BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10288

Length=631
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002300221.2|  hypothetical protein POPTR_0001s31290g             218   1e-63   Populus trichocarpa [western balsam poplar]
gb|KDO52247.1|  hypothetical protein CISIN_1g0088442mg                  216   1e-63   Citrus sinensis [apfelsine]
ref|XP_006485526.1|  PREDICTED: retinoblastoma-binding protein 5-...    216   2e-63   Citrus sinensis [apfelsine]
ref|XP_006445680.1|  hypothetical protein CICLE_v10014800mg             217   2e-63   Citrus clementina [clementine]
ref|XP_007010539.1|  Transducin/WD40 repeat-like superfamily protein    216   3e-63   
ref|XP_011000114.1|  PREDICTED: retinoblastoma-binding protein 5 ...    216   5e-63   Populus euphratica
ref|XP_008238384.1|  PREDICTED: LOW QUALITY PROTEIN: retinoblasto...    214   1e-62   
ref|XP_007209915.1|  hypothetical protein PRUPE_ppa004402mg             214   2e-62   Prunus persica
ref|XP_012074485.1|  PREDICTED: protein RBL                             213   5e-62   Jatropha curcas
gb|KJB78514.1|  hypothetical protein B456_013G003300                    213   8e-62   Gossypium raimondii
ref|XP_002522890.1|  nucleotide binding protein, putative               213   9e-62   
ref|XP_004290312.1|  PREDICTED: protein RBL                             211   2e-61   Fragaria vesca subsp. vesca
ref|XP_009341586.1|  PREDICTED: retinoblastoma-binding protein 5 ...    211   2e-61   Pyrus x bretschneideri [bai li]
ref|XP_008363218.1|  PREDICTED: retinoblastoma-binding protein 5-...    211   3e-61   
ref|XP_008446711.1|  PREDICTED: retinoblastoma-binding protein 5        210   6e-61   Cucumis melo [Oriental melon]
ref|XP_011091980.1|  PREDICTED: retinoblastoma-binding protein 5 ...    209   6e-61   Sesamum indicum [beniseed]
ref|XP_011091979.1|  PREDICTED: retinoblastoma-binding protein 5 ...    210   8e-61   
gb|KCW65156.1|  hypothetical protein EUGRSUZ_G02654                     207   9e-61   Eucalyptus grandis [rose gum]
emb|CBI16678.3|  unnamed protein product                                209   9e-61   Vitis vinifera
emb|CAN70287.1|  hypothetical protein VITISV_003927                     209   1e-60   Vitis vinifera
ref|XP_002271886.1|  PREDICTED: retinoblastoma-binding protein 5 ...    210   1e-60   Vitis vinifera
ref|XP_011655820.1|  PREDICTED: protein RBL                             209   1e-60   Cucumis sativus [cucumbers]
emb|CDP07224.1|  unnamed protein product                                209   2e-60   Coffea canephora [robusta coffee]
ref|XP_009609899.1|  PREDICTED: retinoblastoma-binding protein 5 ...    208   4e-60   Nicotiana tomentosiformis
ref|XP_009609898.1|  PREDICTED: retinoblastoma-binding protein 5 ...    208   4e-60   Nicotiana tomentosiformis
ref|XP_010067087.1|  PREDICTED: retinoblastoma-binding protein 5 ...    207   1e-59   Eucalyptus grandis [rose gum]
ref|XP_009779738.1|  PREDICTED: retinoblastoma-binding protein 5 ...    206   1e-59   Nicotiana sylvestris
ref|XP_009779737.1|  PREDICTED: retinoblastoma-binding protein 5 ...    206   1e-59   Nicotiana sylvestris
ref|XP_010527302.1|  PREDICTED: retinoblastoma-binding protein 5 ...    206   2e-59   Tarenaya hassleriana [spider flower]
ref|XP_006370892.1|  transducin family protein                          206   2e-59   Populus trichocarpa [western balsam poplar]
ref|XP_011012485.1|  PREDICTED: retinoblastoma-binding protein 5 ...    206   2e-59   Populus euphratica
ref|XP_010936566.1|  PREDICTED: LOW QUALITY PROTEIN: retinoblasto...    206   4e-59   Elaeis guineensis
ref|XP_011012484.1|  PREDICTED: retinoblastoma-binding protein 5 ...    206   5e-59   Populus euphratica
ref|XP_010103982.1|  Retinoblastoma-binding protein 5                   205   6e-59   
ref|XP_010939085.1|  PREDICTED: retinoblastoma-binding protein 5 ...    205   8e-59   Elaeis guineensis
ref|XP_008787133.1|  PREDICTED: retinoblastoma-binding protein 5 ...    205   1e-58   
ref|XP_009394337.1|  PREDICTED: retinoblastoma-binding protein 5 ...    204   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010271571.1|  PREDICTED: retinoblastoma-binding protein 5 ...    204   2e-58   Nelumbo nucifera [Indian lotus]
ref|XP_008790627.1|  PREDICTED: retinoblastoma-binding protein 5 ...    202   1e-57   Phoenix dactylifera
ref|XP_010277147.1|  PREDICTED: retinoblastoma-binding protein 5 ...    201   4e-57   Nelumbo nucifera [Indian lotus]
gb|EPS71151.1|  hypothetical protein M569_03609                         198   5e-57   Genlisea aurea
ref|XP_006406323.1|  hypothetical protein EUTSA_v10020461mg             199   1e-56   
ref|XP_006406324.1|  hypothetical protein EUTSA_v10020461mg             199   1e-56   Eutrema salsugineum [saltwater cress]
emb|CDY27548.1|  BnaC01g32310D                                          198   2e-56   Brassica napus [oilseed rape]
emb|CDY37319.1|  BnaA01g25390D                                          199   4e-56   Brassica napus [oilseed rape]
gb|EYU26868.1|  hypothetical protein MIMGU_mgv1a004535mg                197   4e-56   Erythranthe guttata [common monkey flower]
ref|XP_002862673.1|  predicted protein                                  194   4e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_009109937.1|  PREDICTED: retinoblastoma-binding protein 5 ...    197   4e-56   Brassica rapa
ref|XP_009109949.1|  PREDICTED: retinoblastoma-binding protein 5 ...    197   5e-56   Brassica rapa
ref|NP_188743.3|  COMPASS-like H3K4 histone methylation complex c...    197   9e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AAO42218.1|  putative G-protein beta subunit                         197   9e-56   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB01449.1|  retinoblastoma-binding protein-like                    196   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883282.1|  hypothetical protein ARALYDRAFT_318845             196   2e-55   
ref|XP_006829296.1|  PREDICTED: protein RBL                             196   2e-55   Amborella trichopoda
ref|XP_003531795.1|  PREDICTED: retinoblastoma-binding protein 5-...    196   2e-55   Glycine max [soybeans]
ref|XP_004230070.1|  PREDICTED: retinoblastoma-binding protein 5 ...    195   2e-55   Solanum lycopersicum
ref|XP_004230069.1|  PREDICTED: retinoblastoma-binding protein 5 ...    195   2e-55   Solanum lycopersicum
ref|XP_010696132.1|  PREDICTED: retinoblastoma-binding protein 5 ...    194   7e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006582400.1|  PREDICTED: retinoblastoma-binding protein 5-...    194   7e-55   
ref|XP_006594027.1|  PREDICTED: retinoblastoma-binding protein 5-...    194   8e-55   
ref|XP_006594025.1|  PREDICTED: retinoblastoma-binding protein 5-...    194   8e-55   
ref|XP_006582402.1|  PREDICTED: retinoblastoma-binding protein 5-...    194   8e-55   
ref|XP_006582403.1|  PREDICTED: retinoblastoma-binding protein 5-...    194   8e-55   
ref|XP_006594026.1|  PREDICTED: retinoblastoma-binding protein 5-...    194   8e-55   
ref|XP_006594024.1|  PREDICTED: retinoblastoma-binding protein 5-...    194   9e-55   
ref|XP_006347718.1|  PREDICTED: retinoblastoma-binding protein 5-...    193   1e-54   Solanum tuberosum [potatoes]
ref|XP_006347717.1|  PREDICTED: retinoblastoma-binding protein 5-...    193   1e-54   Solanum tuberosum [potatoes]
ref|XP_006582399.1|  PREDICTED: retinoblastoma-binding protein 5-...    194   1e-54   
ref|XP_006582401.1|  PREDICTED: retinoblastoma-binding protein 5-...    194   1e-54   
ref|XP_003541356.1|  PREDICTED: retinoblastoma-binding protein 5-...    194   1e-54   Glycine max [soybeans]
ref|XP_006579832.1|  PREDICTED: retinoblastoma-binding protein 5-...    192   3e-54   Glycine max [soybeans]
ref|XP_003524594.1|  PREDICTED: retinoblastoma-binding protein 5-...    192   3e-54   
ref|XP_007156314.1|  hypothetical protein PHAVU_003G276000g             192   3e-54   Phaseolus vulgaris [French bean]
ref|XP_006579833.1|  PREDICTED: retinoblastoma-binding protein 5-...    192   3e-54   
ref|XP_006579835.1|  PREDICTED: retinoblastoma-binding protein 5-...    192   4e-54   
ref|XP_007141031.1|  hypothetical protein PHAVU_008G161500g             192   5e-54   Phaseolus vulgaris [French bean]
ref|XP_010466323.1|  PREDICTED: retinoblastoma-binding protein 5 ...    192   5e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010488090.1|  PREDICTED: retinoblastoma-binding protein 5 ...    192   5e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010509632.1|  PREDICTED: retinoblastoma-binding protein 5 ...    192   5e-54   Camelina sativa [gold-of-pleasure]
ref|XP_006579834.1|  PREDICTED: retinoblastoma-binding protein 5-...    192   6e-54   Glycine max [soybeans]
ref|XP_004498849.1|  PREDICTED: retinoblastoma-binding protein 5-...    190   7e-54   Cicer arietinum [garbanzo]
ref|XP_004490570.1|  PREDICTED: retinoblastoma-binding protein 5-...    192   7e-54   Cicer arietinum [garbanzo]
ref|XP_006297362.1|  hypothetical protein CARUB_v10013382mg             191   1e-53   Capsella rubella
dbj|BAJ94837.1|  predicted protein                                      191   1e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004985264.1|  PREDICTED: retinoblastoma-binding protein 5-...    191   1e-53   Setaria italica
ref|XP_003561921.1|  PREDICTED: retinoblastoma-binding protein 5 ...    190   4e-53   Brachypodium distachyon [annual false brome]
tpg|DAA43873.1|  TPA: retinoblastoma-binding protein-like protein       189   8e-53   
ref|NP_001146889.1|  LOC100280497                                       189   9e-53   Zea mays [maize]
tpg|DAA43874.1|  TPA: hypothetical protein ZEAMMB73_120366              187   1e-52   
gb|KEH19267.1|  retinoblastoma-binding-like protein                     185   2e-52   Medicago truncatula
ref|XP_003628195.1|  WD repeat-containing protein                       187   4e-52   Medicago truncatula
ref|XP_003628198.1|  Retinoblastoma-binding protein                     186   5e-52   
ref|XP_003628041.1|  WD repeat-containing protein                       186   6e-52   Medicago truncatula
ref|XP_003522878.1|  PREDICTED: retinoblastoma-binding protein 5-...    186   7e-52   
ref|XP_006578412.1|  PREDICTED: retinoblastoma-binding protein 5-...    186   7e-52   Glycine max [soybeans]
gb|KHN48493.1|  Retinoblastoma-binding protein 5                        186   8e-52   Glycine soja [wild soybean]
ref|XP_006578411.1|  PREDICTED: retinoblastoma-binding protein 5-...    186   8e-52   Glycine max [soybeans]
ref|NP_001049328.1|  Os03g0207900                                       185   2e-51   
gb|EAY88980.1|  hypothetical protein OsI_10465                          185   3e-51   Oryza sativa Indica Group [Indian rice]
gb|AFK42526.1|  unknown                                                 184   5e-51   Lotus japonicus
ref|XP_006649601.1|  PREDICTED: retinoblastoma-binding protein 5-...    184   8e-51   Oryza brachyantha
ref|XP_004958908.1|  PREDICTED: retinoblastoma-binding protein 5-...    184   1e-50   Setaria italica
ref|XP_002465668.1|  hypothetical protein SORBIDRAFT_01g043410          182   2e-50   Sorghum bicolor [broomcorn]
gb|EMS61733.1|  Retinoblastoma-binding protein 5                        184   2e-50   Triticum urartu
gb|EMT25536.1|  hypothetical protein F775_27533                         183   3e-50   
ref|XP_008673444.1|  PREDICTED: LOC100280497 isoform X2                 182   5e-50   Zea mays [maize]
gb|KEH19268.1|  retinoblastoma-binding-like protein                     180   2e-49   Medicago truncatula
ref|XP_008673440.1|  PREDICTED: LOC100280497 isoform X1                 179   5e-49   
gb|KHN38141.1|  Retinoblastoma-binding protein 5                        172   2e-46   Glycine soja [wild soybean]
ref|XP_001764783.1|  WD40 repeat protein, COMPASS complex protein       167   5e-45   
ref|XP_006369773.1|  hypothetical protein POPTR_0001s31290g             167   6e-45   
ref|XP_009609900.1|  PREDICTED: retinoblastoma-binding protein 5 ...    158   1e-41   Nicotiana tomentosiformis
ref|XP_010277148.1|  PREDICTED: retinoblastoma-binding protein 5 ...    155   1e-40   
ref|XP_006579836.1|  PREDICTED: retinoblastoma-binding protein 5-...    145   4e-37   
ref|XP_002975565.1|  hypothetical protein SELMODRAFT_103410             137   4e-34   
ref|XP_007133504.1|  hypothetical protein PHAVU_011G184500g             130   1e-31   Phaseolus vulgaris [French bean]
ref|XP_010497484.1|  PREDICTED: retinoblastoma-binding protein 5 ...    117   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006578413.1|  PREDICTED: retinoblastoma-binding protein 5-...    112   3e-25   Glycine max [soybeans]
ref|XP_003615569.1|  Retinoblastoma-binding protein                     101   7e-24   
gb|KFH72296.1|  hypothetical protein MVEG_02587                         109   7e-24   Mortierella verticillata NRRL 6337
emb|CDS04820.1|  hypothetical protein LRAMOSA07350                      102   3e-22   Lichtheimia ramosa
ref|XP_004339591.1|  WD40 repeat protein, COMPASS complex protein       101   1e-21   Acanthamoeba castellanii str. Neff
emb|CDH61504.1|  retinoblastoma-binding protein 5-like                  101   1e-21   Lichtheimia corymbifera JMRC:FSU:9682
emb|CEG72738.1|  hypothetical protein RMATCC62417_08238               97.8    2e-20   Rhizopus microsporus
ref|XP_005839587.1|  hypothetical protein GUITHDRAFT_133657           97.4    2e-20   Guillardia theta CCMP2712
emb|CEJ02518.1|  hypothetical protein RMCBS344292_16519               97.8    3e-20   Rhizopus microsporus
emb|CEG72737.1|  hypothetical protein RMATCC62417_08238               97.8    3e-20   Rhizopus microsporus
gb|ERZ96784.1|  hypothetical protein GLOINDRAFT_299625                95.5    2e-19   
dbj|GAN08020.1|  hypothetical protein MAM1_0186c07526                 91.3    4e-19   Mucor ambiguus
ref|XP_003291427.1|  hypothetical protein DICPUDRAFT_82100            92.0    3e-18   Dictyostelium purpureum
gb|KJE88843.1|  hypothetical protein CAOG_000421                      91.7    6e-18   Capsaspora owczarzaki ATCC 30864
gb|EPB82204.1|  hypothetical protein HMPREF1544_11048                 91.3    6e-18   Mucor circinelloides f. circinelloides 1006PhL
gb|EFA80387.1|  WD-40 repeat-containing protein                       90.1    6e-18   Heterostelium album PN500
ref|XP_004990000.1|  hypothetical protein PTSG_09572                  89.7    7e-18   Salpingoeca rosetta
gb|KHN26444.1|  Retinoblastoma-binding protein 5                      90.5    1e-17   Glycine soja [wild soybean]
ref|XP_005787879.1|  hypothetical protein EMIHUDRAFT_433832           89.0    4e-17   Emiliania huxleyi CCMP1516
ref|XP_008347048.1|  PREDICTED: retinoblastoma-binding protein 5-...  87.0    6e-17   
ref|XP_002504961.1|  COMPASS/Set1C complex protein                    88.2    2e-16   Micromonas commoda
gb|EFX77720.1|  hypothetical protein DAPPUDRAFT_321168                85.5    9e-16   Daphnia pulex
gb|KFM81993.1|  Retinoblastoma-binding protein 5                      79.7    2e-15   Stegodyphus mimosarum
ref|XP_001856893.1|  retinoblastoma-binding protein 5                 84.0    3e-15   Culex quinquefasciatus
ref|XP_009018161.1|  hypothetical protein HELRODRAFT_185612           84.0    3e-15   Helobdella robusta
gb|EIF46863.1|  wd domain protein                                     83.2    3e-15   Brettanomyces bruxellensis AWRI1499
ref|XP_003387125.1|  PREDICTED: retinoblastoma-binding protein 5 ...  83.6    4e-15   Amphimedon queenslandica
gb|ADV40177.1|  retinoblastoma binding protein                        80.9    4e-15   Latrodectus hesperus [black widow]
ref|XP_011136194.1|  PREDICTED: retinoblastoma-binding protein 5 ...  82.8    6e-15   
ref|XP_011349613.1|  PREDICTED: retinoblastoma-binding protein 5 ...  82.8    6e-15   Ooceraea biroi
ref|XP_008551099.1|  PREDICTED: retinoblastoma-binding protein 5 ...  82.8    6e-15   Microplitis demolitor
ref|XP_011064252.1|  PREDICTED: retinoblastoma-binding protein 5 ...  82.8    6e-15   Acromyrmex echinatior
ref|XP_011684913.1|  PREDICTED: retinoblastoma-binding protein 5 ...  82.8    6e-15   Wasmannia auropunctata
ref|XP_011874786.1|  PREDICTED: retinoblastoma-binding protein 5 ...  82.8    6e-15   Vollenhovia emeryi
ref|XP_011254466.1|  PREDICTED: retinoblastoma-binding protein 5 ...  82.8    6e-15   Camponotus floridanus
ref|XP_011497888.1|  PREDICTED: retinoblastoma-binding protein 5 ...  82.8    7e-15   Ceratosolen solmsi marchali
ref|XP_011172153.1|  PREDICTED: retinoblastoma-binding protein 5 ...  82.8    7e-15   Solenopsis invicta [imported red fire ant]
ref|XP_314543.3|  AGAP010575-PA                                       82.8    7e-15   Anopheles gambiae str. PEST
ref|XP_006622476.1|  PREDICTED: retinoblastoma-binding protein 5-...  82.4    7e-15   Apis dorsata [rock honeybee]
ref|XP_006568237.1|  PREDICTED: retinoblastoma-binding protein 5-...  82.4    7e-15   Apis mellifera [bee]
ref|XP_638014.1|  WD-40 repeat-containing protein                     82.8    8e-15   Dictyostelium discoideum AX4
gb|ETN62412.1|  retinoblastoma-binding protein 5                      82.4    8e-15   Anopheles darlingi [American malaria mosquito]
ref|XP_003393845.1|  PREDICTED: retinoblastoma-binding protein 5-...  82.4    8e-15   Bombus terrestris [large earth bumblebee]
ref|XP_394331.2|  PREDICTED: retinoblastoma-binding protein 5-lik...  82.4    9e-15   Apis mellifera [bee]
ref|XP_003696838.1|  PREDICTED: retinoblastoma-binding protein 5      82.4    9e-15   Apis florea [dwarf honeybee]
ref|XP_003702347.1|  PREDICTED: retinoblastoma-binding protein 5 ...  82.4    9e-15   Megachile rotundata
ref|XP_001656334.1|  AAEL003140-PA                                    82.4    1e-14   Aedes aegypti
ref|XP_011894574.1|  PREDICTED: retinoblastoma-binding protein 5      77.8    1e-14   Cercocebus atys
ref|XP_004365292.2|  hypothetical protein CAOG_00421                  81.6    1e-14   Capsaspora owczarzaki ATCC 30864
gb|ACD81779.1|  IP20752p                                              79.7    1e-14   Drosophila melanogaster
gb|EZA47584.1|  Retinoblastoma-binding protein                        82.8    1e-14   Ooceraea biroi
ref|XP_002740061.2|  PREDICTED: retinoblastoma-binding protein 5-...  79.0    2e-14   Saccoglossus kowalevskii
gb|KFB38609.1|  hypothetical protein ZHAS_00005986                    82.4    2e-14   Anopheles sinensis
ref|XP_011666860.1|  PREDICTED: retinoblastoma-binding protein 5      81.6    2e-14   Strongylocentrotus purpuratus [purple urchin]
emb|CCO27321.1|  Retinoblastoma-binding protein 5 Short=RBBP-5        80.9    2e-14   Rhizoctonia solani AG-1 IB
gb|KDN43508.1|  hypothetical protein RSAG8_06097                      80.9    2e-14   Rhizoctonia solani AG-8 WAC10335
ref|XP_009049360.1|  hypothetical protein LOTGIDRAFT_177999           80.9    2e-14   Lottia gigantea
ref|XP_001608301.1|  PREDICTED: retinoblastoma-binding protein 5      80.9    3e-14   Nasonia vitripennis
ref|XP_011300070.1|  PREDICTED: retinoblastoma-binding protein 5 ...  80.5    4e-14   Fopius arisanus
ref|XP_001549040.1|  hypothetical protein BC1G_12448                  76.6    4e-14   
gb|EWC43874.1|  hypothetical protein DRE_07251                        80.1    5e-14   Drechslerella stenobrocha 248
ref|NP_001025680.1|  retinoblastoma binding protein 5                 80.1    5e-14   Xenopus tropicalis [western clawed frog]
ref|XP_009059285.1|  hypothetical protein LOTGIDRAFT_145817           77.8    5e-14   Lottia gigantea
ref|XP_969765.1|  PREDICTED: retinoblastoma-binding protein 5         80.1    5e-14   Tribolium castaneum [rust-red flour beetle]
ref|NP_001086675.1|  retinoblastoma binding protein 5                 80.1    6e-14   Xenopus laevis [clawed frog]
ref|XP_011451298.1|  PREDICTED: retinoblastoma-binding protein 5-...  79.7    7e-14   Crassostrea gigas
ref|XP_011451297.1|  PREDICTED: retinoblastoma-binding protein 5 ...  79.7    7e-14   Crassostrea gigas
ref|XP_008468897.1|  PREDICTED: retinoblastoma-binding protein 5 ...  79.7    8e-14   Diaphorina citri
ref|XP_004357820.1|  WD-40 repeat-containing protein                  79.7    8e-14   Cavenderia fasciculata
ref|XP_007897648.1|  PREDICTED: retinoblastoma-binding protein 5      79.7    9e-14   Callorhinchus milii [Australian ghost shark]
gb|ELU15208.1|  hypothetical protein CAPTEDRAFT_167502                79.3    9e-14   Capitella teleta
ref|XP_010879199.1|  PREDICTED: retinoblastoma-binding protein 5 ...  79.3    1e-13   Esox lucius
ref|XP_006628496.1|  PREDICTED: retinoblastoma-binding protein 5-...  79.3    1e-13   Lepisosteus oculatus
ref|XP_003474722.1|  PREDICTED: retinoblastoma-binding protein 5      77.8    1e-13   
ref|XP_002040644.1|  GM22228                                          79.0    1e-13   Drosophila sechellia
ref|XP_001957252.1|  GF24147                                          79.3    1e-13   
ref|XP_002061876.1|  GK17232                                          79.0    1e-13   Drosophila willistoni
ref|XP_002021047.1|  GL25040                                          79.0    1e-13   Drosophila persimilis
ref|XP_010879198.1|  PREDICTED: retinoblastoma-binding protein 5 ...  79.3    1e-13   Esox lucius
ref|XP_006628495.1|  PREDICTED: retinoblastoma-binding protein 5-...  79.3    1e-13   
gb|KJK64842.1|  WD40 repeat protein                                   79.0    1e-13   Aspergillus parasiticus SU-1
ref|XP_001819666.1|  WD domain protein                                79.0    1e-13   Aspergillus oryzae RIB40
ref|NP_649209.1|  Rbbp5                                               79.0    1e-13   Drosophila melanogaster
ref|XP_002048140.1|  GJ13797                                          79.0    1e-13   Drosophila virilis
ref|XP_002085632.1|  GD12200                                          79.0    1e-13   Drosophila simulans
ref|XP_002095481.1|  GE22415                                          79.0    1e-13   Drosophila yakuba
ref|XP_001973466.1|  GG13327                                          79.0    1e-13   Drosophila erecta
ref|XP_011553834.1|  PREDICTED: retinoblastoma-binding protein 5 ...  79.0    1e-13   Plutella xylostella [cabbage moth]
emb|CCJ29677.1|  unnamed protein product                              78.6    1e-13   Pneumocystis jirovecii
gb|KIY92765.1|  hypothetical protein MNEG_15199                       76.3    1e-13   Monoraphidium neglectum
ref|XP_002008245.1|  GI11921                                          79.0    1e-13   Drosophila mojavensis
dbj|GAD98735.1|  WD domain-containing protein                         78.6    1e-13   Byssochlamys spectabilis No. 5
ref|XP_002129816.1|  PREDICTED: retinoblastoma-binding protein 5-...  79.0    2e-13   Ciona intestinalis [sea vase]
ref|XP_005112725.1|  PREDICTED: retinoblastoma-binding protein 5-...  79.0    2e-13   Aplysia californica
ref|XP_005112727.1|  PREDICTED: retinoblastoma-binding protein 5-...  79.0    2e-13   Aplysia californica
ref|XP_001264290.1|  WD domain protein                                78.6    2e-13   Aspergillus fischeri NRRL 181
ref|XP_658412.1|  hypothetical protein AN0808.2                       78.6    2e-13   Aspergillus nidulans FGSC A4
ref|XP_005112726.1|  PREDICTED: retinoblastoma-binding protein 5-...  79.0    2e-13   Aplysia californica
ref|XP_006529422.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.8    2e-13   Mus musculus [mouse]
ref|XP_007291406.1|  WD domain protein                                78.6    2e-13   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ref|XP_001389675.1|  WD domain protein                                78.2    2e-13   Aspergillus niger CBS 513.88
dbj|GAA86710.1|  WD domain protein                                    78.2    2e-13   Aspergillus kawachii IFO 4308
dbj|GAM22072.1|  hypothetical protein SAMD00019534_052470             77.8    2e-13   Acytostelium subglobosum LB1
ref|XP_001268792.1|  WD domain protein                                78.2    3e-13   Aspergillus clavatus NRRL 1
ref|XP_011508136.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    3e-13   
ref|XP_003177451.1|  Set1 complex component swd1                      78.2    3e-13   Nannizzia gypsea CBS 118893
ref|XP_008266750.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    3e-13   Oryctolagus cuniculus [domestic rabbit]
ref|XP_004924717.1|  PREDICTED: retinoblastoma-binding protein 5-...  77.8    3e-13   Bombyx mori [silk moth]
ref|XP_003231776.1|  WD domain-containing protein                     77.8    3e-13   Trichophyton rubrum CBS 118892
gb|KHJ34404.1|  putative wd domain-containing protein                 77.8    3e-13   Erysiphe necator
ref|XP_001507579.2|  PREDICTED: retinoblastoma-binding protein 5      77.8    3e-13   
gb|EGD96854.1|  WD repeat protein                                     77.8    3e-13   Trichophyton tonsurans CBS 112818
ref|XP_007422782.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.8    4e-13   Python bivittatus
gb|EHJ69754.1|  hypothetical protein KGM_18987                        77.4    4e-13   
gb|ESZ98956.1|  hypothetical protein SBOR_0614                        77.4    4e-13   Sclerotinia borealis F-4128
gb|KDR15310.1|  Retinoblastoma-binding protein 5                      77.8    4e-13   Zootermopsis nevadensis
ref|XP_005306474.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.8    4e-13   Chrysemys picta bellii
dbj|BAF82826.1|  unnamed protein product                              77.8    4e-13   Homo sapiens [man]
ref|XP_008170919.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.8    4e-13   Chrysemys picta bellii
ref|XP_004578775.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.8    4e-13   Ochotona princeps [southern American pika]
ref|XP_004282501.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    4e-13   
ref|NP_001180201.1|  retinoblastoma-binding protein 5 isoform 2       77.4    4e-13   Homo sapiens [man]
ref|XP_008974819.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.8    4e-13   Pan paniscus [bonobo]
ref|XP_005188206.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    4e-13   Musca domestica
ref|XP_003340213.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    4e-13   Monodelphis domestica
ref|XP_009069092.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    4e-13   Acanthisitta chloris
ref|XP_005329570.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    4e-13   Ictidomys tridecemlineatus
ref|XP_004885473.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    4e-13   
ref|XP_003767661.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    4e-13   
ref|XP_011471087.1|  PREDICTED: retinoblastoma-binding protein 5      77.4    4e-13   
ref|XP_007481313.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    4e-13   Monodelphis domestica
ref|XP_010577808.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    4e-13   Haliaeetus leucocephalus
ref|XP_004663610.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    4e-13   Jaculus jaculus
ref|XP_005348402.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    4e-13   Microtus ochrogaster [prairie voles]
ref|XP_002808301.1|  PREDICTED: LOW QUALITY PROTEIN: retinoblasto...  77.4    4e-13   
ref|XP_004610135.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    4e-13   Sorex araneus [Eurasian shrew]
ref|XP_005885327.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    4e-13   Myotis brandtii
ref|XP_005245458.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    4e-13   
ref|XP_001489657.2|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    4e-13   Equus caballus [domestic horse]
ref|XP_006737109.1|  PREDICTED: retinoblastoma-binding protein 5      77.4    4e-13   Leptonychotes weddellii
ref|XP_012042331.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   
ref|XP_011221930.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   Ailuropoda melanoleuca
ref|XP_006529420.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   
ref|XP_004425181.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_007640087.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   Cricetulus griseus [Chinese hamsters]
ref|XP_001210765.1|  conserved hypothetical protein                   77.4    5e-13   Aspergillus terreus NIH2624
ref|XP_003792376.1|  PREDICTED: retinoblastoma-binding protein 5      77.4    5e-13   
ref|XP_008578955.1|  PREDICTED: retinoblastoma-binding protein 5      77.4    5e-13   Galeopterus variegatus [Malayan flying lemur]
ref|XP_005529367.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_004477657.1|  PREDICTED: retinoblastoma-binding protein 5      77.4    5e-13   
ref|XP_007422781.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   Python bivittatus
ref|XP_006888047.1|  PREDICTED: retinoblastoma-binding protein 5      77.4    5e-13   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004578774.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   Ochotona princeps [southern American pika]
ref|XP_001985029.1|  GH16829                                          77.0    5e-13   Drosophila grimshawi
ref|XP_007422780.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   Python bivittatus
gb|KFO19612.1|  Retinoblastoma-binding protein 5                      77.4    5e-13   Fukomys damarensis [Damara mole rat]
ref|XP_004788401.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   
ref|XP_005375401.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   Chinchilla lanigera
ref|XP_008714769.1|  hypothetical protein HMPREF1541_02191            77.0    5e-13   Cyphellophora europaea CBS 101466
ref|XP_003410304.2|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   
dbj|BAI45474.1|  retinoblastoma binding protein 5                     77.4    5e-13   synthetic construct
ref|XP_005306473.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   Chrysemys picta bellii
ref|XP_004641170.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   
ref|XP_004425180.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   
ref|XP_004282500.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   
ref|XP_005306472.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   
ref|XP_008533908.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   
ref|XP_004013603.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   
emb|CAA59446.1|  RB protein binding protein                           77.4    5e-13   
ref|XP_003364974.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   
ref|XP_010577801.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   
ref|XP_004862178.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   
ref|XP_848552.1|  PREDICTED: retinoblastoma-binding protein 5 iso...  77.4    5e-13   
ref|XP_005885325.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   
ref|XP_005885326.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   
ref|XP_006062332.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   
dbj|BAE42295.1|  unnamed protein product                              77.4    5e-13   
ref|XP_002918261.2|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    5e-13   
ref|NP_005048.2|  retinoblastoma-binding protein 5 isoform 1          77.4    5e-13   
ref|XP_005749526.1|  PREDICTED: retinoblastoma-binding protein 5-...  77.0    5e-13   
ref|XP_003447710.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.0    5e-13   
ref|NP_766105.2|  retinoblastoma-binding protein 5                    77.4    5e-13   
ref|XP_010743860.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.0    6e-13   
ref|XP_002551421.1|  hypothetical protein CTRG_05719                  77.0    6e-13   
ref|XP_004788403.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_005375399.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_005329568.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_004885471.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_004663609.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
dbj|BAC33635.1|  unnamed protein product                              77.4    6e-13   
ref|XP_010743859.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.0    6e-13   
ref|XP_008821549.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_001365126.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_009069091.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_008266747.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_007481312.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_006159302.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_004610134.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_003767660.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_003501248.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|NP_001026085.1|  retinoblastoma-binding protein 5                 77.4    6e-13   
ref|XP_008318918.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.0    6e-13   
ref|XP_005329569.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_005348401.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_002717493.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_005348400.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_006988867.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_004885470.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_011114971.1|  hypothetical protein H072_9399                   77.0    6e-13   
ref|XP_008107826.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_003973044.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.0    6e-13   
ref|XP_010577793.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_008107828.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.4    6e-13   
ref|XP_011178496.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.0    6e-13   
ref|NP_001100644.1|  retinoblastoma-binding protein 5                 77.0    6e-13   
ref|XP_005529366.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.0    6e-13   
ref|XP_007542355.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.0    6e-13   
ref|XP_002170756.2|  PREDICTED: retinoblastoma-binding protein 5-...  77.4    6e-13   
ref|XP_005815581.1|  PREDICTED: retinoblastoma-binding protein 5-...  77.0    6e-13   
ref|XP_011205776.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.0    7e-13   
ref|XP_011611870.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.0    7e-13   
ref|XP_011611869.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.0    7e-13   
gb|EFN69569.1|  Retinoblastoma-binding protein 5                      76.6    7e-13   
ref|XP_008107825.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.0    7e-13   
ref|XP_003220453.2|  PREDICTED: retinoblastoma-binding protein 5 ...  77.0    7e-13   
gb|ETE66247.1|  Retinoblastoma-binding protein 5                      77.4    7e-13   
ref|XP_008318917.1|  PREDICTED: retinoblastoma-binding protein 5 ...  77.0    8e-13   
ref|XP_011122681.1|  hypothetical protein AOL_s00080g4                76.6    8e-13   
ref|XP_005749525.1|  PREDICTED: retinoblastoma-binding protein 5-...  77.0    8e-13   
ref|XP_005917850.1|  PREDICTED: retinoblastoma-binding protein 5-...  77.0    8e-13   
ref|XP_006783028.1|  PREDICTED: retinoblastoma-binding protein 5-...  77.0    8e-13   
ref|XP_004547441.1|  PREDICTED: retinoblastoma-binding protein 5-...  77.0    8e-13   
ref|XP_008297322.1|  PREDICTED: retinoblastoma-binding protein 5      77.0    8e-13   
ref|XP_010743858.1|  PREDICTED: retinoblastoma-binding protein 5 ...  76.6    8e-13   
ref|XP_002597204.1|  hypothetical protein BRAFLDRAFT_203393           76.6    9e-13   
ref|XP_007542354.1|  PREDICTED: retinoblastoma-binding protein 5 ...  76.6    9e-13   
emb|CCD33788.1|  similar to retinoblastoma-binding protein 5          76.3    9e-13   
ref|XP_007256813.1|  PREDICTED: retinoblastoma-binding protein 5-...  76.6    9e-13   
ref|XP_002621401.1|  WD domain-containing protein                     76.3    1e-12   
ref|XP_010762077.1|  hypothetical protein PADG_06745                  76.3    1e-12   
emb|CDQ60421.1|  unnamed protein product                              76.3    1e-12   
ref|XP_009566396.1|  PREDICTED: retinoblastoma-binding protein 5-...  73.6    1e-12   
gb|EGC44270.1|  chromatin binding protein                             72.0    1e-12   
gb|KIM98038.1|  hypothetical protein OIDMADRAFT_203456                75.9    1e-12   
ref|XP_002118071.1|  hypothetical protein TRIADDRAFT_33540            75.5    1e-12   
ref|XP_010225303.1|  PREDICTED: retinoblastoma-binding protein 5-...  72.4    2e-12   
ref|XP_008407092.1|  PREDICTED: retinoblastoma-binding protein 5 ...  75.9    2e-12   
gb|ELU43117.1|  Set1 complex component swd1                           75.5    2e-12   
ref|XP_008107829.1|  PREDICTED: retinoblastoma-binding protein 5 ...  75.9    2e-12   
gb|KFP76474.1|  Retinoblastoma-binding protein 5                      75.9    2e-12   
ref|XP_003853474.1|  COMPASS, Set1C complex protein                   75.5    2e-12   
ref|XP_002792667.1|  Set1 complex component swd1                      75.5    2e-12   
gb|EEH15894.2|  hypothetical protein PABG_05981                       75.5    2e-12   
ref|XP_008407090.1|  PREDICTED: retinoblastoma-binding protein 5 ...  75.5    2e-12   
ref|XP_002582323.1|  conserved hypothetical protein                   75.1    2e-12   
gb|KJX99134.1|  WD domain protein                                     75.1    2e-12   
ref|XP_007789156.1|  putative wd domain-containing protein            75.1    3e-12   
ref|XP_004392877.1|  PREDICTED: retinoblastoma-binding protein 5 ...  75.1    3e-12   
gb|KGO39426.1|  hypothetical protein PEXP_042670                      74.7    3e-12   
gb|EMF14075.1|  WD40 repeat-like protein                              74.7    4e-12   
ref|XP_007925739.1|  hypothetical protein MYCFIDRAFT_36175            74.7    4e-12   
dbj|GAM90705.1|  hypothetical protein ANO11243_087500                 74.3    4e-12   
ref|XP_002561698.1|  Pc16g14000                                       74.3    5e-12   
ref|XP_002146908.1|  WD repeat protein                                74.3    5e-12   
gb|EKV09118.1|  WD repeat protein                                     74.3    5e-12   
ref|XP_502155.1|  YALI0C22858p                                        73.9    5e-12   
ref|XP_002424873.1|  restnoblastoma-binding protein, putative         74.3    5e-12   
ref|XP_005640842.1|  PREDICTED: retinoblastoma-binding protein 5 ...  73.9    6e-12   
emb|CDM34700.1|  Set1 complex component swd1                          73.9    6e-12   
gb|KEQ81576.1|  COMPASS, Set1C complex protein                        73.9    6e-12   
ref|XP_005059303.1|  PREDICTED: retinoblastoma-binding protein 5      73.9    6e-12   
gb|EME46474.1|  hypothetical protein DOTSEDRAFT_70469                 73.9    6e-12   
ref|XP_008072865.1|  PREDICTED: retinoblastoma-binding protein 5 ...  73.9    6e-12   
ref|XP_001593004.1|  hypothetical protein SS1G_05926                  73.9    6e-12   
ref|XP_005245455.1|  PREDICTED: retinoblastoma-binding protein 5 ...  73.9    7e-12   
dbj|GAM35418.1|  hypothetical protein TCE0_017r03734                  73.9    7e-12   
gb|ELR52304.1|  Retinoblastoma-binding protein 5                      73.9    7e-12   
ref|XP_006988868.1|  PREDICTED: retinoblastoma-binding protein 5 ...  73.9    7e-12   
ref|XP_011813143.1|  PREDICTED: retinoblastoma-binding protein 5 ...  73.9    7e-12   
dbj|BAG59939.1|  unnamed protein product                              73.9    7e-12   
ref|XP_009439553.1|  PREDICTED: retinoblastoma-binding protein 5      73.9    7e-12   
ref|NP_956539.1|  retinoblastoma-binding protein 5                    73.9    7e-12   
ref|XP_011845814.1|  PREDICTED: retinoblastoma-binding protein 5 ...  73.9    7e-12   
ref|XP_004641169.1|  PREDICTED: retinoblastoma-binding protein 5 ...  73.9    7e-12   
gb|AAH67666.1|  Retinoblastoma binding protein 5                      73.9    7e-12   
gb|ELK03324.1|  Retinoblastoma-binding protein 5                      74.3    7e-12   
ref|XP_001635505.1|  predicted protein                                73.6    7e-12   
gb|ELK37228.1|  Retinoblastoma-binding protein 5                      73.9    7e-12   
ref|XP_005375402.1|  PREDICTED: retinoblastoma-binding protein 5 ...  73.9    7e-12   
gb|EHH15635.1|  hypothetical protein EGK_01750                        73.9    7e-12   
gb|KJJ23358.1|  WD40 repeat                                           73.6    7e-12   
ref|XP_005640841.1|  PREDICTED: retinoblastoma-binding protein 5 ...  73.9    7e-12   
ref|XP_006988866.1|  PREDICTED: retinoblastoma-binding protein 5 ...  73.9    7e-12   
ref|XP_012042330.1|  PREDICTED: retinoblastoma-binding protein 5 ...  73.9    7e-12   
emb|CAF94650.1|  unnamed protein product                              73.6    7e-12   
gb|KFQ88698.1|  Retinoblastoma-binding protein 5                      73.9    7e-12   
gb|KFU89506.1|  Retinoblastoma-binding protein 5                      73.9    8e-12   
gb|KFQ23443.1|  Retinoblastoma-binding protein 5                      73.9    8e-12   
ref|XP_005014676.1|  PREDICTED: retinoblastoma-binding protein 5 ...  73.9    8e-12   
ref|XP_005014677.1|  PREDICTED: retinoblastoma-binding protein 5 ...  73.9    8e-12   
gb|KFM03208.1|  Retinoblastoma-binding protein 5                      73.9    8e-12   
gb|KFW10230.1|  Retinoblastoma-binding protein 5                      73.6    8e-12   
gb|EPQ19629.1|  Retinoblastoma-binding protein 5                      73.9    8e-12   
gb|EMC87434.1|  Retinoblastoma-binding protein 5                      73.9    8e-12   
ref|XP_005505390.1|  PREDICTED: retinoblastoma-binding protein 5      73.9    8e-12   
ref|XP_007833731.1|  hypothetical protein PFICI_06959                 73.6    8e-12   
gb|KFW90279.1|  Retinoblastoma-binding protein 5                      73.6    8e-12   
gb|KFV79857.1|  Retinoblastoma-binding protein 5                      73.6    8e-12   
gb|KFO93126.1|  Retinoblastoma-binding protein 5                      73.6    8e-12   
gb|KFQ65150.1|  Retinoblastoma-binding protein 5                      73.6    8e-12   
gb|KGL95927.1|  Retinoblastoma-binding protein 5                      73.6    8e-12   
gb|KFP08920.1|  Retinoblastoma-binding protein 5                      73.6    8e-12   
gb|KFO81495.1|  Retinoblastoma-binding protein 5                      73.6    8e-12   
gb|KFP28108.1|  Retinoblastoma-binding protein 5                      73.6    8e-12   
gb|KFV71163.1|  Retinoblastoma-binding protein 5                      73.6    8e-12   
ref|XP_009477547.1|  PREDICTED: retinoblastoma-binding protein 5      73.6    8e-12   
gb|EFB17067.1|  hypothetical protein PANDA_006675                     73.6    8e-12   
ref|XP_001951127.1|  PREDICTED: retinoblastoma-binding protein 5      73.6    9e-12   
ref|XP_005014675.1|  PREDICTED: retinoblastoma-binding protein 5 ...  73.9    9e-12   
ref|XP_005168325.1|  PREDICTED: retinoblastoma-binding protein 5 ...  73.6    9e-12   
emb|CAF89732.1|  unnamed protein product                              73.6    9e-12   
gb|EPS25647.1|  hypothetical protein PDE_00581                        73.6    9e-12   
gb|KEQ77677.1|  COMPASS, Set1C complex protein                        73.6    9e-12   
ref|XP_005014674.1|  PREDICTED: retinoblastoma-binding protein 5 ...  73.9    9e-12   
gb|KFY06112.1|  hypothetical protein V491_08848                       72.8    9e-12   
gb|KEQ67532.1|  COMPASS, Set1C complex protein                        73.2    1e-11   
gb|EYE99036.1|  WD40 repeat-like protein                              73.2    1e-11   
gb|KEQ93791.1|  hypothetical protein AUEXF2481DRAFT_90102             72.8    1e-11   
gb|KFP05265.1|  Retinoblastoma-binding protein 5                      72.8    1e-11   
gb|KGO75055.1|  hypothetical protein PITC_047380                      72.8    2e-11   
ref|XP_007872780.1|  hypothetical protein PNEG_00870                  72.8    2e-11   
gb|KFZ12091.1|  hypothetical protein V502_07273                       72.8    2e-11   
gb|KHJ82564.1|  WD domain, G-beta repeat protein                      69.7    2e-11   
gb|KHJ80999.1|  WD domain, G-beta repeat protein                      70.1    2e-11   
ref|XP_003658588.1|  SWD1-like protein                                72.4    2e-11   
ref|XP_002095486.1|  GE22416                                          72.4    2e-11   
ref|XP_003656555.1|  SWD1-like protein                                72.4    2e-11   
gb|EMG46228.1|  putative COMPASS histone methyltransferase subuni...  72.4    2e-11   
emb|CDJ84797.1|  WD40 repeat domain containing protein                70.9    2e-11   
ref|XP_010722515.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    2e-11   
ref|XP_006133126.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    2e-11   
ref|XP_006133125.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    2e-11   
ref|XP_006273939.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    2e-11   
ref|XP_001243805.1|  conserved hypothetical protein                   72.0    3e-11   
gb|ENN79844.1|  hypothetical protein YQE_03665                        72.4    3e-11   
ref|XP_003068900.1|  WD domain, G-beta repeat containing protein      72.0    3e-11   
ref|XP_010139882.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    3e-11   
gb|KFP61886.1|  Retinoblastoma-binding protein 5                      72.0    3e-11   
ref|XP_006062333.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    3e-11   
ref|XP_007130873.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    3e-11   
ref|XP_010184498.1|  PREDICTED: retinoblastoma-binding protein 5      72.0    3e-11   
ref|XP_009995810.1|  PREDICTED: retinoblastoma-binding protein 5      72.0    3e-11   
ref|XP_009903839.1|  PREDICTED: retinoblastoma-binding protein 5      72.0    3e-11   
ref|XP_009708189.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    3e-11   
ref|XP_005087406.1|  PREDICTED: retinoblastoma-binding protein 5      72.0    3e-11   
gb|ENN79845.1|  hypothetical protein YQE_03665                        72.4    3e-11   
ref|XP_010139883.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    3e-11   
ref|XP_011221929.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    3e-11   
ref|XP_009566424.1|  PREDICTED: retinoblastoma-binding protein 5      72.0    3e-11   
ref|XP_005230402.1|  PREDICTED: retinoblastoma-binding protein 5      72.0    3e-11   
ref|XP_008697748.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    3e-11   
ref|XP_010155347.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    3e-11   
ref|XP_007065170.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    3e-11   
ref|XP_010347263.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    3e-11   
ref|XP_010205345.1|  PREDICTED: retinoblastoma-binding protein 5      72.0    3e-11   
ref|XP_009670532.1|  PREDICTED: retinoblastoma-binding protein 5      72.0    3e-11   
ref|XP_006024827.1|  PREDICTED: retinoblastoma-binding protein 5      72.0    3e-11   
ref|XP_007640086.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    3e-11   
ref|XP_009583453.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    3e-11   
ref|XP_006273937.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    3e-11   
ref|XP_010155348.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    3e-11   
ref|XP_009645908.1|  PREDICTED: retinoblastoma-binding protein 5      72.0    3e-11   
ref|XP_009501632.1|  PREDICTED: retinoblastoma-binding protein 5      72.0    3e-11   
ref|XP_006133123.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    3e-11   
ref|XP_009910139.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    3e-11   
ref|XP_006133124.1|  PREDICTED: retinoblastoma-binding protein 5 ...  72.0    3e-11   
emb|CCU81507.1|  putative Set1 complex component swd1/putative WD...  71.6    3e-11   
gb|EPQ64218.1|  Subunit of the COMPASS complex                        71.6    3e-11   
ref|XP_005844984.1|  hypothetical protein CHLNCDRAFT_138391           72.0    3e-11   
gb|KFY89072.1|  hypothetical protein V500_05970                       72.4    4e-11   
ref|XP_007674102.1|  hypothetical protein BAUCODRAFT_389882           71.6    4e-11   
ref|XP_001220926.1|  hypothetical protein CHGG_01705                  71.6    4e-11   
gb|EPB77435.1|  WD domain, G-beta repeat protein                      71.6    4e-11   



>ref|XP_002300221.2| hypothetical protein POPTR_0001s31290g [Populus trichocarpa]
 gb|EEE85026.2| hypothetical protein POPTR_0001s31290g [Populus trichocarpa]
Length=547

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYL+HG+MKCIAFNRRGTLLAAGC+DGSC+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLQHGLMKCIAFNRRGTLLAAGCTDGSCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVV+GE IT +TLQQ
Sbjct  61   LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVSGEKITRITLQQ  109



>gb|KDO52247.1| hypothetical protein CISIN_1g0088442mg, partial [Citrus sinensis]
Length=488

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSC+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDK+CVAAITSVCWSKYGHRILVSAADKSLTLWDV+ GE IT + LQQ
Sbjct  61   LRDKECVAAITSVCWSKYGHRILVSAADKSLTLWDVLKGEKITRIVLQQ  109



>ref|XP_006485526.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Citrus 
sinensis]
Length=496

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSC+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDK+CVAAITSVCWSKYGHRILVSAADKSLTLWDV+ GE IT + LQQ
Sbjct  61   LRDKECVAAITSVCWSKYGHRILVSAADKSLTLWDVLKGEKITRIVLQQ  109



>ref|XP_006445680.1| hypothetical protein CICLE_v10014800mg [Citrus clementina]
 ref|XP_006485525.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Citrus 
sinensis]
 gb|ESR58920.1| hypothetical protein CICLE_v10014800mg [Citrus clementina]
Length=551

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSC+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDK+CVAAITSVCWSKYGHRILVSAADKSLTLWDV+ GE IT + LQQ
Sbjct  61   LRDKECVAAITSVCWSKYGHRILVSAADKSLTLWDVLKGEKITRIVLQQ  109



>ref|XP_007010539.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY19349.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=552

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSC+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD+DC AAITSVCWSKYGHRILVSAADKSLTLWDVV+GE +T + LQQ
Sbjct  61   LRDRDCTAAITSVCWSKYGHRILVSAADKSLTLWDVVSGEKVTRIVLQQ  109



>ref|XP_011000114.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Populus 
euphratica]
Length=547

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYL+HG+MKCIAFNRRGTLLAAGC+DGSC+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLQHGLMKCIAFNRRGTLLAAGCTDGSCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDKDCVAAITSVCWSKYGH+ILVSAADKSLTLWDVV+GE IT +TLQQ
Sbjct  61   LRDKDCVAAITSVCWSKYGHQILVSAADKSLTLWDVVSGEKITRITLQQ  109



>ref|XP_008238384.1| PREDICTED: LOW QUALITY PROTEIN: retinoblastoma-binding protein 
5 [Prunus mume]
Length=503

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDG+C+IWDFETRGI+KE
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGNCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVV+GE IT   LQQ
Sbjct  61   LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVSGEKITRTILQQ  109



>ref|XP_007209915.1| hypothetical protein PRUPE_ppa004402mg [Prunus persica]
 gb|EMJ11114.1| hypothetical protein PRUPE_ppa004402mg [Prunus persica]
Length=512

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDG+C+IWDFETRGI+KE
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGNCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVV+GE IT   LQQ
Sbjct  61   LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVSGEKITRTILQQ  109



>ref|XP_012074485.1| PREDICTED: protein RBL [Jatropha curcas]
 gb|KDP35987.1| hypothetical protein JCGZ_08382 [Jatropha curcas]
Length=551

 Score =   213 bits (543),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG+MKCIAFNRRGTLLAAGCSDGSCIIWDFETRGI+KE
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGIMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDK+CVAAITS+CWSKYGHRILVSAADKSLTLWDVV+GE IT + LQQ
Sbjct  61   LRDKECVAAITSICWSKYGHRILVSAADKSLTLWDVVHGEKITRIILQQ  109



>gb|KJB78514.1| hypothetical protein B456_013G003300 [Gossypium raimondii]
Length=556

 Score =   213 bits (542),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHG+MKCIAFNRRGTLLAAGCSDGSC+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGLMKCIAFNRRGTLLAAGCSDGSCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            L+D+DC AAITSVCWSKYGHRILVSAADKSLTLWDVV+G+ +T + LQQ
Sbjct  61   LKDRDCSAAITSVCWSKYGHRILVSAADKSLTLWDVVSGQKVTRIVLQQ  109



>ref|XP_002522890.1| nucleotide binding protein, putative [Ricinus communis]
 gb|EEF39490.1| nucleotide binding protein, putative [Ricinus communis]
Length=551

 Score =   213 bits (541),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSC+IWDFETRGI+KE
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDKDC+AAITSVCWSKYGHRILVSAADKSLTLWDVV+GE I    LQQ
Sbjct  61   LRDKDCIAAITSVCWSKYGHRILVSAADKSLTLWDVVSGERIARTILQQ  109



>ref|XP_004290312.1| PREDICTED: protein RBL [Fragaria vesca subsp. vesca]
 ref|XP_011458299.1| PREDICTED: protein RBL [Fragaria vesca subsp. vesca]
Length=511

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLAAGCSDG+CIIWDFETRGI+KE
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGTMKCIAFNRRGTLLAAGCSDGNCIIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDK+CVAAITSVCWSKYGHR+LVSAADKSLTLWDVV+GE IT   LQQ
Sbjct  61   LRDKECVAAITSVCWSKYGHRVLVSAADKSLTLWDVVSGEKITRTILQQ  109



>ref|XP_009341586.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Pyrus x 
bretschneideri]
Length=511

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLE+GVMKCIAFNRRGTLLAAGCSDG+CI+WDFETRGI+KE
Sbjct  1    MNAAIIDPLQGDFPEVIEEYLEYGVMKCIAFNRRGTLLAAGCSDGNCIVWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD+DCVAAITSVCWSKYGHRILVSAADKSLTLWDVV+GE IT   LQQ
Sbjct  61   LRDRDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVSGEKITRTILQQ  109



>ref|XP_008363218.1| PREDICTED: retinoblastoma-binding protein 5-like [Malus domestica]
Length=511

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLE+GVMKCIAFNRRGTLLAAGCSDG+CI+WDFETRGI+KE
Sbjct  1    MNAAIIDPLQGDFPEVIEEYLEYGVMKCIAFNRRGTLLAAGCSDGNCIVWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD+DCVAAITSVCWSKYGHRILVSAADKSLTLWDVV+GE IT   LQQ
Sbjct  61   LRDRDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVSGEKITRTILQQ  109



>ref|XP_008446711.1| PREDICTED: retinoblastoma-binding protein 5 [Cucumis melo]
Length=552

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEE+LEHGVMKCIAFNRRGTLLAAGCSDG+C+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEFLEHGVMKCIAFNRRGTLLAAGCSDGNCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            L+DKDCV+AITSVCWSKYGH+ILVSAAD+SLTLWDV+ GE I  +TLQQ
Sbjct  61   LKDKDCVSAITSVCWSKYGHQILVSAADRSLTLWDVLKGEKINRITLQQ  109



>ref|XP_011091980.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X2 
[Sesamum indicum]
Length=510

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSC+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             RDKD VAAITSVCWSK GHRILV+AADKSLTLWDVV GE I   TLQQ
Sbjct  61   FRDKDSVAAITSVCWSKNGHRILVAAADKSLTLWDVVTGEKIARTTLQQ  109



>ref|XP_011091979.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X1 
[Sesamum indicum]
Length=533

 Score =   210 bits (534),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSC+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             RDKD VAAITSVCWSK GHRILV+AADKSLTLWDVV GE I   TLQQ
Sbjct  61   FRDKDSVAAITSVCWSKNGHRILVAAADKSLTLWDVVTGEKIARTTLQQ  109



>gb|KCW65156.1| hypothetical protein EUGRSUZ_G02654 [Eucalyptus grandis]
Length=416

 Score =   207 bits (526),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            M APIIDPLQGDFPEVIEEYLEHG+MKCIAFNRRGTLLAAGC+DGSCIIWDFETRG++KE
Sbjct  1    MEAPIIDPLQGDFPEVIEEYLEHGIMKCIAFNRRGTLLAAGCTDGSCIIWDFETRGVAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDK+C AAITSVCWSKYGHRILVSA+DKSL LWDV++GE I H TLQ 
Sbjct  61   LRDKECTAAITSVCWSKYGHRILVSASDKSLILWDVLSGEKIAHTTLQH  109



>emb|CBI16678.3| unnamed protein product [Vitis vinifera]
Length=530

 Score =   209 bits (533),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGC+DGSCIIWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCADGSCIIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            L DKDCVAAITSVCWSK GH ILVSAADKSLTLWDVV+GE IT  TLQQ
Sbjct  61   LHDKDCVAAITSVCWSKDGHCILVSAADKSLTLWDVVSGEKITRTTLQQ  109



>emb|CAN70287.1| hypothetical protein VITISV_003927 [Vitis vinifera]
Length=543

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGC+DGSCIIWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCADGSCIIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            L DKDCVAAITSVCWSK GH ILVSAADKSLTLWDVV+GE IT  TLQQ
Sbjct  61   LHDKDCVAAITSVCWSKDGHCILVSAADKSLTLWDVVSGEKITRTTLQQ  109



>ref|XP_002271886.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Vitis vinifera]
Length=554

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGC+DGSCIIWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCADGSCIIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            L DKDCVAAITSVCWSK GH ILVSAADKSLTLWDVV+GE IT  TLQQ
Sbjct  61   LHDKDCVAAITSVCWSKDGHCILVSAADKSLTLWDVVSGEKITRTTLQQ  109



>ref|XP_011655820.1| PREDICTED: protein RBL [Cucumis sativus]
 gb|KGN52150.1| hypothetical protein Csa_5G612300 [Cucumis sativus]
Length=552

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEE+LEHGVMKCIAFNRRGTLLAAGCSDG+C+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEFLEHGVMKCIAFNRRGTLLAAGCSDGNCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            L+DKDCV+AITSVCWSKYGH+ILVSAAD+SLTLWDV  GE I  +TLQQ
Sbjct  61   LKDKDCVSAITSVCWSKYGHQILVSAADRSLTLWDVPKGEKINRITLQQ  109



>emb|CDP07224.1| unnamed protein product [Coffea canephora]
Length=542

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEE+LEHGVMKCIAFNRRGTLLAAGC+DG+C+IWDFETRGI+KE
Sbjct  2    MNAPIIDPLQGDFPEVIEEFLEHGVMKCIAFNRRGTLLAAGCADGNCVIWDFETRGIAKE  61

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD DC+AAITS+CWSKYGHRIL SAADKSLTLWDVV GE I   TLQQ
Sbjct  62   LRDDDCLAAITSICWSKYGHRILASAADKSLTLWDVVKGEKIGRTTLQQ  110



>ref|XP_009609899.1| PREDICTED: retinoblastoma-binding protein 5 homolog {ECO:0000250|UniProtKB:Q15291} 
isoform X2 [Nicotiana tomentosiformis]
Length=529

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLE+G+MKCIAFNRRGTLLAAGC DGSC+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLENGIMKCIAFNRRGTLLAAGCFDGSCLIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             +D++CVA+ITSVCWSKYGHRILVSAADKSLTLWDVV GE IT  TLQQ
Sbjct  61   FKDEECVASITSVCWSKYGHRILVSAADKSLTLWDVVKGEKITRTTLQQ  109



>ref|XP_009609898.1| PREDICTED: retinoblastoma-binding protein 5 homolog {ECO:0000250|UniProtKB:Q15291} 
isoform X1 [Nicotiana tomentosiformis]
Length=530

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLE+G+MKCIAFNRRGTLLAAGC DGSC+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLENGIMKCIAFNRRGTLLAAGCFDGSCLIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             +D++CVA+ITSVCWSKYGHRILVSAADKSLTLWDVV GE IT  TLQQ
Sbjct  61   FKDEECVASITSVCWSKYGHRILVSAADKSLTLWDVVKGEKITRTTLQQ  109



>ref|XP_010067087.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Eucalyptus 
grandis]
Length=558

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            M APIIDPLQGDFPEVIEEYLEHG+MKCIAFNRRGTLLAAGC+DGSCIIWDFETRG++KE
Sbjct  1    MEAPIIDPLQGDFPEVIEEYLEHGIMKCIAFNRRGTLLAAGCTDGSCIIWDFETRGVAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDK+C AAITSVCWSKYGHRILVSA+DKSL LWDV++GE I H TLQ 
Sbjct  61   LRDKECTAAITSVCWSKYGHRILVSASDKSLILWDVLSGEKIAHTTLQH  109



>ref|XP_009779738.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X2 
[Nicotiana sylvestris]
Length=525

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLE+G+MKCIAFNRRGTLLAAGC DG+C+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLENGIMKCIAFNRRGTLLAAGCFDGNCLIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             +D++CVA+ITSVCWSKYGHRILVSAADKSLTLWDVV GE IT  TLQQ
Sbjct  61   FKDEECVASITSVCWSKYGHRILVSAADKSLTLWDVVKGEKITRTTLQQ  109



>ref|XP_009779737.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X1 
[Nicotiana sylvestris]
Length=526

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLE+G+MKCIAFNRRGTLLAAGC DG+C+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLENGIMKCIAFNRRGTLLAAGCFDGNCLIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             +D++CVA+ITSVCWSKYGHRILVSAADKSLTLWDVV GE IT  TLQQ
Sbjct  61   FKDEECVASITSVCWSKYGHRILVSAADKSLTLWDVVKGEKITRTTLQQ  109



>ref|XP_010527302.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Tarenaya 
hassleriana]
 ref|XP_010527303.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Tarenaya 
hassleriana]
 ref|XP_010527304.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Tarenaya 
hassleriana]
Length=547

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGV+KC+AFNRRGTLLAAGC+DGSC+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVIKCVAFNRRGTLLAAGCADGSCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDKDC AAITSVCWSKYGHR+LVSAADKSLTLWDV+ G  I    LQQ
Sbjct  61   LRDKDCAAAITSVCWSKYGHRVLVSAADKSLTLWDVLCGNKIARTVLQQ  109



>ref|XP_006370892.1| transducin family protein [Populus trichocarpa]
 gb|ERP48689.1| transducin family protein [Populus trichocarpa]
Length=547

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYL HGV KCIAFNRRGTLLAAGC+DGSC+IWDFETRG++KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLHHGVTKCIAFNRRGTLLAAGCADGSCVIWDFETRGVAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDKDC+AAITS+CWSKYGHRILVS+ADKSL LWDVV+GE IT +TL  
Sbjct  61   LRDKDCIAAITSICWSKYGHRILVSSADKSLILWDVVSGEKITRITLHH  109



>ref|XP_011012485.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X2 
[Populus euphratica]
Length=547

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYL HGV KCIAFNRRGTLLAAGC+DGSC+IWDFETRG++KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLHHGVTKCIAFNRRGTLLAAGCADGSCVIWDFETRGVAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDKDC+AAITS+CWSKYGHRILVS+ADKSL LWDVV+GE IT +TL  
Sbjct  61   LRDKDCIAAITSICWSKYGHRILVSSADKSLILWDVVSGEKITRITLHH  109



>ref|XP_010936566.1| PREDICTED: LOW QUALITY PROTEIN: retinoblastoma-binding protein 
5 homolog [Elaeis guineensis]
Length=562

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN PIIDPLQGDFPEVIEEYL+HG MKCIAFNRRGTLLAAGC+DGSC+IWDFETRG++KE
Sbjct  1    MNVPIIDPLQGDFPEVIEEYLQHGNMKCIAFNRRGTLLAAGCADGSCVIWDFETRGVAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDKDC+A ITSVCWSKYGH IL SA DKSLTLW+VVNGE I  +TLQQ
Sbjct  61   LRDKDCIAPITSVCWSKYGHHILASATDKSLTLWNVVNGEKIARVTLQQ  109



>ref|XP_011012484.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X1 
[Populus euphratica]
Length=566

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYL HGV KCIAFNRRGTLLAAGC+DGSC+IWDFETRG++KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLHHGVTKCIAFNRRGTLLAAGCADGSCVIWDFETRGVAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDKDC+AAITS+CWSKYGHRILVS+ADKSL LWDVV+GE IT +TL  
Sbjct  61   LRDKDCIAAITSICWSKYGHRILVSSADKSLILWDVVSGEKITRITLHH  109



>ref|XP_010103982.1| Retinoblastoma-binding protein 5 [Morus notabilis]
 gb|EXB97685.1| Retinoblastoma-binding protein 5 [Morus notabilis]
Length=553

 Score =   205 bits (522),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  319  IDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKELRDKD  498
            +DPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSC+IWDFETRGI+KEL+DK+
Sbjct  7    VDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCVIWDFETRGIAKELKDKE  66

Query  499  CVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            C AAITSVCWSKYGHRILVSAADKSLTLWDVV+GE IT  TLQQ
Sbjct  67   CSAAITSVCWSKYGHRILVSAADKSLTLWDVVSGEKITRTTLQQ  110



>ref|XP_010939085.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Elaeis guineensis]
Length=563

 Score =   205 bits (521),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN PIIDPLQGDFPEVIEEYL+HG MKCIAFNRRGTLLAAGC+DGSC+IWDFETRG++KE
Sbjct  1    MNVPIIDPLQGDFPEVIEEYLQHGNMKCIAFNRRGTLLAAGCADGSCVIWDFETRGVAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDKDC+A ITSVCWSKYGH IL SA DKSLTLW+VVNGE +  +TLQQ
Sbjct  61   LRDKDCIAPITSVCWSKYGHHILASATDKSLTLWNVVNGEKMARVTLQQ  109



>ref|XP_008787133.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Phoenix 
dactylifera]
 ref|XP_008787134.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Phoenix 
dactylifera]
Length=574

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN PIIDPLQGDFPEVIEEYL+HG MKCIAFNRRGTLLAAGC+DGSC+IWDFETRG++KE
Sbjct  1    MNVPIIDPLQGDFPEVIEEYLQHGNMKCIAFNRRGTLLAAGCADGSCVIWDFETRGVAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDKDC+A ITSVCWSKYGH +L SA DKSLTLW+VVNGE I  +TLQQ
Sbjct  61   LRDKDCIAPITSVCWSKYGHHMLASATDKSLTLWNVVNGEKIARVTLQQ  109



>ref|XP_009394337.1| PREDICTED: retinoblastoma-binding protein 5 homolog {ECO:0000250|UniProtKB:Q15291} 
[Musa acuminata subsp. malaccensis]
Length=564

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEE+L+HG MKCIAFNRRGTLLAAGC++GSC+IWDFETRG++KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEFLQHGNMKCIAFNRRGTLLAAGCANGSCVIWDFETRGVAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDK CVA ITSVCWSKYGH +L SA DKSLTLW+V+NGE ITH+TLQQ
Sbjct  61   LRDKACVAPITSVCWSKYGHYLLASATDKSLTLWNVMNGEKITHITLQQ  109



>ref|XP_010271571.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Nelumbo 
nucifera]
Length=561

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN PIIDPLQGDFPEVIEEYLEHG+MKCIAFNRRGTLLAAGCSDGSC+IWDFETRGI+KE
Sbjct  1    MNVPIIDPLQGDFPEVIEEYLEHGIMKCIAFNRRGTLLAAGCSDGSCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXI  609
            LRD DCVA ITSVCWSKYGH ILVSA DKSLTLWDVVNGE I
Sbjct  61   LRDNDCVAPITSVCWSKYGHHILVSATDKSLTLWDVVNGEKI  102



>ref|XP_008790627.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Phoenix 
dactylifera]
 ref|XP_008790628.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Phoenix 
dactylifera]
Length=564

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN PIIDPLQGDFPEVIEEYL+HG MKCIAFNRRGTLLAAGC+DGSC+IWDFETRG++KE
Sbjct  1    MNVPIIDPLQGDFPEVIEEYLQHGNMKCIAFNRRGTLLAAGCADGSCVIWDFETRGVAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDKDC+A ITSVCWSKYG  IL SA DKSLTLW+VVNGE +  +TLQQ
Sbjct  61   LRDKDCIAPITSVCWSKYGRHILASATDKSLTLWNVVNGEKMARVTLQQ  109



>ref|XP_010277147.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X1 
[Nelumbo nucifera]
Length=564

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  IIDPLQGDFPEVIEE+L+HGVMKCIAFNRRGTLLAAGCSDGSC++WDF+TRGI+KE
Sbjct  1    MNVSIIDPLQGDFPEVIEEFLQHGVMKCIAFNRRGTLLAAGCSDGSCVVWDFQTRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDKDCV+ ITSVCWSKYGH ILVSA DKSLTLWDVV+GE +T  TL Q
Sbjct  61   LRDKDCVSPITSVCWSKYGHYILVSATDKSLTLWDVVSGEKVTRTTLHQ  109



>gb|EPS71151.1| hypothetical protein M569_03609, partial [Genlisea aurea]
Length=452

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +1

Query  301  TMNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISK  480
            TMNAPIIDPLQG FPEVIEEYLEHG+MKCIAFNRRGTLLAAGCSDG C+IWDFETRGI+K
Sbjct  3    TMNAPIIDPLQGAFPEVIEEYLEHGIMKCIAFNRRGTLLAAGCSDGRCVIWDFETRGIAK  62

Query  481  ELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            E RD +CVAAITS+CWSK G RILVSAADKSL LWDV+ GE +  + LQQ
Sbjct  63   EFRDNECVAAITSICWSKNGRRILVSAADKSLNLWDVLKGEKVARIALQQ  112



>ref|XP_006406323.1| hypothetical protein EUTSA_v10020461mg [Eutrema salsugineum]
 ref|XP_006406325.1| hypothetical protein EUTSA_v10020461mg [Eutrema salsugineum]
 gb|ESQ47776.1| hypothetical protein EUTSA_v10020461mg [Eutrema salsugineum]
 gb|ESQ47778.1| hypothetical protein EUTSA_v10020461mg [Eutrema salsugineum]
Length=545

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGV+KC+AFN RG+LLAAGC+DG+C+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVIKCVAFNHRGSLLAAGCADGTCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            +RD DC AAITSV WSKYGHR+LVSAADKSLTLWDV +GE I   TLQQ
Sbjct  61   IRDDDCSAAITSVSWSKYGHRLLVSAADKSLTLWDVPSGERIARTTLQQ  109



>ref|XP_006406324.1| hypothetical protein EUTSA_v10020461mg [Eutrema salsugineum]
 gb|ESQ47777.1| hypothetical protein EUTSA_v10020461mg [Eutrema salsugineum]
Length=544

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGV+KC+AFN RG+LLAAGC+DG+C+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVIKCVAFNHRGSLLAAGCADGTCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            +RD DC AAITSV WSKYGHR+LVSAADKSLTLWDV +GE I   TLQQ
Sbjct  61   IRDDDCSAAITSVSWSKYGHRLLVSAADKSLTLWDVPSGERIARTTLQQ  109



>emb|CDY27548.1| BnaC01g32310D [Brassica napus]
Length=544

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGV+KC+AFN RG+LLAAGC+DGSC+IWDFETRGI+K 
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVIKCVAFNHRGSLLAAGCADGSCVIWDFETRGIAKV  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD DC AAITSV WSKYGHR+LVSAADKSLTLWDV  GE I   TLQQ
Sbjct  61   LRDNDCAAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIARTTLQQ  109



>emb|CDY37319.1| BnaA01g25390D [Brassica napus]
Length=601

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +1

Query  301  TMNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISK  480
            +MNAPIIDPLQGDFPEVIEEYLEHGV+KC+AFN RG+LLAAGC+DGSC+IWDFETRGI+K
Sbjct  54   SMNAPIIDPLQGDFPEVIEEYLEHGVIKCVAFNHRGSLLAAGCADGSCVIWDFETRGIAK  113

Query  481  ELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             LRD DC AAITSV WSKYGHR+LVSAADKSLTLWDV  G+ I   TLQQ
Sbjct  114  VLRDNDCAAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGDKIARTTLQQ  163



>gb|EYU26868.1| hypothetical protein MIMGU_mgv1a004535mg [Erythranthe guttata]
Length=522

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG++KC+AFNRRGTLLAAGCSDGSC+IWDFETRGI+KE
Sbjct  1    MNATIIDPLQGDFPEVIEEYLEHGIVKCVAFNRRGTLLAAGCSDGSCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            L D + VAAITSVCWSKYGH ILVSAADKSLTLWDVV GE I   TLQQ
Sbjct  61   LGDSNNVAAITSVCWSKYGHCILVSAADKSLTLWDVVKGEKIARSTLQQ  109



>ref|XP_002862673.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38931.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=405

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGV+KC+AFN RG+LLAAGC+DG C+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVIKCVAFNHRGSLLAAGCADGGCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            +RD DC AAITSV WSKYGHR+LVSAADKSLTLWDV  GE I    LQQ
Sbjct  61   IRDNDCSAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIARTILQQ  109



>ref|XP_009109937.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X1 
[Brassica rapa]
 ref|XP_009109944.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X1 
[Brassica rapa]
Length=547

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGV+KC+AFN RG+LLAAGC+DGSC+IWDFETRGI+K 
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVIKCVAFNHRGSLLAAGCADGSCVIWDFETRGIAKV  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD DC AAITSV WSKYGHR+LVSAADKSLTLWDV  GE I   TLQQ
Sbjct  61   LRDNDCAAAITSVSWSKYGHRLLVSAADKSLTLWDVSIGEKIARTTLQQ  109



>ref|XP_009109949.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X2 
[Brassica rapa]
Length=546

 Score =   197 bits (502),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGV+KC+AFN RG+LLAAGC+DGSC+IWDFETRGI+K 
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVIKCVAFNHRGSLLAAGCADGSCVIWDFETRGIAKV  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD DC AAITSV WSKYGHR+LVSAADKSLTLWDV  GE I   TLQQ
Sbjct  61   LRDNDCAAAITSVSWSKYGHRLLVSAADKSLTLWDVSIGEKIARTTLQQ  109



>ref|NP_188743.3| COMPASS-like H3K4 histone methylation complex component [Arabidopsis 
thaliana]
 sp|Q5E915.1|RBBP_ARATH RecName: Full=Protein RBL; AltName: Full=COMPASS-like H3K4 histone 
methylation complex component RBL; AltName: Full=RBBP5-like 
protein; AltName: Full=Retinoblastoma-binding protein-like 
[Arabidopsis thaliana]
 gb|AAX12875.1| At3g21060 [Arabidopsis thaliana]
 gb|AEE76455.1| COMPASS-like H3K4 histone methylation complex component [Arabidopsis 
thaliana]
Length=547

 Score =   197 bits (500),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGV+KC+AFN RG+LLAAGC+DG C+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVIKCVAFNHRGSLLAAGCADGGCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            +RD DC AAITSV WSKYGHR+LVSAADKSLTLWDV  GE I    LQQ
Sbjct  61   IRDNDCSAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIARTILQQ  109



>gb|AAO42218.1| putative G-protein beta subunit [Arabidopsis thaliana]
Length=547

 Score =   197 bits (500),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGV+KC+AFN RG+LLAAGC+DG C+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVIKCVAFNHRGSLLAAGCADGGCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            +RD DC AAITSV WSKYGHR+LVSAADKSLTLWDV  GE I    LQQ
Sbjct  61   IRDNDCSAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIARTILQQ  109



>dbj|BAB01449.1| retinoblastoma-binding protein-like [Arabidopsis thaliana]
Length=561

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGV+KC+AFN RG+LLAAGC+DG C+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVIKCVAFNHRGSLLAAGCADGGCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            +RD DC AAITSV WSKYGHR+LVSAADKSLTLWDV  GE I    LQQ
Sbjct  61   IRDNDCSAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIARTILQQ  109



>ref|XP_002883282.1| hypothetical protein ARALYDRAFT_318845 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59541.1| hypothetical protein ARALYDRAFT_318845 [Arabidopsis lyrata subsp. 
lyrata]
Length=560

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGV+KC+AFN RG+LLAAGC+DG C+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVIKCVAFNHRGSLLAAGCADGGCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            +RD DC AAITSV WSKYGHR+LVSAADKSLTLWDV  GE I    LQQ
Sbjct  61   IRDNDCSAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIARTILQQ  109



>ref|XP_006829296.1| PREDICTED: protein RBL [Amborella trichopoda]
 gb|ERM96712.1| hypothetical protein AMTR_s00001p00273050 [Amborella trichopoda]
Length=572

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  IIDPLQGDFPEVIEE+L+HGVMKCIAFNRRGTLLAAGCSDGSC+IWDFETRGI+KE
Sbjct  1    MNISIIDPLQGDFPEVIEEFLQHGVMKCIAFNRRGTLLAAGCSDGSCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDKDC + ITS+ WSKYG+R+L SA DKSLTLWDVVNGE I   TLQ 
Sbjct  61   LRDKDCTSPITSISWSKYGYRLLASATDKSLTLWDVVNGEKIARATLQH  109



>ref|XP_003531795.1| PREDICTED: retinoblastoma-binding protein 5-like [Glycine max]
Length=550

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLAAGC++GSC+IWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGCMKCIAFNRRGTLLAAGCNNGSCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITSVCWSK GHRILVSAADKSL LWDV++G+ IT + LQQ
Sbjct  61   LRDNECSSPITSVCWSKCGHRILVSAADKSLLLWDVMSGKRITRIVLQQ  109



>ref|XP_004230070.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Solanum 
lycopersicum]
Length=524

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            M+APIIDPLQG FPE+IEEYLE G+MKCIAFNRRGTLLAAGC+DG+CIIWDF TRGI++E
Sbjct  2    MDAPIIDPLQGVFPEIIEEYLESGIMKCIAFNRRGTLLAAGCADGTCIIWDFGTRGIARE  61

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             +D D VA+ITSVCWSKYGHRILVSAADKSL+LWDVV GE IT +TLQQ
Sbjct  62   FKDDDSVASITSVCWSKYGHRILVSAADKSLSLWDVVRGEKITRITLQQ  110



>ref|XP_004230069.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Solanum 
lycopersicum]
Length=528

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            M+APIIDPLQG FPE+IEEYLE G+MKCIAFNRRGTLLAAGC+DG+CIIWDF TRGI++E
Sbjct  2    MDAPIIDPLQGVFPEIIEEYLESGIMKCIAFNRRGTLLAAGCADGTCIIWDFGTRGIARE  61

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             +D D VA+ITSVCWSKYGHRILVSAADKSL+LWDVV GE IT +TLQQ
Sbjct  62   FKDDDSVASITSVCWSKYGHRILVSAADKSLSLWDVVRGEKITRITLQQ  110



>ref|XP_010696132.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Beta vulgaris 
subsp. vulgaris]
Length=559

 Score =   194 bits (494),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  IIDPLQGDFPEVIEE+LEHGVMKCIAFNRRGTLLAAGCS+GSCIIWDFETRGI+KE
Sbjct  2    MNTQIIDPLQGDFPEVIEEFLEHGVMKCIAFNRRGTLLAAGCSNGSCIIWDFETRGIAKE  61

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            L DK+C AAITSVCWSKYGHRILVSAAD++L LWDV  GE +   TL++
Sbjct  62   LLDKECNAAITSVCWSKYGHRILVSAADRTLILWDVATGEKVAKTTLEK  110



>ref|XP_006582400.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Glycine 
max]
Length=548

 Score =   194 bits (494),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLAAGC+DGSC+IWDFETRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGCMKCIAFNRRGTLLAAGCNDGSCVIWDFETRGIAKI  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSKYGHRILVSAADKSL LWDV++G+ IT + LQQ
Sbjct  61   LRDDECSSPITSICWSKYGHRILVSAADKSLILWDVMSGKKITRIVLQQ  109



>ref|XP_006594027.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X5 [Glycine 
max]
Length=537

 Score =   194 bits (493),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLAAGC+DGSC+IWDFETRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGCMKCIAFNRRGTLLAAGCNDGSCVIWDFETRGIAKI  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSKYGHRILVSAADKSL LWDV++G+ IT + LQQ
Sbjct  61   LRDDECSSPITSICWSKYGHRILVSAADKSLLLWDVMSGKKITRIVLQQ  109



>ref|XP_006594025.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X3 [Glycine 
max]
Length=548

 Score =   194 bits (493),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLAAGC+DGSC+IWDFETRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGCMKCIAFNRRGTLLAAGCNDGSCVIWDFETRGIAKI  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSKYGHRILVSAADKSL LWDV++G+ IT + LQQ
Sbjct  61   LRDDECSSPITSICWSKYGHRILVSAADKSLLLWDVMSGKKITRIVLQQ  109



>ref|XP_006582402.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X4 [Glycine 
max]
Length=539

 Score =   194 bits (493),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLAAGC+DGSC+IWDFETRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGCMKCIAFNRRGTLLAAGCNDGSCVIWDFETRGIAKI  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSKYGHRILVSAADKSL LWDV++G+ IT + LQQ
Sbjct  61   LRDDECSSPITSICWSKYGHRILVSAADKSLILWDVMSGKKITRIVLQQ  109



>ref|XP_006582403.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X5 [Glycine 
max]
Length=538

 Score =   194 bits (493),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLAAGC+DGSC+IWDFETRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGCMKCIAFNRRGTLLAAGCNDGSCVIWDFETRGIAKI  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSKYGHRILVSAADKSL LWDV++G+ IT + LQQ
Sbjct  61   LRDDECSSPITSICWSKYGHRILVSAADKSLILWDVMSGKKITRIVLQQ  109



>ref|XP_006594026.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X4 [Glycine 
max]
Length=538

 Score =   194 bits (492),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLAAGC+DGSC+IWDFETRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGCMKCIAFNRRGTLLAAGCNDGSCVIWDFETRGIAKI  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSKYGHRILVSAADKSL LWDV++G+ IT + LQQ
Sbjct  61   LRDDECSSPITSICWSKYGHRILVSAADKSLLLWDVMSGKKITRIVLQQ  109



>ref|XP_006594024.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Glycine 
max]
Length=565

 Score =   194 bits (493),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLAAGC+DGSC+IWDFETRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGCMKCIAFNRRGTLLAAGCNDGSCVIWDFETRGIAKI  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSKYGHRILVSAADKSL LWDV++G+ IT + LQQ
Sbjct  61   LRDDECSSPITSICWSKYGHRILVSAADKSLLLWDVMSGKKITRIVLQQ  109



>ref|XP_006347718.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Solanum 
tuberosum]
Length=527

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            M+APIIDPLQG FPE+IEEYLE G+MKCIAFNRRGTLLAAGC+DG+CIIWDF TRGI++E
Sbjct  2    MDAPIIDPLQGVFPEIIEEYLESGIMKCIAFNRRGTLLAAGCADGTCIIWDFGTRGIARE  61

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             +D D VA+ITSVCWSKYGHRILVSAADKSL+LWDVV GE I  +TLQQ
Sbjct  62   FKDDDSVASITSVCWSKYGHRILVSAADKSLSLWDVVRGEKINRITLQQ  110



>ref|XP_006347717.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Solanum 
tuberosum]
Length=531

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            M+APIIDPLQG FPE+IEEYLE G+MKCIAFNRRGTLLAAGC+DG+CIIWDF TRGI++E
Sbjct  2    MDAPIIDPLQGVFPEIIEEYLESGIMKCIAFNRRGTLLAAGCADGTCIIWDFGTRGIARE  61

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             +D D VA+ITSVCWSKYGHRILVSAADKSL+LWDVV GE I  +TLQQ
Sbjct  62   FKDDDSVASITSVCWSKYGHRILVSAADKSLSLWDVVRGEKINRITLQQ  110



>ref|XP_006582399.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Glycine 
max]
Length=565

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLAAGC+DGSC+IWDFETRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGCMKCIAFNRRGTLLAAGCNDGSCVIWDFETRGIAKI  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSKYGHRILVSAADKSL LWDV++G+ IT + LQQ
Sbjct  61   LRDDECSSPITSICWSKYGHRILVSAADKSLILWDVMSGKKITRIVLQQ  109



>ref|XP_006582401.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X3 [Glycine 
max]
Length=547

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLAAGC+DGSC+IWDFETRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGCMKCIAFNRRGTLLAAGCNDGSCVIWDFETRGIAKI  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSKYGHRILVSAADKSL LWDV++G+ IT + LQQ
Sbjct  61   LRDDECSSPITSICWSKYGHRILVSAADKSLILWDVMSGKKITRIVLQQ  109



>ref|XP_003541356.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Glycine 
max]
Length=547

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLAAGC+DGSC+IWDFETRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGCMKCIAFNRRGTLLAAGCNDGSCVIWDFETRGIAKI  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSKYGHRILVSAADKSL LWDV++G+ IT + LQQ
Sbjct  61   LRDDECSSPITSICWSKYGHRILVSAADKSLLLWDVMSGKKITRIVLQQ  109



>ref|XP_006579832.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Glycine 
max]
Length=553

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLA GC+DGSC+IWDFETRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGCMKCIAFNRRGTLLAVGCNDGSCVIWDFETRGIAKI  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSKYGHRILVSAADKSL LWDV++G+ IT + LQQ
Sbjct  61   LRDDECSSPITSICWSKYGHRILVSAADKSLILWDVMSGKKITRIVLQQ  109



>ref|XP_003524594.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Glycine 
max]
Length=537

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLA GC+DGSC+IWDFETRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGCMKCIAFNRRGTLLAVGCNDGSCVIWDFETRGIAKI  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSKYGHRILVSAADKSL LWDV++G+ IT + LQQ
Sbjct  61   LRDDECSSPITSICWSKYGHRILVSAADKSLILWDVMSGKKITRIVLQQ  109



>ref|XP_007156314.1| hypothetical protein PHAVU_003G276000g [Phaseolus vulgaris]
 gb|ESW28308.1| hypothetical protein PHAVU_003G276000g [Phaseolus vulgaris]
Length=550

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLA GC+DGSC+IWDFETRGI+KE
Sbjct  1    MNAQIIDPLQGDFPEVIEEYLEHGCMKCIAFNRRGTLLAVGCNDGSCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD DC + ITSVCWSK G+RILVSAADKSL+LWDV++G+ IT + LQQ
Sbjct  61   LRDNDCSSPITSVCWSKCGNRILVSAADKSLSLWDVMSGKRITRIVLQQ  109



>ref|XP_006579833.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X3 [Glycine 
max]
Length=548

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLA GC+DGSC+IWDFETRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGCMKCIAFNRRGTLLAVGCNDGSCVIWDFETRGIAKI  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSKYGHRILVSAADKSL LWDV++G+ IT + LQQ
Sbjct  61   LRDDECSSPITSICWSKYGHRILVSAADKSLILWDVMSGKKITRIVLQQ  109



>ref|XP_006579835.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X5 [Glycine 
max]
Length=543

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLA GC+DGSC+IWDFETRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGCMKCIAFNRRGTLLAVGCNDGSCVIWDFETRGIAKI  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSKYGHRILVSAADKSL LWDV++G+ IT + LQQ
Sbjct  61   LRDDECSSPITSICWSKYGHRILVSAADKSLILWDVMSGKKITRIVLQQ  109



>ref|XP_007141031.1| hypothetical protein PHAVU_008G161500g [Phaseolus vulgaris]
 gb|ESW13025.1| hypothetical protein PHAVU_008G161500g [Phaseolus vulgaris]
Length=546

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLAAGC+DGSC+IWDFETRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGCMKCIAFNRRGTLLAAGCNDGSCVIWDFETRGIAKI  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            L D +C + ITS+CWSKYGHRILVSAADKSL LWDV++G+ IT + LQQ
Sbjct  61   LHDDECSSPITSICWSKYGHRILVSAADKSLILWDVMSGKKITRIVLQQ  109



>ref|XP_010466323.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Camelina 
sativa]
Length=551

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGV+KC+AFN RG+LLAAGC+DG C+I+DFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVIKCVAFNHRGSLLAAGCADGGCVIFDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            +RD DC AAITSV WSKYGHR+LVSAADKSLTLWDV  GE I    LQQ
Sbjct  61   IRDIDCSAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIARTILQQ  109



>ref|XP_010488090.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X1 
[Camelina sativa]
 ref|XP_010488091.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X2 
[Camelina sativa]
Length=552

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGV+KC+AFN RG+LLAAGC+DG C+I+DFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVIKCVAFNHRGSLLAAGCADGGCVIFDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            +RD DC AAITSV WSKYGHR+LVSAADKSLTLWDV  GE I    LQQ
Sbjct  61   IRDIDCSAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIARTILQQ  109



>ref|XP_010509632.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Camelina 
sativa]
 ref|XP_010509639.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Camelina 
sativa]
Length=553

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEEYLEHGV+KC+AFN RG+LLAAGC+DG C+I+DFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVIKCVAFNHRGSLLAAGCADGGCVIFDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            +RD DC AAITSV WSKYGHR+LVSAADKSLTLWDV  GE I    LQQ
Sbjct  61   IRDIDCSAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIARTILQQ  109



>ref|XP_006579834.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X4 [Glycine 
max]
Length=547

 Score =   192 bits (487),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLA GC+DGSC+IWDFETRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGCMKCIAFNRRGTLLAVGCNDGSCVIWDFETRGIAKI  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSKYGHRILVSAADKSL LWDV++G+ IT + LQQ
Sbjct  61   LRDDECSSPITSICWSKYGHRILVSAADKSLILWDVMSGKKITRIVLQQ  109



>ref|XP_004498849.1| PREDICTED: retinoblastoma-binding protein 5-like [Cicer arietinum]
Length=465

 Score =   190 bits (482),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  IIDPLQGDFPEVIEEYL+HG MKCIAFNRRGTLLAAGC+DGSC+IWDFETRGI+KE
Sbjct  1    MNTSIIDPLQGDFPEVIEEYLQHGCMKCIAFNRRGTLLAAGCNDGSCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C +AITS+CWSK G+RIL SAADKSL+LWDV++G+ IT + LQQ
Sbjct  61   LRDNECSSAITSICWSKCGNRILASAADKSLSLWDVMSGKRITKIVLQQ  109



>ref|XP_004490570.1| PREDICTED: retinoblastoma-binding protein 5-like [Cicer arietinum]
Length=552

 Score =   192 bits (487),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGC+DGSC+IWDFETRGI+KE
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCNDGSCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRDK+C + +TS+CWSK G++IL SA DKSL+LWDV++G+ IT + LQQ
Sbjct  61   LRDKECSSPVTSICWSKCGNQILASATDKSLSLWDVMSGKRITRIVLQQ  109



>ref|XP_006297362.1| hypothetical protein CARUB_v10013382mg [Capsella rubella]
 gb|EOA30260.1| hypothetical protein CARUB_v10013382mg [Capsella rubella]
Length=550

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPIIDPLQGDFPEVIEE+LEHGV+KC+AFN RG+LLAAGC+DG CIIWDFETRGI+KE
Sbjct  1    MNAPIIDPLQGDFPEVIEEFLEHGVIKCVAFNHRGSLLAAGCADGGCIIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            +RD DC AAITSV WSK GHR+LVSAADKSLTLWDV+ G+ I    LQQ
Sbjct  61   IRDTDCSAAITSVSWSKSGHRLLVSAADKSLTLWDVLTGKKIARTILQQ  109



>dbj|BAJ94837.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=588

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN PI+DPLQGDFPE IEE+L+HG MKCIAFNRRGTLLAAGC++GSC+IWDFETRG+++E
Sbjct  1    MNVPIVDPLQGDFPETIEEFLQHGNMKCIAFNRRGTLLAAGCANGSCVIWDFETRGLARE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             RDKDC A ITSV WSKYGHR+L SA DKSLTLW+VV G  I  +TLQQ
Sbjct  61   FRDKDCTAPITSVSWSKYGHRLLASATDKSLTLWNVVTGGKIARITLQQ  109



>ref|XP_004985264.1| PREDICTED: retinoblastoma-binding protein 5-like [Setaria italica]
Length=570

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAP++DP QG+FPE IEEYL HG MKCIAFNR GTLLAAGCS+GSC+IWDFETRG+++E
Sbjct  1    MNAPVVDPYQGEFPETIEEYLHHGTMKCIAFNRTGTLLAAGCSNGSCVIWDFETRGLARE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             RDKDC A ITSV WS+YGHR+L SA DKSLTLWDV  GE I  +TLQQ
Sbjct  61   FRDKDCTAPITSVSWSRYGHRLLASATDKSLTLWDVSTGEKIARITLQQ  109



>ref|XP_003561921.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Brachypodium 
distachyon]
Length=571

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA I+DPLQGDFPE IEE+L+HG MKCIAFNRRGTLLAAGC++GSCIIWDFETRG+++E
Sbjct  1    MNAAIVDPLQGDFPETIEEFLQHGNMKCIAFNRRGTLLAAGCANGSCIIWDFETRGLARE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             RDKDC A ITSV WSKYGHR+L SA D+SLTLW+V  GE I+ +TLQQ
Sbjct  61   FRDKDCTAPITSVSWSKYGHRLLASATDRSLTLWNVETGEKISRITLQQ  109



>tpg|DAA43873.1| TPA: retinoblastoma-binding protein-like protein [Zea mays]
Length=569

 Score =   189 bits (480),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN P++DP QG+FPE IEEYL HG MKCIAFNR+GTLLAAGCS+GSCIIWDFETRG++KE
Sbjct  1    MNVPVVDPYQGEFPETIEEYLHHGTMKCIAFNRKGTLLAAGCSNGSCIIWDFETRGLAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             RDKD  A ITSV WS+YGHR+L SA DKSLTLWDV  GE I  +TLQQ
Sbjct  61   FRDKDSTAPITSVSWSRYGHRLLASATDKSLTLWDVPTGEKIARITLQQ  109



>ref|NP_001146889.1| LOC100280497 [Zea mays]
 gb|ACG24214.1| retinoblastoma-binding protein-like [Zea mays]
Length=569

 Score =   189 bits (480),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN P++DP QG+FPE IEEYL HG MKCIAFNR+GTLLAAGCS+GSCIIWDFETRG++KE
Sbjct  1    MNVPVVDPYQGEFPETIEEYLHHGTMKCIAFNRKGTLLAAGCSNGSCIIWDFETRGLAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             RDKD  A ITSV WS+YGHR+L SA DKSLTLWDV  GE I  +TLQQ
Sbjct  61   FRDKDSTAPITSVSWSRYGHRLLASATDKSLTLWDVPTGEKIARITLQQ  109



>tpg|DAA43874.1| TPA: hypothetical protein ZEAMMB73_120366, partial [Zea mays]
Length=507

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN P++DP QG+FPE IEEYL HG MKCIAFNR+GTLLAAGCS+GSCIIWDFETRG++KE
Sbjct  1    MNVPVVDPYQGEFPETIEEYLHHGTMKCIAFNRKGTLLAAGCSNGSCIIWDFETRGLAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             RDKD  A ITSV WS+YGHR+L SA DKSLTLWDV  GE I  +TLQQ
Sbjct  61   FRDKDSTAPITSVSWSRYGHRLLASATDKSLTLWDVPTGEKIARITLQQ  109



>gb|KEH19267.1| retinoblastoma-binding-like protein [Medicago truncatula]
Length=430

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  IIDPLQGDFPEVIEEYLEHG+MKCIAFNRRGTLLAAGC+DGSC+IWDFE RG++KE
Sbjct  1    MNNSIIDPLQGDFPEVIEEYLEHGIMKCIAFNRRGTLLAAGCNDGSCVIWDFEVRGVAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSK G+RIL SAADKSL+LWDV++G+ I  + LQQ
Sbjct  61   LRDNECCSPITSICWSKGGNRILASAADKSLSLWDVLSGKRIKRIVLQQ  109



>ref|XP_003628195.1| WD repeat-containing protein [Medicago truncatula]
 gb|AET02671.1| retinoblastoma-binding-like protein [Medicago truncatula]
Length=550

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  IIDPLQGDFPEVIEEYLEHG+MKCIAFNRRGTLLAAGC+DGSC+IWDFE RG++KE
Sbjct  1    MNNSIIDPLQGDFPEVIEEYLEHGIMKCIAFNRRGTLLAAGCNDGSCVIWDFEVRGVAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSK G+RIL SAADKSL+LWDV++G+ I  + LQQ
Sbjct  61   LRDNECCSPITSICWSKGGNRILASAADKSLSLWDVLSGKRIKRIVLQQ  109



>ref|XP_003628198.1| Retinoblastoma-binding protein [Medicago truncatula]
Length=542

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  IIDPLQGDFPEVIEEYLEHG+MKCIAFNRRGTLLAAGC+DGSC+IWDFE RG++KE
Sbjct  1    MNNSIIDPLQGDFPEVIEEYLEHGIMKCIAFNRRGTLLAAGCNDGSCVIWDFEVRGVAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSK G+RIL SAADKSL+LWDV++G+ I  + LQQ
Sbjct  61   LRDDECCSPITSICWSKGGNRILASAADKSLSLWDVLSGKRIKRIVLQQ  109



>ref|XP_003628041.1| WD repeat-containing protein [Medicago truncatula]
 gb|ABE88086.1| hypothetical protein MtrDRAFT_AC147431g31v2 [Medicago truncatula]
 gb|AET02517.1| retinoblastoma-binding-like protein [Medicago truncatula]
Length=549

 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  IIDPLQGDFPEVIEEYLEHG+ KCIAFNRRGTLLAAGC+DGSC+IWDFETRGI+KE
Sbjct  1    MNNSIIDPLQGDFPEVIEEYLEHGITKCIAFNRRGTLLAAGCNDGSCVIWDFETRGIAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSK G+RI+VSAADKSL+LWDV++G+ I    LQQ
Sbjct  61   LRDNECSSPITSICWSKCGNRIIVSAADKSLSLWDVMSGKRIKRRVLQQ  109



>ref|XP_003522878.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Glycine 
max]
Length=549

 Score =   186 bits (473),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLE+G MKCIAFNRRGTLLAAGC++GSC+IWDFETRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEYGCMKCIAFNRRGTLLAAGCNNGSCVIWDFETRGIAKI  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSKYGH+ILVSAADKSL LWDV++ + IT + LQQ
Sbjct  61   LRDDECSSPITSICWSKYGHQILVSAADKSLILWDVMSSKKITRIVLQQ  109



>ref|XP_006578412.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X3 [Glycine 
max]
Length=561

 Score =   186 bits (473),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLE+G MKCIAFNRRGTLLAAGC++GSC+IWDFETRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEYGCMKCIAFNRRGTLLAAGCNNGSCVIWDFETRGIAKI  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSKYGH+ILVSAADKSL LWDV++ + IT + LQQ
Sbjct  61   LRDDECSSPITSICWSKYGHQILVSAADKSLILWDVMSSKKITRIVLQQ  109



>gb|KHN48493.1| Retinoblastoma-binding protein 5 [Glycine soja]
Length=549

 Score =   186 bits (472),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLE+G MKCIAFNRRGTLLAAGC++GSC+IWDFETRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEYGCMKCIAFNRRGTLLAAGCNNGSCVIWDFETRGIAKI  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSKYGH+ILVSAADKSL LWDV++ + IT + LQQ
Sbjct  61   LRDDECSSPITSICWSKYGHQILVSAADKSLILWDVMSSKKITRIVLQQ  109



>ref|XP_006578411.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Glycine 
max]
Length=581

 Score =   186 bits (473),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLE+G MKCIAFNRRGTLLAAGC++GSC+IWDFETRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEYGCMKCIAFNRRGTLLAAGCNNGSCVIWDFETRGIAKI  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LRD +C + ITS+CWSKYGH+ILVSAADKSL LWDV++ + IT + LQQ
Sbjct  61   LRDDECSSPITSICWSKYGHQILVSAADKSLILWDVMSSKKITRIVLQQ  109



>ref|NP_001049328.1| Os03g0207900 [Oryza sativa Japonica Group]
 gb|AAN77305.1| Putative retinoblastoma-binding protein [Oryza sativa Japonica 
Group]
 gb|ABF94566.1| retinoblastoma-binding protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11242.1| Os03g0207900 [Oryza sativa Japonica Group]
 gb|EAZ26003.1| hypothetical protein OsJ_09856 [Oryza sativa Japonica Group]
Length=570

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN PI+DPLQGDFPE IEE+L++G MKCIAFNRRGTLLAAGC++G+C+IWDFETRGI++E
Sbjct  1    MNVPIVDPLQGDFPETIEEFLQYGSMKCIAFNRRGTLLAAGCANGTCVIWDFETRGIARE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            L DKDC A ITSV WSKYGH +L SA DKSLTLW VVN + I  +TLQQ
Sbjct  61   LHDKDCTAPITSVAWSKYGHHLLASATDKSLTLWHVVNEKKIARITLQQ  109



>gb|EAY88980.1| hypothetical protein OsI_10465 [Oryza sativa Indica Group]
Length=570

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN PI+DPLQGDFPE IEE+L++G MKCIAFNRRGTLLAAGC++G+C+IWDFETRGI++E
Sbjct  1    MNVPIVDPLQGDFPETIEEFLQYGSMKCIAFNRRGTLLAAGCANGNCVIWDFETRGIARE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            L DKDC A ITSV WSKYGH +L SA DKSLTLW VVN + I  +TLQQ
Sbjct  61   LHDKDCTAPITSVAWSKYGHHLLASATDKSLTLWHVVNEKKIARITLQQ  109



>gb|AFK42526.1| unknown [Lotus japonicus]
Length=548

 Score =   184 bits (467),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLE+G MKCIAF+RRGTLLAAGC+DGSC+IWDF TRGI+K 
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEYGCMKCIAFDRRGTLLAAGCNDGSCVIWDFITRGIAKV  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            L D  C + ITS+CWSK+GHRILVSAADKSLTLWDV++G+ IT + LQQ
Sbjct  61   LSDDGCSSPITSICWSKFGHRILVSAADKSLTLWDVMSGKKITRIVLQQ  109



>ref|XP_006649601.1| PREDICTED: retinoblastoma-binding protein 5-like [Oryza brachyantha]
Length=568

 Score =   184 bits (466),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN PI+DPLQGDFPE IEE+L++G MKCIAFNRRG+LLAAGC++G+C+IWDFETRGI++E
Sbjct  1    MNVPIVDPLQGDFPETIEEFLQYGSMKCIAFNRRGSLLAAGCANGTCVIWDFETRGIARE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            L DKDC A ITSV WSKYGH +L SA DKSLTLW VVN + I  +TLQQ
Sbjct  61   LHDKDCTAPITSVAWSKYGHHLLASATDKSLTLWHVVNEKKIARITLQQ  109



>ref|XP_004958908.1| PREDICTED: retinoblastoma-binding protein 5-like [Setaria italica]
Length=611

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNAPI+DP QG+FPE+IEEYL+HG MKCIAFNR GTLLAAGCS GSC+IWDFET+G+++E
Sbjct  1    MNAPIVDPYQGEFPEIIEEYLQHGTMKCIAFNRTGTLLAAGCSKGSCVIWDFETKGLARE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
              DKD  A+ITSV WSKYGHR+L SA DKSLTLWDV++GE I+ +TL++
Sbjct  61   FHDKDYSASITSVSWSKYGHRLLASATDKSLTLWDVLSGEKISRITLEK  109



>ref|XP_002465668.1| hypothetical protein SORBIDRAFT_01g043410 [Sorghum bicolor]
 gb|EER92666.1| hypothetical protein SORBIDRAFT_01g043410 [Sorghum bicolor]
Length=569

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN P++DP QG+FPE IEEYL +G MKCIAFNR+GTLLAAGCS+GSCIIWDFETRG  KE
Sbjct  1    MNVPVVDPYQGEFPETIEEYLHYGTMKCIAFNRKGTLLAAGCSNGSCIIWDFETRGFIKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             RDKD  A ITSV WS+YGHR+L SA D+SLTLWDV  GE I  +TLQQ
Sbjct  61   FRDKDSTAPITSVSWSRYGHRLLASATDRSLTLWDVSTGEKIARITLQQ  109



>gb|EMS61733.1| Retinoblastoma-binding protein 5 [Triticum urartu]
Length=711

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +1

Query  289  L*CCTMNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETR  468
            L C   ++   DPLQGDFPE IEE+L+HG MKCIAFNRRGTLLAAGC++GSC+IWDFETR
Sbjct  38   LSCKRASSAASDPLQGDFPETIEEFLQHGNMKCIAFNRRGTLLAAGCANGSCVIWDFETR  97

Query  469  GISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            G+++E RDKDC A ITSV WSKYGHR+L SA DKSLTLW+VV GE I  +TLQQ
Sbjct  98   GLAREFRDKDCTAPITSVSWSKYGHRLLASATDKSLTLWNVVTGEKIARITLQQ  151



>gb|EMT25536.1| hypothetical protein F775_27533 [Aegilops tauschii]
Length=667

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +1

Query  322  DPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKELRDKDC  501
            DPLQGDFPE IEE+L+HG MKCIAFNRRGTLLAAGC++GSC+IWDFETRG+++E RDKDC
Sbjct  35   DPLQGDFPETIEEFLQHGNMKCIAFNRRGTLLAAGCANGSCVIWDFETRGLAREFRDKDC  94

Query  502  VAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             A ITSV WSKYGHR+L SA DKSLTLW+VV GE I  +TLQQ
Sbjct  95   TAPITSVSWSKYGHRLLASATDKSLTLWNVVTGEKIARITLQQ  137



>ref|XP_008673444.1| PREDICTED: LOC100280497 isoform X2 [Zea mays]
 tpg|DAA43875.1| TPA: hypothetical protein ZEAMMB73_120366 [Zea mays]
Length=589

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +1

Query  313  PIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKELRD  492
            P +DP QG+FPE IEEYL HG MKCIAFNR+GTLLAAGCS+GSCIIWDFETRG++KE RD
Sbjct  24   PKLDPYQGEFPETIEEYLHHGTMKCIAFNRKGTLLAAGCSNGSCIIWDFETRGLAKEFRD  83

Query  493  KDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            KD  A ITSV WS+YGHR+L SA DKSLTLWDV  GE I  +TLQQ
Sbjct  84   KDSTAPITSVSWSRYGHRLLASATDKSLTLWDVPTGEKIARITLQQ  129



>gb|KEH19268.1| retinoblastoma-binding-like protein [Medicago truncatula]
 gb|AET02674.2| retinoblastoma-binding-like protein [Medicago truncatula]
Length=542

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +1

Query  322  DPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKELRDKDC  501
            DPLQGDFPEVIEEYLEHG+MKCIAFNRRGTLLAAGC+DGSC+IWDFE RG++KELRD +C
Sbjct  7    DPLQGDFPEVIEEYLEHGIMKCIAFNRRGTLLAAGCNDGSCVIWDFEVRGVAKELRDDEC  66

Query  502  VAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             + ITS+CWSK G+RIL SAADKSL+LWDV++G+ I  + LQQ
Sbjct  67   CSPITSICWSKGGNRILASAADKSLSLWDVLSGKRIKRIVLQQ  109



>ref|XP_008673440.1| PREDICTED: LOC100280497 isoform X1 [Zea mays]
Length=594

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +1

Query  322  DPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKELRDKDC  501
            DP QG+FPE IEEYL HG MKCIAFNR+GTLLAAGCS+GSCIIWDFETRG++KE RDKD 
Sbjct  32   DPYQGEFPETIEEYLHHGTMKCIAFNRKGTLLAAGCSNGSCIIWDFETRGLAKEFRDKDS  91

Query  502  VAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             A ITSV WS+YGHR+L SA DKSLTLWDV  GE I  +TLQQ
Sbjct  92   TAPITSVSWSRYGHRLLASATDKSLTLWDVPTGEKIARITLQQ  134



>gb|KHN38141.1| Retinoblastoma-binding protein 5 [Glycine soja]
Length=564

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 95/123 (77%), Gaps = 19/123 (15%)
 Frame = +1

Query  319  IDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAG-------------------CSDGS  441
            +DPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLAAG                   C++GS
Sbjct  1    MDPLQGDFPEVIEEYLEHGCMKCIAFNRRGTLLAAGFICCWSSWSGKEDDIVFAGCNNGS  60

Query  442  CIIWDFETRGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMT  621
            C+IWDFETRGI+KELRD +C + ITSVCWSK GHRILVSAADKSL LWDV++G+ IT + 
Sbjct  61   CVIWDFETRGIAKELRDNECSSPITSVCWSKCGHRILVSAADKSLLLWDVMSGKRITRIV  120

Query  622  LQQ  630
            LQQ
Sbjct  121  LQQ  123



>ref|XP_001764783.1| WD40 repeat protein, COMPASS complex protein [Physcomitrella 
patens]
 gb|EDQ70482.1| WD40 repeat protein, COMPASS complex protein [Physcomitrella 
patens]
Length=522

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  +IDP Q DFPEVIEEYLEHGV KCIAFNRRGTLLAAGC+DGSC IWDF+TRG++KE
Sbjct  1    MNLSLIDPFQSDFPEVIEEYLEHGVTKCIAFNRRGTLLAAGCNDGSCTIWDFDTRGVAKE  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            LR+K+  + ITSV WSK GHR+L +A DK+L+LWDV  G  I  + LQQ
Sbjct  61   LREKEVASPITSVSWSKCGHRLLSAATDKTLSLWDVGKGLKIGSVILQQ  109



>ref|XP_006369773.1| hypothetical protein POPTR_0001s31290g [Populus trichocarpa]
 gb|ERP66342.1| hypothetical protein POPTR_0001s31290g [Populus trichocarpa]
Length=531

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +1

Query  379  MKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKELRDKDCVAAITSVCWSKYGHRILVS  558
            MKCIAFNRRGTLLAAGC+DGSC+IWDFETRGI+KELRDKDCVAAITSVCWSKYGHRILVS
Sbjct  1    MKCIAFNRRGTLLAAGCTDGSCVIWDFETRGIAKELRDKDCVAAITSVCWSKYGHRILVS  60

Query  559  AADKSLTLWDVVNGEXITHMTLQQ  630
            AADKSLTLWDVV+GE IT +TLQQ
Sbjct  61   AADKSLTLWDVVSGEKITRITLQQ  84



>ref|XP_009609900.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Nicotiana 
tomentosiformis]
Length=505

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +1

Query  379  MKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKELRDKDCVAAITSVCWSKYGHRILVS  558
            MKCIAFNRRGTLLAAGC DGSC+IWDFETRGI+KE +D++CVA+ITSVCWSKYGHRILVS
Sbjct  1    MKCIAFNRRGTLLAAGCFDGSCLIWDFETRGIAKEFKDEECVASITSVCWSKYGHRILVS  60

Query  559  AADKSLTLWDVVNGEXITHMTLQQ  630
            AADKSLTLWDVV GE IT  TLQQ
Sbjct  61   AADKSLTLWDVVKGEKITRTTLQQ  84



>ref|XP_010277148.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X2 
[Nelumbo nucifera]
Length=539

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +1

Query  379  MKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKELRDKDCVAAITSVCWSKYGHRILVS  558
            MKCIAFNRRGTLLAAGCSDGSC++WDF+TRGI+KELRDKDCV+ ITSVCWSKYGH ILVS
Sbjct  1    MKCIAFNRRGTLLAAGCSDGSCVVWDFQTRGIAKELRDKDCVSPITSVCWSKYGHYILVS  60

Query  559  AADKSLTLWDVVNGEXITHMTLQQ  630
            A DKSLTLWDVV+GE +T  TL Q
Sbjct  61   ATDKSLTLWDVVSGEKVTRTTLHQ  84



>ref|XP_006579836.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X6 [Glycine 
max]
Length=528

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  379  MKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKELRDKDCVAAITSVCWSKYGHRILVS  558
            MKCIAFNRRGTLLA GC+DGSC+IWDFETRGI+K LRD +C + ITS+CWSKYGHRILVS
Sbjct  1    MKCIAFNRRGTLLAVGCNDGSCVIWDFETRGIAKILRDDECSSPITSICWSKYGHRILVS  60

Query  559  AADKSLTLWDVVNGEXITHMTLQQ  630
            AADKSL LWDV++G+ IT + LQQ
Sbjct  61   AADKSLILWDVMSGKKITRIVLQQ  84



>ref|XP_002975565.1| hypothetical protein SELMODRAFT_103410, partial [Selaginella 
moellendorffii]
 gb|EFJ23194.1| hypothetical protein SELMODRAFT_103410, partial [Selaginella 
moellendorffii]
Length=553

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 74/105 (70%), Gaps = 6/105 (6%)
 Frame = +1

Query  316  IIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKELRDK  495
            + DP Q DFPEVIEE+LEHG+ K IAFNR       GC+DGSC+IWDF TRG++ ELRDK
Sbjct  1    LADPFQNDFPEVIEEFLEHGITKSIAFNR------PGCADGSCVIWDFHTRGVAAELRDK  54

Query  496  DCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
             C + +TSV WSK GH ++ +A DKSL+ WDV  G  I   TL Q
Sbjct  55   SCSSPVTSVSWSKCGHHLVAAAMDKSLSCWDVAKGVKIASTTLHQ  99



>ref|XP_007133504.1| hypothetical protein PHAVU_011G184500g, partial [Phaseolus vulgaris]
 gb|ESW05498.1| hypothetical protein PHAVU_011G184500g, partial [Phaseolus vulgaris]
Length=480

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +1

Query  349  VIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKELRDKDCVAAITSVCW  528
            V+++YL++G  KCIAFNRRGTLLA GC DG C+IWDFETR I KEL+D++C + I SVCW
Sbjct  24   VVDDYLDYGHAKCIAFNRRGTLLAVGCKDGRCVIWDFETRCIVKELKDEECSSPINSVCW  83

Query  529  SKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            S+  + +LVS+AD+SLTLWDV N   IT + LQ+
Sbjct  84   SRSCNHLLVSSADQSLTLWDVKNDNRITRIVLQK  117



>ref|XP_010497484.1| PREDICTED: retinoblastoma-binding protein 5 homolog, partial 
[Camelina sativa]
Length=210

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  415  LAAGCSDGSCIIWDFETRGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVV  594
            L AGC+DG C+I+DFETRGI+KE+RD DC AAITSV WSKYGHR+LVSAADKSLTLWDV 
Sbjct  12   LLAGCADGGCVIFDFETRGIAKEIRDIDCSAAITSVSWSKYGHRLLVSAADKSLTLWDVS  71

Query  595  NGEXITHMTLQQ  630
             GE I    LQQ
Sbjct  72   TGEKIARTILQQ  83



>ref|XP_006578413.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X4 [Glycine 
max]
Length=543

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +1

Query  421  AGCSDGSCIIWDFETRGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNG  600
            AGC++GSC+IWDFETRGI+K LRD +C + ITS+CWSKYGH+ILVSAADKSL LWDV++ 
Sbjct  2    AGCNNGSCVIWDFETRGIAKILRDDECSSPITSICWSKYGHQILVSAADKSLILWDVMSS  61

Query  601  EXITHMTLQQ  630
            + IT + LQQ
Sbjct  62   KKITRIVLQQ  71



>ref|XP_003615569.1| Retinoblastoma-binding protein [Medicago truncatula]
 gb|AES98527.1| retinoblastoma-binding-like protein [Medicago truncatula]
Length=95

 Score =   101 bits (252),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  415  LAAGCSDGSCIIWDFETRGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVV  594
            +  G +DGSC+IWDFETRGI+KELRD +C + +TS+CWSK  +RILVSAADKSL LWDV+
Sbjct  8    IITGSNDGSCVIWDFETRGIAKELRDNECSSPMTSICWSKCVNRILVSAADKSLLLWDVM  67

Query  595  NGEXITHMTLQQ  630
            NG+ I    LQ+
Sbjct  68   NGKVIKRKVLQK  79



>gb|KFH72296.1| hypothetical protein MVEG_02587 [Mortierella verticillata NRRL 
6337]
Length=617

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  +IDP + DFPEVIE+ LE G    + FNRRGTLLAAGCSDGS ++WDF+TRG+S+ 
Sbjct  1    MNLELIDPFEQDFPEVIEDTLEDGPAVTVKFNRRGTLLAAGCSDGSIVVWDFDTRGVSRS  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNG  600
            L     +  ITS+ WS+ G  +L S+ D +  +WD++ G
Sbjct  61   L--IGHIKTITSLSWSRNGRYLLSSSRDWNCIVWDLLTG  97



>emb|CDS04820.1| hypothetical protein LRAMOSA07350 [Absidia idahoensis var. thermophila]
Length=437

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 69/107 (64%), Gaps = 2/107 (2%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  ++DP + ++P+ IEE LE G +    FNRRGTLLAAGC DG C++WDF+T+GI++ 
Sbjct  1    MNLELLDPWEQEYPQTIEETLEDGYVMTCRFNRRGTLLAAGCHDGRCVVWDFDTKGIARS  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTL  624
            L     V +I SV WS+ G  +L ++ D +  +WD+V  E +  +  
Sbjct  61   LTGH--VKSIASVSWSRNGRYLLSASKDWTCAMWDLVTAERLVRVRF  105



>ref|XP_004339591.1| WD40 repeat protein, COMPASS complex protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR17578.1| WD40 repeat protein, COMPASS complex protein [Acanthamoeba castellanii 
str. Neff]
Length=427

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 73/108 (68%), Gaps = 2/108 (2%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  +++P + +FPEVIE+ LE G   C + NRRGTLLA GC DG  +IWDF+TRGI++ 
Sbjct  1    MNLELLNPFENEFPEVIEDCLEDGYACCCSPNRRGTLLAVGCLDGRVVIWDFDTRGIARV  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQ  627
            L  K     I+SV WS+ G ++L +++D ++ LWDV++G     + L+
Sbjct  61   L--KGHSHPISSVSWSRDGRKLLSASSDWTVKLWDVLSGNVDQTLQLE  106



>emb|CDH61504.1| retinoblastoma-binding protein 5-like [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=437

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 69/107 (64%), Gaps = 2/107 (2%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  ++DP + ++P+ IEE LE G +    FNRRGTLLAAGC DG C++WDF+T+GI++ 
Sbjct  1    MNLELLDPWEQEYPQTIEETLEDGYVMTCRFNRRGTLLAAGCHDGRCVVWDFDTKGIARS  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTL  624
            L     V +I SV WS+ G  +L ++ D +  +WD++  E +  +  
Sbjct  61   LTGH--VKSIASVSWSRNGRYLLSASKDWTCAVWDLLTAERLVRVRF  105



>emb|CEG72738.1| hypothetical protein RMATCC62417_08238 [Rhizopus microsporus]
Length=397

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 68/100 (68%), Gaps = 2/100 (2%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  ++DP + ++P++IEE LE G +    FN+RGTLLAAGC DG CI+WDF+T+G+S+ 
Sbjct  1    MNLELLDPWEQEYPQLIEETLEDGYVLNCKFNKRGTLLAAGCLDGRCIVWDFDTKGVSRN  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            L     V  ++S+ WS+ G  +L ++ D +   WD++ G+
Sbjct  61   LIGH--VKPVSSISWSRNGKYLLSASKDWTCIYWDLITGK  98



>ref|XP_005839587.1| hypothetical protein GUITHDRAFT_133657 [Guillardia theta CCMP2712]
 gb|EKX52607.1| hypothetical protein GUITHDRAFT_133657 [Guillardia theta CCMP2712]
Length=392

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 65/100 (65%), Gaps = 5/100 (5%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVM--KCIAFNRRGTLLAAGCSDGSCIIWDFETRGIS  477
            MN  ++DP + D+PE IE+ L H     +C AFNRRGTLLA GC DG+  +WDF+TRG+ 
Sbjct  1    MNKQLLDPFEADYPERIEDELVHEKFQARCCAFNRRGTLLATGCQDGAAALWDFDTRGVI  60

Query  478  KELRDK---DCVAAITSVCWSKYGHRILVSAADKSLTLWD  588
            K L+DK   +  AAI ++ WS+ G RI+ +     + +WD
Sbjct  61   KVLQDKKLQEIPAAIAAIGWSQDGRRIVTAEERGRVRVWD  100



>emb|CEJ02518.1| hypothetical protein RMCBS344292_16519 [Rhizopus microsporus]
Length=453

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 68/100 (68%), Gaps = 2/100 (2%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  ++DP + ++P++IEE LE G +    FN+RGTLLAAGC DG CI+WDF+T+G+S+ 
Sbjct  1    MNLELLDPWEQEYPQLIEETLEDGYVLNCKFNKRGTLLAAGCLDGRCIVWDFDTKGVSRN  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            L     V  ++S+ WS+ G  +L ++ D +   WD++ G+
Sbjct  61   LIGH--VKPVSSISWSRNGKYLLSASKDWTCIYWDLITGK  98



>emb|CEG72737.1| hypothetical protein RMATCC62417_08238 [Rhizopus microsporus]
 emb|CEI89400.1| hypothetical protein RMCBS344292_03761 [Rhizopus microsporus]
Length=453

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 68/100 (68%), Gaps = 2/100 (2%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  ++DP + ++P++IEE LE G +    FN+RGTLLAAGC DG CI+WDF+T+G+S+ 
Sbjct  1    MNLELLDPWEQEYPQLIEETLEDGYVLNCKFNKRGTLLAAGCLDGRCIVWDFDTKGVSRN  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            L     V  ++S+ WS+ G  +L ++ D +   WD++ G+
Sbjct  61   LIGH--VKPVSSISWSRNGKYLLSASKDWTCIYWDLITGK  98



>gb|ERZ96784.1| hypothetical protein GLOINDRAFT_299625 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX71079.1| Swd1p [Rhizophagus irregularis DAOM 197198w]
Length=488

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 63/100 (63%), Gaps = 4/100 (4%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  +  P + D+P  +E  +  G ++CI+FN+RGT+LA GCSDG CI+WDF++  I ++
Sbjct  1    MNLELRSPFESDYPAKLEATVRDGPVRCISFNKRGTMLAGGCSDGYCIVWDFQSMSIIRK  60

Query  484  LRDKDC-VAAITSVCWSKYGHRILVSAADKSLTLWDVVNG  600
            +R   C V ++TSV WS+ G  IL S  D     WD+  G
Sbjct  61   MR---CHVNSVTSVSWSRNGRCILSSGEDHKCVYWDITKG  97



>dbj|GAN08020.1| hypothetical protein MAM1_0186c07526 [Mucor ambiguus]
Length=180

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  ++DP + ++P++IE+ LE G +    FN+RGTLLAAGC DG C+++DF+T+G+++ 
Sbjct  1    MNLELLDPWEQEYPQLIEDTLEDGFVLNCKFNKRGTLLAAGCLDGRCVVYDFDTKGVTRS  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNG  600
            L     V  + S+ WS  G  +L ++ D +   WD+V+G
Sbjct  61   LLGH--VKPVASISWSHNGRSLLSASKDWTCIYWDLVSG  97



>ref|XP_003291427.1| hypothetical protein DICPUDRAFT_82100 [Dictyostelium purpureum]
 gb|EGC32041.1| hypothetical protein DICPUDRAFT_82100 [Dictyostelium purpureum]
Length=445

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 68/112 (61%), Gaps = 6/112 (5%)
 Frame = +1

Query  304  MNAPIIDPL-QGDFPEVIEEYL--EHGVMKCIA-FNRRGTLLAAGCSDGSCIIWDFETRG  471
            MN  +IDP  Q D PE +E YL    G+   +A FNRRGTLLA GC +G+  IWDF+TR 
Sbjct  1    MNLSLIDPFKQADVPEAVEYYLVDPSGMKSSVAQFNRRGTLLAVGCGNGTISIWDFDTRR  60

Query  472  ISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQ  627
            I + L        ITS+ WS+ G ++L S+ D SL LWD+ + +   H+ L+
Sbjct  61   IVRTLYFHK--QYITSIGWSRNGRKLLTSSYDGSLVLWDLPSAKIEKHLELE  110



>gb|KJE88843.1| hypothetical protein CAOG_000421 [Capsaspora owczarzaki ATCC 
30864]
Length=468

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 64/102 (63%), Gaps = 2/102 (2%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  ++D    D+PEV+E YLE G  +  AFNR GTLLAAGC+DG  ++WDF+T  +++ 
Sbjct  1    MNLELLDSAGQDYPEVVERYLEDGFAQTCAFNRFGTLLAAGCNDGRVVVWDFDTHSVARH  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXI  609
            L     V  ++SV W++    +L  ++D ++ LW+V   E +
Sbjct  61   LTGH--VHPVSSVSWTRNSRFLLSGSSDTNVILWNVATAERM  100



>gb|EPB82204.1| hypothetical protein HMPREF1544_11048 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=459

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  ++DP + ++P++IE+ LE G +    FN+RGTLLAAGC DG C+++DF+T+G+++ 
Sbjct  1    MNLELLDPWEQEYPQLIEDTLEDGFVLNCKFNKRGTLLAAGCLDGRCVVYDFDTKGVTRS  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNG  600
            L     V  + S+ WS  G  +L ++ D +   WD+V+G
Sbjct  61   LLGH--VKPVASISWSHNGRSLLSASKDWTCIYWDLVSG  97



>gb|EFA80387.1| WD-40 repeat-containing protein [Polysphondylium pallidum PN500]
Length=350

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 68/113 (60%), Gaps = 8/113 (7%)
 Frame = +1

Query  304  MNAPIIDPLQ-GDFPEVIEEYLEHGV---MKCIAFNRRGTLLAAGCSDGSCIIWDFETRG  471
            MN  ++DP + GD PE IE+YL   V     C+ FNRRG LLA G   G  +IWDF+T+ 
Sbjct  1    MNLSLLDPFRIGDVPESIEDYLVDHVESKANCLQFNRRGLLLAVGNQSGVVVIWDFDTKS  60

Query  472  ISKELR-DKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQ  627
            ISK+L+  K CV    SV W++ G RIL  + D SL LW++++    T +  +
Sbjct  61   ISKQLKAHKQCV---NSVGWTRNGKRILSCSTDGSLILWNLIDDSIETKIDFE  110



>ref|XP_004990000.1| hypothetical protein PTSG_09572 [Salpingoeca rosetta]
 gb|EGD77937.1| hypothetical protein PTSG_09572 [Salpingoeca rosetta]
Length=324

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 64/100 (64%), Gaps = 2/100 (2%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            M  P++DP     P+VIE  LE G+     FNR+G+LLA GCSDG  ++WDF+T+  +  
Sbjct  1    MQTPLLDPFGTKIPDVIEHTLEEGIALTSKFNRKGSLLATGCSDGKVVLWDFDTKSPATS  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            L DK  +A +  + WS+ G ++L  AAD+++ ++DV  G+
Sbjct  61   L-DKHTMAVL-GLSWSRNGRKLLTWAADQTVVVFDVKKGK  98



>gb|KHN26444.1| Retinoblastoma-binding protein 5 [Glycine soja]
Length=442

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 64/105 (61%), Gaps = 7/105 (7%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA IIDPLQGDFPEVIEEYLEHG MKCIAFNRRGTLLA   +     + +    G +  
Sbjct  1    MNASIIDPLQGDFPEVIEEYLEHGCMKCIAFNRRGTLLAGDTTLLKVSVSE-TCNGPTPP  59

Query  484  LRDKDCVAAITS-----VCWSKYGHRILVSAADKSLTLWDVVNGE  603
             R+K C   ITS      C++KYG  + V  +   + + D  NG+
Sbjct  60   SRNK-CSDGITSFTPTAACFNKYGTLVYVGNSKGEILVIDYKNGD  103



>ref|XP_005787879.1| hypothetical protein EMIHUDRAFT_433832 [Emiliania huxleyi CCMP1516]
 gb|EOD35450.1| hypothetical protein EMIHUDRAFT_433832 [Emiliania huxleyi CCMP1516]
Length=453

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +1

Query  304  MNAPIIDPL-QGDFPEVIEEYLE-HGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGIS  477
            MN  ++DP    + PEVIE  LE    +   AFNRRG++LA GC +G  I+WDFET G++
Sbjct  1    MNLALLDPFSHNELPEVIEAKLEVPSTVSVCAFNRRGSMLAGGCDNGHVIVWDFETHGVA  60

Query  478  KELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNG  600
            + L   +  A +TSV W+K   R+L S AD  L +WDV+  
Sbjct  61   RTLELHE--APVTSVSWTKSSRRLLSSGADGRLAVWDVLGA  99



>ref|XP_008347048.1| PREDICTED: retinoblastoma-binding protein 5-like [Malus domestica]
Length=344

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLA  420
            MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLA
Sbjct  1    MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLA  39



>ref|XP_002504961.1| COMPASS/Set1C complex protein [Micromonas sp. RCC299]
 gb|ACO66219.1| COMPASS/Set1C complex protein [Micromonas sp. RCC299]
Length=738

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 69/117 (59%), Gaps = 10/117 (9%)
 Frame = +1

Query  304  MNAPIIDPLQG-DFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISK  480
            MN  + + + G D  E+IEE L+HG   C+AFNRRGTLLAAG S GS  I+DF TR +++
Sbjct  1    MNRAMEEVVPGSDMLEIIEEALQHGKATCVAFNRRGTLLAAGTSGGSIAIFDFITRSVAR  60

Query  481  ELRDK---------DCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTL  624
            EL  +         + + A+ SV WS  G ++L +AAD S+ +WDV   +     T 
Sbjct  61   ELVPEAITNEDGTVEELPAVFSVAWSSDGRKLLSTAADGSVVVWDVAESDLSFRATF  117



>gb|EFX77720.1| hypothetical protein DAPPUDRAFT_321168 [Daphnia pulex]
Length=503

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+RGTLLA GC+DG  ++WDF T
Sbjct  1    MNLDLLESFGQNYPEEFD-----GALDCISMAVTCTFNKRGTLLAVGCNDGRIVVWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+CWS+ GH IL ++ D ++ +WDV+ GE
Sbjct  56   RGIAKIISAH--VHPVCSLCWSRSGHTILSASTDNTVAIWDVLTGE  99



>gb|KFM81993.1| Retinoblastoma-binding protein 5, partial [Stegodyphus mimosarum]
Length=117

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 67/115 (58%), Gaps = 13/115 (11%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI      AFN+ GTLLA GC+DG  ++WDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GALDCISLAVTCAFNKHGTLLAVGCNDGRIVLWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQQ  630
            RGI+K +     +  + S+ WS+ GH++L ++ D S+++WDV++ E  +    Q 
Sbjct  56   RGIAKIICAH--IHPVCSLSWSRSGHKLLSASTDNSVSIWDVLSAECESRYRFQS  108



>ref|XP_001856893.1| retinoblastoma-binding protein 5 [Culex quinquefasciatus]
 gb|EDS34699.1| retinoblastoma-binding protein 5 [Culex quinquefasciatus]
Length=494

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI      AFN+ GTLLA GC+DG  ++WDF T
Sbjct  1    MNLQLLESFGQNYPEEFD-----GSLDCISLAVTCAFNKYGTLLAVGCNDGRIVVWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+CWS+ GH++L ++ D ++ +WDV+NG+
Sbjct  56   RGIAKIISAH--VHPVCSLCWSRNGHKLLSASTDNNVCIWDVLNGD  99



>ref|XP_009018161.1| hypothetical protein HELRODRAFT_185612 [Helobdella robusta]
 gb|ESO03604.1| hypothetical protein HELRODRAFT_185612 [Helobdella robusta]
Length=530

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 68/106 (64%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     GV+ C++      FN+RGTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEDFD-----GVLDCVSMAVTCVFNKRGTLLAIGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CW++ GH+IL ++ D  +++WDV++GE
Sbjct  56   RGIAKVISAH--IHPVCSLCWNRSGHKILSASTDCMVSIWDVLSGE  99



>gb|EIF46863.1| wd domain protein [Brettanomyces bruxellensis AWRI1499]
Length=426

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 61/104 (59%), Gaps = 4/104 (4%)
 Frame = +1

Query  304  MNAPIIDPLQ--GDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGIS  477
            MN  ++DP     DFPE + E L +G   C+ FNR+G  LA+G +DG+ +I D +T  + 
Sbjct  1    MNLSLLDPFAVASDFPETLTETLSYGYSTCVKFNRKGDYLASGLADGNIVIIDVDTNSVI  60

Query  478  KELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXI  609
              LR    V AITS+CWS+ G  +L S+ D  + LWD+  G  I
Sbjct  61   LILRGH--VRAITSLCWSEDGRYLLSSSRDFKVBLWDLKXGSAI  102



>ref|XP_003387125.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Amphimedon 
queenslandica]
Length=500

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 62/101 (61%), Gaps = 3/101 (3%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA-FNRRGTLLAAGCSDGSCIIWDFETRGISK  480
            MN  ++      +PE  +  L+ G    I  FNRRGT+LA GC+DG   +WDF TRGIS+
Sbjct  1    MNLELLRTFDHSYPEHNDGVLDSGSEAVIVQFNRRGTMLAVGCNDGRIALWDFMTRGISR  60

Query  481  ELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            +      +  ITS+ W++ G R+L SA D ++ LWDV++GE
Sbjct  61   QCSYH--IHPITSLSWNRSGRRLLSSATDWNVVLWDVISGE  99



>gb|ADV40177.1| retinoblastoma binding protein [Latrodectus hesperus]
Length=229

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+ GTLLA GC+DG  ++WDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GALDCISLAVTCQFNKHGTLLAVGCNDGRIVLWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D S+++WDV++ E
Sbjct  56   RGIAKIICAH--IHPVCSLCWSRTGHKLVSASTDNSVSIWDVLSAE  99



>ref|XP_011136194.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Harpegnathos 
saltator]
 gb|EFN86646.1| Retinoblastoma-binding protein 5 [Harpegnathos saltator]
Length=465

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+RGTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GTLDCISLAVTCTFNKRGTLLAVGCNDGRLVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ WS+ GH++L ++ D ++ +WDV++GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWSRNGHKLLSASTDNNVCIWDVLSGE  99



>ref|XP_011349613.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Cerapachys 
biroi]
Length=465

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+RGTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GTLDCISLAVTCTFNKRGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ WS+ GH++L ++ D ++ +WDV++GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWSRNGHKLLSASTDNNVCIWDVLSGE  99



>ref|XP_008551099.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Microplitis 
demolitor]
Length=464

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+RGTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GTLDCISLAVTCTFNKRGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ WS+ GH++L ++ D ++ +WDV++GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWSRNGHKLLSASTDNNVCIWDVLSGE  99



>ref|XP_011064252.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Acromyrmex 
echinatior]
 ref|XP_011064253.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Acromyrmex 
echinatior]
 gb|EGI59371.1| Retinoblastoma-binding protein 5 [Acromyrmex echinatior]
Length=465

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+RGTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GTLDCISLAVTCTFNKRGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ WS+ GH++L ++ D ++ +WDV++GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWSRNGHKLLSASTDNNVCIWDVLSGE  99



>ref|XP_011684913.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Wasmannia 
auropunctata]
 ref|XP_011684993.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Wasmannia 
auropunctata]
Length=465

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+RGTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GTLDCISLAVTCTFNKRGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ WS+ GH++L ++ D ++ +WDV++GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWSRNGHKLLSASTDNNVCIWDVLSGE  99



>ref|XP_011874786.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Vollenhovia 
emeryi]
Length=465

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+RGTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GTLDCISLAVTCTFNKRGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ WS+ GH++L ++ D ++ +WDV++GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWSRNGHKLLSASTDNNVCIWDVLSGE  99



>ref|XP_011254466.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Camponotus 
floridanus]
Length=465

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+RGTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GTLDCISLAVTCTFNKRGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ WS+ GH++L ++ D ++ +WDV++GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWSRNGHKLLSASTDNNVCIWDVLSGE  99



>ref|XP_011497888.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Ceratosolen 
solmsi marchali]
Length=465

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+RGTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GTLDCISLAVTCTFNKRGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ WS+ GH++L ++ D ++ +WDV++GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWSRNGHKLLSASTDNNVCIWDVLSGE  99



>ref|XP_011172153.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Solenopsis 
invicta]
Length=464

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+RGTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GTLDCISLAVTCTFNKRGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ WS+ GH++L ++ D ++ +WDV++GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWSRNGHKLLSASTDNNVCIWDVLSGE  99



>ref|XP_314543.3| AGAP010575-PA [Anopheles gambiae str. PEST]
 gb|EAA09974.3| AGAP010575-PA [Anopheles gambiae str. PEST]
Length=490

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI      AFN+ GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GSLDCISLAVTCAFNKYGTLLAVGCNDGRVVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+CWS+ GH++L ++ D ++ +WDV++G+
Sbjct  56   RGIAKIISAH--VHPVCSLCWSRNGHKLLSASTDNNVCIWDVLSGD  99



>ref|XP_006622476.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Apis 
dorsata]
Length=460

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+RGTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GTLDCISLAVTCTFNKRGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RG++K +     V  + S+ WS+ GH++L ++ D ++ +WDV++GE
Sbjct  56   RGVAKIISAH--VHPVCSLSWSRNGHKLLSASTDNNVCIWDVLSGE  99



>ref|XP_006568237.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Apis 
mellifera]
Length=460

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+RGTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GTLDCISLAVTCTFNKRGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RG++K +     V  + S+ WS+ GH++L ++ D ++ +WDV++GE
Sbjct  56   RGVAKIISAH--VHPVCSLSWSRNGHKLLSASTDNNVCIWDVLSGE  99



>ref|XP_638014.1| WD-40 repeat-containing protein [Dictyostelium discoideum AX4]
 sp|Q54MH6.1|RBBE_DICDI RecName: Full=Retinoblastoma-binding-like protein E [Dictyostelium 
discoideum]
 gb|EAL64458.1| WD-40 repeat-containing protein [Dictyostelium discoideum AX4]
Length=525

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 66/114 (58%), Gaps = 8/114 (7%)
 Frame = +1

Query  304  MNAPIIDPL-QGDFPEVIEEYL---EHGVMKCIAFNRRGTLLAAGCSD--GSCIIWDFET  465
            MN  +IDP  Q D PE +E YL   ++    C +FNRRGTLLA GC+   G  ++WDF+T
Sbjct  1    MNLCLIDPFKQSDVPETVEYYLVDPKNIKSNCASFNRRGTLLAVGCASPIGKILVWDFDT  60

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQ  627
            + I + L        + S+ WS+ G ++L ++ D SL LWD+   + +  + L+
Sbjct  61   KKIVRTLYHH--TGCVNSISWSRNGKKLLTASNDGSLVLWDLATSKILYSLELE  112



>gb|ETN62412.1| retinoblastoma-binding protein 5 [Anopheles darlingi]
Length=497

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI      AFN+ GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GSLDCISLAVTCAFNKYGTLLAVGCNDGRVVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+CWS+ GH++L ++ D ++ +WDV++G+
Sbjct  56   RGIAKIISAH--VHPVCSLCWSRNGHKLLSASTDNNVCIWDVLSGD  99



>ref|XP_003393845.1| PREDICTED: retinoblastoma-binding protein 5-like [Bombus terrestris]
 ref|XP_003494736.1| PREDICTED: retinoblastoma-binding protein 5-like [Bombus impatiens]
Length=465

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+RGTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GTLDCISLAVTCTFNKRGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RG++K +     V  + S+ WS+ GH++L ++ D ++ +WDV++GE
Sbjct  56   RGVAKIISAH--VHPVCSLSWSRNGHKLLSASTDNNVCIWDVLSGE  99



>ref|XP_394331.2| PREDICTED: retinoblastoma-binding protein 5-like isoformX1 [Apis 
mellifera]
Length=465

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+RGTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GTLDCISLAVTCTFNKRGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RG++K +     V  + S+ WS+ GH++L ++ D ++ +WDV++GE
Sbjct  56   RGVAKIISAH--VHPVCSLSWSRNGHKLLSASTDNNVCIWDVLSGE  99



>ref|XP_003696838.1| PREDICTED: retinoblastoma-binding protein 5 [Apis florea]
 ref|XP_006622475.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Apis 
dorsata]
Length=465

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+RGTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GTLDCISLAVTCTFNKRGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RG++K +     V  + S+ WS+ GH++L ++ D ++ +WDV++GE
Sbjct  56   RGVAKIISAH--VHPVCSLSWSRNGHKLLSASTDNNVCIWDVLSGE  99



>ref|XP_003702347.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Megachile 
rotundata]
Length=465

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+RGTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GTLDCISLAVTCTFNKRGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RG++K +     V  + S+ WS+ GH++L ++ D ++ +WDV++GE
Sbjct  56   RGVAKIISAH--VHPVCSLSWSRNGHKLLSASTDNNVCIWDVLSGE  99



>ref|XP_001656334.1| AAEL003140-PA [Aedes aegypti]
 gb|EAT45597.1| AAEL003140-PA [Aedes aegypti]
Length=491

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI      AFN+ GTLLA GC+DG  +IWDF T
Sbjct  1    MNLQLLESFGQNYPEEFD-----GSLDCISLAVTCAFNKYGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+CWS+ GH++L ++ D ++ +WDV++G+
Sbjct  56   RGIAKIISAH--VHPVCSLCWSRNGHKLLSASTDNNVCIWDVMSGD  99



>ref|XP_011894574.1| PREDICTED: retinoblastoma-binding protein 5 [Cercocebus atys]
Length=122

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  99



>ref|XP_004365292.2| hypothetical protein CAOG_00421 [Capsaspora owczarzaki ATCC 30864]
Length=384

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 64/102 (63%), Gaps = 7/102 (7%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  ++D    D+PEV+E YLE G  +  AFNR GTLLAAGC+DG  ++WDF+T  +++ 
Sbjct  1    MNLELLDSAGQDYPEVVERYLEDGFAQTCAFNRFGTLLAAGCNDGRVVVWDFDTHSVARH  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXI  609
            L     V  ++SV  S++   +L  ++D ++ LW+V   E +
Sbjct  61   LTGH--VHPVSSV--SRF---LLSGSSDTNVILWNVATAERM  95



>gb|ACD81779.1| IP20752p [Drosophila melanogaster]
Length=212

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 64/106 (60%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI      AFN+ GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GSLDCISLAVTCAFNKYGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ W++ GH++L ++ D ++ +WDV+ GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWTRNGHKLLSASTDNNVCIWDVLTGE  99



>gb|EZA47584.1| Retinoblastoma-binding protein [Cerapachys biroi]
Length=748

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+RGTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GTLDCISLAVTCTFNKRGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ WS+ GH++L ++ D ++ +WDV++GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWSRNGHKLLSASTDNNVCIWDVLSGE  99



>ref|XP_002740061.2| PREDICTED: retinoblastoma-binding protein 5-like [Saccoglossus 
kowalevskii]
Length=210

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 63/106 (59%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI      AFN+RGTLLA GC+DG  ++WDF T
Sbjct  1    MNLALLESFGQNYPEESD-----GTLDCISIAITCAFNKRGTLLAVGCNDGRIVLWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ W + GH++L ++ D  + +WDV+ GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWGRTGHKLLSASTDNIVCIWDVLTGE  99



>gb|KFB38609.1| hypothetical protein ZHAS_00005986 [Anopheles sinensis]
Length=1131

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 39/95 (41%), Positives = 61/95 (64%), Gaps = 13/95 (14%)
 Frame = +1

Query  337  DFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFETRGISKELRDKD  498
            ++PE  +     G + CI      AFN+ GTLLA GC+DG  +IWDF TRGI+K +    
Sbjct  633  NYPEEFD-----GSLDCISLAVTCAFNKYGTLLAVGCNDGRVVIWDFLTRGIAKIISAH-  686

Query  499  CVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
             V  + S+CWS+ GH++L ++ D ++ +WDV++G+
Sbjct  687  -VHPVCSLCWSRNGHKLLSASTDNNVCIWDVLSGD  720



>ref|XP_011666860.1| PREDICTED: retinoblastoma-binding protein 5 [Strongylocentrotus 
purpuratus]
Length=506

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 64/106 (60%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    +FPE  +     G + CI      AFN+RGTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNFPEESD-----GTLDCISMALTCAFNKRGTLLAVGCNDGRVVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ WS+ GH++L ++ D  +++WDV  G+
Sbjct  56   RGIAKIISAH--VHPVCSLSWSRNGHKLLSASTDNMVSVWDVSTGD  99



>emb|CCO27321.1| Retinoblastoma-binding protein 5 Short=RBBP-5 [Rhizoctonia solani 
AG-1 IB]
 emb|CEL58100.1| Retinoblastoma-binding protein 5 OS=Homo sapiens GN=RBBP5 PE=1 
SV=2 [Rhizoctonia solani AG-1 IB]
Length=428

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 3/100 (3%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA ++DP   D+PE +E  L+   + C  FNR G  +AAG  DG   IWD ET+G+ + 
Sbjct  1    MNAALLDPFGQDYPESVENTLDEYAV-CARFNRTGRFIAAGRPDGKTSIWDLETKGVIQV  59

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
                  V  ITSV WS+    +L S+ D +  +WD+ NGE
Sbjct  60   FTGH--VKTITSVSWSRNSRYLLTSSKDWNCIIWDMSNGE  97



>gb|KDN43508.1| hypothetical protein RSAG8_06097, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=428

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 3/100 (3%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MNA ++DP   D+PE +E  L+   + C  FNR G  +AAG  DG   IWD ET+G+ + 
Sbjct  1    MNAALLDPFGQDYPESVENTLDEYAV-CARFNRTGRFIAAGRPDGKTSIWDLETKGVIQV  59

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
                  V  ITSV WS+    +L S+ D +  +WD+ NGE
Sbjct  60   FTGH--VKTITSVSWSRNSRYLLTSSKDWNCIIWDMSNGE  97



>ref|XP_009049360.1| hypothetical protein LOTGIDRAFT_177999 [Lottia gigantea]
 gb|ESO99920.1| hypothetical protein LOTGIDRAFT_177999 [Lottia gigantea]
Length=439

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 63/106 (59%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    + PE  +     G + C+      AFNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNHPEEFD-----GTLDCVSIAITCAFNRHGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ WS+ GH++L +A D +++LW V+ G+
Sbjct  56   RGIAKVINAH--VHPVCSISWSRDGHKLLSAATDNTVSLWSVMTGD  99



>ref|XP_001608301.1| PREDICTED: retinoblastoma-binding protein 5 [Nasonia vitripennis]
Length=465

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+RGTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEDND-----GTLDCISLAVTCTFNKRGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ WS+ GH++L ++ D ++ +WDV+ GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWSRNGHKLLSASTDNNVCIWDVLTGE  99



>ref|XP_011300070.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Fopius arisanus]
Length=465

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+RGTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GTLDCISLAVTCTFNKRGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ WS+ GH++L ++ D ++ +W+V++GE
Sbjct  56   RGIAKIIGAH--VHPVCSLSWSRNGHKLLSASTDNNVCIWNVLSGE  99



>ref|XP_001549040.1| hypothetical protein BC1G_12448 [Botrytis cinerea B05.10]
Length=141

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 61/104 (59%), Gaps = 4/104 (4%)
 Frame = +1

Query  304  MNAPIIDP--LQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGIS  477
            MN  + DP  L  D+PE     L  G   C+ FNR+G  LAAG +DG+ +I+D ET GI+
Sbjct  1    MNLSLTDPFVLAQDYPESSTLTLRSGHASCVRFNRKGDFLAAGRTDGTVVIFDVETNGIA  60

Query  478  KELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXI  609
            ++L  K     + S+ WS+ G  +L S+ D +  +WD+++G  +
Sbjct  61   RKL--KGHTRQVQSLSWSRDGRFLLTSSQDWTSIVWDLMDGSIL  102



>gb|EWC43874.1| hypothetical protein DRE_07251 [Drechslerella stenobrocha 248]
Length=466

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 60/101 (59%), Gaps = 4/101 (4%)
 Frame = +1

Query  304  MNAPIIDP--LQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGIS  477
            MN  + DP  L  D+PEV    L +G   C+ FNRRG LLA+G  DG+ +++D ET G++
Sbjct  1    MNLSLADPFSLSQDYPEVFSHSLHYGHSACVVFNRRGDLLASGRHDGTVVLFDVETGGLA  60

Query  478  KELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNG  600
            + LR      ++ SV WS+ G  IL S+ D    LWD+ +G
Sbjct  61   RILRGH--TRSVQSVSWSRDGRYILSSSLDCKCILWDLEDG  99



>ref|NP_001025680.1| retinoblastoma binding protein 5 [Xenopus (Silurana) tropicalis]
 gb|AAH93469.1| retinoblastoma binding protein 5 [Xenopus (Silurana) tropicalis]
Length=501

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++LWDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNMVSLWDVLSGD  99



>ref|XP_009059285.1| hypothetical protein LOTGIDRAFT_145817, partial [Lottia gigantea]
 gb|ESO90027.1| hypothetical protein LOTGIDRAFT_145817, partial [Lottia gigantea]
Length=235

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 54/83 (65%), Gaps = 8/83 (10%)
 Frame = +1

Query  373  GVMKCI------AFNRRGTLLAAGCSDGSCIIWDFETRGISKELRDKDCVAAITSVCWSK  534
            G + C+      AFNR GTLLA GC+DG  +IWDF TRGI+K +     V  + S+ WS+
Sbjct  4    GTLDCVSIAITCAFNRHGTLLAVGCNDGRIVIWDFLTRGIAKVINAH--VHPVCSISWSR  61

Query  535  YGHRILVSAADKSLTLWDVVNGE  603
             GH++L +A D +++LW V+ G+
Sbjct  62   DGHKLLSAATDNTVSLWSVMTGD  84



>ref|XP_969765.1| PREDICTED: retinoblastoma-binding protein 5 [Tribolium castaneum]
 gb|EFA00179.1| hypothetical protein TcasGA2_TC003004 [Tribolium castaneum]
Length=478

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 64/101 (63%), Gaps = 3/101 (3%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEH-GVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISK  480
            MN  +++    ++PE  +  L+   +    AFN+RGTLLA GC+DG  +IWDF TRGI+K
Sbjct  1    MNLELLESFGQNYPEEFDGTLDSLSIAVTCAFNKRGTLLAVGCNDGRIVIWDFLTRGIAK  60

Query  481  ELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
             +     V  + S+ WS+ G++I  ++ D ++ +WD+++GE
Sbjct  61   VISAH--VHPVCSISWSRTGYKIASASTDNTVCIWDILSGE  99



>ref|NP_001086675.1| retinoblastoma binding protein 5 [Xenopus laevis]
 gb|AAH77294.1| Rbbp5-prov protein [Xenopus laevis]
Length=501

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++LWDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNMVSLWDVLSGD  99



>ref|XP_011451298.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Crassostrea 
gigas]
Length=502

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 63/106 (59%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI      AFNR+GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEDFD-----GTLDCISIAITCAFNRQGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ WS+ G ++L +A D + ++WD+V  E
Sbjct  56   RGIAKIISAH--VHPVCSLSWSRNGKKLLSAATDNTASIWDIVTAE  99



>ref|XP_011451297.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X1 
[Crassostrea gigas]
Length=511

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 63/106 (59%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI      AFNR+GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEDFD-----GTLDCISIAITCAFNRQGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ WS+ G ++L +A D + ++WD+V  E
Sbjct  56   RGIAKIISAH--VHPVCSLSWSRNGKKLLSAATDNTASIWDIVTAE  99



>ref|XP_008468897.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Diaphorina 
citri]
Length=466

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI      AFN+RGTLLA GC+DG  ++WDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GALDCISLAVTCAFNKRGTLLAVGCNDGRIVLWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+ WS+ G++I+ ++ D ++ +WDV+ GE
Sbjct  56   RGIAKIISAH--MHPVCSISWSRNGYKIISASTDNNVCIWDVLTGE  99



>ref|XP_004357820.1| WD-40 repeat-containing protein [Dictyostelium fasciculatum]
 gb|EGG19526.1| WD-40 repeat-containing protein [Dictyostelium fasciculatum]
Length=495

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 60/109 (55%), Gaps = 6/109 (6%)
 Frame = +1

Query  304  MNAPIIDPLQ-GDFPEVIEEYLEHGV---MKCIAFNRRGTLLAAGCSDGSCIIWDFETRG  471
            MN    DP + GD PE +E+YL   +     C+ FNRRGTLLA G   G+  IWDF T+ 
Sbjct  1    MNLSFQDPFRIGDIPEGVEDYLMDSLGSKANCLKFNRRGTLLAVGNQSGTISIWDFITKS  60

Query  472  ISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHM  618
            I +         +I S+ W++ G R+L  ++D S+ LWD+ N   I  +
Sbjct  61   IVRLFASHK--QSINSLSWTRDGQRLLSGSSDGSIILWDINNSSIIYKL  107



>ref|XP_007897648.1| PREDICTED: retinoblastoma-binding protein 5 [Callorhinchus milii]
Length=499

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++LWDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSLWDVLSGD  99



>gb|ELU15208.1| hypothetical protein CAPTEDRAFT_167502 [Capitella teleta]
Length=511

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 57/83 (69%), Gaps = 8/83 (10%)
 Frame = +1

Query  373  GVMKCI------AFNRRGTLLAAGCSDGSCIIWDFETRGISKELRDKDCVAAITSVCWSK  534
            G + C+      AFN+RG+LLA GC+DG  +IWDF TRGI+K +     V  + S+ WS+
Sbjct  19   GTLDCVSIAVTCAFNKRGSLLAVGCNDGRIVIWDFLTRGIAKWITAH--VHPVCSLSWSR  76

Query  535  YGHRILVSAADKSLTLWDVVNGE  603
             GH++L ++ D S+++WDV++GE
Sbjct  77   NGHKLLSASTDNSVSIWDVLSGE  99



>ref|XP_010879199.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Esox 
lucius]
Length=513

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++LWDV+ G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSLWDVLTGD  99



>ref|XP_006628496.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Lepisosteus 
oculatus]
Length=513

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++LWDV+ G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSLWDVLTGD  99



>ref|XP_003474722.1| PREDICTED: retinoblastoma-binding protein 5 [Cavia porcellus]
Length=335

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  99



>ref|XP_002040644.1| GM22228 [Drosophila sechellia]
 gb|EDW44197.1| GM22228 [Drosophila sechellia]
Length=466

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 64/106 (60%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI      AFN+ GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GSLDCISLAVTCAFNKYGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ W++ GH++L ++ D ++ +WDV+ GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWTRNGHKLLSASTDNNVCIWDVLTGE  99



>ref|XP_001957252.1| GF24147 [Drosophila ananassae]
 gb|EDV40058.1| GF24147 [Drosophila ananassae]
Length=488

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI      AFN+ GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GSLDCISLAVTCAFNKYGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ W++ GH++L ++ D ++ +WDV++GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWTRNGHKLLSASTDNNVCIWDVLSGE  99



>ref|XP_002061876.1| GK17232 [Drosophila willistoni]
 gb|EDW72862.1| GK17232 [Drosophila willistoni]
Length=488

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 64/106 (60%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI      AFN+ GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GSLDCISLAVTCAFNKYGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ W++ GH++L ++ D ++ +WDV+ GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWTRNGHKLLSASTDNNVCIWDVLTGE  99



>ref|XP_002021047.1| GL25040 [Drosophila persimilis]
 ref|XP_001353320.2| GA18987 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW40203.1| GL25040 [Drosophila persimilis]
 gb|EAL30823.2| GA18987 [Drosophila pseudoobscura pseudoobscura]
Length=488

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 64/106 (60%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI      AFN+ GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GSLDCISLAVTCAFNKYGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ W++ GH++L ++ D ++ +WDV+ GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWTRNGHKLLSASTDNNVCIWDVLTGE  99



>ref|XP_010879198.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Esox 
lucius]
Length=557

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++LWDV+ G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSLWDVLTGD  99



>ref|XP_006628495.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Lepisosteus 
oculatus]
Length=539

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++LWDV+ G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSLWDVLTGD  99



>gb|KJK64842.1| WD40 repeat protein [Aspergillus parasiticus SU-1]
Length=479

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 61/104 (59%), Gaps = 4/104 (4%)
 Frame = +1

Query  304  MNAPIIDP--LQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGIS  477
            MN  ++DP  L  D+P+ + E L  G   C+ FNR+G  LA+G  DG+ +I+D ET G++
Sbjct  1    MNLSLLDPFVLAQDYPDTLTEKLRSGHATCLRFNRKGDYLASGRVDGTVVIFDLETNGVA  60

Query  478  KELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXI  609
            ++LR       I S+ WS+ G  +L S+ D    LWD+ +G  +
Sbjct  61   RKLRGH--TRQIQSLSWSRNGRYLLSSSQDWKCILWDLKDGSRV  102



>ref|XP_001819666.1| WD domain protein [Aspergillus oryzae RIB40]
 ref|XP_002374838.1| WD repeat protein [Aspergillus flavus NRRL3357]
 dbj|BAE57664.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EED56056.1| WD repeat protein [Aspergillus flavus NRRL3357]
 gb|EIT76567.1| WD40 repeat protein [Aspergillus oryzae 3.042]
 gb|KDE80234.1| WD40 repeat protein [Aspergillus oryzae 100-8]
 gb|KJJ35489.1| WD domain G-beta repeat [Aspergillus flavus AF70]
Length=479

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 61/104 (59%), Gaps = 4/104 (4%)
 Frame = +1

Query  304  MNAPIIDP--LQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGIS  477
            MN  ++DP  L  D+P+ + E L  G   C+ FNR+G  LA+G  DG+ +I+D ET G++
Sbjct  1    MNLSLLDPFVLAQDYPDTLTEKLRSGHATCLRFNRKGDYLASGRVDGTVVIFDLETNGVA  60

Query  478  KELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXI  609
            ++LR       I S+ WS+ G  +L S+ D    LWD+ +G  +
Sbjct  61   RKLRGH--TRQIQSLSWSRNGRYLLSSSQDWKCILWDLKDGSRV  102



>ref|NP_649209.1| Rbbp5 [Drosophila melanogaster]
 sp|Q9VPH8.2|RBBP5_DROME RecName: Full=Retinoblastoma-binding protein 5 homolog [Drosophila 
melanogaster]
 gb|AAF51573.2| Rbbp5 [Drosophila melanogaster]
 gb|AAL48742.1| RE17089p [Drosophila melanogaster]
 gb|ACD81773.1| IP20652p [Drosophila melanogaster]
 gb|ACL86588.1| CG5585-PA, partial [synthetic construct]
 gb|ACL92751.1| CG5585-PA [synthetic construct]
Length=489

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 64/106 (60%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI      AFN+ GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GSLDCISLAVTCAFNKYGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ W++ GH++L ++ D ++ +WDV+ GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWTRNGHKLLSASTDNNVCIWDVLTGE  99



>ref|XP_002048140.1| GJ13797 [Drosophila virilis]
 gb|EDW70482.1| GJ13797 [Drosophila virilis]
Length=488

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 64/106 (60%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI      AFN+ GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GSLDCISLAVTCAFNKYGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ W++ GH++L ++ D ++ +WDV+ GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWTRNGHKLLSASTDNNVCIWDVLTGE  99



>ref|XP_002085632.1| GD12200 [Drosophila simulans]
 gb|EDX11217.1| GD12200 [Drosophila simulans]
Length=489

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 64/106 (60%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI      AFN+ GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GSLDCISLAVTCAFNKYGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ W++ GH++L ++ D ++ +WDV+ GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWTRNGHKLLSASTDNNVCIWDVLTGE  99



>ref|XP_002095481.1| GE22415 [Drosophila yakuba]
 gb|EDW95193.1| GE22415 [Drosophila yakuba]
Length=488

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 64/106 (60%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI      AFN+ GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GSLDCISLAVTCAFNKYGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ W++ GH++L ++ D ++ +WDV+ GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWTRNGHKLLSASTDNNVCIWDVLTGE  99



>ref|XP_001973466.1| GG13327 [Drosophila erecta]
 gb|EDV52492.1| GG13327 [Drosophila erecta]
Length=488

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 64/106 (60%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI      AFN+ GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GSLDCISLAVTCAFNKYGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ W++ GH++L ++ D ++ +WDV+ GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWTRNGHKLLSASTDNNVCIWDVLTGE  99



>ref|XP_011553834.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Plutella 
xylostella]
Length=475

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 61/101 (60%), Gaps = 3/101 (3%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEH-GVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISK  480
            MN  +++    ++PE  +  L+   +    AFNRRGTLLA GC+DG   IWDF TRGI+K
Sbjct  1    MNLELLESFGQNYPEEFDGTLDSISLAATCAFNRRGTLLAVGCNDGRIFIWDFLTRGIAK  60

Query  481  ELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
             +     V  + S+ WS+   ++L +A D ++ +WDV+ GE
Sbjct  61   SISAH--VYPVCSLSWSRNCQKLLSAATDHNVCIWDVLTGE  99



>emb|CCJ29677.1| unnamed protein product [Pneumocystis jirovecii]
Length=452

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 57/102 (56%), Gaps = 2/102 (2%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKE  483
            MN  +++P   ++PE +   L +G    I FN++G  LAAG  DG+ IIWD  T G+S+ 
Sbjct  1    MNLELLNPFSQEYPESLTSSLSYGHAMLIRFNKKGDHLAAGLFDGAVIIWDLLTNGVSRV  60

Query  484  LRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXI  609
            L  K     I SVCWS  G  +L +A D    LWD+ +G  I
Sbjct  61   L--KGHTRPIQSVCWSIEGRYLLSAARDWRCVLWDLKDGSRI  100



>gb|KIY92765.1| hypothetical protein MNEG_15199 [Monoraphidium neglectum]
Length=231

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 59/119 (50%), Gaps = 31/119 (26%)
 Frame = +1

Query  337  DFPEVIEEYL-----EHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISKELRDKDC  501
            + PE IE+Y      +HG   C+AFNR GTLLAAG  +G  +IWDFETRG++K L     
Sbjct  16   ELPEAIEDYFDEHQAQHGAACCLAFNRHGTLLAAGTENGRVVIWDFETRGVAKVLGWAGA  75

Query  502  VA--------------------------AITSVCWSKYGHRILVSAADKSLTLWDVVNG  600
             A                           +T+V WS+ G R+L   A+  + LWDVV G
Sbjct  76   AAYEKEHGDADGGAAAGATATAAAASGAGVTAVAWSRSGRRLLAGDAEGKVVLWDVVAG  134



>ref|XP_002008245.1| GI11921 [Drosophila mojavensis]
 gb|EDW18721.1| GI11921 [Drosophila mojavensis]
Length=486

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 64/106 (60%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI------AFNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI      AFN+ GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GSLDCISLAVTCAFNKYGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ W++ GH++L ++ D ++ +WDV+ GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWTRNGHKLLSASTDNNVCIWDVLTGE  99



>dbj|GAD98735.1| WD domain-containing protein [Byssochlamys spectabilis No. 5]
Length=476

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  MNAPIIDP--LQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGIS  477
            MN  +IDP  L  D+P+ + + L  G   CI FNRRG  LA+G  DG+ +I+D ET G++
Sbjct  1    MNLSLIDPFVLAQDYPDSLTDKLRSGHATCIRFNRRGDYLASGRVDGTVVIFDVETNGVA  60

Query  478  KELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQ  627
            ++LR       I S+ WS+ G  +L S+ D    LWD+ +G  +  +  +
Sbjct  61   RKLRGH--TRQIQSLSWSRDGRYLLSSSQDWKCILWDMKDGSRVRTVRFE  108



>ref|XP_002129816.1| PREDICTED: retinoblastoma-binding protein 5-like [Ciona intestinalis]
Length=503

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 60/101 (59%), Gaps = 3/101 (3%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCI-AFNRRGTLLAAGCSDGSCIIWDFETRGISK  480
            MN  +++    ++PE  +  L+ G M     FNR GTLLA GC+DG  ++WDF TRGI+K
Sbjct  1    MNLELLESFGQNYPEEADGTLDTGSMAVTCTFNRHGTLLAVGCNDGRIVVWDFLTRGIAK  60

Query  481  ELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
                      + S+ WS+ G R++ +A D  + +WDV++GE
Sbjct  61   VYNAH--AHPVCSLSWSRNGRRLISAATDNLVCIWDVLSGE  99



>ref|XP_005112725.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Aplysia 
californica]
Length=557

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    +FPE  +     G + C++      FNR+GTLLA GC+DG  ++WDF T
Sbjct  1    MNLELLESFGQNFPEDFD-----GALDCVSIAITCTFNRQGTLLAVGCNDGRIVVWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ +S+ G ++L +A D ++++WDV++GE
Sbjct  56   RGIAKFINAH--VHPVCSLSFSRNGRKLLSAATDNTVSIWDVLSGE  99



>ref|XP_005112727.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X3 [Aplysia 
californica]
Length=534

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    +FPE  +     G + C++      FNR+GTLLA GC+DG  ++WDF T
Sbjct  1    MNLELLESFGQNFPEDFD-----GALDCVSIAITCTFNRQGTLLAVGCNDGRIVVWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ +S+ G ++L +A D ++++WDV++GE
Sbjct  56   RGIAKFINAH--VHPVCSLSFSRNGRKLLSAATDNTVSIWDVLSGE  99



>ref|XP_001264290.1| WD domain protein [Neosartorya fischeri NRRL 181]
 gb|EAW22393.1| WD domain protein [Neosartorya fischeri NRRL 181]
Length=479

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (59%), Gaps = 4/104 (4%)
 Frame = +1

Query  304  MNAPIIDP--LQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGIS  477
            MN  +IDP  L  D+P+ + E L  G   C+ FNR+G  LA+G  DG+ +I+D ET G++
Sbjct  1    MNLSLIDPFVLAQDYPDTLTEKLRSGHATCLRFNRKGDYLASGRVDGTVVIFDIETNGVA  60

Query  478  KELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXI  609
            ++LR       I S+ WS+ G  +L S+ D    LWD+ +G  +
Sbjct  61   RKLRGH--TRQIQSLSWSRDGRYLLSSSQDWKCILWDMKDGSRV  102



>ref|XP_658412.1| hypothetical protein AN0808.2 [Aspergillus nidulans FGSC A4]
 gb|EAA65638.1| hypothetical protein AN0808.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF88743.1| TPA: WD repeat protein (AFU_orthologue; AFUA_1G14670) [Aspergillus 
nidulans FGSC A4]
Length=477

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 64/110 (58%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  MNAPIIDP--LQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGIS  477
            MN  ++DP  L  D+P+ + E L  G   C+ FNR+G  LA+G  DG+ +I+D ET G++
Sbjct  1    MNLSLVDPFVLAQDYPDTLSEKLRSGHATCLRFNRKGDYLASGRVDGTVVIFDVETNGVA  60

Query  478  KELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQ  627
            ++L  K  +  I S+ WS+ G  +L S+ D    LWD+ +G  +  +  +
Sbjct  61   RKL--KGHIRQIQSLSWSRDGRYLLSSSQDWKCILWDLKDGSRVRTVRFE  108



>ref|XP_005112726.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Aplysia 
californica]
Length=551

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    +FPE  +     G + C++      FNR+GTLLA GC+DG  ++WDF T
Sbjct  1    MNLELLESFGQNFPEDFD-----GALDCVSIAITCTFNRQGTLLAVGCNDGRIVVWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ +S+ G ++L +A D ++++WDV++GE
Sbjct  56   RGIAKFINAH--VHPVCSLSFSRNGRKLLSAATDNTVSIWDVLSGE  99



>ref|XP_006529422.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Mus musculus]
Length=391

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  99



>ref|XP_007291406.1| WD domain protein [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD18524.1| WD domain protein [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=484

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 59/104 (57%), Gaps = 4/104 (4%)
 Frame = +1

Query  304  MNAPIIDP--LQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGIS  477
            MN  ++DP  L  D+PE     L  G   C+ FNR+G  LAAG +DG+ +I+D ET G++
Sbjct  1    MNLSLVDPFVLAQDYPESTTRSLRSGHATCVRFNRKGDFLAAGRADGTVVIFDVETNGVA  60

Query  478  KELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXI  609
            ++L  K     + S+ WS+ G  +L S+ D    LWD+  G  +
Sbjct  61   RKL--KGHTRQVQSLSWSRDGRYLLTSSQDWKCNLWDLQEGRIL  102



>ref|XP_001389675.1| WD domain protein [Aspergillus niger CBS 513.88]
 emb|CAK37320.1| unnamed protein product [Aspergillus niger]
 gb|EHA27021.1| hypothetical protein ASPNIDRAFT_35543 [Aspergillus niger ATCC 
1015]
Length=483

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 61/104 (59%), Gaps = 4/104 (4%)
 Frame = +1

Query  304  MNAPIIDP--LQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGIS  477
            MN  ++DP  L  D+P+ + E L  G   C+ FNR+G  LA+G  DG+ +I+D ET G++
Sbjct  1    MNLSLVDPFVLAQDYPDTLTEKLRSGHATCLRFNRKGDYLASGRVDGTVVIFDVETNGVA  60

Query  478  KELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXI  609
            ++LR       I S+ WS+ G  +L S+ D    LWD+ +G  +
Sbjct  61   RKLRGH--TRQIQSLSWSRDGRYLLSSSQDWKCILWDLKDGSRV  102



>dbj|GAA86710.1| WD domain protein [Aspergillus kawachii IFO 4308]
Length=483

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 61/104 (59%), Gaps = 4/104 (4%)
 Frame = +1

Query  304  MNAPIIDP--LQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGIS  477
            MN  ++DP  L  D+P+ + E L  G   C+ FNR+G  LA+G  DG+ +I+D ET G++
Sbjct  1    MNLSLVDPFVLAQDYPDTLTEKLRSGHATCLRFNRKGDYLASGRVDGTVVIFDVETNGVA  60

Query  478  KELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXI  609
            ++LR       I S+ WS+ G  +L S+ D    LWD+ +G  +
Sbjct  61   RKLRGH--TRQIQSLSWSRDGRYLLSSSQDWKCILWDLKDGSRV  102



>dbj|GAM22072.1| hypothetical protein SAMD00019534_052470, partial [Acytostelium 
subglobosum LB1]
Length=403

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 60/113 (53%), Gaps = 8/113 (7%)
 Frame = +1

Query  304  MNAPIIDPLQ-GDFPEVIEEYLEHGV---MKCIAFNRRGTLLAAGCSDGSCIIWDFETRG  471
            MN  + DP + GD PE +E YL         C+ +NRRG LL  G   GS  IWDFET  
Sbjct  6    MNLSLQDPFRSGDVPESVEYYLRDPAGDKANCLQYNRRGLLLCVGNQSGSVTIWDFETMS  65

Query  472  ISKEL-RDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQ  627
            I+++L   K CV    SV W++ G +I+  + D SL LW+VV       M  +
Sbjct  66   IARQLIEHKQCV---NSVGWTRDGKKIISCSNDGSLILWNVVTATMEVKMEFE  115



>ref|XP_001268792.1| WD domain protein [Aspergillus clavatus NRRL 1]
 gb|EAW07366.1| WD domain protein [Aspergillus clavatus NRRL 1]
Length=481

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 61/104 (59%), Gaps = 4/104 (4%)
 Frame = +1

Query  304  MNAPIIDP--LQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGIS  477
            MN  ++DP  L  D+P+ + E L  G   C+ FNR+G  LA+G  DG+ +I+D ET G++
Sbjct  1    MNLSLVDPFVLAQDYPDTLTEKLRSGHATCLRFNRKGDYLASGRVDGTVVIFDIETNGVA  60

Query  478  KELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXI  609
            ++LR       I S+ WS+ G  +L S+ D    LWD+ +G  +
Sbjct  61   RKLRGH--TRQIQSLSWSRDGRYLLSSSQDWKCILWDLKDGSRV  102



>ref|XP_011508136.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Homo 
sapiens]
Length=409

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  99



>ref|XP_003177451.1| Set1 complex component swd1 [Microsporum gypseum CBS 118893]
 gb|EFQ98499.1| Set1 complex component swd1 [Microsporum gypseum CBS 118893]
Length=493

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (59%), Gaps = 4/104 (4%)
 Frame = +1

Query  304  MNAPIIDP--LQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGIS  477
            MN  +IDP  L  D+P+++   L  G   C+ FNR+G  LA+G  DG+ +I+D ET G++
Sbjct  1    MNLALIDPFALAQDYPDILTGTLRSGHAACLRFNRKGDFLASGRVDGTIVIFDVETNGVA  60

Query  478  KELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXI  609
            ++LR       I S+ WS+ G  +L S+ D    LWD+ +G  I
Sbjct  61   RKLRGHS--KQIQSLSWSRDGRYLLSSSQDWKCVLWDLKDGSRI  102



>ref|XP_008266750.1| PREDICTED: retinoblastoma-binding protein 5 isoform X5 [Oryctolagus 
cuniculus]
Length=412

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  99



>ref|XP_004924717.1| PREDICTED: retinoblastoma-binding protein 5-like [Bombyx mori]
Length=476

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 62/101 (61%), Gaps = 3/101 (3%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEH-GVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISK  480
            MN  +++    ++PE  +  L+   +    AFNRRGTLLA GC+DG   IWDF TRGI+K
Sbjct  1    MNLELLESFGQNYPEEFDGTLDSISLASTCAFNRRGTLLAVGCNDGRIFIWDFLTRGIAK  60

Query  481  ELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
             +     V  + S+ WS+   ++L ++ D ++ +WDV++GE
Sbjct  61   SISAH--VYPVCSLSWSRNCKKLLSASTDHNVCIWDVLSGE  99



>ref|XP_003231776.1| WD domain-containing protein [Trichophyton rubrum CBS 118892]
 gb|EGD91174.1| hypothetical protein TERG_07395 [Trichophyton rubrum CBS 118892]
 gb|EZF26981.1| hypothetical protein H100_00972 [Trichophyton rubrum MR850]
 gb|EZF46024.1| hypothetical protein H102_00963 [Trichophyton rubrum CBS 100081]
 gb|EZF56609.1| hypothetical protein H103_00972 [Trichophyton rubrum CBS 288.86]
 gb|EZF67269.1| hypothetical protein H104_00955 [Trichophyton rubrum CBS 289.86]
 gb|EZF77918.1| hypothetical protein H105_00969 [Trichophyton soudanense CBS 
452.61]
 gb|EZF88569.1| hypothetical protein H110_00972 [Trichophyton rubrum MR1448]
 gb|EZF99372.1| hypothetical protein H113_00973 [Trichophyton rubrum MR1459]
 gb|EZG10268.1| hypothetical protein H106_00768 [Trichophyton rubrum CBS 735.88]
 gb|EZG20938.1| hypothetical protein H107_01021 [Trichophyton rubrum CBS 202.88]
 gb|KDB37783.1| hypothetical protein H112_00972 [Trichophyton rubrum D6]
Length=498

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (59%), Gaps = 4/104 (4%)
 Frame = +1

Query  304  MNAPIIDP--LQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGIS  477
            MN  +IDP  L  D+P+++   L  G   C+ FNR+G  LA+G  DG+ +I+D ET G++
Sbjct  1    MNLALIDPFALAQDYPDILTGTLRSGHAACLRFNRKGDFLASGRVDGTIVIFDVETNGVA  60

Query  478  KELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXI  609
            ++LR       I S+ WS+ G  +L S+ D    LWD+ +G  I
Sbjct  61   RKLRGHS--KQIQSLSWSRDGRYLLSSSQDWKCVLWDLKDGSRI  102



>gb|KHJ34404.1| putative wd domain-containing protein [Erysiphe necator]
Length=469

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 59/100 (59%), Gaps = 4/100 (4%)
 Frame = +1

Query  304  MNAPIIDP--LQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGIS  477
            MN  ++DP  L  D+PE +   L  G   C+ FNR+G  LAAG  DG+ +I+D ET G++
Sbjct  1    MNLSLVDPFVLAQDYPESLIGSLRSGHTSCVRFNRKGDYLAAGRVDGTVVIFDVETNGVA  60

Query  478  KELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVN  597
            K+L  K  V  + S+ WS+ G  +L S+ D    +WD+ N
Sbjct  61   KKL--KGHVRQVQSLSWSRNGRYLLTSSQDWKCNIWDLQN  98



>ref|XP_001507579.2| PREDICTED: retinoblastoma-binding protein 5 [Ornithorhynchus 
anatinus]
Length=534

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 64/103 (62%), Gaps = 13/103 (13%)
 Frame = +1

Query  313  PIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFETRGI  474
            P+I+    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF TRGI
Sbjct  42   PLIESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGI  96

Query  475  SKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            +K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  97   AKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  137



>gb|EGD96854.1| WD repeat protein [Trichophyton tonsurans CBS 112818]
 gb|EGE04458.1| Set1 complex component swd1 [Trichophyton equinum CBS 127.97]
 gb|EZF30000.1| hypothetical protein H101_06350 [Trichophyton interdigitale H6]
 gb|KDB27595.1| hypothetical protein H109_00612 [Trichophyton interdigitale MR816]
Length=498

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (59%), Gaps = 4/104 (4%)
 Frame = +1

Query  304  MNAPIIDP--LQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGIS  477
            MN  +IDP  L  D+P+++   L  G   C+ FNR+G  LA+G  DG+ +I+D ET G++
Sbjct  1    MNLALIDPFALAQDYPDILTGTLRSGHAACLRFNRKGDFLASGRVDGTIVIFDVETNGVA  60

Query  478  KELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXI  609
            ++LR       I S+ WS+ G  +L S+ D    LWD+ +G  I
Sbjct  61   RKLRGHS--KQIQSLSWSRDGRYLLSSSQDWKCVLWDLKDGSRI  102



>ref|XP_007422782.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Python 
bivittatus]
Length=500

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 64/106 (60%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV+ G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNMVSQWDVLTGD  99



>gb|EHJ69754.1| hypothetical protein KGM_18987 [Danaus plexippus]
Length=476

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 62/101 (61%), Gaps = 3/101 (3%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEH-GVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGISK  480
            MN  +++    ++PE  +  L+   +    AFNRRGTLLA GC+DG   IWDF TRGI+K
Sbjct  1    MNLELLESFGQNYPEEFDGTLDSISLAATCAFNRRGTLLAVGCNDGRIFIWDFLTRGIAK  60

Query  481  ELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
             +     V  + S+ WS+   ++L ++ D ++ +WDV++GE
Sbjct  61   SISAH--VYPVCSLSWSRNCKKLLSASTDHNVCIWDVLSGE  99



>gb|ESZ98956.1| hypothetical protein SBOR_0614 [Sclerotinia borealis F-4157]
Length=466

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 63/110 (57%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  MNAPIIDP--LQGDFPEVIEEYLEHGVMKCIAFNRRGTLLAAGCSDGSCIIWDFETRGIS  477
            MN  + DP  L  D+PE     L  G   C+ FNR+G  LA G +DG+ +I+D ET GI+
Sbjct  1    MNLSLTDPFVLAQDYPESSTHTLRSGHASCVRFNRKGDFLAVGRTDGTVVIFDVETNGIA  60

Query  478  KELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGEXITHMTLQ  627
            ++L  K     + S+ WS+ G  +L S+ D + ++WD+++G  +  +  +
Sbjct  61   RKL--KGHTRQVQSLSWSRDGRFLLTSSQDWTCSIWDLMDGSIVKSVRFE  108



>gb|KDR15310.1| Retinoblastoma-binding protein 5 [Zootermopsis nevadensis]
Length=506

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 56/83 (67%), Gaps = 8/83 (10%)
 Frame = +1

Query  373  GVMKCI------AFNRRGTLLAAGCSDGSCIIWDFETRGISKELRDKDCVAAITSVCWSK  534
            G + CI      AFN+RGTLLA GC+DG  +IWDF TRGI+K +     V  + S+ WS+
Sbjct  27   GALDCISLAVTCAFNKRGTLLAVGCNDGRIVIWDFLTRGIAKIISAH--VHPVCSLSWSR  84

Query  535  YGHRILVSAADKSLTLWDVVNGE  603
             GH+++ ++ D ++ +WD+++GE
Sbjct  85   NGHKLVSASTDNNVCIWDILSGE  107



>ref|XP_005306474.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Chrysemys 
picta bellii]
Length=500

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  99



>dbj|BAF82826.1| unnamed protein product [Homo sapiens]
Length=500

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  99



>ref|XP_008170919.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Chrysemys 
picta bellii]
Length=499

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  99



>ref|XP_004578775.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Ochotona 
princeps]
Length=500

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  99



>ref|XP_004282501.1| PREDICTED: retinoblastoma-binding protein 5 isoform 2 [Orcinus 
orca]
 ref|XP_006922925.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Pteropus 
alecto]
 ref|XP_007130874.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Physeter 
catodon]
 ref|XP_007182853.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007470740.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Lipotes 
vexillifer]
 ref|XP_007951679.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Orycteropus 
afer afer]
Length=500

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  99



>ref|NP_001180201.1| retinoblastoma-binding protein 5 isoform 2 [Homo sapiens]
 ref|XP_002760752.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Callithrix 
jacchus]
 ref|XP_003273213.1| PREDICTED: retinoblastoma-binding protein 5 isoform 2 [Nomascus 
leucogenys]
 ref|XP_003482704.1| PREDICTED: retinoblastoma-binding protein 5 isoformX3 [Sus scrofa]
 ref|XP_003823006.1| PREDICTED: retinoblastoma-binding protein 5 isoform X5 [Pan paniscus]
 ref|XP_003893284.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Papio 
anubis]
 ref|XP_003999457.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Felis 
catus]
 ref|XP_004375292.1| PREDICTED: retinoblastoma-binding protein 5 isoform 2 [Trichechus 
manatus latirostris]
 ref|XP_004641171.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Octodon 
degus]
 ref|XP_004756480.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Mustela 
putorius furo]
 ref|XP_004788404.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Mustela 
putorius furo]
 ref|XP_004885472.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Heterocephalus 
glaber]
 ref|XP_004862179.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Heterocephalus 
glaber]
 ref|XP_005216723.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Bos taurus]
 ref|XP_005375403.1| PREDICTED: retinoblastoma-binding protein 5 isoform X5 [Chinchilla 
lanigera]
 ref|XP_005540632.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Macaca 
fascicularis]
 ref|XP_005690452.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Capra 
hircus]
 ref|XP_005962699.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Pantholops 
hodgsonii]
 ref|XP_006182351.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Camelus 
ferus]
 ref|XP_006215550.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Vicugna 
pacos]
 ref|XP_006159303.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Tupaia 
chinensis]
 ref|XP_007086600.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Panthera 
tigris altaica]
 ref|XP_006062334.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Bubalus 
bubalis]
 ref|XP_007986954.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Chlorocebus 
sabaeus]
 ref|XP_008072867.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Tarsius 
syrichta]
 ref|XP_008266748.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Oryctolagus 
cuniculus]
 ref|XP_008697749.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Ursus 
maritimus]
 ref|XP_009237064.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Pongo 
abelii]
 ref|XP_010611350.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Fukomys 
damarensis]
 ref|XP_010588554.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Loxodonta 
africana]
 ref|XP_010852468.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Bison 
bison bison]
 ref|XP_010967613.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Camelus 
bactrianus]
 ref|XP_010989677.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Camelus 
dromedarius]
 ref|XP_011371306.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Pteropus 
vampyrus]
 ref|XP_011845816.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Mandrillus 
leucophaeus]
 ref|XP_011813145.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Colobus 
angolensis palliatus]
 ref|XP_011745109.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Macaca 
nemestrina]
 ref|XP_011991076.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Ovis 
aries musimon]
 gb|AAH37284.1| RBBP5 protein [Homo sapiens]
 gb|EAW91538.1| retinoblastoma binding protein 5, isoform CRA_c [Homo sapiens]
 gb|ABM82131.1| retinoblastoma binding protein 5 [synthetic construct]
 gb|ABM85314.1| retinoblastoma binding protein 5 [synthetic construct]
Length=500

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  99



>ref|XP_008974819.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Pan paniscus]
Length=517

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  99



>ref|XP_005188206.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Musca domestica]
 ref|XP_011294439.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Musca domestica]
 ref|XP_011294440.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Musca domestica]
Length=489

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FN+ GTLLA GC+DG  ++WDF T
Sbjct  1    MNLELLESFGQNYPEEFD-----GSLDCISLAVTCVFNKYGTLLAVGCNDGRIVVWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     V  + S+ W++ GH++L ++ D ++ +WDV++GE
Sbjct  56   RGIAKIISAH--VHPVCSLSWTRNGHKLLSASTDNNVCIWDVLSGE  99



>ref|XP_003340213.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Monodelphis 
domestica]
Length=500

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  99



>ref|XP_009069092.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Acanthisitta 
chloris]
Length=500

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  99



>ref|XP_005329570.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Ictidomys 
tridecemlineatus]
Length=500

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  99



>ref|XP_004885473.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Heterocephalus 
glaber]
 ref|XP_004862180.1| PREDICTED: retinoblastoma-binding protein 5 isoform X5 [Heterocephalus 
glaber]
 ref|XP_010611351.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Fukomys 
damarensis]
Length=499

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  99



>ref|XP_003767661.1| PREDICTED: retinoblastoma-binding protein 5 isoform 2 [Sarcophilus 
harrisii]
Length=500

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  99



>ref|XP_011471087.1| PREDICTED: retinoblastoma-binding protein 5 [Oryzias latipes]
Length=501

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 64/106 (60%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV+ G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLTGD  99



>ref|XP_007481313.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Monodelphis 
domestica]
Length=499

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  99



>ref|XP_010577808.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Haliaeetus 
leucocephalus]
Length=500

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  99



>ref|XP_004663610.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Jaculus 
jaculus]
Length=500

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  304  MNAPIIDPLQGDFPEVIEEYLEHGVMKCIA------FNRRGTLLAAGCSDGSCIIWDFET  465
            MN  +++    ++PE  +     G + CI+      FNR GTLLA GC+DG  +IWDF T
Sbjct  1    MNLELLESFGQNYPEEAD-----GTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLT  55

Query  466  RGISKELRDKDCVAAITSVCWSKYGHRILVSAADKSLTLWDVVNGE  603
            RGI+K +     +  + S+CWS+ GH+++ ++ D  ++ WDV++G+
Sbjct  56   RGIAKIISAH--IHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGD  99



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 941888806496