Sbjct  223   SNTT  226



>gb|ACF85839.1| unknown [Zea mays]
 gb|ACG46105.1| transposon protein [Zea mays]
 tpg|DAA40776.1| TPA: Transposon protein [Zea mays]
Length=293

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 123/176 (70%), Gaps = 10/176 (6%)
 Frame = +2

Query  482   FHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPDTAQSRIRF  661
             FH LL M+LW Y   VFTDPG VP NWR   D E       ++S       D  +S  R+
Sbjct  64    FHILLAMILWCYLMAVFTDPGAVPENWRH--DAEDSGNPSFSSS-------DEQESAPRY  114

Query  662   CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  841
             C +C   KPPRCHHCSVC RCVLKMDHHC+WVVNCVGA NYKYFLLFL YTF+ET L TL
Sbjct  115   CSRCQNGKPPRCHHCSVCNRCVLKMDHHCIWVVNCVGARNYKYFLLFLVYTFIETVLDTL  174

Query  842   SLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
              LLPNF+ FF D     S+ GD+A  FLAFVLNLAFALS+L F+ MH SLV+RNTT
Sbjct  175   VLLPNFIEFFQDEHRRSSSPGDIAILFLAFVLNLAFALSLLCFIGMHASLVTRNTT  230



>ref|XP_002462839.1| hypothetical protein SORBIDRAFT_02g032840 [Sorghum bicolor]
 gb|EER99360.1| hypothetical protein SORBIDRAFT_02g032840 [Sorghum bicolor]
Length=293

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 125/176 (71%), Gaps = 10/176 (6%)
 Frame = +2

Query  482   FHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPDTAQSRIRF  661
             FH LL M+LW Y  VVFTDPG VP NWR    E+ G+    ++ E GS P        ++
Sbjct  64    FHILLAMILWCYLMVVFTDPGAVPENWRHD-AEDSGNPLFSSSEEQGSAP--------KY  114

Query  662   CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  841
             C +C   KPPRCHHCSVC RCVLKMDHHC+WVVNCVGA NYKYFLLFL YTF+ET L TL
Sbjct  115   CSRCQNGKPPRCHHCSVCNRCVLKMDHHCIWVVNCVGARNYKYFLLFLVYTFIETVLDTL  174

Query  842   SLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
              LLPNF+ FF D     S+ GD+A  FLAFVLNLAFALS+L F+ MH SLV+ NTT
Sbjct  175   VLLPNFIEFFQDESRRSSSPGDIAILFLAFVLNLAFALSLLCFIGMHTSLVTHNTT  230



>ref|XP_006360644.1| PREDICTED: probable protein S-acyltransferase 12-like [Solanum 
tuberosum]
Length=309

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 134/201 (67%), Gaps = 12/201 (6%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G F + ++  +I +FH LLVML+WSY  VV  DPG VP NW+   ++     + +  S++
Sbjct  46    GGFTSFLSFTIIIIFHILLVMLMWSYIKVVIQDPGSVPENWKLVSEQNIEGGNSVALSDY  105

Query  620   GSLPPDT----------AQSRIR-FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNC  766
              S+   T           QS+ R +C KC   KPPRCHHCSVC RCVLKMDHHC+WVVNC
Sbjct  106   ASIENPTPTLSTEQIERRQSQSRGYCSKCQNGKPPRCHHCSVCQRCVLKMDHHCIWVVNC  165

Query  767   VGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnla  943
             VGA NYK+FLLF+ YTFL +TL TL LLP+F+ FF   +      G++A  FL FVLNLA
Sbjct  166   VGARNYKFFLLFVVYTFLISTLDTLVLLPSFIKFFRQAENQSLLPGNIAVIFLVFVLNLA  225

Query  944   falsvlGFLIMHISLVSRNTT  1006
             F+LS+L F+IMH SL+S NTT
Sbjct  226   FSLSLLCFVIMHASLLSSNTT  246



>ref|XP_009134494.1| PREDICTED: probable protein S-acyltransferase 12 [Brassica rapa]
Length=291

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 132/184 (72%), Gaps = 8/184 (4%)
 Frame = +2

Query  458   VALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPD  637
             +A  +I+LFH LLVMLLWS F+VVFTDPG VP ++R     E G  + L A   G+    
Sbjct  52    LACLIISLFHFLLVMLLWSCFTVVFTDPGSVPEHFR----RELGGGESLEA---GTSTDQ  104

Query  638   TAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytf  817
              A   I +C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFL YTF
Sbjct  105   GAFGSIGYCPKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLLYTF  164

Query  818   lettlvtlSLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  994
             LET L  + LLP+F+ FF + +    S G LA+  LAFVLNLAF LS+L F++MH+SL+S
Sbjct  165   LETMLDVVVLLPSFIKFFSEAIKHSSSPGKLASLVLAFVLNLAFVLSLLCFVVMHLSLLS  224

Query  995   RNTT  1006
              NTT
Sbjct  225   TNTT  228



>ref|XP_011082342.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Sesamum 
indicum]
Length=306

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 137/200 (69%), Gaps = 13/200 (7%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G F + V+  ++ LFH LLV+L WSYF VVF DPG VP NW+ + ++   D + ++ +  
Sbjct  46    GGFKSFVSFLIVTLFHVLLVLLTWSYFMVVFRDPGSVPANWKTSPEQNVADENFVSCTY-  104

Query  620   GSLPPDTA----------QSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCV  769
              S P ++A          +  + +C  C   KPPRCHHCSVC RCVLKMDHHC+WVVNCV
Sbjct  105   -SAPDNSAGPSSSEGIEKRPALNYCSYCKNGKPPRCHHCSVCQRCVLKMDHHCIWVVNCV  163

Query  770   GALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlaf  946
             GA NYK+FLLF+ YT+LET + TL LLP F+ FF       S+ G+LA TFLAFVLNLAF
Sbjct  164   GARNYKFFLLFVLYTYLETMMDTLVLLPGFINFFQQAKRHSSSPGNLAITFLAFVLNLAF  223

Query  947   alsvlGFLIMHISLVSRNTT  1006
             +LS+L F++MHISL+  NTT
Sbjct  224   SLSLLCFVVMHISLLLSNTT  243



>ref|XP_010428132.1| PREDICTED: probable protein S-acyltransferase 12 [Camelina sativa]
Length=292

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 128/184 (70%), Gaps = 7/184 (4%)
 Frame = +2

Query  458   VALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPD  637
             +A+ +I +FH LL+MLLWSYF+ VFTDPG VP  +R     E G  D L A   G+    
Sbjct  52    LAILIIFVFHFLLIMLLWSYFATVFTDPGSVPERFR----REMGGGDSLEAG--GTSTDQ  105

Query  638   TAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytf  817
              A   + +C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFLFYTF
Sbjct  106   GAFGSLGYCTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLFYTF  165

Query  818   lettlvtlSLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  994
              ET L  + LLP+F+ FF   V    S G LA+  LAFVLN AF LS+L F++MH+SL+S
Sbjct  166   FETLLDVIVLLPSFIEFFSQAVKHSSSPGKLASLVLAFVLNFAFVLSLLCFVVMHLSLLS  225

Query  995   RNTT  1006
              N T
Sbjct  226   SNIT  229



>ref|XP_003560239.2| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Brachypodium 
distachyon]
Length=312

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 129/185 (70%), Gaps = 10/185 (5%)
 Frame = +2

Query  482   FHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPL------TASEFGSLPPDTA  643
             FH LL+M+LW Y  VVFTDPG VP NWR A +E+  D           A++  + P  T+
Sbjct  65    FHLLLIMMLWCYLMVVFTDPGAVPENWRHAAEEDDMDESNTRTISNDVATDIVNPPLFTS  124

Query  644   QSR---IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  814
             + +    R+C +C   KPPRCHHCS+C RCVLKMDHHCVWVVNCVGA NYKYFLLFL YT
Sbjct  125   EGQGNASRYCSRCQNGKPPRCHHCSICDRCVLKMDHHCVWVVNCVGARNYKYFLLFLVYT  184

Query  815   flettlvtlSLLPNFLAFFGDVD-IPGSAGDlattflafvlnlafalsvlGFLIMHISLV  991
             FLET L TL LLP+F+ FF D      SA D+A  FLAFVLNLAFALS+L F+ MH SLV
Sbjct  185   FLETVLDTLVLLPSFITFFRDESRRSSSASDVAILFLAFVLNLAFALSLLIFIGMHTSLV  244

Query  992   SRNTT  1006
             + NTT
Sbjct  245   ASNTT  249



>ref|XP_004240115.1| PREDICTED: probable protein S-acyltransferase 12 [Solanum lycopersicum]
Length=309

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 134/201 (67%), Gaps = 12/201 (6%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G F + ++  +I +FH LLVML+WSY  VV  DPG VP NW+   ++   + + +  S++
Sbjct  46    GGFTSFLSFTIIIIFHILLVMLMWSYIRVVVQDPGSVPENWKLVSEQNIEEGNSVALSDY  105

Query  620   GSLPPDT----------AQSRIR-FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNC  766
              S+   T           QS+ R +C KC   KPPRCHHCSVC RCVLKMDHHC+WVVNC
Sbjct  106   ASIENPTPTLSTEQIERRQSQSRGYCSKCQNGKPPRCHHCSVCQRCVLKMDHHCIWVVNC  165

Query  767   VGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnla  943
             VGA NYK+FLLF+ YTFL TTL TL LLP+F+ FF          G++A  FL FVLNLA
Sbjct  166   VGACNYKFFLLFVVYTFLITTLDTLVLLPSFIKFFRQSKNQSLLPGNIAVIFLVFVLNLA  225

Query  944   falsvlGFLIMHISLVSRNTT  1006
             F+LS+L F+IMH SL+S NTT
Sbjct  226   FSLSLLCFVIMHASLLSSNTT  246



>ref|XP_006396329.1| hypothetical protein EUTSA_v10028856mg [Eutrema salsugineum]
 gb|ESQ37782.1| hypothetical protein EUTSA_v10028856mg [Eutrema salsugineum]
Length=290

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 136/195 (70%), Gaps = 10/195 (5%)
 Frame = +2

Query  425   VAVGVGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPL  604
             +  G G    L  L ++ +FH LL+MLLWSYF+VVFTDPG VP ++R  L+   GD    
Sbjct  42    IESGHGALSALACL-IVFVFHFLLMMLLWSYFTVVFTDPGSVPEHFRRELE---GDN---  94

Query  605   TASEFGSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNY  784
                E G+     A S + +C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NY
Sbjct  95    --LEAGTSTDRGAFSSLGYCPKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNY  152

Query  785   KYfllflfytflettlvtlSLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvl  961
             K+FLLFLFYTFLET L  + LLP+F+ FF   +    S G LA+  LAFVLNLAF LS+L
Sbjct  153   KFFLLFLFYTFLETMLDVVVLLPSFIKFFSQAMKHSSSPGKLASLVLAFVLNLAFVLSLL  212

Query  962   GFLIMHISLVSRNTT  1006
              F++MH+SL+S NTT
Sbjct  213   CFVVMHLSLLSTNTT  227



>ref|XP_004957652.1| PREDICTED: probable S-acyltransferase At4g00840-like [Setaria 
italica]
Length=292

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 120/176 (68%), Gaps = 11/176 (6%)
 Frame = +2

Query  482   FHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPDTAQSRIRF  661
             FH LL M+LW Y  VVFTDPG VP NWR   D E       ++ E GS P         +
Sbjct  64    FHVLLAMILWCYLMVVFTDPGAVPENWRH--DAEYSGDPGSSSEEQGSAPS--------Y  113

Query  662   CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  841
             C +C   KPPRCHHCSVC RCVLKMDHHC+WVVNCVGA NYKYFLLFL YTF ET L TL
Sbjct  114   CSRCQNGKPPRCHHCSVCNRCVLKMDHHCIWVVNCVGARNYKYFLLFLVYTFAETVLDTL  173

Query  842   SLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
              LLPNF+ FF D     S+ GD+A  FLAFVLNLAF LS+L F+ MH SLV+ NTT
Sbjct  174   VLLPNFIEFFQDESRRSSSPGDIAILFLAFVLNLAFVLSLLCFIGMHTSLVTSNTT  229



>tpg|DAA40774.1| TPA: hypothetical protein ZEAMMB73_782285 [Zea mays]
Length=258

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 122/177 (69%), Gaps = 10/177 (6%)
 Frame = +2

Query  479   LFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPDTAQSRIR  658
             LF   L M+LW Y   VFTDPG VP NWR   D E       ++S       D  +S  R
Sbjct  28    LFLLQLAMILWCYLMAVFTDPGAVPENWRH--DAEDSGNPSFSSS-------DEQESAPR  78

Query  659   FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvt  838
             +C +C   KPPRCHHCSVC RCVLKMDHHC+WVVNCVGA NYKYFLLFL YTF+ET L T
Sbjct  79    YCSRCQNGKPPRCHHCSVCNRCVLKMDHHCIWVVNCVGARNYKYFLLFLVYTFIETVLDT  138

Query  839   lSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             L LLPNF+ FF D     S+ GD+A  FLAFVLNLAFALS+L F+ MH SLV+RNTT
Sbjct  139   LVLLPNFIEFFQDEHRRSSSPGDIAILFLAFVLNLAFALSLLCFIGMHASLVTRNTT  195



>gb|KJB09588.1| hypothetical protein B456_001G151300 [Gossypium raimondii]
Length=210

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 106/159 (67%), Gaps = 10/159 (6%)
 Frame = +2

Query  440  GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDT-DPLTASE  616
            G FD+ ++  ++ +FH LLV+LLWSY  VV  DPG VP NWR    EE  +    L A+E
Sbjct  46   GGFDSFLSFTIVIIFHVLLVLLLWSYIRVVLKDPGSVPENWRAVSGEESLEVGTSLAAAE  105

Query  617  FGSLPPDTAQSRIR---FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK  787
                  D  + R R   +C  C   KPPRCHHCS+C RCVLKMDHHCVWVVNCVGA NYK
Sbjct  106  ------DGFERRSRGGGYCIHCQNGKPPRCHHCSICQRCVLKMDHHCVWVVNCVGACNYK  159

Query  788  YfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGD  904
            +FLLFL YTFLETT+VT+ LLP+F+ FFG+     SA  
Sbjct  160  FFLLFLLYTFLETTMVTIVLLPSFINFFGEAKNHSSAAK  198



>dbj|BAK01014.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=330

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 125/179 (70%), Gaps = 9/179 (5%)
 Frame = +2

Query  497   VMLLWSYFSVVFTDPGIVPPNWRPALDEE------RGDTDPLTASEFGSLPPDTAQS--R  652
             +M+LW YF VVFT+PG VP NWR A +E+              A++  + PP + +    
Sbjct  89    IMMLWCYFMVVFTNPGAVPGNWRHAAEEDGMYPNNSSTISDNVATDCANRPPTSEEQGHA  148

Query  653   IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettl  832
              R+C +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYKYFLLFL YTFLET L
Sbjct  149   PRYCSRCQSGKPPRCHHCSVCDRCVLKMDHHCVWVVNCVGARNYKYFLLFLVYTFLETVL  208

Query  833   vtlSLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
               L LLP+F+ FF D    P SAGD+A  FLAFVLNLAFALS+L F+ MH SLV+ NTT
Sbjct  209   DALVLLPSFIIFFRDGSGRPSSAGDIAILFLAFVLNLAFALSLLCFICMHTSLVASNTT  267



>ref|XP_010919145.1| PREDICTED: probable protein S-acyltransferase 12 [Elaeis guineensis]
Length=315

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 141/203 (69%), Gaps = 16/203 (8%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDT-DPLTASE  616
             G   +++A  ++ +FH LL +L+WSYF VVF DPG VP NWRP ++EE  +    +T S+
Sbjct  52    GGLVSVLAFAIVLVFHLLLALLIWSYFMVVFVDPGSVPLNWRPTIEEENLEIGSSVTLSD  111

Query  617   FGSLPPDTAQS------------RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVV  760
             +  + P+T+ S             I +C +C+  KPPRCHHCSVC RCVLKMDHHCVWVV
Sbjct  112   Y--VAPETSASAWSSSEGLERRPTIGYCSRCHNSKPPRCHHCSVCQRCVLKMDHHCVWVV  169

Query  761   NCVGALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvln  937
             NCVG  NYK FLLFL YTFLET L TL+LLP F+ FFGD     S+ G LA TFLAFVLN
Sbjct  170   NCVGVRNYKCFLLFLLYTFLETVLDTLALLPRFIKFFGDARNHNSSPGKLAVTFLAFVLN  229

Query  938   lafalsvlGFLIMHISLVSRNTT  1006
             LAFALS+L F+++H SLV  NTT
Sbjct  230   LAFALSLLCFVVLHTSLVLSNTT  252



>gb|KJB49336.1| hypothetical protein B456_008G114100 [Gossypium raimondii]
Length=257

 Score =   123 bits (308),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 110/189 (58%), Gaps = 50/189 (26%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G   + +A+ V+ LFH LLV+LLWSYF+VV TD G VPPNW+PA DEERG+ DPL  SEF
Sbjct  53    GGLHSFIAVVVLILFHFLLVLLLWSYFTVVLTDSGTVPPNWKPASDEERGEVDPLNESEF  112

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
               L PD +  RIR+C KCNQ KPPRCHHCSV                             
Sbjct  113   DGLQPDLSSQRIRYCWKCNQFKPPRCHHCSV-----------------------------  143

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
                                  +FF D +IPG+   LATTFL+FVLNLAFALSV GFLIMH
Sbjct  144   ---------------------SFFSDEEIPGTTATLATTFLSFVLNLAFALSVFGFLIMH  182

Query  980   ISLVSRNTT  1006
             +SLVS NTT
Sbjct  183   VSLVSANTT  191


 Score = 58.2 bits (139),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  268  MYRSGAVMAWNVFKFCTALRGLGSIMIllvlgvvgvtyyvvvltNYGPIL  417
            M+RSG  MAWNVFKFCT LRGLGSIMILLVLGVVGVTYY VV TNYGP L
Sbjct  1    MHRSGTTMAWNVFKFCTVLRGLGSIMILLVLGVVGVTYYAVVFTNYGPAL  50



>emb|CDY07150.1| BnaCnng01650D [Brassica napus]
Length=289

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 129/184 (70%), Gaps = 10/184 (5%)
 Frame = +2

Query  458   VALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPD  637
             +A  +I +FH LL+MLLWSYF+ VFTDPG VP ++R  L    GD+    AS        
Sbjct  52    LACLIILVFHFLLIMLLWSYFTAVFTDPGSVPEHFRREL-VVVGDSLEAGAS--------  102

Query  638   TAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytf  817
             T Q  + +C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFL YTF
Sbjct  103   TGQGALGYCPKCRIVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLLYTF  162

Query  818   lettlvtlSLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  994
             LET L  + LLP+F+ FF   +    S   LA+  LAFVLNLAF LS+L F++MH+SL+S
Sbjct  163   LETLLDVVVLLPSFIEFFSQAIKHSSSPSQLASLVLAFVLNLAFVLSLLCFIVMHLSLLS  222

Query  995   RNTT  1006
              NTT
Sbjct  223   TNTT  226



>ref|XP_002320223.1| hypothetical protein POPTR_0014s09980g [Populus trichocarpa]
 gb|EEE98538.1| hypothetical protein POPTR_0014s09980g [Populus trichocarpa]
Length=331

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 100/152 (66%), Gaps = 1/152 (1%)
 Frame = +2

Query  452  TLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLP  631
            +++A  +I +FH LL+MLLWSYF+V+  DPG VP NWR  L EE  +T          + 
Sbjct  50   SVLAFAIIMIFHFLLIMLLWSYFTVLSKDPGSVPENWRAVLPEEALETGSSLNDRSDCVV  109

Query  632  PDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfy  811
                  R  FC  C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FLLFL Y
Sbjct  110  ATDGLDRRAFCNHCENGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKFFLLFLLY  169

Query  812  tflettlvtlSLLPNFLAFFGDVDIPGSA-GD  904
            TF+ TT+ TL LLP F+ FFG      S+ GD
Sbjct  170  TFMVTTMDTLVLLPGFINFFGKAKNHSSSPGD  201



>emb|CBI25933.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  641   AQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytfl  820
             A   +RFC+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGA NYKYFLLFLFYTFL
Sbjct  6     ASEAVRFCRKCNLFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGAKNYKYFLLFLFYTFL  65

Query  821   ettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRN  1000
             ETTLVTLSLLP+F+AFF D +IPG+ G +A TFL FVLNLAFALSVLGFLIMHISLV+ N
Sbjct  66    ETTLVTLSLLPHFIAFFSDGEIPGTPGTIAATFLTFVLNLAFALSVLGFLIMHISLVAAN  125

Query  1001  TT  1006
             TT
Sbjct  126   TT  127



>ref|XP_001419536.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97829.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=331

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 118/189 (62%), Gaps = 9/189 (5%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G  D  VA   +  +H    MLLWSYF+ V T PG VP  W PA +      DP  A+  
Sbjct  68    GGEDAGVATGALCAYHVFAFMLLWSYFACVLTAPGDVPRGWTPAPE------DPEEAA--  119

Query  620   GSLPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
                    ++ R RFCKKC   KP R HHCSVC RCVLKMDHHCVWV NCVGA NYK+FL 
Sbjct  120   SEAKKSNSEKRRRFCKKCAAWKPTRTHHCSVCKRCVLKMDHHCVWVANCVGAYNYKFFLQ  179

Query  800   flfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  979
             FL YTFL T L  + LL NF+ FF DVD P    +LA  F+ F++N+AF+ S+LGFL+MH
Sbjct  180   FLAYTFLATVLDAILLLSNFIDFFKDVD-PAEGTELAVVFVTFIVNVAFSASLLGFLVMH  238

Query  980   ISLVSRNTT  1006
              +L+  N T
Sbjct  239   GNLILSNMT  247



>ref|XP_008779824.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Phoenix 
dactylifera]
Length=339

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 118/228 (52%), Positives = 142/228 (62%), Gaps = 40/228 (18%)
 Frame = +2

Query  437   VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDT-DPLTAS  613
             VG   +++AL ++ +FH LL +L+WSYF VVF DPG VP NWRP L+EE  +    +T S
Sbjct  51    VGGLVSVLALAIVIVFHLLLALLIWSYFMVVFVDPGSVPLNWRPTLEEENLEIGSSVTLS  110

Query  614   EFGSLPPDTAQS------------RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWV  757
             ++  + P+T  S             I +C +C+  KPPRCHHCSVC RCVLKMDHHCVWV
Sbjct  111   DY--VAPETRASAWPSSEGLERRPTIGYCSRCHNSKPPRCHHCSVCQRCVLKMDHHCVWV  168

Query  758   VNCVGALNYKYfllflf------------------------ytflettlvtlSLLPNFLA  865
             VNCVGA NYK FLLFL                         YTFLET L  ++LLP F+ 
Sbjct  169   VNCVGARNYKCFLLFLEFCRFKCRALEDTWTLWHPWPTVCLYTFLETVLDAVALLPRFVK  228

Query  866   FFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             FFGD     S+ G LA TFLAFVLNLAFALS+L F+IMH SLV  NTT
Sbjct  229   FFGDARNHNSSPGKLAVTFLAFVLNLAFALSLLCFVIMHTSLVLSNTT  276



>ref|XP_011082343.1| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Sesamum 
indicum]
Length=292

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 115/199 (58%), Gaps = 25/199 (13%)
 Frame = +2

Query  440   GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
             G F + V+  ++ LFH LLV+L WSYF VVF DPG VP NW+ + ++   D + ++ +  
Sbjct  46    GGFKSFVSFLIVTLFHVLLVLLTWSYFMVVFRDPGSVPANWKTSPEQNVADENFVSCTY-  104

Query  620   GSLPPDTA----------QSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCV  769
              S P ++A          +  + +C  C   KPPRCHHCSVC RCVLKMDHHC+WVVNCV
Sbjct  105   -SAPDNSAGPSSSEGIEKRPALNYCSYCKNGKPPRCHHCSVCQRCVLKMDHHCIWVVNCV  163

Query  770   GALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafa  949
             GA NYK+FLLF+ YT+LET + TL LLP F+ FF       S+                 
Sbjct  164   GARNYKFFLLFVLYTYLETMMDTLVLLPGFINFFQQAKRHSSSPGNLAITFLA-------  216

Query  950   lsvlGFLIMHISLVSRNTT  1006
                    +MHISL+  NTT
Sbjct  217   ------FVMHISLLLSNTT  229



>gb|KDO86584.1| hypothetical protein CISIN_1g021385mg [Citrus sinensis]
Length=286

 Score =   142 bits (357),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 129/191 (68%), Gaps = 16/191 (8%)
 Frame = +2

Query  470   VIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRP---------ALDEERGDTDPLTASEFG  622
             +I LFH LLVML+WSY  VVF DPG VP NWR           ++ E G +    +    
Sbjct  56    IIILFHILLVMLVWSYVMVVFWDPGSVPENWRSVSVSSSSSSGVNLEAGTS----SQSLD  111

Query  623   SLPPDTA--QSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfl  796
             ++ PD       + FC +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK FL
Sbjct  112   NVGPDARGPSRSVGFCDRCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKSFL  171

Query  797   lflfytflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLI  973
             LFL YTFLETT+ TL LLP+F+ FFG      S+  +LA  FLAFV+NLAFALS+L F++
Sbjct  172   LFLLYTFLETTMDTLVLLPSFIKFFGKAKNHSSSPANLAIVFLAFVINLAFALSLLCFIV  231

Query  974   MHISLVSRNTT  1006
             MH SLVS NTT
Sbjct  232   MHSSLVSSNTT  242



>emb|CDY51717.1| BnaA09g52040D [Brassica napus]
Length=289

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 128/184 (70%), Gaps = 10/184 (5%)
 Frame = +2

Query  458   VALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPD  637
             +A  +I +FH LL+MLLWSYF+ V TDPG VP ++R  L       +  T++E G+L   
Sbjct  52    LACLIIFVFHFLLIMLLWSYFTAVCTDPGSVPEHFRRELVVVGDSLEAGTSTEQGALG--  109

Query  638   TAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytf  817
                    +C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFL YTF
Sbjct  110   -------YCPKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLLYTF  162

Query  818   lettlvtlSLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  994
             LET L  + LLP+F+ FF   +    S   LA+  LAFVLNLAF LS+L F++MH+SLVS
Sbjct  163   LETLLDVVVLLPSFIEFFSQAIKRSSSPSQLASLVLAFVLNLAFVLSLLCFIVMHLSLVS  222

Query  995   RNTT  1006
              NTT
Sbjct  223   TNTT  226



>ref|XP_006288365.1| hypothetical protein CARUB_v10001614mg [Capsella rubella]
 gb|EOA21263.1| hypothetical protein CARUB_v10001614mg [Capsella rubella]
Length=210

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 99/140 (71%), Gaps = 7/140 (5%)
 Frame = +2

Query  458  VALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPD  637
            +A+ +I  FH LL+MLLWSYFS VFTDPG VP ++R     E G  D L A   G+    
Sbjct  52   LAILIIFTFHFLLIMLLWSYFSTVFTDPGSVPEHFR----REMGGGDNLEA---GTSTDQ  104

Query  638  TAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytf  817
             A   + +C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFLFYTF
Sbjct  105  GAFGSLGYCTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLFYTF  164

Query  818  lettlvtlSLLPNFLAFFGD  877
            LET L  + LLP+F+ FF  
Sbjct  165  LETMLDVIVLLPSFIEFFSQ  184



>ref|XP_009111388.1| PREDICTED: LOW QUALITY PROTEIN: probable protein S-acyltransferase 
12 [Brassica rapa]
Length=292

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 128/184 (70%), Gaps = 7/184 (4%)
 Frame = +2

Query  458   VALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPD  637
             +A  +I +FH LL+MLLWSYF+ V TDPG VP ++R  L       +  T++E G+L   
Sbjct  52    LACLIIFVFHFLLIMLLWSYFTAVCTDPGSVPEHFRRELVVVGDSLEAGTSTEQGAL---  108

Query  638   TAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytf  817
                    +C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFL YTF
Sbjct  109   ---GSXGYCPKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLLYTF  165

Query  818   lettlvtlSLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  994
             LET L  + LLP+F+ FF   +    S   LA+  LAFVLNLAF LS+L F++MH+SLVS
Sbjct  166   LETLLDVVVLLPSFIEFFSQAIKRSSSPSQLASLVLAFVLNLAFVLSLLCFIVMHLSLVS  225

Query  995   RNTT  1006
              NTT
Sbjct  226   TNTT  229



>ref|XP_010238650.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Brachypodium 
distachyon]
Length=298

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 109/184 (59%), Gaps = 22/184 (12%)
 Frame = +2

Query  482   FHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPL------TASEFGSLPPDTA  643
             FH LL+M+LW Y  VVFTDPG VP NWR A +E+  D           A++  + P  T+
Sbjct  65    FHLLLIMMLWCYLMVVFTDPGAVPENWRHAAEEDDMDESNTRTISNDVATDIVNPPLFTS  124

Query  644   QSR---IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  814
             + +    R+C +C   KPPRCHHCS+C RCVLKMDHHCVWVVNCVGA NYKYFLLFL YT
Sbjct  125   EGQGNASRYCSRCQNGKPPRCHHCSICDRCVLKMDHHCVWVVNCVGARNYKYFLLFLVYT  184

Query  815   flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  994
             FLET L TL LLP+F+ FF D     S+                         MH SLV+
Sbjct  185   FLETVLDTLVLLPSFITFFRDESRRSSSASDVAILFLAFG-------------MHTSLVA  231

Query  995   RNTT  1006
              NTT
Sbjct  232   SNTT  235



>gb|KDO86583.1| hypothetical protein CISIN_1g021385mg [Citrus sinensis]
Length=313

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 129/187 (69%), Gaps = 8/187 (4%)
 Frame = +2

Query  470   VIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERG----DTDPLTASE-FGSLPP  634
             +I LFH LLVML+WSY  VVF DPG VP NWR            + +  T+S+   ++ P
Sbjct  56    IIILFHILLVMLVWSYVMVVFWDPGSVPENWRSVSVSSSSSSGVNLEAGTSSQSLDNVGP  115

Query  635   DTA--QSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflf  808
             D       + FC +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK FLLFL 
Sbjct  116   DARGPSRSVGFCDRCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKSFLLFLL  175

Query  809   ytflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHIS  985
             YTFLETT+ TL LLP+F+ FFG      S+  +LA  FLAFV+NLAFALS+L F++MH S
Sbjct  176   YTFLETTMDTLVLLPSFIKFFGKAKNHSSSPANLAIVFLAFVINLAFALSLLCFIVMHSS  235

Query  986   LVSRNTT  1006
             LVS NTT
Sbjct  236   LVSSNTT  242



>ref|XP_006491350.1| PREDICTED: LOW QUALITY PROTEIN: probable protein S-acyltransferase 
12-like [Citrus sinensis]
Length=303

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 129/191 (68%), Gaps = 16/191 (8%)
 Frame = +2

Query  470   VIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRP---------ALDEERGDTDPLTASEFG  622
             +I LFH LLVML+WSY  VVF DPG VP NWR           ++ E G +    +    
Sbjct  56    IIILFHILLVMLVWSYVMVVFWDPGSVPENWRSVSVSSSSSSGVNLEAGTS----SQSLD  111

Query  623   SLPPDTA--QSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfl  796
             ++ PD       + FC +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK FL
Sbjct  112   NVGPDARGPSRSVGFCDRCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKSFL  171

Query  797   lflfytflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLI  973
             LFL YTFLETT+ TL LLP+F+ FFG      S+  +LA  FLAFV+NLAFALS+L F++
Sbjct  172   LFLLYTFLETTMDTLVLLPSFIKFFGKAKNHSSSPANLAIVFLAFVINLAFALSLLCFIV  231

Query  974   MHISLVSRNTT  1006
             MH SLVS NTT
Sbjct  232   MHSSLVSSNTT  242



>ref|XP_011082344.1| PREDICTED: probable protein S-acyltransferase 12 isoform X3 [Sesamum 
indicum]
Length=221

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 105/163 (64%), Gaps = 12/163 (7%)
 Frame = +2

Query  440  GVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEF  619
            G F + V+  ++ LFH LLV+L WSYF VVF DPG VP NW+ + ++   D + ++ +  
Sbjct  46   GGFKSFVSFLIVTLFHVLLVLLTWSYFMVVFRDPGSVPANWKTSPEQNVADENFVSCTY-  104

Query  620  GSLPPDTA----------QSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCV  769
             S P ++A          +  + +C  C   KPPRCHHCSVC RCVLKMDHHC+WVVNCV
Sbjct  105  -SAPDNSAGPSSSEGIEKRPALNYCSYCKNGKPPRCHHCSVCQRCVLKMDHHCIWVVNCV  163

Query  770  GALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDIPGSA  898
            GA NYK+FLLF+ YT+LET + TL LLP F+ FF       S+
Sbjct  164  GARNYKFFLLFVLYTYLETMMDTLVLLPGFINFFQQAKRHSSS  206



>ref|XP_010054971.1| PREDICTED: probable protein S-acyltransferase 12 [Eucalyptus 
grandis]
 gb|KCW71455.1| hypothetical protein EUGRSUZ_E00018 [Eucalyptus grandis]
Length=306

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 121/175 (69%), Gaps = 9/175 (5%)
 Frame = +2

Query  509   WSYFSVVFTDPGIVPPNWRPALDEERGDTD----PLTASEFGSLPPDTAQSRIR----FC  664
             WSYF VV  DPG VP NWRP  DEE  + D    P  AS  GS  P +  S  R    FC
Sbjct  69    WSYFMVVLRDPGSVPENWRPVRDEENFEGDASYLPHEASGSGSTWPSSNGSEGRPPSGFC  128

Query  665   KKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlS  844
              +C   KPPRCHHCS+C RCVLKMDHHCVWVVNCVGA NYK+FLLFL YTFLET + TL 
Sbjct  129   VRCQNGKPPRCHHCSICQRCVLKMDHHCVWVVNCVGACNYKFFLLFLLYTFLETMMDTLV  188

Query  845   LLPNFLAFFGDV-DIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
             LLP+F+ FF +  D   S G LA  F+AFVLNLAFALS+L FL+MH SLV  NTT
Sbjct  189   LLPSFINFFSEAKDHSNSPGKLAVIFVAFVLNLAFALSLLCFLVMHGSLVFSNTT  243



>gb|KDO86582.1| hypothetical protein CISIN_1g021385mg [Citrus sinensis]
Length=300

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 129/191 (68%), Gaps = 16/191 (8%)
 Frame = +2

Query  470   VIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRP---------ALDEERGDTDPLTASEFG  622
             +I LFH LLVML+WSY  VVF DPG VP NWR           ++ E G +    +    
Sbjct  56    IIILFHILLVMLVWSYVMVVFWDPGSVPENWRSVSVSSSSSSGVNLEAGTS----SQSLD  111

Query  623   SLPPDTA--QSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfl  796
             ++ PD       + FC +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK FL
Sbjct  112   NVGPDARGPSRSVGFCDRCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKSFL  171

Query  797   lflfytflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLI  973
             LFL YTFLETT+ TL LLP+F+ FFG      S+  +LA  FLAFV+NLAFALS+L F++
Sbjct  172   LFLLYTFLETTMDTLVLLPSFIKFFGKAKNHSSSPANLAIVFLAFVINLAFALSLLCFIV  231

Query  974   MHISLVSRNTT  1006
             MH SLVS NTT
Sbjct  232   MHSSLVSSNTT  242



>gb|KJB09590.1| hypothetical protein B456_001G151300 [Gossypium raimondii]
Length=234

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 121/175 (69%), Gaps = 10/175 (6%)
 Frame = +2

Query  494   LVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDT-DPLTASEFGSLPPDTAQSRIR---F  661
             LV+LLWSY  VV  DPG VP NWR    EE  +    L A+E      D  + R R   +
Sbjct  3     LVLLLWSYIRVVLKDPGSVPENWRAVSGEESLEVGTSLAAAE------DGFERRSRGGGY  56

Query  662   CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  841
             C  C   KPPRCHHCS+C RCVLKMDHHCVWVVNCVGA NYK+FLLFL YTFLETT+VT+
Sbjct  57    CIHCQNGKPPRCHHCSICQRCVLKMDHHCVWVVNCVGACNYKFFLLFLLYTFLETTMVTI  116

Query  842   SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  1006
              LLP+F+ FFG+     SA   A  FLAFVLN AFALS+L F++MH SL+S NTT
Sbjct  117   VLLPSFINFFGEAKNHSSAAKSAIIFLAFVLNFAFALSLLCFVVMHASLLSSNTT  171



>emb|CDP08628.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 102/148 (69%), Gaps = 12/148 (8%)
 Frame = +2

Query  470  VIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASEFGSLPPDTAQS  649
            ++ LFH LL++L WSY  VVF DPG VP NW+   +E+  + +P + S   +L P T+ S
Sbjct  58   IVILFHYLLILLTWSYMMVVFRDPGSVPDNWQLVSEEDLEEGNPTSISH--NLGPQTSAS  115

Query  650  R----------IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfll  799
                       IR+C +C   KPPRCHHCS+C RCVLKMDHHC+WVVNCVGA N+K+FLL
Sbjct  116  ALSDGTEIRPAIRYCSQCQNGKPPRCHHCSICQRCVLKMDHHCIWVVNCVGARNHKFFLL  175

Query  800  flfytflettlvtlSLLPNFLAFFGDVD  883
            F+FYTFLETTL T+ LLP+F+ FF    
Sbjct  176  FVFYTFLETTLNTVVLLPSFVNFFEQTK  203



>ref|XP_004133790.1| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Cucumis 
sativus]
 gb|KGN56387.1| hypothetical protein Csa_3G118230 [Cucumis sativus]
Length=306

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 131/198 (66%), Gaps = 8/198 (4%)
 Frame = +2

Query  437   VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASE  616
             +G F + +A  +I LFH LL++L WSYF VV  DPG VP NW  A + E  +    +  E
Sbjct  46    MGGFRSFLAFSIIILFHVLLLLLSWSYFMVVLEDPGSVPANWVLASEAENMEAGSSSLPE  105

Query  617   FGSLPPDTAQS-------RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA  775
              G     T  S          +C++C   KPPRCHHCSVC RCVLKMDHHC+WVVNCVGA
Sbjct  106   HGPTGDATYSSLDGAGRRSTAYCRQCQNGKPPRCHHCSVCQRCVLKMDHHCIWVVNCVGA  165

Query  776   LNYKYfllflfytflettlvtlSLLPNFLAFFGDVDI-PGSAGDlattflafvlnlafal  952
              NYK+FLLFL YTFLETT+ TL LLP+F+ FF +     GS  +L   FLAFVLNLAFAL
Sbjct  166   RNYKFFLLFLLYTFLETTMDTLVLLPSFIKFFDEAKSHSGSPANLVILFLAFVLNLAFAL  225

Query  953   svlGFLIMHISLVSRNTT  1006
             S+L F++MH SL+  NTT
Sbjct  226   SLLCFVVMHASLLMSNTT  243



>ref|XP_002529972.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF32415.1| zinc finger protein, putative [Ricinus communis]
Length=223

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 99/154 (64%), Gaps = 10/154 (6%)
 Frame = +2

Query  452  TLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERG----DTD---PLTA  610
            + +A  +I LFH LLVMLLWSYF VVF DPG VP NWR    E  G    ++D   P  +
Sbjct  50   SFLAFSLIILFHILLVMLLWSYFRVVFKDPGSVPENWRQENLEGGGSCINESDCGAPEAS  109

Query  611  SEFGSLPPDTAQSRIR---FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALN  781
                         R+    +C  C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA N
Sbjct  110  GSASVWAASEGSDRLAASGYCTHCKNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARN  169

Query  782  YKYfllflfytflettlvtlSLLPNFLAFFGDVD  883
            YK+FLLFL YTFLETT+ TL LLP+F+ FF +  
Sbjct  170  YKFFLLFLLYTFLETTMDTLVLLPSFIKFFDEAK  203



>ref|XP_008437841.1| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Cucumis 
melo]
Length=306

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 136/200 (68%), Gaps = 12/200 (6%)
 Frame = +2

Query  437   VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNW---RPALDEERGDTD---  598
             +G F + +A  +I LFH LL++L WSYF VV  DPG VP NW     A + E G++    
Sbjct  46    MGGFRSFLAFSIIILFHVLLLLLSWSYFMVVLEDPGSVPANWVLASEAENMEAGNSSLPE  105

Query  599   --PLTASEFGSLPPDTAQSR-IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCV  769
               P   + + SL  D A  R   +C++C   KPPRCHHCSVC RCVLKMDHHC+WVVNCV
Sbjct  106   HGPTGDASYSSL--DGAGRRSTAYCRQCQNGKPPRCHHCSVCQRCVLKMDHHCIWVVNCV  163

Query  770   GALNYKYfllflfytflettlvtlSLLPNFLAFFGDVDI-PGSAGDlattflafvlnlaf  946
             GA NYK+FLLFL YTFLETT+ TL LLP+F+ FF +     GS  +L   FLAFVLNLAF
Sbjct  164   GARNYKFFLLFLLYTFLETTMDTLVLLPSFIKFFDEAKSHSGSPANLVILFLAFVLNLAF  223

Query  947   alsvlGFLIMHISLVSRNTT  1006
             ALS+L F++MH SL+  NTT
Sbjct  224   ALSLLCFVVMHASLLMSNTT  243



>ref|XP_011650657.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Cucumis 
sativus]
 ref|XP_011650658.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Cucumis 
sativus]
 ref|XP_011650659.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Cucumis 
sativus]
 ref|XP_011650660.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Cucumis 
sativus]
Length=307

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 131/198 (66%), Gaps = 8/198 (4%)
 Frame = +2

Query  437   VGVFDTLVALFVIALFHCLLVMLLWSYFSVVFTDPGIVPPNWRPALDEERGDTDPLTASE  616
             +G F + +A  +I LFH LL++L WSYF VV  DPG VP NW  A + E  +    +  E
Sbjct  46    MGGFRSFLAFSIIILFHVLLLLLSWSYFMVVLEDPGSVPANWVLASEAENMEAGSSSLPE  105

Query  617   FGSLPPDTAQS-------RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA  775
              G     T  S          +C++C   KPPRCHHCSVC RCVLKMDHHC+WVVNCVGA
Sbjct  106   HGPTGDATYSSLDGAGRRSTAYCRQCQNGKPPRCHHCSVCQRCVLKMDHHCIWVVNCVGA  165

Query  776   LNYKYfllflfytflettlvtlSLLPNFLAFFGDVDI-PGSAGDlattflafvlnlafal  952
              NYK+FLLFL YTFLETT+ TL LLP+F+ FF +     GS  +L   FLAFVLNLAFAL
Sbjct  166   RNYKFFLLFLLYTFLETTMDTLVLLPSFIKFFDEAKSHSGSPANLVILFLAFVLNLAFAL  225

Query  953   svlGFLIMHISLVSRNTT  1006
             S+L F++MH SL+  NTT
Sbjct  226   SLLCFVVMHASLLMSNTT  243



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2529774447726