BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10230

Length=646
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007034956.1|  Indole-3-acetic acid 7 isoform 1                   220   8e-68   
gb|AFK42031.1|  unknown                                                 218   2e-67   Medicago truncatula
gb|KEH42779.1|  auxin-responsive AUX/IAA family protein                 217   2e-67   Medicago truncatula
ref|XP_003591806.1|  Indoleacetic acid-induced-like protein             217   8e-67   Medicago truncatula
emb|CDO99148.1|  unnamed protein product                                217   1e-66   Coffea canephora [robusta coffee]
ref|XP_011030585.1|  PREDICTED: auxin-responsive protein IAA14-li...    217   1e-66   Populus euphratica
ref|XP_011030586.1|  PREDICTED: auxin-responsive protein IAA14-li...    217   1e-66   Populus euphratica
gb|KEH42778.1|  auxin-responsive AUX/IAA family protein                 216   2e-66   Medicago truncatula
ref|XP_012069759.1|  PREDICTED: auxin-responsive protein IAA14-like     216   3e-66   Jatropha curcas
gb|KJB38279.1|  hypothetical protein B456_006G246000                    215   3e-66   Gossypium raimondii
gb|AEE25653.1|  auxin-responsive protein                                215   5e-66   Gossypium hirsutum [American cotton]
gb|KJB38280.1|  hypothetical protein B456_006G246000                    215   9e-66   Gossypium raimondii
gb|KJB38278.1|  hypothetical protein B456_006G246000                    216   2e-65   Gossypium raimondii
gb|AFK37379.1|  unknown                                                 213   2e-65   Medicago truncatula
gb|KHF98789.1|  Auxin-responsive IAA14 -like protein                    214   2e-65   Gossypium arboreum [tree cotton]
ref|XP_009611797.1|  PREDICTED: auxin-responsive protein IAA14          213   5e-65   Nicotiana tomentosiformis
ref|XP_011027545.1|  PREDICTED: auxin-responsive protein IAA14 is...    212   1e-64   Populus euphratica
ref|XP_011027555.1|  PREDICTED: auxin-responsive protein IAA14 is...    211   2e-64   Populus euphratica
gb|KHG01271.1|  Auxin-responsive IAA14 -like protein                    211   2e-64   Gossypium arboreum [tree cotton]
ref|XP_002311658.1|  aux/IAA family protein                             211   2e-64   Populus trichocarpa [western balsam poplar]
gb|AFZ78617.1|  hypothetical protein                                    210   7e-64   Populus tomentosa [Chinese white poplar]
gb|KJB28413.1|  hypothetical protein B456_005G046500                    209   2e-63   Gossypium raimondii
ref|XP_004495392.1|  PREDICTED: auxin-responsive protein IAA14-li...    208   2e-63   Cicer arietinum [garbanzo]
ref|XP_004495391.1|  PREDICTED: auxin-responsive protein IAA14-li...    208   2e-63   
gb|KFK24541.1|  hypothetical protein AALP_AAs58011U000100               208   2e-63   Arabis alpina [alpine rockcress]
ref|XP_008362015.1|  PREDICTED: auxin-responsive protein IAA14-like     207   9e-63   
ref|XP_009777122.1|  PREDICTED: auxin-responsive protein IAA14-like     206   1e-62   Nicotiana sylvestris
gb|ADB93628.1|  indole-3-acetic acid inducible 14                       205   1e-62   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93627.2|  indole-3-acetic acid inducible 14                       205   1e-62   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93629.2|  indole-3-acetic acid inducible 14                       205   1e-62   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93625.2|  indole-3-acetic acid inducible 14                       205   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002284133.1|  PREDICTED: auxin-responsive protein IAA14          206   2e-62   Vitis vinifera
gb|AFK44393.1|  unknown                                                 206   2e-62   Lotus japonicus
ref|XP_009591035.1|  PREDICTED: auxin-responsive protein IAA7-like      205   3e-62   Nicotiana tomentosiformis
gb|ADL70641.1|  indole-3-acetic acid inducible 14                       204   4e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007143877.1|  hypothetical protein PHAVU_007G109500g             205   4e-62   Phaseolus vulgaris [French bean]
ref|NP_193191.2|  auxin-responsive protein IAA14                        204   5e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008465181.1|  PREDICTED: auxin-responsive protein IAA14-like     205   5e-62   Cucumis melo [Oriental melon]
ref|NP_001240213.1|  auxin-induced protein ali50                        204   6e-62   Glycine max [soybeans]
emb|CAB46059.1|  IAA7 like protein                                      204   7e-62   Arabidopsis thaliana [mouse-ear cress]
emb|CBI26357.3|  unnamed protein product                                204   7e-62   Vitis vinifera
ref|XP_008224185.1|  PREDICTED: auxin-responsive protein IAA14          204   9e-62   Prunus mume [ume]
ref|XP_007223810.1|  hypothetical protein PRUPE_ppa010698mg             204   1e-61   
ref|XP_009337294.1|  PREDICTED: auxin-responsive protein IAA14-like     203   3e-61   
ref|XP_011091113.1|  PREDICTED: auxin-responsive protein IAA14          202   5e-61   Sesamum indicum [beniseed]
ref|XP_010551700.1|  PREDICTED: auxin-responsive protein IAA14          202   6e-61   Tarenaya hassleriana [spider flower]
ref|NP_001280875.1|  auxin-responsive protein IAA14-like                202   9e-61   Malus domestica [apple tree]
ref|XP_006298251.1|  hypothetical protein CARUB_v10014321mg             202   1e-60   
ref|XP_002315736.1|  aux/IAA family protein                             202   1e-60   Populus trichocarpa [western balsam poplar]
ref|XP_002868277.1|  hypothetical protein ARALYDRAFT_493451             201   1e-60   
ref|XP_010435110.1|  PREDICTED: auxin-responsive protein IAA14          200   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010552451.1|  PREDICTED: auxin-responsive protein IAA14-like     201   2e-60   Tarenaya hassleriana [spider flower]
gb|KHN30563.1|  Auxin-responsive protein IAA14                          199   5e-60   Glycine soja [wild soybean]
ref|XP_010087762.1|  Auxin-responsive protein IAA7                      202   5e-60   
ref|XP_006414696.1|  hypothetical protein EUTSA_v10026031mg             200   7e-60   
ref|XP_004288427.1|  PREDICTED: auxin-responsive protein IAA14-like     199   7e-60   Fragaria vesca subsp. vesca
dbj|BAH15071.1|  indole-3-acetic acid 14 transcription factor like      199   9e-60   Malus prunifolia
gb|KHN05057.1|  Auxin-responsive protein IAA14                          199   1e-59   Glycine soja [wild soybean]
gb|KFK39592.1|  hypothetical protein AALP_AA3G264300                    199   1e-59   Arabis alpina [alpine rockcress]
ref|XP_007034957.1|  Indole-3-acetic acid inducible 14 isoform 2        197   2e-59   
gb|ADL70640.1|  indole-3-acetic acid inducible 14                       196   2e-59   Arabidopsis thaliana [mouse-ear cress]
gb|AFS44507.1|  auxin repressor                                         197   3e-59   Fragaria x ananassa
ref|XP_010440448.1|  PREDICTED: auxin-responsive protein IAA14-like     197   5e-59   Camelina sativa [gold-of-pleasure]
ref|XP_003556389.2|  PREDICTED: auxin-responsive protein IAA14-like     200   6e-59   
emb|CAC84710.1|  aux/IAA protein                                        197   1e-58   Populus tremula x Populus tremuloides
gb|ADL70642.1|  indole-3-acetic acid inducible 14                       194   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006362195.1|  PREDICTED: auxin-responsive protein IAA14-like     196   2e-58   Solanum tuberosum [potatoes]
ref|XP_006284476.1|  hypothetical protein CARUB_v10005662mg             195   2e-58   Capsella rubella
ref|XP_011032399.1|  PREDICTED: auxin-responsive protein IAA16-like     195   3e-58   Populus euphratica
ref|XP_010450026.1|  PREDICTED: auxin-responsive protein IAA14-like     194   7e-58   Camelina sativa [gold-of-pleasure]
ref|NP_974355.1|  auxin-responsive protein IAA7                         193   8e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009776553.1|  PREDICTED: auxin-responsive protein IAA14-like     194   9e-58   Nicotiana sylvestris
gb|ADL70639.1|  indole-3-acetic acid inducible 14                       192   9e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011038568.1|  PREDICTED: auxin-responsive protein IAA16-like     194   1e-57   Populus euphratica
ref|XP_009135842.1|  PREDICTED: auxin-responsive protein IAA7-like      194   1e-57   Brassica rapa
gb|EYU32514.1|  hypothetical protein MIMGU_mgv1a012542mg                194   1e-57   Erythranthe guttata [common monkey flower]
emb|CDY62130.1|  BnaC08g47390D                                          193   2e-57   Brassica napus [oilseed rape]
emb|CDY47148.1|  BnaA08g05350D                                          192   2e-57   Brassica napus [oilseed rape]
gb|AAM65301.1|  indoleacetic acid (IAA)-inducible gene (IAA7)           192   3e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188945.1|  auxin-responsive protein IAA7                         192   3e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107777.1|  PREDICTED: auxin-responsive protein IAA14          192   4e-57   Brassica rapa
ref|XP_010512022.1|  PREDICTED: auxin-responsive protein IAA7           192   7e-57   Camelina sativa [gold-of-pleasure]
ref|XP_002319075.1|  hypothetical protein POPTR_0013s03870g             191   9e-57   Populus trichocarpa [western balsam poplar]
gb|AAM21317.1|AF373100_1  auxin-regulated protein                       191   1e-56   Populus tremula x Populus tremuloides
ref|XP_006304183.1|  hypothetical protein CARUB_v10010236mg             190   1e-56   Capsella rubella
ref|XP_010488346.1|  PREDICTED: auxin-responsive protein IAA7-like      191   1e-56   Camelina sativa [gold-of-pleasure]
gb|KJB82525.1|  hypothetical protein B456_013G200700                    190   3e-56   Gossypium raimondii
ref|XP_010466604.1|  PREDICTED: auxin-responsive protein IAA7-like      189   5e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010457463.1|  PREDICTED: auxin-responsive protein IAA17          189   5e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010483317.1|  PREDICTED: auxin-responsive protein IAA17-like     189   5e-56   Camelina sativa [gold-of-pleasure]
gb|KHG19190.1|  Auxin-responsive IAA16 -like protein                    189   6e-56   Gossypium arboreum [tree cotton]
ref|XP_006406100.1|  hypothetical protein EUTSA_v10021428mg             189   6e-56   Eutrema salsugineum [saltwater cress]
gb|ADJ68049.1|  auxin responsive protein                                189   9e-56   Catharanthus roseus [chatas]
gb|AEE25654.1|  auxin-responsive protein                                189   1e-55   Gossypium hirsutum [American cotton]
ref|XP_006382798.1|  hypothetical protein POPTR_0005s05560g             189   1e-55   Populus trichocarpa [western balsam poplar]
ref|XP_004302055.1|  PREDICTED: auxin-responsive protein IAA16          188   2e-55   Fragaria vesca subsp. vesca
ref|XP_010475075.1|  PREDICTED: auxin-responsive protein IAA17-like     187   3e-55   Camelina sativa [gold-of-pleasure]
ref|NP_171921.1|  auxin-responsive protein IAA17                        187   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889499.1|  hypothetical protein ARALYDRAFT_470401             187   3e-55   
ref|XP_002883395.1|  hypothetical protein ARALYDRAFT_319024             187   3e-55   Arabidopsis lyrata subsp. lyrata
ref|NP_001288823.1|  auxin-responsive protein IAA7                      187   3e-55   Brassica rapa
gb|ABH01143.1|  auxin-regulated protein                                 187   4e-55   Populus tomentosa [Chinese white poplar]
ref|XP_004134096.1|  PREDICTED: auxin-responsive protein IAA14          187   4e-55   Cucumis sativus [cucumbers]
gb|EYU33008.1|  hypothetical protein MIMGU_mgv1a012321mg                187   5e-55   Erythranthe guttata [common monkey flower]
ref|XP_011649168.1|  PREDICTED: auxin-responsive protein IAA14          187   5e-55   Cucumis sativus [cucumbers]
ref|NP_001275031.1|  auxin-responsive protein IAA14-like                186   7e-55   Solanum tuberosum [potatoes]
ref|XP_008438588.1|  PREDICTED: auxin-responsive protein IAA14-like     186   9e-55   Cucumis melo [Oriental melon]
gb|AAM64837.1|  putative auxin-induced protein, IAA17/AXR3-1            185   2e-54   Arabidopsis thaliana [mouse-ear cress]
emb|CDY63910.1|  BnaC01g43640D                                          185   2e-54   Brassica napus [oilseed rape]
ref|XP_010024036.1|  PREDICTED: auxin-responsive protein IAA14-like     185   3e-54   Eucalyptus grandis [rose gum]
ref|NP_001266070.1|  IAA14                                              185   3e-54   Solanum lycopersicum
ref|XP_009111119.1|  PREDICTED: auxin-responsive protein IAA17          184   3e-54   Brassica rapa
emb|CDY63072.1|  BnaCnng41350D                                          189   3e-54   Brassica napus [oilseed rape]
emb|CDY15493.1|  BnaA08g27770D                                          184   3e-54   Brassica napus [oilseed rape]
ref|XP_011073485.1|  PREDICTED: auxin-responsive protein IAA14          185   3e-54   Sesamum indicum [beniseed]
ref|XP_006418149.1|  hypothetical protein EUTSA_v10008679mg             184   3e-54   Eutrema salsugineum [saltwater cress]
ref|XP_010556884.1|  PREDICTED: auxin-responsive protein IAA17          184   4e-54   Tarenaya hassleriana [spider flower]
emb|CDY10349.1|  BnaC05g29300D                                          184   6e-54   Brassica napus [oilseed rape]
gb|AAC39440.1|  IAA17/AXR3-1 protein                                    182   2e-53   Arabidopsis thaliana [mouse-ear cress]
gb|KDO53919.1|  hypothetical protein CISIN_1g026811mg                   181   3e-53   Citrus sinensis [apfelsine]
gb|EPS64756.1|  hypothetical protein M569_10024                         181   3e-53   Genlisea aurea
ref|XP_009119323.1|  PREDICTED: auxin-responsive protein IAA17-like     182   4e-53   Brassica rapa
emb|CDX89832.1|  BnaA10g02500D                                          181   5e-53   
ref|XP_006420094.1|  hypothetical protein CICLE_v10005789mg             181   9e-53   Citrus clementina [clementine]
ref|XP_010278165.1|  PREDICTED: auxin-responsive protein IAA16-like     181   1e-52   Nelumbo nucifera [Indian lotus]
ref|XP_006418150.1|  hypothetical protein EUTSA_v10008679mg             181   1e-52   Eutrema salsugineum [saltwater cress]
gb|EYU46510.1|  hypothetical protein MIMGU_mgv1a013084mg                181   1e-52   Erythranthe guttata [common monkey flower]
ref|XP_007030567.1|  Indoleacetic acid-induced protein 16               181   2e-52   
ref|XP_006443921.1|  hypothetical protein CICLE_v10022032mg             180   2e-52   Citrus clementina [clementine]
ref|XP_004495802.1|  PREDICTED: auxin-responsive protein IAA16-like     180   2e-52   Cicer arietinum [garbanzo]
ref|NP_001288939.1|  auxin-responsive protein IAA16                     180   2e-52   Brassica rapa
ref|XP_010274203.1|  PREDICTED: auxin-responsive protein IAA16-like     179   5e-52   Nelumbo nucifera [Indian lotus]
emb|CDY32537.1|  BnaA09g50590D                                          179   6e-52   Brassica napus [oilseed rape]
ref|XP_009118658.1|  PREDICTED: auxin-responsive protein IAA17-like     179   6e-52   Brassica rapa
emb|CDY18214.1|  BnaC05g02370D                                          178   9e-52   Brassica napus [oilseed rape]
emb|CDY50750.1|  BnaAnng10570D                                          180   1e-51   Brassica napus [oilseed rape]
ref|XP_006408158.1|  hypothetical protein EUTSA_v10021441mg             177   1e-51   
ref|XP_006408159.1|  hypothetical protein EUTSA_v10021441mg             177   2e-51   Eutrema salsugineum [saltwater cress]
ref|XP_002281771.1|  PREDICTED: auxin-responsive protein IAA16-like     177   2e-51   Vitis vinifera
ref|NP_001280973.1|  auxin-responsive protein IAA16                     178   2e-51   Malus domestica [apple tree]
emb|CAN63268.1|  hypothetical protein VITISV_013635                     177   2e-51   Vitis vinifera
dbj|BAJ34138.1|  unnamed protein product                                177   2e-51   Eutrema halophilum
ref|XP_009413916.1|  PREDICTED: auxin-responsive protein IAA30-like     177   3e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009610435.1|  PREDICTED: auxin-responsive protein IAA16          177   3e-51   Nicotiana tomentosiformis
ref|XP_002531288.1|  Auxin-responsive protein IAA16, putative           177   4e-51   Ricinus communis
emb|CDY10068.1|  BnaC08g43830D                                          176   6e-51   Brassica napus [oilseed rape]
gb|KDO68557.1|  hypothetical protein CISIN_1g026823mg                   176   9e-51   Citrus sinensis [apfelsine]
gb|KFK37887.1|  hypothetical protein AALP_AA3G042100                    175   1e-50   Arabis alpina [alpine rockcress]
ref|XP_010532600.1|  PREDICTED: auxin-responsive protein IAA14          175   1e-50   Tarenaya hassleriana [spider flower]
ref|XP_007050422.1|  Indole-3-acetic acid inducible 14 isoform 2        175   3e-50   
ref|XP_012089266.1|  PREDICTED: auxin-responsive protein IAA16          175   3e-50   Jatropha curcas
ref|XP_011079949.1|  PREDICTED: auxin-induced protein AUX28-like        174   5e-50   Sesamum indicum [beniseed]
gb|AFK44192.1|  unknown                                                 174   5e-50   Medicago truncatula
ref|NP_001268036.1|  uncharacterized protein LOC100250231               174   6e-50   Vitis vinifera
ref|XP_010418365.1|  PREDICTED: auxin-responsive protein IAA16          174   6e-50   Camelina sativa [gold-of-pleasure]
ref|XP_007050421.1|  Indole-3-acetic acid inducible 14 isoform 1        175   9e-50   
ref|XP_009761467.1|  PREDICTED: auxin-responsive protein IAA16          173   1e-49   Nicotiana sylvestris
ref|XP_010485858.1|  PREDICTED: auxin-responsive protein IAA16-like     173   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_002306817.1|  hypothetical protein POPTR_0005s23980g             172   1e-49   
ref|XP_006383686.1|  auxin-induced protein aux28                        172   2e-49   Populus trichocarpa [western balsam poplar]
emb|CDY41894.1|  BnaC05g47100D                                          172   2e-49   Brassica napus [oilseed rape]
gb|AEE25650.1|  auxin-responsive protein                                173   2e-49   Gossypium hirsutum [American cotton]
ref|NP_187124.1|  auxin-responsive protein IAA16                        172   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008218270.1|  PREDICTED: auxin-responsive protein IAA16          172   3e-49   Prunus mume [ume]
ref|NP_001275398.1|  auxin/indole-3-acetic acid 3                       172   3e-49   Solanum tuberosum [potatoes]
gb|KJB11141.1|  hypothetical protein B456_001G242900                    172   6e-49   Gossypium raimondii
ref|XP_010522504.1|  PREDICTED: auxin-responsive protein IAA17-like     171   6e-49   Tarenaya hassleriana [spider flower]
gb|KJB11142.1|  hypothetical protein B456_001G242900                    171   6e-49   Gossypium raimondii
gb|KJB44872.1|  hypothetical protein B456_007G276900                    170   7e-49   Gossypium raimondii
gb|KJB11145.1|  hypothetical protein B456_001G242900                    172   7e-49   Gossypium raimondii
emb|CAN72026.1|  hypothetical protein VITISV_014421                     172   8e-49   Vitis vinifera
ref|XP_011042427.1|  PREDICTED: auxin-induced protein AUX28-like        171   8e-49   Populus euphratica
ref|XP_011082603.1|  PREDICTED: auxin-responsive protein IAA14-like     170   9e-49   Sesamum indicum [beniseed]
ref|XP_009364490.1|  PREDICTED: auxin-responsive protein IAA16          171   9e-49   Pyrus x bretschneideri [bai li]
ref|XP_002517023.1|  Auxin-responsive protein IAA7, putative            169   9e-49   
ref|XP_007205640.1|  hypothetical protein PRUPE_ppa009254mg             172   2e-48   
gb|KJB11146.1|  hypothetical protein B456_001G242900                    171   2e-48   Gossypium raimondii
gb|AAD32146.1|AF123508_1  Nt-iaa28 deduced protein                      170   2e-48   Nicotiana tabacum [American tobacco]
ref|NP_001266049.1|  IAA9 protein                                       170   2e-48   Solanum lycopersicum
gb|KJB44873.1|  hypothetical protein B456_007G276900                    170   3e-48   Gossypium raimondii
ref|XP_010463960.1|  PREDICTED: auxin-responsive protein IAA16-like     169   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_002302075.1|  auxin-induced protein aux28                        169   3e-48   Populus trichocarpa [western balsam poplar]
gb|KEH43016.1|  auxin-responsive AUX/IAA family protein                 169   6e-48   Medicago truncatula
ref|XP_009124981.1|  PREDICTED: auxin-responsive protein IAA16-like     168   7e-48   Brassica rapa
gb|KHG04941.1|  Auxin-induced AUX28                                     168   7e-48   Gossypium arboreum [tree cotton]
ref|XP_002884465.1|  indoleacetic acid-induced protein 16               168   8e-48   
gb|KEH43017.1|  auxin-responsive AUX/IAA family protein                 169   8e-48   Medicago truncatula
gb|KJB42200.1|  hypothetical protein B456_007G141900                    168   9e-48   Gossypium raimondii
ref|XP_010917602.1|  PREDICTED: auxin-responsive protein IAA30 is...    168   9e-48   Elaeis guineensis
ref|XP_006298436.1|  hypothetical protein CARUB_v10014507mg             168   9e-48   Capsella rubella
ref|XP_010917600.1|  PREDICTED: auxin-responsive protein IAA30 is...    168   2e-47   
emb|CAC84711.1|  aux/IAA protein                                        166   3e-47   Populus tremula x Populus tremuloides
ref|XP_010102292.1|  Auxin-responsive protein IAA16                     166   6e-47   Morus notabilis
ref|XP_006443920.1|  hypothetical protein CICLE_v10022032mg             166   7e-47   
dbj|BAI94494.1|  Aux/IAA protein                                        166   8e-47   Dianthus caryophyllus [carnation]
ref|XP_006471686.1|  PREDICTED: auxin-responsive protein IAA16-li...    165   8e-47   
ref|XP_006432921.1|  hypothetical protein CICLE_v10002290mg             165   9e-47   
gb|ACJ83896.1|  unknown                                                 166   9e-47   Medicago truncatula
gb|AAC49055.1|  IAA14                                                   163   9e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010936171.1|  PREDICTED: auxin-responsive protein IAA30-like     165   2e-46   Elaeis guineensis
ref|XP_004493739.1|  PREDICTED: auxin-induced protein AUX28-like        165   2e-46   Cicer arietinum [garbanzo]
gb|EPS60474.1|  hypothetical protein M569_14329                         164   2e-46   Genlisea aurea
gb|KDO48906.1|  hypothetical protein CISIN_1g026005mg                   164   3e-46   Citrus sinensis [apfelsine]
ref|XP_006432923.1|  hypothetical protein CICLE_v10002290mg             164   3e-46   Citrus clementina [clementine]
gb|KDO48907.1|  hypothetical protein CISIN_1g026005mg                   163   3e-46   Citrus sinensis [apfelsine]
emb|CAH59413.1|  auxin resistance protein                               164   3e-46   Plantago major [cart-track plant]
gb|ABM53874.1|  IAA6                                                    161   4e-46   Cestrum elegans
ref|XP_003521753.1|  PREDICTED: auxin-responsive protein IAA16-like     164   5e-46   Glycine max [soybeans]
ref|XP_011026048.1|  PREDICTED: auxin-induced protein AUX28-like        163   6e-46   Populus euphratica
ref|NP_001266039.1|  IAA7 protein                                       162   7e-46   Solanum lycopersicum
gb|KHN31465.1|  Auxin-responsive protein IAA16                          163   7e-46   Glycine soja [wild soybean]
ref|XP_006838867.1|  PREDICTED: auxin-responsive protein IAA16          163   8e-46   Amborella trichopoda
gb|KDO48905.1|  hypothetical protein CISIN_1g026005mg                   163   8e-46   Citrus sinensis [apfelsine]
ref|XP_010679165.1|  PREDICTED: auxin-responsive protein IAA14-like     163   2e-45   
emb|CDY30017.1|  BnaC01g39910D                                          161   4e-45   Brassica napus [oilseed rape]
ref|XP_010025014.1|  PREDICTED: auxin-responsive protein IAA16-like     162   4e-45   Eucalyptus grandis [rose gum]
ref|XP_010923479.1|  PREDICTED: auxin-responsive protein IAA30-li...    161   4e-45   Elaeis guineensis
ref|XP_009398568.1|  PREDICTED: auxin-responsive protein IAA30-like     161   5e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007147174.1|  hypothetical protein PHAVU_006G102100g             162   5e-45   Phaseolus vulgaris [French bean]
ref|XP_010923478.1|  PREDICTED: auxin-responsive protein IAA30-li...    161   5e-45   Elaeis guineensis
ref|XP_009367750.1|  PREDICTED: auxin-induced protein AUX28-like        162   5e-45   Pyrus x bretschneideri [bai li]
ref|XP_002520980.1|  Auxin-induced protein AUX28, putative              161   5e-45   Ricinus communis
ref|XP_008810170.1|  PREDICTED: auxin-responsive protein IAA30-like     161   5e-45   Phoenix dactylifera
ref|NP_001239753.1|  uncharacterized protein LOC100781847               160   6e-45   Glycine max [soybeans]
gb|ACU19136.1|  unknown                                                 161   7e-45   Glycine max [soybeans]
ref|XP_007162490.1|  hypothetical protein PHAVU_001G156600g             161   7e-45   Phaseolus vulgaris [French bean]
gb|KHN18836.1|  Auxin-induced protein AUX28                             160   1e-44   Glycine soja [wild soybean]
gb|ACU18407.1|  unknown                                                 160   1e-44   Glycine max [soybeans]
ref|XP_009354870.1|  PREDICTED: auxin-induced protein AUX28-like        160   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_008341049.1|  PREDICTED: auxin-responsive protein IAA7-like      158   1e-44   
ref|XP_009774251.1|  PREDICTED: auxin-responsive protein IAA16-like     158   2e-44   Nicotiana sylvestris
ref|XP_009417112.1|  PREDICTED: auxin-responsive protein IAA30-like     160   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004289900.1|  PREDICTED: auxin-induced protein AUX28-like        159   3e-44   Fragaria vesca subsp. vesca
ref|XP_009420668.1|  PREDICTED: auxin-responsive protein IAA30-like     159   3e-44   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN22078.1|  Auxin-responsive protein IAA16                          158   5e-44   Glycine soja [wild soybean]
ref|XP_008382962.1|  PREDICTED: auxin-induced protein AUX28-like        159   7e-44   Malus domestica [apple tree]
ref|NP_001241599.1|  uncharacterized protein LOC100803065               158   7e-44   Glycine max [soybeans]
ref|XP_010674855.1|  PREDICTED: auxin-induced protein AUX28             159   2e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003554705.1|  PREDICTED: auxin-responsive protein IAA16-li...    157   2e-43   Glycine max [soybeans]
gb|ACL81167.1|  auxin-responsive protein IAA1                           157   2e-43   Mirabilis jalapa
gb|ACU19616.1|  unknown                                                 157   2e-43   Glycine max [soybeans]
ref|XP_009418923.1|  PREDICTED: auxin-responsive protein IAA30-like     156   3e-43   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAG55005.1|  auxin-responsive Aux/IAA gene family member            155   5e-43   Ipomoea nil [qian niu]
ref|XP_010550916.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    155   5e-43   Tarenaya hassleriana [spider flower]
dbj|BAH56942.1|  AT4G14550                                              154   6e-43   Arabidopsis thaliana [mouse-ear cress]
gb|ABD98055.1|  auxin-regulated protein                                 155   7e-43   Striga asiatica [witchweed]
gb|KJB82526.1|  hypothetical protein B456_013G200700                    154   8e-43   Gossypium raimondii
emb|CDP06818.1|  unnamed protein product                                155   9e-43   Coffea canephora [robusta coffee]
ref|XP_008372303.1|  PREDICTED: auxin-induced protein AUX28-like        155   1e-42   
gb|AAM96891.1|  auxin-responsive protein IAA1                           153   1e-42   Mirabilis jalapa
gb|EYU30526.1|  hypothetical protein MIMGU_mgv1a012831mg                155   1e-42   Erythranthe guttata [common monkey flower]
ref|NP_001237212.1|  uncharacterized protein LOC100499872               154   2e-42   
ref|XP_006605305.1|  PREDICTED: uncharacterized protein LOC100499...    154   2e-42   
ref|XP_008235328.1|  PREDICTED: auxin-induced protein AUX28-like        154   4e-42   Prunus mume [ume]
ref|XP_006366663.1|  PREDICTED: auxin-responsive protein IAA16-like     152   5e-42   Solanum tuberosum [potatoes]
ref|XP_008462707.1|  PREDICTED: auxin-induced protein AUX28-like ...    152   6e-42   Cucumis melo [Oriental melon]
ref|XP_008788131.1|  PREDICTED: auxin-responsive protein IAA30-like     153   6e-42   Phoenix dactylifera
ref|XP_008462706.1|  PREDICTED: auxin-responsive protein IAA16-li...    152   9e-42   Cucumis melo [Oriental melon]
ref|XP_007201400.1|  hypothetical protein PRUPE_ppa010342mg             153   1e-41   Prunus persica
emb|CDY10694.1|  BnaA05g16680D                                          150   1e-41   Brassica napus [oilseed rape]
ref|NP_001236693.1|  auxin-induced protein AUX28                        151   3e-41   
gb|KHN02537.1|  Auxin-induced protein AUX28                             151   4e-41   Glycine soja [wild soybean]
ref|XP_004142529.1|  PREDICTED: auxin-responsive protein IAA16          151   4e-41   Cucumis sativus [cucumbers]
ref|XP_003521268.1|  PREDICTED: auxin-induced protein AUX28-like        151   4e-41   Glycine max [soybeans]
gb|ADB93635.1|  indole-3-acetic acid inducible 17                       148   4e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KFK31703.1|  hypothetical protein AALP_AA6G148100                    149   1e-40   Arabis alpina [alpine rockcress]
gb|ACU21378.1|  unknown                                                 149   2e-40   Glycine max [soybeans]
gb|AFZ78616.1|  hypothetical protein                                    148   2e-40   Populus tomentosa [Chinese white poplar]
gb|AAD32147.1|AF123509_1  Nt-iaa4.1 deduced protein                     148   3e-40   Nicotiana tabacum [American tobacco]
gb|ADL70685.1|  indole-3-acetic acid inducible 17                       146   3e-40   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001267662.1|  auxin-induced protein AUX28-like                   149   3e-40   Cucumis sativus [cucumbers]
gb|ADL70684.1|  indole-3-acetic acid inducible 17                       145   5e-40   Arabidopsis thaliana [mouse-ear cress]
gb|AFK36086.1|  unknown                                                 148   8e-40   Lotus japonicus
gb|AFK43673.1|  unknown                                                 148   8e-40   Lotus japonicus
gb|ADL36587.1|  ARF domain class transcription factor                   145   2e-39   Malus domestica [apple tree]
ref|XP_008451270.1|  PREDICTED: auxin-induced protein AUX28-like        146   2e-39   Cucumis melo [Oriental melon]
ref|XP_008455992.1|  PREDICTED: auxin-responsive protein IAA16 is...    146   2e-39   Cucumis melo [Oriental melon]
ref|NP_001266055.1|  IAA10 protein                                      145   3e-39   Solanum lycopersicum
gb|AGV54609.1|  auxin-induced protein                                   147   3e-39   Phaseolus vulgaris [French bean]
ref|XP_008455985.1|  PREDICTED: auxin-responsive protein IAA16 is...    146   3e-39   
gb|AFK42876.1|  unknown                                                 145   6e-39   
gb|ACJ84642.1|  unknown                                                 145   6e-39   
ref|XP_007144686.1|  hypothetical protein PHAVU_007G176600g             145   1e-38   
emb|CBI35213.3|  unnamed protein product                                142   1e-38   
ref|XP_012092112.1|  PREDICTED: auxin-induced protein AUX28-like        145   1e-38   
gb|ABI36487.1|  AUX/IAA7 A                                              142   2e-38   
ref|XP_004963100.1|  PREDICTED: auxin-responsive protein IAA30-like     144   2e-38   
tpg|DAA55065.1|  TPA: hypothetical protein ZEAMMB73_489535              143   3e-38   
gb|ACF88333.1|  unknown                                                 144   4e-38   
ref|XP_011648755.1|  PREDICTED: auxin-responsive protein IAA16 is...    142   6e-38   
gb|AGV54230.1|  auxin-induced protein AUX28                             143   6e-38   
gb|ADL70681.1|  indole-3-acetic acid inducible 16                       140   8e-38   
ref|XP_011648754.1|  PREDICTED: auxin-responsive protein IAA16 is...    142   8e-38   
emb|CBI36106.3|  unnamed protein product                                144   9e-38   
gb|AAC36584.1|  putative IAA-related protein                            139   2e-37   
ref|XP_003637871.1|  Auxin-responsive aux/iaa gene family member        140   3e-37   
gb|KEH27147.1|  auxin response factor                                   141   4e-37   
gb|ADL70671.1|  indole-3-acetic acid inducible 16                       138   5e-37   
gb|ADL70672.1|  indole-3-acetic acid inducible 16                       138   6e-37   
dbj|BAK01326.1|  predicted protein                                      140   9e-37   
dbj|BAJ84870.1|  predicted protein                                      139   1e-36   
gb|AFK45766.1|  unknown                                                 139   2e-36   
ref|XP_010249884.1|  PREDICTED: auxin-responsive protein IAA1           137   3e-36   
ref|XP_007201399.1|  hypothetical protein PRUPE_ppa010342mg             138   3e-36   
dbj|BAP05448.1|  auxin-responsive protein                               134   4e-36   
gb|ADL70689.1|  indole-3-acetic acid inducible 17                       135   4e-36   
gb|ABY65124.1|  At1g04250                                               134   4e-36   
ref|XP_003579189.1|  PREDICTED: auxin-responsive protein IAA30-like     137   6e-36   
gb|ACF87179.1|  unknown                                                 138   8e-36   
gb|ABI36493.1|  AUX/IAA16 A                                             134   1e-35   
gb|ADL70673.1|  indole-3-acetic acid inducible 16                       134   2e-35   
gb|EMT20161.1|  Auxin-responsive protein IAA30                          139   2e-35   
ref|NP_001150626.1|  IAA30 - auxin-responsive Aux/IAA family member     137   3e-35   
gb|ABY65168.1|  At1g04250-like protein                                  131   3e-35   
gb|ABM53872.1|  IAA4                                                    132   6e-35   
ref|XP_002443496.1|  hypothetical protein SORBIDRAFT_08g020580          136   6e-35   
ref|XP_004982377.1|  PREDICTED: auxin-responsive protein IAA30-li...    134   1e-34   
ref|XP_010038039.1|  PREDICTED: auxin-induced protein AUX28-like        134   3e-34   
gb|ABR08758.1|  auxin-resistance protein 3                              129   4e-34   
gb|AAC13258.1|  IAA7                                                    128   5e-34   
gb|ADL70687.1|  indole-3-acetic acid inducible 17                       129   8e-34   
ref|XP_004982378.1|  PREDICTED: auxin-responsive protein IAA30-li...    132   9e-34   
ref|XP_010254225.1|  PREDICTED: auxin-responsive protein IAA1-like      130   1e-33   
gb|ABR08763.1|  auxin-resistance protein 3                              127   2e-33   
ref|NP_001067209.1|  Os12g0601300                                       131   2e-33   
ref|XP_004982376.1|  PREDICTED: auxin-responsive protein IAA30-li...    131   3e-33   
gb|EMS50778.1|  Auxin-responsive protein IAA30                          131   3e-33   
emb|CBW30571.1|  auxin-responsive protein iaa27                         130   4e-33   
gb|ABI36490.1|  AUX/IAA7 C                                              127   5e-33   
ref|XP_006833393.1|  PREDICTED: auxin-responsive protein IAA27          132   7e-33   
ref|XP_009793769.1|  PREDICTED: auxin-responsive protein IAA27-like     130   9e-33   
gb|KDO48908.1|  hypothetical protein CISIN_1g026005mg                   127   1e-32   
gb|ABK24636.1|  unknown                                                 132   1e-32   
ref|XP_004150556.1|  PREDICTED: auxin-responsive protein IAA27          130   1e-32   
dbj|BAJ97201.1|  predicted protein                                      129   1e-32   
ref|XP_006575865.1|  PREDICTED: auxin-induced protein AUX28-like        126   2e-32   
gb|ADL70679.1|  indole-3-acetic acid inducible 16                       125   2e-32   
ref|XP_010925905.1|  PREDICTED: auxin-responsive protein IAA17-like     130   2e-32   
ref|XP_008802939.1|  PREDICTED: auxin-responsive protein IAA17-like     130   2e-32   
gb|ADL70678.1|  indole-3-acetic acid inducible 16                       125   2e-32   
gb|AAC13260.1|  IAA9                                                    124   3e-32   
gb|AAM12952.1|  auxin-regulated protein                                 130   3e-32   
ref|XP_010915883.1|  PREDICTED: auxin-responsive protein IAA17-like     129   4e-32   
emb|CBI28036.3|  unnamed protein product                                125   5e-32   
ref|XP_009388718.1|  PREDICTED: auxin-responsive protein IAA17-like     129   5e-32   
ref|XP_009421456.1|  PREDICTED: auxin-responsive protein IAA21-like     128   7e-32   
gb|ABR17764.1|  unknown                                                 129   7e-32   
ref|XP_009398379.1|  PREDICTED: auxin-responsive protein IAA30-like     127   7e-32   
ref|XP_008462746.1|  PREDICTED: auxin-responsive protein IAA27          127   2e-31   
ref|NP_001267710.1|  auxin-responsive protein IAA9-like                 128   2e-31   
ref|XP_009390697.1|  PREDICTED: auxin-responsive protein IAA17-like     127   2e-31   
ref|XP_008444965.1|  PREDICTED: auxin-responsive protein IAA9-like      128   2e-31   
ref|XP_009617338.1|  PREDICTED: auxin-responsive protein IAA27-like     126   2e-31   
emb|CDY25617.1|  BnaA04g13090D                                          126   2e-31   
ref|XP_010924571.1|  PREDICTED: auxin-responsive protein IAA27-like     127   3e-31   
ref|NP_001275473.1|  Aux/IAA protein                                    127   3e-31   
gb|ADB93632.2|  indole-3-acetic acid inducible 16                       122   3e-31   
ref|XP_002517529.1|  Auxin-responsive protein IAA1, putative            124   3e-31   
gb|ABB55368.1|  Aux/IAA protein-like                                    127   3e-31   
gb|KJB54241.1|  hypothetical protein B456_009G026700                    126   3e-31   
gb|EEE53551.1|  hypothetical protein OsJ_36765                          123   3e-31   
ref|XP_012073288.1|  PREDICTED: auxin-responsive protein IAA1           124   3e-31   
gb|AEV89263.1|  IAA9                                                    126   4e-31   
ref|XP_007205358.1|  hypothetical protein PRUPE_ppa007194mg             127   4e-31   
gb|ABR16139.1|  unknown                                                 128   4e-31   
ref|XP_008236708.1|  PREDICTED: auxin-responsive protein IAA9           127   4e-31   
ref|XP_002284282.1|  PREDICTED: auxin-responsive protein IAA27-like     127   4e-31   
gb|KJB54244.1|  hypothetical protein B456_009G026700                    126   4e-31   
gb|KJB54243.1|  hypothetical protein B456_009G026700                    126   5e-31   
gb|KJB54240.1|  hypothetical protein B456_009G026700                    126   5e-31   
ref|XP_008793078.1|  PREDICTED: auxin-responsive protein IAA27-li...    126   5e-31   
gb|KHG03466.1|  Auxin-responsive IAA27 -like protein                    126   6e-31   
ref|XP_008793077.1|  PREDICTED: auxin-responsive protein IAA27-li...    126   6e-31   
ref|XP_003637872.1|  Auxin-responsive aux/iaa gene family member        123   6e-31   
ref|XP_010463453.1|  PREDICTED: auxin-responsive protein IAA9-lik...    125   6e-31   
ref|XP_012076736.1|  PREDICTED: auxin-responsive protein IAA27-like     125   6e-31   
ref|XP_008783242.1|  PREDICTED: auxin-responsive protein IAA17-li...    126   7e-31   
gb|AAP44405.1|  auxin-induced protein 2                                 125   7e-31   
ref|XP_008783241.1|  PREDICTED: auxin-responsive protein IAA17-li...    126   8e-31   
ref|XP_009786555.1|  PREDICTED: auxin-responsive protein IAA27-like     124   8e-31   
ref|XP_003612933.1|  Auxin-responsive protein (Aux/IAA)                 125   1e-30   
gb|ADL36578.1|  ARF domain class transcription factor                   126   1e-30   
gb|ABR08738.1|  auxin-resistance protein 2                              120   1e-30   
gb|KDO56957.1|  hypothetical protein CISIN_1g019236mg                   125   1e-30   
ref|XP_006465643.1|  PREDICTED: auxin-responsive protein IAA8-lik...    125   1e-30   
gb|ADL70570.1|  indole-3-acetic acid inducible 8                        124   1e-30   
ref|XP_006426926.1|  hypothetical protein CICLE_v10025988mg             125   1e-30   
ref|XP_009344514.1|  PREDICTED: auxin-responsive protein IAA9           126   1e-30   
gb|AFZ78621.1|  hypothetical protein                                    123   1e-30   
gb|ABY65138.1|  At1g04250                                               119   1e-30   
gb|EMS64858.1|  Auxin-responsive protein IAA30                          125   1e-30   
ref|XP_010254042.1|  PREDICTED: auxin-responsive protein IAA27-like     125   1e-30   
ref|XP_011073641.1|  PREDICTED: auxin-responsive protein IAA9-like      125   1e-30   
ref|XP_009409066.1|  PREDICTED: auxin-responsive protein IAA17-like     125   1e-30   
gb|ABR08736.1|  auxin-resistance protein 2                              119   1e-30   
ref|XP_006426927.1|  hypothetical protein CICLE_v10025988mg             125   1e-30   
ref|XP_006465642.1|  PREDICTED: auxin-responsive protein IAA8-lik...    125   1e-30   
ref|XP_002284118.1|  PREDICTED: auxin-responsive protein IAA27          125   2e-30   
emb|CAC85936.1|  putative auxin induced transcription factor Aux/IAA    124   2e-30   
ref|NP_179852.1|  auxin-responsive protein IAA8                         125   2e-30   
ref|XP_006433732.1|  hypothetical protein CICLE_v10001479mg             125   2e-30   
ref|XP_011099452.1|  PREDICTED: auxin-responsive protein IAA9-like      125   2e-30   
ref|NP_850028.1|  auxin-responsive protein IAA8                         124   2e-30   
ref|XP_009140376.1|  PREDICTED: auxin-responsive protein IAA8           123   2e-30   
ref|XP_010098105.1|  Auxin-responsive protein IAA27                     125   2e-30   
ref|NP_001189579.1|  auxin-responsive protein IAA8                      125   2e-30   
ref|XP_007018336.1|  Aux/IAA protein isoform 1                          125   3e-30   
ref|XP_006432922.1|  hypothetical protein CICLE_v10002290mg             122   3e-30   
ref|XP_007013106.1|  Phytochrome-associated protein 2 isoform 1         124   3e-30   
ref|XP_006664171.1|  PREDICTED: auxin-responsive protein IAA30-like     122   3e-30   
ref|XP_009381047.1|  PREDICTED: auxin-responsive protein IAA17-like     124   3e-30   
ref|NP_001241389.1|  uncharacterized protein LOC100783314               125   3e-30   
emb|CDP02673.1|  unnamed protein product                                125   3e-30   
gb|KHN08222.1|  Auxin-responsive protein IAA8                           125   3e-30   
ref|XP_002878628.1|  indoleacetic acid-induced protein 8                124   4e-30   
emb|CAI77628.1|  Aux/IAA protein                                        124   4e-30   
ref|XP_009789143.1|  PREDICTED: auxin-responsive protein IAA8-like      124   4e-30   
ref|XP_002299625.1|  auxin-induced protein IAA4                         122   4e-30   
gb|ADL70749.1|  indole-3-acetic acid inducible 27                       122   4e-30   
ref|XP_010527157.1|  PREDICTED: auxin-responsive protein IAA8           124   4e-30   
ref|XP_008228477.1|  PREDICTED: auxin-responsive protein IAA27-like     124   4e-30   
gb|ADL70577.1|  indole-3-acetic acid inducible 9                        123   4e-30   
ref|XP_010320058.1|  PREDICTED: auxin-responsive protein (Aux/IAA...    124   4e-30   
ref|XP_004302884.1|  PREDICTED: auxin-responsive protein IAA27-like     124   4e-30   
gb|ADL70677.1|  indole-3-acetic acid inducible 16                       119   4e-30   
gb|ABY48132.1|  GH1 protein                                             124   4e-30   
ref|NP_001265888.1|  auxin-responsive protein (Aux/IAA)                 124   5e-30   
ref|XP_007160318.1|  hypothetical protein PHAVU_002G311500g             123   5e-30   
ref|XP_009608764.1|  PREDICTED: auxin-responsive protein IAA8-like      124   5e-30   
ref|XP_009112194.1|  PREDICTED: auxin-responsive protein IAA9-lik...    122   5e-30   
ref|XP_010275506.1|  PREDICTED: auxin-responsive protein IAA9 iso...    124   5e-30   
ref|XP_003544843.1|  PREDICTED: auxin-responsive protein IAA9           124   5e-30   
ref|XP_010275504.1|  PREDICTED: auxin-responsive protein IAA9 iso...    125   6e-30   
gb|KCW59655.1|  hypothetical protein EUGRSUZ_H02407                     124   6e-30   
ref|XP_010275505.1|  PREDICTED: auxin-responsive protein IAA9 iso...    124   6e-30   
emb|CDY06836.1|  BnaC01g09350D                                          122   6e-30   
ref|XP_009112193.1|  PREDICTED: auxin-responsive protein IAA9-lik...    123   6e-30   
gb|ADL70760.1|  indole-3-acetic acid inducible 27                       121   6e-30   
ref|XP_004512542.1|  PREDICTED: auxin-responsive protein IAA8-like      124   6e-30   
gb|ABR08742.1|  auxin-resistance protein 2                              118   6e-30   
gb|KHG27397.1|  Auxin-responsive IAA27 -like protein                    121   6e-30   
ref|XP_010023411.1|  PREDICTED: auxin-responsive protein IAA9 iso...    124   7e-30   
gb|ADL70583.1|  indole-3-acetic acid inducible 9                        123   7e-30   
gb|ADC29394.1|  indole-3-acetic acid inducible 9                        123   7e-30   
ref|XP_002514266.1|  Auxin-responsive protein IAA27, putative           122   7e-30   
ref|XP_010023413.1|  PREDICTED: auxin-responsive protein IAA9 iso...    124   7e-30   
gb|ADL70574.1|  indole-3-acetic acid inducible 9                        122   7e-30   
gb|ADC29395.2|  indole-3-acetic acid inducible 9                        123   7e-30   
gb|ADL70756.1|  indole-3-acetic acid inducible 27                       122   8e-30   
ref|XP_009406220.1|  PREDICTED: auxin-responsive protein IAA21-like     122   8e-30   
ref|XP_006394000.1|  hypothetical protein EUTSA_v10004532mg             123   8e-30   
emb|CDY45607.1|  BnaCnng13150D                                          123   8e-30   
dbj|BAM10419.1|  Aux/IAA protein                                        118   8e-30   
ref|XP_006394001.1|  hypothetical protein EUTSA_v10004532mg             123   8e-30   
gb|KDO48904.1|  hypothetical protein CISIN_1g026005mg                   120   8e-30   
gb|AAM64650.1|  auxin-induced protein IAA9                              123   9e-30   
dbj|BAM10421.1|  Aux/IAA protein                                        118   9e-30   
ref|XP_009352507.1|  PREDICTED: auxin-responsive protein IAA27-like     123   9e-30   
dbj|BAB10673.1|  auxin-induced protein IAA9                             123   9e-30   
gb|KJB56781.1|  hypothetical protein B456_009G135900                    122   9e-30   
ref|NP_851275.1|  auxin-responsive protein IAA9                         123   9e-30   
ref|XP_010518881.1|  PREDICTED: auxin-responsive protein IAA9-like      122   9e-30   
ref|XP_009150656.1|  PREDICTED: auxin-responsive protein IAA9-lik...    123   9e-30   
ref|XP_007013107.1|  Phytochrome-associated protein 2 isoform 2         123   9e-30   
ref|XP_010547581.1|  PREDICTED: auxin-responsive protein IAA9-lik...    123   9e-30   
ref|XP_010254653.1|  PREDICTED: auxin-responsive protein IAA9-like      124   9e-30   
gb|KHN09036.1|  Auxin-responsive protein IAA8                           123   1e-29   
gb|KHG09793.1|  Auxin-responsive IAA27 -like protein                    123   1e-29   
gb|ADL70757.1|  indole-3-acetic acid inducible 27                       121   1e-29   
gb|KJB56779.1|  hypothetical protein B456_009G135900                    123   1e-29   
gb|ADL70750.1|  indole-3-acetic acid inducible 27                       121   1e-29   
ref|NP_569017.2|  auxin-responsive protein IAA9                         123   1e-29   
ref|XP_009150655.1|  PREDICTED: auxin-responsive protein IAA9-lik...    123   1e-29   
gb|KJB56782.1|  hypothetical protein B456_009G135900                    123   1e-29   
emb|CDY08767.1|  BnaA06g24570D                                          123   1e-29   
ref|XP_006850381.1|  PREDICTED: auxin-responsive protein IAA9           124   1e-29   
gb|ABR16302.1|  unknown                                                 123   1e-29   
ref|XP_006294565.1|  hypothetical protein CARUB_v10023602mg             123   1e-29   
gb|ADL70755.1|  indole-3-acetic acid inducible 27                       121   1e-29   
emb|CDY18679.1|  BnaA09g07160D                                          122   1e-29   
gb|AEI70506.1|  auxin-responsive protein                                123   1e-29   
ref|XP_009774736.1|  PREDICTED: auxin-responsive protein IAA27-like     122   1e-29   
emb|CDX89499.1|  BnaC04g35180D                                          122   1e-29   
ref|XP_008242568.1|  PREDICTED: auxin-responsive protein IAA27          122   1e-29   
ref|XP_010463449.1|  PREDICTED: auxin-responsive protein IAA9-lik...    123   1e-29   
ref|XP_002864969.1|  auxin-induced protein IAA9                         123   1e-29   
ref|XP_010444576.1|  PREDICTED: auxin-responsive protein IAA9-like      123   1e-29   
ref|XP_012079519.1|  PREDICTED: auxin-responsive protein IAA9           123   1e-29   
gb|ADL70752.1|  indole-3-acetic acid inducible 27                       121   1e-29   
gb|KHG13564.1|  Auxin-responsive IAA9 -like protein                     123   1e-29   
gb|KJB56783.1|  hypothetical protein B456_009G135900                    123   1e-29   
gb|ADL70759.1|  indole-3-acetic acid inducible 27                       120   2e-29   
gb|ADB93662.1|  indole-3-acetic acid inducible 27                       120   2e-29   
gb|ADL70753.1|  indole-3-acetic acid inducible 27                       121   2e-29   
ref|XP_006294567.1|  hypothetical protein CARUB_v10023602mg             122   2e-29   
gb|ADB93663.1|  indole-3-acetic acid inducible 27                       121   2e-29   
ref|XP_007152862.1|  hypothetical protein PHAVU_004G166400g             122   2e-29   
gb|ADB93661.1|  indole-3-acetic acid inducible 27                       121   2e-29   
gb|AGV54485.1|  auxin-responsive protein                                122   2e-29   
ref|XP_010484401.1|  PREDICTED: auxin-responsive protein IAA9           122   2e-29   



>ref|XP_007034956.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
 gb|EOY05882.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
Length=254

 Score =   220 bits (561),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 154/204 (75%), Gaps = 17/204 (8%)
 Frame = +3

Query  78   TSVKMTNMLG-HGGLNLKETELCLGLPggsgggn-----enesMKTTGKRGFSETVDLKL  239
             S KM NMLG    LN KETELCLGLPGG GGG      E E+ KTTGKRGFSETVDLKL
Sbjct  3    VSRKMANMLGAERDLNFKETELCLGLPGGGGGGGGGGGNEVETPKTTGKRGFSETVDLKL  62

Query  240  NLQSDGSCLDLSET------KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQK  401
            NLQS  + +DL++       +    P   KDP KPPAKAQVVGWPPVRSYRKN+MA+ + 
Sbjct  63   NLQSKETGMDLNKNIENGSKEKTLLPACTKDPAKPPAKAQVVGWPPVRSYRKNIMANQK-  121

Query  402  SNNGEEGDQKS---GNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYG  572
             N+ EE D+K+   G  FVKVSMDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT GNYG
Sbjct  122  -NSCEESDKKASSGGAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYG  180

Query  573  AQGMIDFMNERKLMDLLNTSEYVP  644
            AQGMIDFMNE KLMDLLN+S+YVP
Sbjct  181  AQGMIDFMNESKLMDLLNSSDYVP  204



>gb|AFK42031.1| unknown [Medicago truncatula]
Length=214

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 146/189 (77%), Gaps = 14/189 (7%)
 Frame = +3

Query  102  LGHGGLNLKETELCLGLPggsggg----nenesMKTTGKRGFSETVDLKLNLQSDGSCLD  269
            +GHG LNLKETELCLGLPGG GGG    +E E+ + +GKRGFSETVDLKLNLQ+     D
Sbjct  4    MGHG-LNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKE---D  59

Query  270  LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--  443
            L+E          KDP KPPAKAQVVGWPPVRSYRKN+MA  QK NN E+ ++ + N   
Sbjct  60   LNEKSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA--QKVNNTEDTEKTTSNTTA  117

Query  444  --FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMD  617
              FVKVSMDGAPYLRKVDL +Y TY  LSDALA MFSSFTTGNYGAQGMIDFMNE KLMD
Sbjct  118  AAFVKVSMDGAPYLRKVDLTMYKTYKDLSDALAKMFSSFTTGNYGAQGMIDFMNESKLMD  177

Query  618  LLNTSEYVP  644
            LLN+SEYVP
Sbjct  178  LLNSSEYVP  186



>gb|KEH42779.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=204

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 146/189 (77%), Gaps = 14/189 (7%)
 Frame = +3

Query  102  LGHGGLNLKETELCLGLPggsggg----nenesMKTTGKRGFSETVDLKLNLQSDGSCLD  269
            +GHG LNLKETELCLGLPGG GGG    +E E+ + +GKRGFSETVDLKLNLQ+     D
Sbjct  4    MGHG-LNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKE---D  59

Query  270  LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--  443
            L+E          KDP KPPAKAQVVGWPPVRSYRKN+MA  QK NN E+ ++ + N   
Sbjct  60   LNEKSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA--QKVNNTEDTEKTTSNTTA  117

Query  444  --FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMD  617
              FVKVSMDGAPYLRKVDL +Y TY  LSDALA MFSSFTTGNYGAQGMIDFMNE KLMD
Sbjct  118  AAFVKVSMDGAPYLRKVDLTMYKTYKDLSDALAKMFSSFTTGNYGAQGMIDFMNESKLMD  177

Query  618  LLNTSEYVP  644
            LLN+SEYVP
Sbjct  178  LLNSSEYVP  186



>ref|XP_003591806.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AES62057.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=236

 Score =   217 bits (553),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 146/189 (77%), Gaps = 14/189 (7%)
 Frame = +3

Query  102  LGHGGLNLKETELCLGLPggsggg----nenesMKTTGKRGFSETVDLKLNLQSDGSCLD  269
            +GHG LNLKETELCLGLPGG GGG    +E E+ + +GKRGFSETVDLKLNLQ+     D
Sbjct  4    MGHG-LNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKE---D  59

Query  270  LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--  443
            L+E          KDP KPPAKAQVVGWPPVRSYRKN+MA  QK NN E+ ++ + N   
Sbjct  60   LNEKSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA--QKVNNTEDTEKTTSNTTA  117

Query  444  --FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMD  617
              FVKVSMDGAPYLRKVDL +Y TY  LSDALA MFSSFTTGNYGAQGMIDFMNE KLMD
Sbjct  118  AAFVKVSMDGAPYLRKVDLTMYKTYKDLSDALAKMFSSFTTGNYGAQGMIDFMNESKLMD  177

Query  618  LLNTSEYVP  644
            LLN+SEYVP
Sbjct  178  LLNSSEYVP  186



>emb|CDO99148.1| unnamed protein product [Coffea canephora]
Length=239

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 144/191 (75%), Gaps = 8/191 (4%)
 Frame = +3

Query  90   MTNMLG--HGGLNLKETELCLGLPggsgggne-nesMKTTGKRGFSETVDLKLNLQSDGS  260
            MT MLG  HGGLNLK TELCLGLPGG G      ES+K TGKRGFSETVDLKLNLQ +  
Sbjct  1    MTTMLGEEHGGLNLKATELCLGLPGGGGCAGADTESLKITGKRGFSETVDLKLNLQPNEP  60

Query  261  CLDLSET-KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSG  437
             +DL E  K  A          P AKAQVVGWPPVRS+RKN+MA  QKSN  E   +K+G
Sbjct  61   VVDLKEKMKAPAKEATKDPVKPPAAKAQVVGWPPVRSFRKNIMA--QKSNTEEAAAEKAG  118

Query  438  NN--FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKL  611
            ++  FVKVSMDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT GNYG QGMIDFMNE KL
Sbjct  119  SSAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGPQGMIDFMNESKL  178

Query  612  MDLLNTSEYVP  644
            MDLLN+SEYVP
Sbjct  179  MDLLNSSEYVP  189



>ref|XP_011030585.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 137/185 (74%), Gaps = 9/185 (5%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSET-----  281
            LN KETELCLGLPG  G  NE E+ K TGKRGF+ETVDLKLNLQ+    +DL+E      
Sbjct  14   LNYKETELCLGLPGAVGVKNEVETHKATGKRGFAETVDLKLNLQAKEGVMDLNENIKNIA  73

Query  282  ---KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK-SGNNFV  449
               K Q P    KDP KPPAKAQVVGWPPVRSYRKNV+A    S  GE+     S   FV
Sbjct  74   SKDKNQLPAATIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASEEGEKASTGGSSAAFV  133

Query  450  KVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNT  629
            KV MDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLN+
Sbjct  134  KVCMDGAPYLRKVDLKMYRSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNS  193

Query  630  SEYVP  644
            SEYVP
Sbjct  194  SEYVP  198



>ref|XP_011030586.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 137/185 (74%), Gaps = 9/185 (5%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSET-----  281
            LN KETELCLGLPG  G  NE E+ K TGKRGF+ETVDLKLNLQ+    +DL+E      
Sbjct  14   LNYKETELCLGLPGAVGVKNEVETHKATGKRGFAETVDLKLNLQAKEGVMDLNENIKNIA  73

Query  282  ---KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK-SGNNFV  449
               K Q P    KDP KPPAKAQVVGWPPVRSYRKNV+A    S  GE+     S   FV
Sbjct  74   SKDKNQLPAATIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASEEGEKASTGGSSAAFV  133

Query  450  KVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNT  629
            KV MDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLN+
Sbjct  134  KVCMDGAPYLRKVDLKMYRSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNS  193

Query  630  SEYVP  644
            SEYVP
Sbjct  194  SEYVP  198



>gb|KEH42778.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=239

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 146/189 (77%), Gaps = 14/189 (7%)
 Frame = +3

Query  102  LGHGGLNLKETELCLGLPggsggg----nenesMKTTGKRGFSETVDLKLNLQSDGSCLD  269
            +GHG LNLKETELCLGLPGG GGG    +E E+ + +GKRGFSETVDLKLNLQ+     D
Sbjct  4    MGHG-LNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKE---D  59

Query  270  LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--  443
            L+E          KDP KPPAKAQVVGWPPVRSYRKN+MA  QK NN E+ ++ + N   
Sbjct  60   LNEKSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA--QKVNNTEDTEKTTSNTTA  117

Query  444  --FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMD  617
              FVKVSMDGAPYLRKVDL +Y TY  LSDALA MFSSFTTGNYGAQGMIDFMNE KLMD
Sbjct  118  AAFVKVSMDGAPYLRKVDLTMYKTYKDLSDALAKMFSSFTTGNYGAQGMIDFMNESKLMD  177

Query  618  LLNTSEYVP  644
            LLN+SEYVP
Sbjct  178  LLNSSEYVP  186



>ref|XP_012069759.1| PREDICTED: auxin-responsive protein IAA14-like [Jatropha curcas]
 gb|KDP40274.1| hypothetical protein JCGZ_02272 [Jatropha curcas]
Length=241

 Score =   216 bits (549),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 137/183 (75%), Gaps = 11/183 (6%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSET-----  281
            LN KETELCLGLPGG     E    K TGKRGF+ETVDLKLNLQ+    +DL+E      
Sbjct  13   LNFKETELCLGLPGGGKTEVETP--KATGKRGFAETVDLKLNLQAKDGVMDLNENIKNAS  70

Query  282  --KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKV  455
              K   P    KDP KPPAKAQVVGWPPVRSYRKN+MA+ +  NN +EG++     FVKV
Sbjct  71   KDKNHLPTSTIKDPAKPPAKAQVVGWPPVRSYRKNIMANQK--NNSDEGEKSLSAAFVKV  128

Query  456  SMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSE  635
             MDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLN+SE
Sbjct  129  CMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSE  188

Query  636  YVP  644
            YVP
Sbjct  189  YVP  191



>gb|KJB38279.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=217

 Score =   215 bits (547),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 143/197 (73%), Gaps = 14/197 (7%)
 Frame = +3

Query  87   KMTNMLG-HGGLNLKETELCLGLP------ggsgggnenesMKTTGKRGFSETVDLKLNL  245
            KM NMLG    LN KETELCLGLP              + S KT GKRGFSETVDLKLNL
Sbjct  6    KMANMLGTDHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVDLKLNL  65

Query  246  QSDGSCLDLS----ETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNG  413
            QS  S +DL+    +   +      KDP KPPAKAQVVGWPPVRSYRKN+MA+ QK+++ 
Sbjct  66   QSKESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMAN-QKNSSE  124

Query  414  EEGDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDF  593
            E G+  SG   VKVSMDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT GNYG QGMIDF
Sbjct  125  ESGN--SGAALVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGPQGMIDF  182

Query  594  MNERKLMDLLNTSEYVP  644
            MNE KLMDLLN+S+YVP
Sbjct  183  MNESKLMDLLNSSDYVP  199



>gb|AEE25653.1| auxin-responsive protein [Gossypium hirsutum]
Length=249

 Score =   215 bits (548),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 143/197 (73%), Gaps = 14/197 (7%)
 Frame = +3

Query  87   KMTNMLG-HGGLNLKETELCLGLP------ggsgggnenesMKTTGKRGFSETVDLKLNL  245
            KM NMLG    LN KETELCLGLP              + S KT GKRGFSETVDLKLNL
Sbjct  6    KMANMLGTEHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVDLKLNL  65

Query  246  QSDGSCLDLS----ETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNG  413
            QS  S +DL+    +   +      KDP KPPAKAQVVGWPPVRSYRKN+MA+ QK+++ 
Sbjct  66   QSKESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMAN-QKNSSE  124

Query  414  EEGDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDF  593
            E G+  SG   VKVSMDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT GNYG QGMIDF
Sbjct  125  ESGN--SGAALVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGPQGMIDF  182

Query  594  MNERKLMDLLNTSEYVP  644
            MNE KLMDLLN+S+YVP
Sbjct  183  MNESKLMDLLNSSDYVP  199



>gb|KJB38280.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=249

 Score =   215 bits (547),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 143/197 (73%), Gaps = 14/197 (7%)
 Frame = +3

Query  87   KMTNMLG-HGGLNLKETELCLGLP------ggsgggnenesMKTTGKRGFSETVDLKLNL  245
            KM NMLG    LN KETELCLGLP              + S KT GKRGFSETVDLKLNL
Sbjct  6    KMANMLGTDHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVDLKLNL  65

Query  246  QSDGSCLDLS----ETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNG  413
            QS  S +DL+    +   +      KDP KPPAKAQVVGWPPVRSYRKN+MA+ QK+++ 
Sbjct  66   QSKESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMAN-QKNSSE  124

Query  414  EEGDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDF  593
            E G+  SG   VKVSMDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT GNYG QGMIDF
Sbjct  125  ESGN--SGAALVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGPQGMIDF  182

Query  594  MNERKLMDLLNTSEYVP  644
            MNE KLMDLLN+S+YVP
Sbjct  183  MNESKLMDLLNSSDYVP  199



>gb|KJB38278.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=294

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 143/197 (73%), Gaps = 14/197 (7%)
 Frame = +3

Query  87   KMTNMLG-HGGLNLKETELCLGLP------ggsgggnenesMKTTGKRGFSETVDLKLNL  245
            KM NMLG    LN KETELCLGLP              + S KT GKRGFSETVDLKLNL
Sbjct  51   KMANMLGTDHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVDLKLNL  110

Query  246  QSDGSCLDLS----ETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNG  413
            QS  S +DL+    +   +      KDP KPPAKAQVVGWPPVRSYRKN+MA+ QK+++ 
Sbjct  111  QSKESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMAN-QKNSSE  169

Query  414  EEGDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDF  593
            E G+  SG   VKVSMDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT GNYG QGMIDF
Sbjct  170  ESGN--SGAALVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGPQGMIDF  227

Query  594  MNERKLMDLLNTSEYVP  644
            MNE KLMDLLN+S+YVP
Sbjct  228  MNESKLMDLLNSSDYVP  244



>gb|AFK37379.1| unknown [Medicago truncatula]
Length=236

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 145/189 (77%), Gaps = 14/189 (7%)
 Frame = +3

Query  102  LGHGGLNLKETELCLGLPggsggg----nenesMKTTGKRGFSETVDLKLNLQSDGSCLD  269
            +GHG LNLKETELCLGLPGG GGG    +E E+ + +GKRGFSETVDLKLNLQ+     D
Sbjct  4    MGHG-LNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKE---D  59

Query  270  LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--  443
            L+E          KDP KPPAKAQVVGWPPVRSY+KN+MA  QK NN E+ ++ + N   
Sbjct  60   LNEKSASKEKTLLKDPAKPPAKAQVVGWPPVRSYKKNMMA--QKVNNTEDTEKTTSNTTA  117

Query  444  --FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMD  617
              FVKVSMDGAPYLRKVDL +Y TY  LSDALA MFSSFT GNYGAQGMIDFMNE KLMD
Sbjct  118  AVFVKVSMDGAPYLRKVDLTMYKTYKDLSDALAKMFSSFTIGNYGAQGMIDFMNESKLMD  177

Query  618  LLNTSEYVP  644
            LLN+SEYVP
Sbjct  178  LLNSSEYVP  186



>gb|KHF98789.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=249

 Score =   214 bits (544),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 143/197 (73%), Gaps = 14/197 (7%)
 Frame = +3

Query  87   KMTNMLG-HGGLNLKETELCLGLP------ggsgggnenesMKTTGKRGFSETVDLKLNL  245
            KM NMLG    LN KETELCLGLP              + S KT GKRGFSETVDLKLNL
Sbjct  6    KMANMLGTEHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVDLKLNL  65

Query  246  QSDGSCLDLS----ETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNG  413
            QS  S +DL+    +   +      KDP KPPAKAQ+VGWPPVRSYRKN+MA+ QK+++ 
Sbjct  66   QSKESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQMVGWPPVRSYRKNIMAN-QKNSSE  124

Query  414  EEGDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDF  593
            E G+  SG   VKVSMDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT GNYG QGMIDF
Sbjct  125  ESGN--SGAALVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGPQGMIDF  182

Query  594  MNERKLMDLLNTSEYVP  644
            MNE KLMDLLN+S+YVP
Sbjct  183  MNESKLMDLLNSSDYVP  199



>ref|XP_009611797.1| PREDICTED: auxin-responsive protein IAA14 [Nicotiana tomentosiformis]
Length=243

 Score =   213 bits (541),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 138/185 (75%), Gaps = 9/185 (5%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTG---KRGFSETVDLKLNLQS-DGSCLDLSETK  284
            LNLKETELCLGLPGG       +         KRGFSETVDLKLNLQS D S LDL + K
Sbjct  9    LNLKETELCLGLPGGEVRAAIADQNNIDSINKKRGFSETVDLKLNLQSNDSSGLDLKKDK  68

Query  285  MQ--AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN---FV  449
            M+  +    NKD  KPPAKAQVVGWPPVRS+RKN+MA    S   E  + K G++   FV
Sbjct  69   MKNPSKETCNKDSAKPPAKAQVVGWPPVRSFRKNIMAQKGSSICEESENSKGGSSSAAFV  128

Query  450  KVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNT  629
            KVSMDGAPYLRKVDLK+Y +Y QLSDALA MFSSFT GNYGAQGMIDFMNERKLMDLLN+
Sbjct  129  KVSMDGAPYLRKVDLKMYKSYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNS  188

Query  630  SEYVP  644
            S+YVP
Sbjct  189  SDYVP  193



>ref|XP_011027545.1| PREDICTED: auxin-responsive protein IAA14 isoform X1 [Populus 
euphratica]
 ref|XP_011029890.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 136/196 (69%), Gaps = 12/196 (6%)
 Frame = +3

Query  93   TNMLG--HGGLNLKETELCLGLPggs-gggnenesMKTTGKRGFSETVDLKLNLQSDGSC  263
            T++LG     LN KETELCLGLPG            K TGKRGF+ETVDLKLNLQ+    
Sbjct  3    TSVLGAERTDLNYKETELCLGLPGAVGAKNEVETPSKATGKRGFAETVDLKLNLQAKEGV  62

Query  264  LDLSET--------KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEE  419
            +DL+E         K   P    KDP KPPAKAQVVGWPPVRSYRKNVMA    S  GE+
Sbjct  63   MDLNENIKNITSKDKNHLPAVTIKDPAKPPAKAQVVGWPPVRSYRKNVMAQKNASEEGEK  122

Query  420  GDQK-SGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFM  596
                 S   FVKV MDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT GNYGAQGMIDFM
Sbjct  123  ASTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQELSDALAKMFSSFTMGNYGAQGMIDFM  182

Query  597  NERKLMDLLNTSEYVP  644
            NE KLMDLLN+SEYVP
Sbjct  183  NESKLMDLLNSSEYVP  198



>ref|XP_011027555.1| PREDICTED: auxin-responsive protein IAA14 isoform X2 [Populus 
euphratica]
 ref|XP_011029891.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 136/196 (69%), Gaps = 12/196 (6%)
 Frame = +3

Query  93   TNMLG--HGGLNLKETELCLGLPggs-gggnenesMKTTGKRGFSETVDLKLNLQSDGSC  263
            T++LG     LN KETELCLGLPG            K TGKRGF+ETVDLKLNLQ+    
Sbjct  3    TSVLGAERTDLNYKETELCLGLPGAVGAKNEVETPSKATGKRGFAETVDLKLNLQAKEGV  62

Query  264  LDLSET--------KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEE  419
            +DL+E         K   P    KDP KPPAKAQVVGWPPVRSYRKNVMA    S  GE+
Sbjct  63   MDLNENIKNITSKDKNHLPAVTIKDPAKPPAKAQVVGWPPVRSYRKNVMAQKNASEEGEK  122

Query  420  GDQK-SGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFM  596
                 S   FVKV MDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT GNYGAQGMIDFM
Sbjct  123  ASTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQELSDALAKMFSSFTMGNYGAQGMIDFM  182

Query  597  NERKLMDLLNTSEYVP  644
            NE KLMDLLN+SEYVP
Sbjct  183  NESKLMDLLNSSEYVP  198



>gb|KHG01271.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=248

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 144/199 (72%), Gaps = 18/199 (9%)
 Frame = +3

Query  99   MLG-HGGLNLKETELCLGLPggsg------------ggnenesMKTTGKRGFSETVDLKL  239
            MLG    LN KETELCLGLPGGSG                  S KTTGKRG+SETVDLKL
Sbjct  1    MLGTEHDLNFKETELCLGLPGGSGGGGGAAAAGGGGKNEVESSPKTTGKRGYSETVDLKL  60

Query  240  NLQSDGSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEE  419
            NLQS   C+DL++       E N  P KPPAKAQV+GWPPVRSYRKN+MA+ QK+N+ E 
Sbjct  61   NLQSKEGCMDLNQNLENGSKEKNHHPAKPPAKAQVLGWPPVRSYRKNIMAN-QKNNSDEI  119

Query  420  GDQKS----GNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMI  587
             D+ S    G  FVKV MDGAPYLRKVDLK+YN+Y +LSDALA MFSSFT G+YG +GMI
Sbjct  120  SDRASSGSGGAAFVKVCMDGAPYLRKVDLKMYNSYQKLSDALAKMFSSFTMGSYGCEGMI  179

Query  588  DFMNERKLMDLLNTSEYVP  644
            DFMNE KLMDLLN+S+YVP
Sbjct  180  DFMNESKLMDLLNSSDYVP  198



>ref|XP_002311658.1| aux/IAA family protein [Populus trichocarpa]
 gb|ABK95711.1| unknown [Populus trichocarpa]
 gb|EEE89025.1| aux/IAA family protein [Populus trichocarpa]
Length=248

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 141/196 (72%), Gaps = 12/196 (6%)
 Frame = +3

Query  93   TNMLG--HGGLNLKETELCLGLPggsgggnenesM-KTTGKRGFSETVDLKLNLQSDGSC  263
            T++LG     LN KETELCLGLPG  G  NE E+  K TGKRGF+ETVDLKLNLQ+    
Sbjct  3    TSVLGTERTDLNYKETELCLGLPGAVGAKNEVETPNKATGKRGFAETVDLKLNLQAKEGV  62

Query  264  LDLSET--------KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEE  419
            +DL+E         K   P    KDP KPPAKAQVVGWPPVRSYRKNVMA    S  GE+
Sbjct  63   MDLNENIKNITSKDKNHLPAVTIKDPAKPPAKAQVVGWPPVRSYRKNVMAQKNASEEGEK  122

Query  420  GDQK-SGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFM  596
                 S   FVKV MDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT GNYGAQGMIDFM
Sbjct  123  ASTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQELSDALAKMFSSFTMGNYGAQGMIDFM  182

Query  597  NERKLMDLLNTSEYVP  644
            NE KLMDLLN+SEYVP
Sbjct  183  NESKLMDLLNSSEYVP  198



>gb|AFZ78617.1| hypothetical protein [Populus tomentosa]
Length=248

 Score =   210 bits (534),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 141/196 (72%), Gaps = 12/196 (6%)
 Frame = +3

Query  93   TNMLG--HGGLNLKETELCLGLPggsgggnenesM-KTTGKRGFSETVDLKLNLQSDGSC  263
            T++LG     LN KETELCLGLPG  G  NE E+  K TGKRGF+ETVDLKLNLQ+    
Sbjct  3    TSVLGTERTDLNYKETELCLGLPGAVGVKNEVETPNKATGKRGFAETVDLKLNLQAKDGV  62

Query  264  LDL--------SETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEE  419
            +DL        S+ K   P    KDP KPPAKAQVVGWPPVRSYRKNVMA    S  GE+
Sbjct  63   MDLNDNIKNITSKDKNHLPAAAIKDPAKPPAKAQVVGWPPVRSYRKNVMAQKNASEEGEK  122

Query  420  GDQK-SGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFM  596
                 S   FVKV MDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT GNYGAQGMIDFM
Sbjct  123  TSTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQELSDALAKMFSSFTMGNYGAQGMIDFM  182

Query  597  NERKLMDLLNTSEYVP  644
            NE KLMDLLN+SEYVP
Sbjct  183  NESKLMDLLNSSEYVP  198



>gb|KJB28413.1| hypothetical protein B456_005G046500 [Gossypium raimondii]
Length=248

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 143/199 (72%), Gaps = 18/199 (9%)
 Frame = +3

Query  99   MLG-HGGLNLKETELCLGLPggsg------------ggnenesMKTTGKRGFSETVDLKL  239
            MLG    LN  ETELCLGLPGGSG                  S KTTGKRG+SETVDLKL
Sbjct  1    MLGTERDLNFNETELCLGLPGGSGGGGGAAAAGGGGKNEVESSPKTTGKRGYSETVDLKL  60

Query  240  NLQSDGSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEE  419
            NLQS   C+DL++       E N  P KPPAKAQV+GWPPVRSYRKN+MA+ QK+N+ E 
Sbjct  61   NLQSKEGCMDLNQNLENGSKEKNHLPAKPPAKAQVLGWPPVRSYRKNIMAN-QKNNSDEI  119

Query  420  GDQKS----GNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMI  587
             D+ S    G  FVKV MDGAPYLRKVDLK+YN+Y +LSDALA MFSSFT G+YG +GMI
Sbjct  120  SDRASSGSGGAAFVKVCMDGAPYLRKVDLKMYNSYQKLSDALAKMFSSFTMGSYGCEGMI  179

Query  588  DFMNERKLMDLLNTSEYVP  644
            DFMNE KLMDLLN+S+YVP
Sbjct  180  DFMNESKLMDLLNSSDYVP  198



>ref|XP_004495392.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Cicer 
arietinum]
Length=240

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 147/192 (77%), Gaps = 9/192 (5%)
 Frame = +3

Query  90   MTNMLG-HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL  266
            M  ++G   GLNLKETELCLGLPGG G G+E E+ +  GKRGFSETVDLKLNLQS+   L
Sbjct  1    MATLIGKESGLNLKETELCLGLPGGGGSGSEVETQRAAGKRGFSETVDLKLNLQSNKEDL  60

Query  267  DLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEE-GDQKS---  434
            + +   +       KDP KPPAKAQVVGWPPVRSYRKN+MA  QK NN ++ G++K+   
Sbjct  61   NDNSKNVSKDKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA--QKVNNSDQDGNEKTTSS  118

Query  435  --GNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERK  608
                 FVKVSMDGAPYLRKVDL +YNTY  LSDALA MFSSFTTG YGAQGMIDFMNE K
Sbjct  119  TTAGTFVKVSMDGAPYLRKVDLTMYNTYKDLSDALAKMFSSFTTGKYGAQGMIDFMNESK  178

Query  609  LMDLLNTSEYVP  644
            LMDLLN+SEYVP
Sbjct  179  LMDLLNSSEYVP  190



>ref|XP_004495391.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Cicer 
arietinum]
Length=244

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 147/192 (77%), Gaps = 9/192 (5%)
 Frame = +3

Query  90   MTNMLG-HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL  266
            M  ++G   GLNLKETELCLGLPGG G G+E E+ +  GKRGFSETVDLKLNLQS+   L
Sbjct  1    MATLIGKESGLNLKETELCLGLPGGGGSGSEVETQRAAGKRGFSETVDLKLNLQSNKEDL  60

Query  267  DLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEE-GDQKS---  434
            + +   +       KDP KPPAKAQVVGWPPVRSYRKN+MA  QK NN ++ G++K+   
Sbjct  61   NDNSKNVSKDKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA--QKVNNSDQDGNEKTTSS  118

Query  435  --GNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERK  608
                 FVKVSMDGAPYLRKVDL +YNTY  LSDALA MFSSFTTG YGAQGMIDFMNE K
Sbjct  119  TTAGTFVKVSMDGAPYLRKVDLTMYNTYKDLSDALAKMFSSFTTGKYGAQGMIDFMNESK  178

Query  609  LMDLLNTSEYVP  644
            LMDLLN+SEYVP
Sbjct  179  LMDLLNSSEYVP  190



>gb|KFK24541.1| hypothetical protein AALP_AAs58011U000100 [Arabis alpina]
Length=230

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 130/180 (72%), Gaps = 4/180 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG              KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGLETVESPAKSGVGNKRGFSETVDLKLNLQSNKQAPIDLNVAGTSR  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN---FVKVSMD  464
                 KDP KPPAKAQVVGWPPVR+YRKN+MA+ + S   EE     G     FVKVSMD
Sbjct  61   EKTLLKDPSKPPAKAQVVGWPPVRNYRKNIMANQKSSEEAEEAMSGGGGGTVAFVKVSMD  120

Query  465  GAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            GAPYLRKVDLK+YN+Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLN+SEYVP
Sbjct  121  GAPYLRKVDLKMYNSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNETKVMDLLNSSEYVP  180



>ref|XP_008362015.1| PREDICTED: auxin-responsive protein IAA14-like [Malus domestica]
Length=244

 Score =   207 bits (526),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 133/194 (69%), Gaps = 9/194 (5%)
 Frame = +3

Query  90   MTNMLG-HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL  266
            MT+MLG    LNL+ETELCLGLPGG          K TGKRGFSETVDLKL LQS     
Sbjct  1    MTSMLGVECDLNLRETELCLGLPGGGTSTVAEPETKATGKRGFSETVDLKLKLQSKDDLN  60

Query  267  D----LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS  434
            D    ++  +        KDP KPPAKAQVVGWPPVRSYRKN+MA    S    E     
Sbjct  61   DNVKNIASREKNDLLSCTKDPAKPPAKAQVVGWPPVRSYRKNIMAQKNTSEENTEKATVG  120

Query  435  GNN----FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNE  602
            G      FVKV MDGAPYLRKVDLK+Y +Y +LS+ALA MFSSFTTG YGAQGMIDFMNE
Sbjct  121  GGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNALAKMFSSFTTGYYGAQGMIDFMNE  180

Query  603  RKLMDLLNTSEYVP  644
             KLMDLLN+SEYVP
Sbjct  181  SKLMDLLNSSEYVP  194



>ref|XP_009777122.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=223

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 132/181 (73%), Gaps = 13/181 (7%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD--GSCLDLSE---T  281
            ++LKETELCLGLPGG          K  GKRGFSETVDLKLN Q++   S +DL E   T
Sbjct  1    MDLKETELCLGLPGGGERD------KIKGKRGFSETVDLKLNFQTNDSSSAMDLKEKIKT  54

Query  282  KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSM  461
                    NKD +KPPAKAQVVGWPPVRS+RKNVMA  QK+N   E    +   FVKV M
Sbjct  55   PTTKEIASNKDSVKPPAKAQVVGWPPVRSFRKNVMA--QKNNTEAEKSNATAAAFVKVCM  112

Query  462  DGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYV  641
            DGAPYLRKVDLK+Y +Y QLSDALA MFSSFT GNYG QGMIDFMNE KLMDLLN+SEYV
Sbjct  113  DGAPYLRKVDLKMYKSYQQLSDALAKMFSSFTMGNYGPQGMIDFMNESKLMDLLNSSEYV  172

Query  642  P  644
            P
Sbjct  173  P  173



>gb|ADB93628.1| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADL70647.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70648.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70649.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70651.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=189

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 131/179 (73%), Gaps = 4/179 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDG  467
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ QKS   EE     G    FVKVSMDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  468  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            APYLRKVDLK+Y +Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLN+SEYVP
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVP  178



>gb|ADB93627.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
Length=191

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 131/179 (73%), Gaps = 4/179 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDG  467
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ QKS   EE     G    FVKVSMDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  468  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            APYLRKVDLK+Y +Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLN+SEYVP
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVP  178



>gb|ADB93629.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
Length=190

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 131/179 (73%), Gaps = 4/179 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGTETIESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDG  467
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ QKS   EE     G    FVKVSMDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  468  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            APYLRKVDLK+Y +Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLN+SEYVP
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVP  178



>gb|ADB93625.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADB93626.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADL70643.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70644.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70645.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70646.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=190

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 131/179 (73%), Gaps = 4/179 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDG  467
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ QKS   EE     G    FVKVSMDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  468  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            APYLRKVDLK+Y +Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLN+SEYVP
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVP  178



>ref|XP_002284133.1| PREDICTED: auxin-responsive protein IAA14 [Vitis vinifera]
Length=243

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 144/192 (75%), Gaps = 10/192 (5%)
 Frame = +3

Query  87   KMTNMLG-HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC  263
            KM++MLG   G + KETELCLG     GGG E E++K +GKRGFSETVDLKLNLQS  S 
Sbjct  6    KMSSMLGAERGFDFKETELCLG--LPGGGGGEAETLKASGKRGFSETVDLKLNLQSKESV  63

Query  264  LDLSE-----TKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQ  428
            +DL+E      K +      KDP KPPAKAQVVGWPPVRS+RKN+MA    S  GE+G  
Sbjct  64   VDLNENVKCPPKEKNLLPCTKDPAKPPAKAQVVGWPPVRSFRKNIMAQKNSSEEGEKGS-  122

Query  429  KSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERK  608
             SG  FVKV MDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GNYGAQGMIDFMNE K
Sbjct  123  -SGAAFVKVCMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTMGNYGAQGMIDFMNESK  181

Query  609  LMDLLNTSEYVP  644
            LMDLLN+SEYVP
Sbjct  182  LMDLLNSSEYVP  193



>gb|AFK44393.1| unknown [Lotus japonicus]
Length=242

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 142/195 (73%), Gaps = 13/195 (7%)
 Frame = +3

Query  90   MTNMLG--HGGLNLKETELCLGLPggsgggnenesMKTT---GKRGFSETVDLKLNLQSD  254
            M  +LG     LNLKETELCLGLPGG GGG  ++ ++T    GKRGFSETVDLKLNLQS 
Sbjct  1    MATLLGKVQNDLNLKETELCLGLPGGGGGGGGSDQVETPRSNGKRGFSETVDLKLNLQSK  60

Query  255  GSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK-  431
                D     +       KDP KPPAKAQVVGWPPVRSYRKN+M   QK NN ++G +K 
Sbjct  61   EDLND-DVKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMV--QKVNNEDQGTEKT  117

Query  432  ----SGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMN  599
                +G  F KVSMDGAPYLRKVDL +Y +Y +LSDALA MFSSFT GNYGAQGMIDFMN
Sbjct  118  TSSTAGGAFAKVSMDGAPYLRKVDLTMYKSYKELSDALAKMFSSFTMGNYGAQGMIDFMN  177

Query  600  ERKLMDLLNTSEYVP  644
            E KLMDLLN+SEYVP
Sbjct  178  ESKLMDLLNSSEYVP  192



>ref|XP_009591035.1| PREDICTED: auxin-responsive protein IAA7-like [Nicotiana tomentosiformis]
Length=225

 Score =   205 bits (521),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 134/184 (73%), Gaps = 17/184 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD--GSCLDLSE----  278
            ++LKETELCLGLPGG          K  GKRGFSETVDLKLN Q++   S +DL E    
Sbjct  1    MDLKETELCLGLPGGGERD------KIKGKRGFSETVDLKLNFQTNDSSSAMDLKEKIKT  54

Query  279  TKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVK  452
               +     NKD +KPPAKAQVVGWPPVRS+RKNVMA     NN EE ++ S     FVK
Sbjct  55   PTTKEIANCNKDSVKPPAKAQVVGWPPVRSFRKNVMAQK---NNTEETEKSSATAVAFVK  111

Query  453  VSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTS  632
            V MDGAPYLRKVDLK+Y +Y QLSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLN+S
Sbjct  112  VCMDGAPYLRKVDLKMYKSYQQLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSS  171

Query  633  EYVP  644
            EYVP
Sbjct  172  EYVP  175



>gb|ADL70641.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=190

 Score =   204 bits (518),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 130/179 (73%), Gaps = 4/179 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPG +             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGCTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNVNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDG  467
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ QKS   EE     G    FVKVSMDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  468  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            APYLRKVDLK+Y +Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLN+SEYVP
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVP  178



>ref|XP_007143877.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
 gb|ESW15871.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
Length=244

 Score =   205 bits (522),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 137/197 (70%), Gaps = 15/197 (8%)
 Frame = +3

Query  90   MTNMLG-HGGLNLKETELCLGLPggsgggnenesM-------KTTGKRGFSETVDLKLNL  245
            M  MLG    LNLKETELCLGLPG  GGG             + TGKRGFSETVDLKLNL
Sbjct  1    MATMLGKEHHLNLKETELCLGLPGAGGGGGSGGGGGSEVETPRATGKRGFSETVDLKLNL  60

Query  246  QSDGSCLDLSETKMQAppepn--kdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEE  419
            Q+     DL+E    AP E    KDP K PAKAQVVGWPPVRSYRKN+M     + +G E
Sbjct  61   QAKE---DLNENLKNAPEEKTLLKDPTKQPAKAQVVGWPPVRSYRKNMMTQKVSTEDGAE  117

Query  420  GDQKS--GNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDF  593
                S     FVKVSMDGAPYLRKVDL +Y +Y  LSDALA MFSSFT GNYGAQGMIDF
Sbjct  118  KTTSSTASGAFVKVSMDGAPYLRKVDLTMYKSYKDLSDALAKMFSSFTMGNYGAQGMIDF  177

Query  594  MNERKLMDLLNTSEYVP  644
            MNERKLMDLLN+SEYVP
Sbjct  178  MNERKLMDLLNSSEYVP  194



>ref|NP_193191.2| auxin-responsive protein IAA14 [Arabidopsis thaliana]
 sp|Q38832.2|IAA14_ARATH RecName: Full=Auxin-responsive protein IAA14; AltName: Full=Indoleacetic 
acid-induced protein 14; AltName: Full=Protein SOLITARY 
ROOT [Arabidopsis thaliana]
 gb|AAG50096.1|AF334718_1 IAA14 [Arabidopsis thaliana]
 dbj|BAF00338.1| IAA14 [Arabidopsis thaliana]
 dbj|BAH30518.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83459.1| auxin-responsive protein IAA14 [Arabidopsis thaliana]
Length=228

 Score =   204 bits (520),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 131/179 (73%), Gaps = 4/179 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDG  467
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ QKS   EE     G    FVKVSMDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  468  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            APYLRKVDLK+Y +Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLN+SEYVP
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVP  178



>ref|XP_008465181.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=256

 Score =   205 bits (522),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 145/202 (72%), Gaps = 21/202 (10%)
 Frame = +3

Query  96   NMLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL---  266
            NM  +  ++LKETELCLGLPGG GGG +  S+K++GKRGFSETVDLKLNLQS        
Sbjct  7    NMPNNQFVSLKETELCLGLPGGGGGGGDQTSLKSSGKRGFSETVDLKLNLQSKDGGGGGG  66

Query  267  -----DLSETKMQAppep-------nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
                 DL+E                +KDP KPPAKAQVVGWPPVRSYRKNVMA  QK+ +
Sbjct  67   VGVGVDLNENVKNVSTNVDGEKSLCSKDPAKPPAKAQVVGWPPVRSYRKNVMA--QKNTS  124

Query  411  GEEGDQK----SGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQ  578
            G EG +K    S   FVKV MDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT G YG Q
Sbjct  125  GGEGAEKGSSGSSAAFVKVCMDGAPYLRKVDLKMYQSYQELSDALAKMFSSFTMGEYGTQ  184

Query  579  GMIDFMNERKLMDLLNTSEYVP  644
            GMIDFMNERKLMDLLN+SE+VP
Sbjct  185  GMIDFMNERKLMDLLNSSEFVP  206



>ref|NP_001240213.1| auxin-induced protein ali50 [Glycine max]
 gb|ACR39367.1| Aux/IAA protein [Glycine max]
Length=239

 Score =   204 bits (520),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 141/197 (72%), Gaps = 20/197 (10%)
 Frame = +3

Query  90   MTNMLG--HG-GLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS  260
            MT ML   HG  LNLKETELCLGLPGG          + TGKRGFSETVDLKLNLQ+   
Sbjct  1    MTTMLTNEHGLSLNLKETELCLGLPGGGSEVETP---RATGKRGFSETVDLKLNLQTKE-  56

Query  261  CLDLSET--KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS  434
              DL+E    +       KDP KPPAKAQVVGWPPVRSYRKN+MA  + SN  EE  +K+
Sbjct  57   --DLNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAVQKVSN--EEVAEKT  112

Query  435  GNN-------FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDF  593
             ++       FVKVSMDGAPYLRKVDL +Y +Y  LSDALA MFSSFT GNYGAQGMIDF
Sbjct  113  TSSTIANSGAFVKVSMDGAPYLRKVDLTMYKSYKDLSDALAKMFSSFTMGNYGAQGMIDF  172

Query  594  MNERKLMDLLNTSEYVP  644
            MNE KLMDLLN+SEYVP
Sbjct  173  MNESKLMDLLNSSEYVP  189



>emb|CAB46059.1| IAA7 like protein [Arabidopsis thaliana]
 emb|CAB78497.1| IAA7 like protein [Arabidopsis thaliana]
Length=234

 Score =   204 bits (520),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 131/179 (73%), Gaps = 4/179 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDG  467
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ QKS   EE     G    FVKVSMDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  468  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            APYLRKVDLK+Y +Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLN+SEYVP
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVP  178



>emb|CBI26357.3| unnamed protein product [Vitis vinifera]
Length=237

 Score =   204 bits (520),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 143/191 (75%), Gaps = 10/191 (5%)
 Frame = +3

Query  90   MTNMLG-HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL  266
            M++MLG   G + KETELCLG     GGG E E++K +GKRGFSETVDLKLNLQS  S +
Sbjct  1    MSSMLGAERGFDFKETELCLG--LPGGGGGEAETLKASGKRGFSETVDLKLNLQSKESVV  58

Query  267  DLSE-----TKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK  431
            DL+E      K +      KDP KPPAKAQVVGWPPVRS+RKN+MA    S  GE+G   
Sbjct  59   DLNENVKCPPKEKNLLPCTKDPAKPPAKAQVVGWPPVRSFRKNIMAQKNSSEEGEKGS--  116

Query  432  SGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKL  611
            SG  FVKV MDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GNYGAQGMIDFMNE KL
Sbjct  117  SGAAFVKVCMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTMGNYGAQGMIDFMNESKL  176

Query  612  MDLLNTSEYVP  644
            MDLLN+SEYVP
Sbjct  177  MDLLNSSEYVP  187



>ref|XP_008224185.1| PREDICTED: auxin-responsive protein IAA14 [Prunus mume]
Length=248

 Score =   204 bits (520),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 139/207 (67%), Gaps = 28/207 (14%)
 Frame = +3

Query  72   SCTSVKMTNMLG-HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQ  248
            S  S KM NMLG    LNLKETELCLGLPGG          + TGKRGFSET+DLKLNLQ
Sbjct  4    SAVSRKMPNMLGVERDLNLKETELCLGLPGGGTVPEPETP-RATGKRGFSETIDLKLNLQ  62

Query  249  SDGSCLD-------------LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMA  389
            S     D             L+ TK  A P          AKAQVVGWPPVRSYRKN+MA
Sbjct  63   SKEDLNDKVKNNASKEKNNLLTCTKYPAKPP---------AKAQVVGWPPVRSYRKNIMA  113

Query  390  HHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTG  563
              QKS++ E  ++ SG +  FVKV MDGAPYLRKVDLK+Y +Y +LS++LA MFSSFT G
Sbjct  114  --QKSSSEESTEKGSGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNSLAKMFSSFTMG  171

Query  564  NYGAQGMIDFMNERKLMDLLNTSEYVP  644
             YG QGMIDFMNE KLMDLLN+SEYVP
Sbjct  172  YYGPQGMIDFMNESKLMDLLNSSEYVP  198



>ref|XP_007223810.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
 gb|EMJ25009.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
Length=239

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 140/192 (73%), Gaps = 10/192 (5%)
 Frame = +3

Query  90   MTNMLG-HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL  266
            M NMLG    LNLKETELCLGLPGG          + TGKRGFSET+DLKLNLQS     
Sbjct  1    MPNMLGVERDLNLKETELCLGLPGGGTVPEPETP-RATGKRGFSETIDLKLNLQSKEDLN  59

Query  267  D----LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS  434
            D    ++  +        KDP KPPAKAQVVGWPPVRSYRKN+MA  QKS++ E  ++ S
Sbjct  60   DNVKNIASKEKNNLLTCTKDPAKPPAKAQVVGWPPVRSYRKNIMA--QKSSSEESTEKGS  117

Query  435  GNN--FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERK  608
            G +  FVKV MDGAPYLRKVDLK+Y +Y +LS++LA MFSSFT G YGAQGMIDFMNE K
Sbjct  118  GCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNSLAKMFSSFTMGYYGAQGMIDFMNESK  177

Query  609  LMDLLNTSEYVP  644
            LMDLLN+SEYVP
Sbjct  178  LMDLLNSSEYVP  189



>ref|XP_009337294.1| PREDICTED: auxin-responsive protein IAA14-like [Pyrus x bretschneideri]
Length=244

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 144/196 (73%), Gaps = 13/196 (7%)
 Frame = +3

Query  90   MTNMLG-HGGLNLKETELCLGLPgg-sgggnenesMKTTGKRGFSETVDLKLNLQSDGSC  263
            MT+MLG    LNL+ETELCLGLPGG +    E E+ KTTGKRGFSETVDLKLNLQS    
Sbjct  1    MTSMLGVERDLNLRETELCLGLPGGGTTTVAEPETAKTTGKRGFSETVDLKLNLQSKEDL  60

Query  264  LD----LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK  431
             D    ++           KDP KPPAKAQVVGWPPVRSYRKN+M+  QK+ + E+ ++ 
Sbjct  61   NDNVKNIASKDKNNLLSCTKDPSKPPAKAQVVGWPPVRSYRKNIMS--QKNTSEEKTEKA  118

Query  432  SGNN-----FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFM  596
            SG       FVKV MDGAPYLRKVDLK+Y +Y +LS+AL+ MFSSFTTG YG QGMIDFM
Sbjct  119  SGGGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNALSKMFSSFTTGYYGTQGMIDFM  178

Query  597  NERKLMDLLNTSEYVP  644
            NE KLMDLLN+SEYVP
Sbjct  179  NESKLMDLLNSSEYVP  194



>ref|XP_011091113.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=241

 Score =   202 bits (515),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 142/193 (74%), Gaps = 14/193 (7%)
 Frame = +3

Query  87   KMTNMLGH-GGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-DGS  260
            KM  +L    GLNLKETEL          G    + K TGKRGFSETVDLKLNLQ  + +
Sbjct  6    KMGGLLAEEQGLNLKETEL-----CLGLPGGGGGADKITGKRGFSETVDLKLNLQPNESA  60

Query  261  CLDLSETK-MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSG  437
             LDL ET  M  P  P KDP+KPPAKAQVVGWPPVRS+RKN+MAH + S+  EE ++ + 
Sbjct  61   ALDLKETSAMDKPVLPPKDPVKPPAKAQVVGWPPVRSFRKNIMAHQKSSD--EEAEKAAC  118

Query  438  NN----FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNER  605
            ++    FVKVSMDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT GNYG QGMIDFMNE 
Sbjct  119  SSPTAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGTQGMIDFMNES  178

Query  606  KLMDLLNTSEYVP  644
            KLMDLLN+SEYVP
Sbjct  179  KLMDLLNSSEYVP  191



>ref|XP_010551700.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=234

 Score =   202 bits (513),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 131/184 (71%), Gaps = 13/184 (7%)
 Frame = +3

Query  117  LNLKETELCLGLP-----ggsgggnenesMKTTG-KRGFSETVDLKLNLQS--DGSCLDL  272
            +NLKETELCLGLP                  T G KRGFSETVDLKLNLQ+  +G  +DL
Sbjct  6    MNLKETELCLGLPGSGGGEAEAVVESPAKAATVGNKRGFSETVDLKLNLQTNEEGRVVDL  65

Query  273  SETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVK  452
            +    +      KD  KPPAKAQVVGWPPVR+YRKN+MA  + S+  EE  +K+   FVK
Sbjct  66   NAGDPKNFAGATKDKNKPPAKAQVVGWPPVRNYRKNMMAQQKSSSAVEE--EKA---FVK  120

Query  453  VSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTS  632
            VSMDGAPYLRKVDLK+Y  Y  LSDALA MFSSFT GNYG+QGMIDFMNE KLMDLLN+S
Sbjct  121  VSMDGAPYLRKVDLKIYQCYQDLSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSS  180

Query  633  EYVP  644
            EYVP
Sbjct  181  EYVP  184



>ref|NP_001280875.1| auxin-responsive protein IAA14-like [Malus domestica]
 gb|ADL36585.1| ARF domain class transcription factor [Malus domestica]
Length=244

 Score =   202 bits (513),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 142/196 (72%), Gaps = 13/196 (7%)
 Frame = +3

Query  90   MTNMLG-HGGLNLKETELCLGLPgg-sgggnenesMKTTGKRGFSETVDLKLNLQSDGSC  263
            M +MLG    LNL+ETELCLGLPGG +    E E+ KTTGKRGFSET+DLKLNLQS    
Sbjct  1    MMSMLGVERDLNLRETELCLGLPGGGTTTVAEPETAKTTGKRGFSETIDLKLNLQSKEDL  60

Query  264  LD----LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK  431
             D    ++           KDP KPPAKAQVVGWPPVRSYRKN+MA  QK+ + E+  + 
Sbjct  61   NDNVKNIASKDKNNFLSCTKDPSKPPAKAQVVGWPPVRSYRKNIMA--QKNTSEEKTKKA  118

Query  432  SGNN-----FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFM  596
            SG       FVKV MDGAPYLRKVDLK+Y +Y +LS+ALA MFSSFTTG YG QGMIDFM
Sbjct  119  SGGGGCTAAFVKVCMDGAPYLRKVDLKMYKSYQELSNALAKMFSSFTTGYYGTQGMIDFM  178

Query  597  NERKLMDLLNTSEYVP  644
            NE KLMDLLN+SEYVP
Sbjct  179  NESKLMDLLNSSEYVP  194



>ref|XP_006298251.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
 gb|EOA31149.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
Length=285

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 136/188 (72%), Gaps = 6/188 (3%)
 Frame = +3

Query  93   TNMLGHGGLNLKETELCLGLPggsgggnenesMKTTG-KRGFSETVDLKLNLQS--DGSC  263
             NM+G   +NLK TELCLGLPGG+    E+ +    G KRGFSETVDL LNLQS  +GS 
Sbjct  49   VNMIGQL-MNLKATELCLGLPGGADQAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGS-  106

Query  264  LDLSETKMQAppepnkd-pikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN  440
            +DL+        +     P KPPAKAQVVGWPPVR+YRKN+M   + S   E   +K+G 
Sbjct  107  VDLNNVAASPKEKNLIKDPAKPPAKAQVVGWPPVRNYRKNIMTQQKTSGTEEASSEKAGA  166

Query  441  NFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDL  620
              VKVSMDGAPYLRKVDLK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLM+L
Sbjct  167  GLVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNL  226

Query  621  LNTSEYVP  644
            LN+SEYVP
Sbjct  227  LNSSEYVP  234



>ref|XP_002315736.1| aux/IAA family protein [Populus trichocarpa]
 gb|EEF01907.1| aux/IAA family protein [Populus trichocarpa]
Length=277

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 140/214 (65%), Gaps = 38/214 (18%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesM-KTTGKRGFSETVDLKLNLQSDGSCLDLSET----  281
            LN KETELCLGLPG  G  NE E+  K TGKRGF+ETVDLKLNLQ+    +DL+E     
Sbjct  14   LNYKETELCLGLPGAVGVKNEVETPNKATGKRGFAETVDLKLNLQAKEGVMDLNENIKNI  73

Query  282  ----KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNG------------  413
                K   P +  KDP KPPAKAQVVGWPPVRSYRKNV+A    S  G            
Sbjct  74   ASKDKNHLPADTIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASEEGFRAQVVGWPPLR  133

Query  414  -------------EEGDQKSGNN----FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANM  542
                         EEGD+ S       FVKV MDGAPYLRKVDLK+Y +Y +LSDALA M
Sbjct  134  SYRKNVLTQKNASEEGDKASTGGSSAAFVKVCMDGAPYLRKVDLKMYKSYQELSDALAKM  193

Query  543  FSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            FSSFT GNYGAQGMIDFMNE KLMDLLN+SEYVP
Sbjct  194  FSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVP  227



>ref|XP_002868277.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44536.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 130/179 (73%), Gaps = 4/179 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS-CLDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETV LKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGAETVECPSKSGVGNKRGFSETVGLKLNLQSNKQGPVDLNVNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDG  467
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ QKS   EE     G    FVKVSMDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  468  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            APYLRKVDLK+Y +Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLN+SEYVP
Sbjct  120  APYLRKVDLKMYKSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVP  178



>ref|XP_010435110.1| PREDICTED: auxin-responsive protein IAA14 [Camelina sativa]
Length=228

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 128/178 (72%), Gaps = 2/178 (1%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL-DLSETKMQA  293
            +NL ETELCLGLPGG+             KRGFSETVDLKLNLQS+     DL+      
Sbjct  1    MNLTETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHGDLNVAGSIK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN-NFVKVSMDGA  470
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+H+     E      G   FVKVSMDGA
Sbjct  61   EKTLLKDPAKPPAKAQVVGWPPVRNYRKNVMANHKNGEPDEAMSSAGGTVAFVKVSMDGA  120

Query  471  PYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            PYLRKVDLK+YN+Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLN+SEYVP
Sbjct  121  PYLRKVDLKMYNSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVP  178



>ref|XP_010552451.1| PREDICTED: auxin-responsive protein IAA14-like [Tarenaya hassleriana]
Length=235

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 139/183 (76%), Gaps = 10/183 (5%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesM-----KTTG-KRGFSETVDLKLNLQSDGS-CLDLS  275
            +N+KETELCLGLPGG GGG E E +     K  G KRGFSETVDLKLNLQ++    +DL+
Sbjct  6    MNMKETELCLGLPGGGGGGGEAEVVAESPAKAAGNKRGFSETVDLKLNLQTNKEGVVDLN  65

Query  276  ETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKV  455
                      +KD  KPPAKAQVVGWPPVR+YRKN+MAH + S   E   +K+   FVKV
Sbjct  66   NVAKDKSLLVSKDHAKPPAKAQVVGWPPVRNYRKNMMAHQKSSAVEE---EKAAAAFVKV  122

Query  456  SMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSE  635
            SMDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLN+SE
Sbjct  123  SMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSE  182

Query  636  YVP  644
            YVP
Sbjct  183  YVP  185



>gb|KHN30563.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=233

 Score =   199 bits (507),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 136/189 (72%), Gaps = 18/189 (10%)
 Frame = +3

Query  108  HG-GLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSET-  281
            HG  LNLKETELCLGLPGG          + TGKRGFSETVDLKLNLQ+     DL+E  
Sbjct  6    HGLSLNLKETELCLGLPGGGSEVETP---RATGKRGFSETVDLKLNLQTKE---DLNENL  59

Query  282  -KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-----  443
              +       KDP KPPAKAQVVGWPPVRSYRKN+MA  + S   EE  +K+ ++     
Sbjct  60   KNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAVQKVST--EEVAEKTTSSTTANS  117

Query  444  --FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMD  617
              FVKVSMDGAPYLRKVDL +Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLMD
Sbjct  118  GAFVKVSMDGAPYLRKVDLTMYKSYKDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMD  177

Query  618  LLNTSEYVP  644
            LLN+SEYVP
Sbjct  178  LLNSSEYVP  186



>ref|XP_010087762.1| Auxin-responsive protein IAA7 [Morus notabilis]
 gb|EXB29843.1| Auxin-responsive protein IAA7 [Morus notabilis]
Length=304

 Score =   202 bits (513),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 129/198 (65%), Gaps = 22/198 (11%)
 Frame = +3

Query  117  LNLKETELCLGLP-------ggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLS  275
            LN KETELCLGLP         +          TTGKRG+SETVDLKLNL       DL+
Sbjct  8    LNFKETELCLGLPGGCGITAEPAAAETPTRPAATTGKRGYSETVDLKLNLHRQSVKEDLN  67

Query  276  ETKMQAppepnkdp---------ikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQ  428
            E  +++   P K+           KPPAKAQVVGWPPVRSYRKN+MA    +N      +
Sbjct  68   EINIKSTSAPPKEKNLLPCTKDPAKPPAKAQVVGWPPVRSYRKNIMAQKMSTNEESSPHE  127

Query  429  K------SGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMID  590
            K      S   FVKV MDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT GNYGAQGMID
Sbjct  128  KTSSSSNSAGAFVKVCMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGAQGMID  187

Query  591  FMNERKLMDLLNTSEYVP  644
            FMNE KLMDLLN+SEYVP
Sbjct  188  FMNESKLMDLLNSSEYVP  205



>ref|XP_006414696.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
 gb|ESQ56149.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
Length=257

 Score =   200 bits (508),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 132/182 (73%), Gaps = 9/182 (5%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            + LKETELCLGLPGG              KRGFSETVD KLNLQS+    +DL+ T   A
Sbjct  29   MKLKETELCLGLPGGVETVETPTKSGVGNKRGFSETVDFKLNLQSNKQGHVDLNVT--VA  86

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-----FVKVS  458
              E  KDP KPPAKAQVVGWPPVR+YRK+VMAH QKS+  EE     G       FVKVS
Sbjct  87   HKEKTKDPAKPPAKAQVVGWPPVRNYRKSVMAH-QKSSEVEEASSCGGGRGGTVAFVKVS  145

Query  459  MDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEY  638
            MDGAPYLRKVDLK+Y +Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLN+SEY
Sbjct  146  MDGAPYLRKVDLKMYKSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEY  205

Query  639  VP  644
            VP
Sbjct  206  VP  207



>ref|XP_004288427.1| PREDICTED: auxin-responsive protein IAA14-like [Fragaria vesca 
subsp. vesca]
Length=238

 Score =   199 bits (507),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 130/181 (72%), Gaps = 7/181 (4%)
 Frame = +3

Query  117  LNLKETELCLGLP--ggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQ  290
            LN KETELCLGLP         E  + K TGKRGFSETVDLKLNL ++   ++ S   + 
Sbjct  10   LNFKETELCLGLPGGAALTTEPEICTPKATGKRGFSETVDLKLNLHANEGLMNESVKNVS  69

Query  291  Appep---nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSM  461
            +  +     KDP KPPAKAQVVGWPPVRS+RKNVMA  QKS   E         FVKV M
Sbjct  70   SREKNLPCIKDPAKPPAKAQVVGWPPVRSFRKNVMA--QKSTGEESSTTTEKAAFVKVCM  127

Query  462  DGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYV  641
            DGAPYLRKVDLK+Y +Y +LSDAL+ MFSSFTTG YGAQGMIDFMNE KLMDLLN++EYV
Sbjct  128  DGAPYLRKVDLKMYKSYKELSDALSKMFSSFTTGYYGAQGMIDFMNESKLMDLLNSTEYV  187

Query  642  P  644
            P
Sbjct  188  P  188



>dbj|BAH15071.1| indole-3-acetic acid 14 transcription factor like [Malus prunifolia]
Length=243

 Score =   199 bits (506),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 138/196 (70%), Gaps = 14/196 (7%)
 Frame = +3

Query  90   MTNMLG-HGGLNLKETELCLGLPgg-sgggnenesMKTTGKRGFSETVDLKLNLQSDGSC  263
            M +MLG    LNL+E ELCLGLPGG +    E E+ KTTGKRGFSET+DLKLNLQS    
Sbjct  1    MMSMLGVERDLNLREAELCLGLPGGGTTTVAEPETAKTTGKRGFSETIDLKLNLQSKEDL  60

Query  264  LD----LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK  431
             D    ++           KDP KPPAKAQVVGWPPVRSYRKNVMA     N  EE  +K
Sbjct  61   NDNVKNIASKDKNNFLSCTKDPSKPPAKAQVVGWPPVRSYRKNVMAQK---NTSEEKTKK  117

Query  432  SGNN-----FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFM  596
            +        FVKV MDGAPYLRKVDLK+Y +Y +LS+ALA MFSSFTTG YG QGMIDFM
Sbjct  118  ASAGGCTAAFVKVCMDGAPYLRKVDLKMYRSYQELSNALAKMFSSFTTGYYGDQGMIDFM  177

Query  597  NERKLMDLLNTSEYVP  644
            NE KLMDLLN+SEYVP
Sbjct  178  NESKLMDLLNSSEYVP  193



>gb|KHN05057.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=245

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 137/189 (72%), Gaps = 15/189 (8%)
 Frame = +3

Query  114  GLNLKETELCLGLPggsggg------nenesMKTTGKRGFSETVDLKLNLQSDGSCLDLS  275
            GLNLKETELCLGLPGG          +E E+ + TGKRGFSETVDLKLNL S     DL+
Sbjct  10   GLNLKETELCLGLPGGELCLGLPGGGSEVETPRATGKRGFSETVDLKLNLHSKE---DLN  66

Query  276  ET--KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN--GEEGDQKSGNN  443
            E    +       KDP KPPAKAQVVGWPPVRSYRKN+MA  + S     E+    + N+
Sbjct  67   ENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAVQKVSTEDVAEKTTSSTANS  126

Query  444  --FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMD  617
              FVKVSMDGAPYLRKVDL +Y +Y +LSDALA MFSSFT GNYGAQGMIDFMNE KLMD
Sbjct  127  GAFVKVSMDGAPYLRKVDLTMYKSYKELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMD  186

Query  618  LLNTSEYVP  644
            LLN+SEYVP
Sbjct  187  LLNSSEYVP  195



>gb|KFK39592.1| hypothetical protein AALP_AA3G264300 [Arabis alpina]
Length=235

 Score =   199 bits (505),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 126/179 (70%), Gaps = 3/179 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS-CLDLSETKMQA  293
            +NLK TELCLGLPGG+             KRGFSETVDL LNLQS+    +DL+      
Sbjct  6    MNLKATELCLGLPGGTEAVESPAKSAVGNKRGFSETVDLMLNLQSNKEEAVDLNNIAAAP  65

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDG  467
                 KDP KPPAKAQVVGWPPVR+YRKN+M   + + + E    K+G     VKVSMDG
Sbjct  66   KESLLKDPTKPPAKAQVVGWPPVRNYRKNMMTQQKTTGSEEASSDKAGTGAALVKVSMDG  125

Query  468  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            APYLRKVDL +Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLN+SEYVP
Sbjct  126  APYLRKVDLNMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVP  184



>ref|XP_007034957.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
 gb|EOY05883.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
Length=204

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 126/160 (79%), Gaps = 11/160 (7%)
 Frame = +3

Query  192  KTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAppepn------kdpikppAKAQVVGW  353
            KTTGKRGFSETVDLKLNLQS  + +DL++       E        KDP KPPAKAQVVGW
Sbjct  10   KTTGKRGFSETVDLKLNLQSKETGMDLNKNIENGSKEKTLLPACTKDPAKPPAKAQVVGW  69

Query  354  PPVRSYRKNVMAHHQKSNNGEEGDQKS---GNNFVKVSMDGAPYLRKVDLKVYNTYNQLS  524
            PPVRSYRKN+MA+ +  N+ EE D+K+   G  FVKVSMDGAPYLRKVDLK+Y +Y +LS
Sbjct  70   PPVRSYRKNIMANQK--NSCEESDKKASSGGAAFVKVSMDGAPYLRKVDLKMYKSYQELS  127

Query  525  DALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            DALA MFSSFT GNYGAQGMIDFMNE KLMDLLN+S+YVP
Sbjct  128  DALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSDYVP  167



>gb|ADL70640.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=172

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 126/173 (73%), Gaps = 4/173 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDG  467
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ QKS   EE     G    FVKVSMDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  468  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLN  626
            APYLRKVDLK+YN+Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLN
Sbjct  120  APYLRKVDLKMYNSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLN  172



>gb|AFS44507.1| auxin repressor, partial [Fragaria x ananassa]
Length=231

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 129/181 (71%), Gaps = 7/181 (4%)
 Frame = +3

Query  117  LNLKETELCLGLP--ggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQ  290
            LN KETELCLGLP         E  + K TGKRGFSETVDLKLNL ++   ++ S   + 
Sbjct  3    LNFKETELCLGLPGGAALTTEPEICTPKATGKRGFSETVDLKLNLHANEGLMNESVKNVS  62

Query  291  Appep---nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSM  461
            +  +     KDP KPPAKAQVVGWPPVRSYRKNVMA  QKS   E         FVKV M
Sbjct  63   SREKNLPCIKDPAKPPAKAQVVGWPPVRSYRKNVMA--QKSTGEESSTTTEKAAFVKVCM  120

Query  462  DGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYV  641
            DGAPYLRKVDLK+Y +Y +LSDAL+ MFSSFTTG YG QGMIDFMNE KLMDLLN+++YV
Sbjct  121  DGAPYLRKVDLKMYKSYKELSDALSKMFSSFTTGYYGTQGMIDFMNESKLMDLLNSTDYV  180

Query  642  P  644
            P
Sbjct  181  P  181



>ref|XP_010440448.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score =   197 bits (500),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 134/179 (75%), Gaps = 7/179 (4%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL-DLSETKMQA  293
            +NLKETELCLGLPGG+    ++       KRGFSETVDLKLNLQS+     DL+      
Sbjct  1    MNLKETELCLGLPGGTETVAKSG---VGNKRGFSETVDLKLNLQSNKQGHGDLNVAGSIK  57

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDG  467
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ QK+   +E    +G    FVKVSMDG
Sbjct  58   EKTLLKDPAKPPAKAQVVGWPPVRNYRKNVMAN-QKNGETDEAMSSAGGTVAFVKVSMDG  116

Query  468  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            APYLRKVDLK+YN+Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLN+SEYVP
Sbjct  117  APYLRKVDLKMYNSYKNLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVP  175



>ref|XP_003556389.2| PREDICTED: auxin-responsive protein IAA14-like [Glycine max]
Length=331

 Score =   200 bits (508),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 139/201 (69%), Gaps = 18/201 (9%)
 Frame = +3

Query  87   KMTNML-GHGGLNLKETELCLGLPggsgggnenesM--------KTTGKRGFSETVDLKL  239
            +M  ML    GLNLKETELCLGLPGG GGG              + TGKRGFSETVDLKL
Sbjct  84   EMATMLTKEHGLNLKETELCLGLPGGGGGGGGGGGGGGGEVETPRATGKRGFSETVDLKL  143

Query  240  NLQSDGSCLDLSE--TKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN-  410
            NL S     DL+E    +       KDP KPPAKAQVVGWPPVRSYRKN+MA  + S   
Sbjct  144  NLHSKE---DLNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAVQKVSTED  200

Query  411  -GEEGDQKSGN--NFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQG  581
              E+    + N   FVKVSMDGAPYLRKVDL +Y +Y +LSDALA MFSSFT GNYGAQG
Sbjct  201  VAEKTTSSTANPGAFVKVSMDGAPYLRKVDLTMYKSYKELSDALAKMFSSFTMGNYGAQG  260

Query  582  MIDFMNERKLMDLLNTSEYVP  644
            MIDFMNE KLMDLLN+SEYVP
Sbjct  261  MIDFMNESKLMDLLNSSEYVP  281



>emb|CAC84710.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=277

 Score =   197 bits (502),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 137/214 (64%), Gaps = 38/214 (18%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesM-KTTGKRGFSETVDLKLNLQSDGSCLDL-------  272
            LN K TELCLGLPG  G  NE E+  K TGKRGF+ETVDLKLNLQ+    +DL       
Sbjct  14   LNYKATELCLGLPGAVGVKNEVETPNKATGKRGFAETVDLKLNLQAKEGVMDLNENINNI  73

Query  273  -SETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNG------------  413
             SE K   P    KDP KPPAKAQVVGWPPVRSYRKNV+A    S  G            
Sbjct  74   ASEDKNHLPSATIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASEEGFGAQVEGWPPVR  133

Query  414  -------------EEGDQKSGNN----FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANM  542
                         EEG++ S       FVKV MDGAPYLRKVDLK+Y +Y +LSDALA M
Sbjct  134  SYRKNVLVQKNASEEGEKASTGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSDALAKM  193

Query  543  FSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            FSS T GNYGAQGMIDFMNE KLMDLLN+SEYVP
Sbjct  194  FSSLTMGNYGAQGMIDFMNESKLMDLLNSSEYVP  227



>gb|ADL70642.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70650.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=172

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 125/173 (72%), Gaps = 4/173 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDG  467
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ QKS   EE     G    FVKVSMDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  468  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLN  626
            APYLRKVDLK+Y +Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLN
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLN  172



>ref|XP_006362195.1| PREDICTED: auxin-responsive protein IAA14-like [Solanum tuberosum]
Length=238

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 136/193 (70%), Gaps = 22/193 (11%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesM--------KTTGKRGFSETVDLKLNLQS---DGSC  263
            ++LKETELCLGLPGG GGG     +        K  GKRGFSETVDLKLN      D SC
Sbjct  1    MDLKETELCLGLPGGGGGGGGGGELIRDNNNNNKINGKRGFSETVDLKLNFHQANDDISC  60

Query  264  LDLSETKMQAppepnkdpi------kppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGD  425
              +   KM+      K+ +      KPPAKAQVVGWPPVRS+RKNVMA  QKSN  E   
Sbjct  61   A-MENNKMKNSVTTTKEVVCNKDPIKPPAKAQVVGWPPVRSFRKNVMA--QKSNTEES--  115

Query  426  QKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNER  605
            +K+   FVKV MDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT GNYG+QGMIDFMNE 
Sbjct  116  EKTTVAFVKVCMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTNGNYGSQGMIDFMNES  175

Query  606  KLMDLLNTSEYVP  644
            KLMDLLN+SEYVP
Sbjct  176  KLMDLLNSSEYVP  188



>ref|XP_006284476.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
 gb|EOA17374.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
Length=228

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 129/179 (72%), Gaps = 4/179 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL-DLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+     DL+ +    
Sbjct  1    MNLKETELCLGLPGGAETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHGDLNVSGSIK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDG  467
                 +DP KPP KAQVVGWPPVR+YRK VMA  QK+   EE     G    FVKVSMDG
Sbjct  61   EKTLLQDPTKPPTKAQVVGWPPVRNYRKTVMAT-QKNGETEETMSSGGGTIAFVKVSMDG  119

Query  468  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            APYLRKVDL++YN+Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLN+SEYVP
Sbjct  120  APYLRKVDLRMYNSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVP  178



>ref|XP_011032399.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=249

 Score =   195 bits (496),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 143/201 (71%), Gaps = 18/201 (9%)
 Frame = +3

Query  90   MTNMLG------HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS  251
            MT+++G      +  +N +ETEL LGLPGG   GN+ E+ K+ GKRGFSETVDLKLNL +
Sbjct  1    MTSIMGAEPADTYSMINFEETELRLGLPGGVSNGNDAEAAKSNGKRGFSETVDLKLNLST  60

Query  252  -----DGSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGE  416
                 DGS  +   TK +       DP KPP+KAQVVGWPP+RS+RKNVMA  +  NN +
Sbjct  61   KETGKDGSDQEKVATKEKTVAPRPNDPAKPPSKAQVVGWPPIRSFRKNVMAVQK--NNND  118

Query  417  EGDQKS-----GNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQG  581
            EG++ S     G  FVKVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QG
Sbjct  119  EGEKASSSGTTGAAFVKVSMDGAPYLRKVDLKLYKSYRELSDALGKMFSSFTIGNCGSQG  178

Query  582  MIDFMNERKLMDLLNTSEYVP  644
              DFMNE KL+DLLN+SEYVP
Sbjct  179  TKDFMNESKLIDLLNSSEYVP  199



>ref|XP_010450026.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score =   194 bits (492),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 133/179 (74%), Gaps = 7/179 (4%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL-DLSETKMQA  293
            +NLKETELCLGLPGG+    ++       KRGFSETVDLKLNLQS+     DL+      
Sbjct  1    MNLKETELCLGLPGGTETVAKSG---VGNKRGFSETVDLKLNLQSNKQGHGDLNVAGSIK  57

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDG  467
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ QK+   +E    +G    FVKVSMDG
Sbjct  58   EKTLLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKNGETDEAMSSAGGTVAFVKVSMDG  116

Query  468  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            APYLRKVDLK+YN+Y  LSDALA MFSSFT  +YGAQGMIDFMNE K+MDLLN+SEYVP
Sbjct  117  APYLRKVDLKMYNSYKDLSDALAKMFSSFTMESYGAQGMIDFMNESKVMDLLNSSEYVP  175



>ref|NP_974355.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AEE76709.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
Length=210

 Score =   193 bits (490),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 129/187 (69%), Gaps = 11/187 (6%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS--DGSCLDLSETKMQ  290
            +NLK TELCLGLPGG+             KRGFSETVDL LNLQS  +GS    + + + 
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVP  65

Query  291  AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK---------SGNN  443
                  KDP KPPAKAQVVGWPPVR+YRKN+M   + S+  EE   +         +G  
Sbjct  66   KEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAG  125

Query  444  FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLL  623
             VKVSMDGAPYLRKVDLK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLM+LL
Sbjct  126  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLL  185

Query  624  NTSEYVP  644
            N+SEYVP
Sbjct  186  NSSEYVP  192



>ref|XP_009776553.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=244

 Score =   194 bits (493),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 121/155 (78%), Gaps = 9/155 (6%)
 Frame = +3

Query  198  TGKRGFSETVDLKLNLQSDGSCLDLSETKMQ--AppepnkdpikppAKAQVVGWPPVRSY  371
            T KRGFSETVDLKLNLQS+   LDLS+ K++  +    NKD  KPPAK QVVGWPPVRSY
Sbjct  43   TKKRGFSETVDLKLNLQSN---LDLSKEKIKNPSKETCNKDSAKPPAKTQVVGWPPVRSY  99

Query  372  RKNVMAHHQKSNNGEEGDQKSG----NNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALAN  539
            RKN+MA    S   E  + K G      FVKVSMDGAPYLRKVDLK+Y +Y QLSDALAN
Sbjct  100  RKNIMAQKGGSICEESENSKGGICSSAAFVKVSMDGAPYLRKVDLKMYKSYQQLSDALAN  159

Query  540  MFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            MFSSFT GNYGAQGMIDFMNERKLMDLLN+S+YVP
Sbjct  160  MFSSFTMGNYGAQGMIDFMNERKLMDLLNSSDYVP  194



>gb|ADL70639.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=171

 Score =   192 bits (487),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 124/172 (72%), Gaps = 4/172 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDG  467
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ QKS   EE     G    FVKVSMDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  468  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLL  623
            APYLRKVDLK+Y +Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLL
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLL  171



>ref|XP_011038568.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=246

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 143/196 (73%), Gaps = 11/196 (6%)
 Frame = +3

Query  90   MTNMLG-----HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD  254
            MT+++G     +  +N +ETEL LGLPGG G GN+ E  K+ GKRGFSETVDLKLNL + 
Sbjct  1    MTSIMGAEPEKYSMINFEETELRLGLPGGIGNGNDGEVAKSNGKRGFSETVDLKLNLSTK  60

Query  255  GSCLDLSETKMQ----AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN-NGEE  419
             S   + E K+       P  + DP KPPAKAQVVGWPP+RS+RKNVMA  + SN NGE+
Sbjct  61   ESGKGVVEEKVMKEKTVAPPASTDPAKPPAKAQVVGWPPIRSFRKNVMAVQKNSNDNGEK  120

Query  420  -GDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFM  596
             G   +G  FVKVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DFM
Sbjct  121  SGSGGAGVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFM  180

Query  597  NERKLMDLLNTSEYVP  644
            NE KL+DLLN SEYVP
Sbjct  181  NESKLIDLLNGSEYVP  196



>ref|XP_009135842.1| PREDICTED: auxin-responsive protein IAA7-like [Brassica rapa]
 emb|CDX92973.1| BnaA03g36950D [Brassica napus]
Length=237

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 125/181 (69%), Gaps = 5/181 (3%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS-CLDLSETKMQA  293
            +NL  TELCLGLPGG+             KRGFSET+DL LNLQ +    +DL+      
Sbjct  6    MNLNATELCLGLPGGTKAVESPAKSSVRNKRGFSETMDLMLNLQCNKEETVDLNNATASK  65

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN----FVKVSM  461
                 KDP KPPAKAQVVGWPPVR+YRKN+M   + S   E   +K+GN      VKVSM
Sbjct  66   EKTLLKDPAKPPAKAQVVGWPPVRNYRKNMMTQQKTSGEEEASSEKAGNGGGAALVKVSM  125

Query  462  DGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYV  641
            DGAPYLRKVDL +Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLM+LLN+SEYV
Sbjct  126  DGAPYLRKVDLTMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYV  185

Query  642  P  644
            P
Sbjct  186  P  186



>gb|EYU32514.1| hypothetical protein MIMGU_mgv1a012542mg [Erythranthe guttata]
Length=247

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 138/192 (72%), Gaps = 12/192 (6%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD-----GSC  263
            M G  GLN  ETELCLGL  G GGG   + +KTTGKRGFSETVDLKLNLQS+        
Sbjct  8    MAGLHGLNFMETELCLGL-PGGGGGESTDPIKTTGKRGFSETVDLKLNLQSNEPPSSSDL  66

Query  264  LDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQ-----  428
            +++S T++ A   P      P AKAQVVGWPPVRS+RKN+++H + S+  ++ D      
Sbjct  67   INISSTEINAMLPPKDPIKPP-AKAQVVGWPPVRSFRKNIISHQKSSSPADQQDSDKAAA  125

Query  429  KSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERK  608
                 FVKVSMDGAPYLRKVDLK+Y  Y +LSDALA MFSSFT GNYG++GMIDFMNE K
Sbjct  126  ACSAAFVKVSMDGAPYLRKVDLKMYGAYQELSDALAKMFSSFTMGNYGSEGMIDFMNEGK  185

Query  609  LMDLLNTSEYVP  644
            LMDLLN+SEYVP
Sbjct  186  LMDLLNSSEYVP  197



>emb|CDY62130.1| BnaC08g47390D [Brassica napus]
Length=233

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 128/180 (71%), Gaps = 5/180 (3%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS--DGSCLDLSETKMQ  290
            +NLKETELCLGLPGG              KRGFSE V+LKL L S   GS +DL+     
Sbjct  5    INLKETELCLGLPGGPDPVETPTKSCLRNKRGFSEIVELKLGLHSTKQGS-VDLNVAGAP  63

Query  291  AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMD  464
                 +KDP KPPAKAQVVGWPPVR+YRK+VM H + S   E    + G    FVKVSMD
Sbjct  64   KEKTLHKDPSKPPAKAQVVGWPPVRNYRKSVMTHQKCSEVEEASSDRGGGTVAFVKVSMD  123

Query  465  GAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            GAPYLRKVDLK+Y +Y +LSDALA MFSSFT G+YGAQGMIDFMNE K+MDL+N+SEYVP
Sbjct  124  GAPYLRKVDLKMYTSYKELSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLVNSSEYVP  183



>emb|CDY47148.1| BnaA08g05350D [Brassica napus]
Length=233

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 129/180 (72%), Gaps = 5/180 (3%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS--DGSCLDLSETKMQ  290
            +NLKETELCLGLPGG              KRGFSE V+LKL L S  +GS +DL+     
Sbjct  5    INLKETELCLGLPGGPDPVETPTKSCLRNKRGFSEIVELKLGLHSTKEGS-VDLNVAGAP  63

Query  291  AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMD  464
                 +KDP KPPAKAQVVGWPPVR+YRK+VM H + S   E    + G    FVKVSMD
Sbjct  64   KEKTLHKDPSKPPAKAQVVGWPPVRNYRKSVMTHQKCSEVEEASSDRGGGTVAFVKVSMD  123

Query  465  GAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            GAPYLRKVDLK+Y +Y +LSDALA MFSSFT G+YGAQGMIDFMNE K+MDL+N+S+YVP
Sbjct  124  GAPYLRKVDLKMYTSYKELSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLVNSSDYVP  183



>gb|AAM65301.1| indoleacetic acid (IAA)-inducible gene (IAA7) [Arabidopsis thaliana]
Length=238

 Score =   192 bits (489),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 129/187 (69%), Gaps = 11/187 (6%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS--DGSCLDLSETKMQ  290
            +NLK TELCLGLPGG+             KRGFSETVDL LNLQS  +GS    + + + 
Sbjct  1    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVP  60

Query  291  AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK---------SGNN  443
                  KDP KPPAKAQVVGWPPVR+YRKN+M   + S+  EE   +         +G  
Sbjct  61   KEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAG  120

Query  444  FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLL  623
             VKVSMDGAPYLRKVDLK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLM+LL
Sbjct  121  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLL  180

Query  624  NTSEYVP  644
            N+SEYVP
Sbjct  181  NSSEYVP  187



>ref|NP_188945.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 sp|Q38825.1|IAA7_ARATH RecName: Full=Auxin-responsive protein IAA7; AltName: Full=Auxin 
resistant 2; AltName: Full=Indoleacetic acid-induced protein 
7 [Arabidopsis thaliana]
 gb|AAG48759.1|AF332395_1 indoleacetic acid-inducible protein IAA7 [Arabidopsis thaliana]
 gb|AAC49048.1| IAA7 [Arabidopsis thaliana]
 dbj|BAB02096.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAK96842.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAL66876.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AEE76710.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
Length=243

 Score =   192 bits (489),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 128/187 (68%), Gaps = 11/187 (6%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS--DGSCLDLSETKMQ  290
            +NLK TELCLGLPGG+             KRGFSETVDL LNLQS  +GS    + + + 
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVP  65

Query  291  AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN---------  443
                  KDP KPPAKAQVVGWPPVR+YRKN+M   + S+  EE   +   N         
Sbjct  66   KEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAG  125

Query  444  FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLL  623
             VKVSMDGAPYLRKVDLK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLM+LL
Sbjct  126  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLL  185

Query  624  NTSEYVP  644
            N+SEYVP
Sbjct  186  NSSEYVP  192



>ref|XP_009107777.1| PREDICTED: auxin-responsive protein IAA14 [Brassica rapa]
Length=233

 Score =   192 bits (488),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 129/180 (72%), Gaps = 5/180 (3%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS--DGSCLDLSETKMQ  290
            +NLKETELCLGLPGG              KRGFSE V+LKL L S  +GS +DL+     
Sbjct  5    INLKETELCLGLPGGPDPVETPTKSCLRNKRGFSEIVELKLGLHSTKEGS-VDLNVAGAP  63

Query  291  AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMD  464
                 +KDP KPPAKAQVVGWPPVR+YRK+VM H + S   E    + G    FVKVSMD
Sbjct  64   KEKTLHKDPSKPPAKAQVVGWPPVRNYRKSVMTHQKCSEVEEASSDRGGGTVAFVKVSMD  123

Query  465  GAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            GAPYLRKVDLK+Y +Y +LSDALA MFSSFT G+YGAQGMIDFMNE K+MDL+N+S+YVP
Sbjct  124  GAPYLRKVDLKMYKSYKELSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLVNSSDYVP  183



>ref|XP_010512022.1| PREDICTED: auxin-responsive protein IAA7 [Camelina sativa]
Length=242

 Score =   192 bits (487),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 131/187 (70%), Gaps = 12/187 (6%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS--DGSCLDLSETKMQ  290
            +NLK TELCLGLPGG+             KRGFSETVDL LNLQS  +GS +DL+     
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGS-VDLNNVAAS  64

Query  291  Appepn-kdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--------  443
               +   KDP KPPAKAQVVGWPPVR+YRKN+M   + S   E   +K+G+         
Sbjct  65   TKEKTLLKDPAKPPAKAQVVGWPPVRNYRKNIMTQQKASGTEEASSEKAGSGSGGAAGAG  124

Query  444  FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLL  623
             VKVSMDGAPYLRKVDLK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLM+LL
Sbjct  125  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLL  184

Query  624  NTSEYVP  644
            N+SEYVP
Sbjct  185  NSSEYVP  191



>ref|XP_002319075.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
 gb|EEE94998.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
Length=246

 Score =   191 bits (486),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 142/196 (72%), Gaps = 11/196 (6%)
 Frame = +3

Query  90   MTNMLG-----HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD  254
            MT+++G     +  +N +ETEL LGLPGG G GN+ E  K+ GKRGFSETVDLKLNL + 
Sbjct  1    MTSIMGAEPEKYSMINFEETELRLGLPGGIGNGNDGEVAKSNGKRGFSETVDLKLNLSTK  60

Query  255  GSCLDLSETKMQ----AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN-NGEE  419
             S     E K+       P  + DP KPPAKAQVVGWPP+RS+RKNVMA  + SN NGE+
Sbjct  61   ESGKGGDEEKVMKEKTVAPPASTDPAKPPAKAQVVGWPPIRSFRKNVMAVQKNSNDNGEK  120

Query  420  -GDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFM  596
             G   +G  FVKVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DFM
Sbjct  121  SGSSGTGVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFM  180

Query  597  NERKLMDLLNTSEYVP  644
            NE KL+DLLN S+YVP
Sbjct  181  NESKLIDLLNGSDYVP  196



>gb|AAM21317.1|AF373100_1 auxin-regulated protein [Populus tremula x Populus tremuloides]
Length=249

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 143/201 (71%), Gaps = 18/201 (9%)
 Frame = +3

Query  90   MTNMLG------HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS  251
            MT+++G      +  +N +ETEL LGLPGG   GN++E+ K+ GKRGFSETVDLKLNL +
Sbjct  1    MTSIMGAEPAGTYSMMNFEETELRLGLPGGVSNGNDSEAAKSNGKRGFSETVDLKLNLST  60

Query  252  -----DGSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGE  416
                 DGS  +    K +       DP KPP+KAQVVGWPP+RS+RKNVMA  + SN  +
Sbjct  61   KETGKDGSDQEKVVMKEKTVAPRPNDPAKPPSKAQVVGWPPIRSFRKNVMAVQKNSN--D  118

Query  417  EGDQKS-----GNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQG  581
            EG++ S     G  FVKVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QG
Sbjct  119  EGEKASSSGATGAAFVKVSMDGAPYLRKVDLKLYKSYRELSDALGKMFSSFTIGNCGSQG  178

Query  582  MIDFMNERKLMDLLNTSEYVP  644
              DFMNE KL+DLLN+SEYVP
Sbjct  179  TKDFMNESKLIDLLNSSEYVP  199



>ref|XP_006304183.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
 gb|EOA37081.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
Length=224

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 133/184 (72%), Gaps = 12/184 (7%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSE  278
            M+G   LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++    + S 
Sbjct  1    MIGSVELNLRETELCLGLPGGDTVAPV-----TGNKRGFSETVDLKLNLNNEPENKEGST  55

Query  279  T-KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKV  455
            T   +     +KDP KPPAKAQVVGWPPVRSYRKNVM   QK+++G E        FVKV
Sbjct  56   TLDSKEKSSCSKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKASSGPEAAA-----FVKV  110

Query  456  SMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGA-QGMIDFMNERKLMDLLNTS  632
            SMDGAPYLRKVDL++Y +Y++LS AL+NMFSSFT G YG  +GMIDFMNERKLMDL+N+ 
Sbjct  111  SMDGAPYLRKVDLRMYKSYDELSTALSNMFSSFTMGKYGGEEGMIDFMNERKLMDLVNSW  170

Query  633  EYVP  644
            +YVP
Sbjct  171  DYVP  174



>ref|XP_010488346.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 131/187 (70%), Gaps = 12/187 (6%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS--DGSCLDLSETKMQ  290
            +NL+ TELCLGLPGG+             KRGFSETVDL LNLQS  +GS +DL+     
Sbjct  6    MNLRATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGS-VDLNNVAAS  64

Query  291  Appepn-kdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--------  443
               +   KDP KPPAKAQVVGWPPVR+YRKN+M   + S   E   +K+G+         
Sbjct  65   TKEKTLLKDPAKPPAKAQVVGWPPVRNYRKNIMTQQKASGTEEASSEKAGSGSGGAAGAG  124

Query  444  FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLL  623
             VKVSMDGAPYLRKVDLK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLM+LL
Sbjct  125  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLL  184

Query  624  NTSEYVP  644
            N+SEYVP
Sbjct  185  NSSEYVP  191



>gb|KJB82525.1| hypothetical protein B456_013G200700 [Gossypium raimondii]
Length=246

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 142/201 (71%), Gaps = 21/201 (10%)
 Frame = +3

Query  90   MTNMLG-----HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD  254
            MT+++G     +  +N +ETEL LGLPG +G   E    K  GKRGFSETV+LKLNL S 
Sbjct  1    MTSIMGTEDDKYSTINFEETELRLGLPGANGNDGETT--KNNGKRGFSETVNLKLNLSSK  58

Query  255  GSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS  434
             +  + SE KM+   + + DP KPPAKAQVVGWPPVRS+RKN+MA  + S+  E G +K+
Sbjct  59   ETVAEDSE-KMK--EKSSTDPAKPPAKAQVVGWPPVRSFRKNIMAVQKASSEEEGGSKKA  115

Query  435  GNN-----------FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQG  581
            GN+           FVKVSMDGAPYLRKVDLK+Y +Y QLSDAL+ MFSSFT GN G+ G
Sbjct  116  GNSAAATTTTTAAAFVKVSMDGAPYLRKVDLKLYKSYQQLSDALSKMFSSFTIGNCGSHG  175

Query  582  MIDFMNERKLMDLLNTSEYVP  644
            M DFMNE KL+DLLN SEYVP
Sbjct  176  MKDFMNESKLIDLLNGSEYVP  196



>ref|XP_010466604.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score =   189 bits (481),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 128/187 (68%), Gaps = 12/187 (6%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS--DGSCLDLSETKMQ  290
            +NLK TELCLGLPGG+             KR FSETVDL LNLQS  +GS +DL+     
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRSFSETVDLMLNLQSNKEGS-VDLNNVAAS  64

Query  291  Appepnkd-pikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--------  443
               +     P KPPAKAQVVGWPPVR+YRKN+M   + S   E   +K+G+         
Sbjct  65   TKEKTLLKDPAKPPAKAQVVGWPPVRNYRKNIMTQQKASGTEEASSEKAGSGSGGAAGAG  124

Query  444  FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLL  623
             VKVSMDGAPYLRKVDLK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLM+LL
Sbjct  125  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLL  184

Query  624  NTSEYVP  644
            N+SEYVP
Sbjct  185  NSSEYVP  191



>ref|XP_010457463.1| PREDICTED: auxin-responsive protein IAA17 [Camelina sativa]
Length=229

 Score =   189 bits (480),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 133/189 (70%), Gaps = 17/189 (9%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSE  278
            M+G   LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++    + S 
Sbjct  1    MIGSVELNLRETELCLGLPGGDTVAPV-----TGNKRGFSETVDLKLNLNNEPENKEGST  55

Query  279  T------KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN  440
            T        +      KDP KPPAKAQVVGWPPVRSYRKNVM   QKS++G E       
Sbjct  56   THGVVTFDSKDKSSCPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSSGPEAAA----  111

Query  441  NFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGA-QGMIDFMNERKLMD  617
             FVKVSMDGAPYLRKVDL++Y +Y++LS+AL+NMFSSFT G YG  +GMIDFMNERKLMD
Sbjct  112  -FVKVSMDGAPYLRKVDLRMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERKLMD  170

Query  618  LLNTSEYVP  644
            L+N+ +YVP
Sbjct  171  LVNSWDYVP  179



>ref|XP_010483317.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=229

 Score =   189 bits (480),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 133/189 (70%), Gaps = 17/189 (9%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSE  278
            M+G   LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++    + S 
Sbjct  1    MIGSVELNLRETELCLGLPGGDTVAPV-----TGNKRGFSETVDLKLNLNNEPENKEGST  55

Query  279  T------KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN  440
            T        +      KDP KPPAKAQVVGWPPVRSYRKNVM   QKS++G E       
Sbjct  56   THGVVTFDSKDKSSCPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSSGPEAAA----  111

Query  441  NFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGA-QGMIDFMNERKLMD  617
             FVKVSMDGAPYLRKVDL++Y +Y++LS+AL+NMFSSFT G YG  +GMIDFMNERKLMD
Sbjct  112  -FVKVSMDGAPYLRKVDLRMYKSYDELSNALSNMFSSFTLGKYGGEEGMIDFMNERKLMD  170

Query  618  LLNTSEYVP  644
            L+N+ +YVP
Sbjct  171  LVNSWDYVP  179



>gb|KHG19190.1| Auxin-responsive IAA16 -like protein [Gossypium arboreum]
Length=246

 Score =   189 bits (481),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 139/201 (69%), Gaps = 21/201 (10%)
 Frame = +3

Query  90   MTNMLG-----HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD  254
            MT+++G     +  +N +ETEL LGLPG +G   E    K  GKRGFSETV+LKLNL S 
Sbjct  1    MTSIMGTEDDKYSTINFEETELRLGLPGANGNEGETT--KNNGKRGFSETVNLKLNLSSK  58

Query  255  GSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS  434
             +   ++E   +   + + D  KPPAKAQVVGWPPVRS+RKN+MA  + S+  E G +K+
Sbjct  59   ET---VAEDSDEMKEKSSTDTAKPPAKAQVVGWPPVRSFRKNIMAVQKASSEEEGGSKKA  115

Query  435  GNN-----------FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQG  581
            GN+           FVKVSMDGAPYLRKVDLK+Y +Y QLSDAL+ MFSSFT GN G+ G
Sbjct  116  GNSAAATTTTTAAAFVKVSMDGAPYLRKVDLKLYKSYQQLSDALSKMFSSFTIGNCGSHG  175

Query  582  MIDFMNERKLMDLLNTSEYVP  644
            M DFMNE KL+DLLN SEYVP
Sbjct  176  MKDFMNESKLIDLLNGSEYVP  196



>ref|XP_006406100.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
 dbj|BAJ33997.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47553.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
Length=239

 Score =   189 bits (481),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 128/183 (70%), Gaps = 7/183 (4%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS-CLDLSETKMQA  293
            +NLK T+LCLGLPGG+             KRGFSETVDL LNLQS+    +DL+      
Sbjct  6    MNLKATDLCLGLPGGAEAVESPAKSAVGNKRGFSETVDLMLNLQSNKEGTVDLNNVSAAP  65

Query  294  ppepn-kdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-----FVKV  455
              +   KD  KPPAKAQVVGWPPVR+YRKN+M   + S   E   +K+G+       VKV
Sbjct  66   KEKTLLKDHSKPPAKAQVVGWPPVRNYRKNIMTQQKTSGVEEASSEKAGSGGGAAALVKV  125

Query  456  SMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSE  635
            SMDGAPYLRKVDLK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLM+LLN+SE
Sbjct  126  SMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSE  185

Query  636  YVP  644
            YVP
Sbjct  186  YVP  188



>gb|ADJ68049.1| auxin responsive protein [Catharanthus roseus]
Length=242

 Score =   189 bits (480),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 147/190 (77%), Gaps = 15/190 (8%)
 Frame = +3

Query  114  GLNLKETELCLGLPggsgg---gnenesMKTTGKRGFSETVDLKLNLQS-DGSCLDLSET  281
            GLNLKETELCLGLPGG GG      ++SM+ TGKRGFSETVDLKLNLQS D S +DL+E 
Sbjct  5    GLNLKETELCLGLPGGGGGGTGEITDQSMRITGKRGFSETVDLKLNLQSNDQSSVDLNEK  64

Query  282  --KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN----  443
                 +    +KDP+KPPAKAQVVGWPPVR++RKN+MA  QK+N   E  +K  ++    
Sbjct  65   VKNPPSKETNSKDPVKPPAKAQVVGWPPVRAFRKNIMA--QKNNTEVEAGEKGSSSSSSS  122

Query  444  --FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGA-QGMIDFMNERKLM  614
              FVKVSMDGAPYLRKVDLK+Y +Y +L+DALA MFSSFT GNYG  QGMIDFMNE KLM
Sbjct  123  VAFVKVSMDGAPYLRKVDLKIYKSYQELADALAKMFSSFTMGNYGTQQGMIDFMNESKLM  182

Query  615  DLLNTSEYVP  644
            DLLN+SEYVP
Sbjct  183  DLLNSSEYVP  192



>gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum]
Length=246

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 142/201 (71%), Gaps = 21/201 (10%)
 Frame = +3

Query  90   MTNMLG-----HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD  254
            MT+++G     +  +N +ETEL LGLPG +G   E    K  GKRGFSETV+LKLNL S 
Sbjct  1    MTSIMGTEDDKYSTINFEETELRLGLPGANGNDGETT--KNNGKRGFSETVNLKLNLSSK  58

Query  255  GSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS  434
             +  + S+ KM+   + + DP KPPAKAQVVGWPPVRS+RKN+MA  + S+  E G +K+
Sbjct  59   ETVAEDSD-KMK--EKSSTDPAKPPAKAQVVGWPPVRSFRKNIMAVQKASSEEEGGSKKA  115

Query  435  GNN-----------FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQG  581
            GN+           FVKVSMDGAPYLRKVDLK+Y +Y QLSDAL+ MFSSFT GN G+ G
Sbjct  116  GNSAAAITTTTAAAFVKVSMDGAPYLRKVDLKLYKSYQQLSDALSKMFSSFTIGNCGSHG  175

Query  582  MIDFMNERKLMDLLNTSEYVP  644
            M DFMNE KL+DLLN SEYVP
Sbjct  176  MKDFMNESKLIDLLNGSEYVP  196



>ref|XP_006382798.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
 gb|ABK94241.1| unknown [Populus trichocarpa]
 gb|ERP60595.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
Length=250

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 139/200 (70%), Gaps = 15/200 (8%)
 Frame = +3

Query  90   MTNMLG------HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS  251
            MT+++G      +  +N +ETEL LGLPGG+  GN+ E+ K  GKRGFSETVDLKLNL +
Sbjct  1    MTSIMGAETADTYSMINYEETELRLGLPGGASNGNDGEAAKGNGKRGFSETVDLKLNLST  60

Query  252  -----DGSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGE  416
                 DGS  +    K +       DP KPP+KAQVVGWPP+RS+RKNVMA  + SN+  
Sbjct  61   KETGKDGSDQEKVVMKEKTVAPRPNDPAKPPSKAQVVGWPPIRSFRKNVMAVQKNSNDEG  120

Query  417  EGDQKSGNN----FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGM  584
            E    SG      FVKVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QG 
Sbjct  121  EKASSSGTTGTAAFVKVSMDGAPYLRKVDLKLYKSYRELSDALGKMFSSFTIGNCGSQGT  180

Query  585  IDFMNERKLMDLLNTSEYVP  644
             DFMNE KL+DLLN+SEYVP
Sbjct  181  KDFMNESKLIDLLNSSEYVP  200



>ref|XP_004302055.1| PREDICTED: auxin-responsive protein IAA16 [Fragaria vesca subsp. 
vesca]
Length=254

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 127/184 (69%), Gaps = 8/184 (4%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +N +ETEL LGLPG    G++     ++GKRGFSETVDLKLN  S+   +  S    Q  
Sbjct  21   INFEETELRLGLPGALKDGDQGVKSCSSGKRGFSETVDLKLNFSSENDDVSRSGRDGQVE  80

Query  297  pepnkdpikp---pAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-----FVK  452
             +  KD        AKAQVVGWPPVRS+RKN++A  +KS + ++  +KSG+      FVK
Sbjct  81   IKKEKDASAAPAPRAKAQVVGWPPVRSFRKNIVAVQKKSTDQDQAAEKSGSTSTSAAFVK  140

Query  453  VSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTS  632
            VSMDGAPYLRKVDLK+Y +Y +LS AL  MFSSFT GN G+QGM DFMNE KL+DLLN S
Sbjct  141  VSMDGAPYLRKVDLKLYQSYQELSTALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGS  200

Query  633  EYVP  644
            EYVP
Sbjct  201  EYVP  204



>ref|XP_010475075.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=230

 Score =   187 bits (475),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 132/190 (69%), Gaps = 18/190 (9%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSE  278
            M+G   LNL+ETELCLGLPGG    +      T  KRGFSETVDLKLNL ++    + S 
Sbjct  1    MIGSVELNLRETELCLGLPGGDTVASV-----TGNKRGFSETVDLKLNLNNEPENKEGST  55

Query  279  T-------KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSG  437
            T                KDP KPPAKAQVVGWPPVRSYRKNVM   QK ++G E      
Sbjct  56   THGVVTFDSKDKISSCPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKPSSGPEAAA---  112

Query  438  NNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGA-QGMIDFMNERKLM  614
              FVKVSMDGAPYLRKVDL++Y +Y++LS+AL+NMFSSFT G YG  +GMIDFMNERKLM
Sbjct  113  --FVKVSMDGAPYLRKVDLRMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERKLM  170

Query  615  DLLNTSEYVP  644
            DL+N+ +YVP
Sbjct  171  DLVNSWDYVP  180



>ref|NP_171921.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 sp|P93830.2|IAA17_ARATH RecName: Full=Auxin-responsive protein IAA17; AltName: Full=Auxin 
response 3; AltName: Full=Indoleacetic acid-induced protein 
17 [Arabidopsis thaliana]
 gb|AAG53997.1|AF336916_1 auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAB84354.1| IAA17 [Arabidopsis thaliana]
 gb|AAC39439.1| IAA17/AXR3 protein [Arabidopsis thaliana]
 gb|AAB70451.2| Identical to Arabidopsis gb|AF040632 and gb|U49073 IAA17/AXR3 
gene. ESTs gb|H36782 and gb|F14074 come from this gene [Arabidopsis 
thaliana]
 gb|AAL49831.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAM51258.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AEE27674.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 gb|AGZ13682.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17]
 gb|AGZ59820.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17-spo5DSR]
Length=229

 Score =   187 bits (475),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 132/189 (70%), Gaps = 17/189 (9%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD------GS  260
            M+G   LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++       +
Sbjct  1    MMGSVELNLRETELCLGLPGGDTVAPV-----TGNKRGFSETVDLKLNLNNEPANKEGST  55

Query  261  CLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN  440
              D+     +      KDP KPPAKAQVVGWPPVRSYRKNVM   QKS+ G E       
Sbjct  56   THDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAA----  111

Query  441  NFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGA-QGMIDFMNERKLMD  617
             FVKVSMDGAPYLRK+DL++Y +Y++LS+AL+NMFSSFT G +G  +GMIDFMNERKLMD
Sbjct  112  -FVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMD  170

Query  618  LLNTSEYVP  644
            L+N+ +YVP
Sbjct  171  LVNSWDYVP  179



>ref|XP_002889499.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65758.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
Length=229

 Score =   187 bits (475),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 132/189 (70%), Gaps = 17/189 (9%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD------GS  260
            M+G   LNLKETELCLGLPGG           T  KRGFSETVDLKLNL ++       +
Sbjct  1    MIGSVELNLKETELCLGLPGGDTVAPV-----TGNKRGFSETVDLKLNLNNEPENKEGST  55

Query  261  CLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN  440
              D+     +      KDP KPP+KAQVVGWPPVRSYRKNVM   QKS+ G E       
Sbjct  56   THDVVTFDSKEKSSCPKDPAKPPSKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAA----  111

Query  441  NFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGA-QGMIDFMNERKLMD  617
             FVKVSMDGAPYLRKVDL++Y +Y++LS+AL+NMFSSFT G +G  +GMIDFMNERKLMD
Sbjct  112  -FVKVSMDGAPYLRKVDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMD  170

Query  618  LLNTSEYVP  644
            L+N+ +YVP
Sbjct  171  LVNSWDYVP  179



>ref|XP_002883395.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59654.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
Length=242

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 130/187 (70%), Gaps = 12/187 (6%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS--DGSCLDLSETKMQ  290
            +NLK TELCLGLPGG+             KRGFSETVDL LNLQS  +GS +DL+     
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGS-VDLNNVAAA  64

Query  291  Appepn-kdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--------  443
               +   KDP KPP KAQVVGWPPVR+YRKN+M   + S   E   +K+G+         
Sbjct  65   PKEKTTLKDPSKPPTKAQVVGWPPVRNYRKNMMTQQKTSGVEEASSEKAGSGGGGAAGAG  124

Query  444  FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLL  623
             VKVSMDGAPYLRKVDLK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLM+LL
Sbjct  125  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLL  184

Query  624  NTSEYVP  644
            N+SEYVP
Sbjct  185  NSSEYVP  191



>ref|NP_001288823.1| auxin-responsive protein IAA7 [Brassica rapa]
 dbj|BAF81520.1| auxin-responsive protein IAA [Brassica rapa]
Length=242

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 130/186 (70%), Gaps = 10/186 (5%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS-CLDLSETKMQA  293
            +NLK TELCLGLPGG+      E      KRGFSETVDL LNLQS+    +DL+     +
Sbjct  6    INLKATELCLGLPGGAEANENLEKSAVGNKRGFSETVDLMLNLQSNKEGAVDLNNVASAS  65

Query  294  ppepn-kdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--------F  446
              +   KDP KPPAKAQVVGWPPVR+YRKN++   + S   E   +K+GN+         
Sbjct  66   KDKTLLKDPAKPPAKAQVVGWPPVRNYRKNIITQQKTSGKEEASSEKAGNSGGGASGAAL  125

Query  447  VKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLN  626
            VKVSMDGAPYLRKVDLK+Y +Y   SDALA MFSSFT G YGAQGMIDFMNE KLMDLLN
Sbjct  126  VKVSMDGAPYLRKVDLKMYKSYKDFSDALAKMFSSFTMGKYGAQGMIDFMNESKLMDLLN  185

Query  627  TSEYVP  644
            +SEYVP
Sbjct  186  SSEYVP  191



>gb|ABH01143.1| auxin-regulated protein [Populus tomentosa]
Length=258

 Score =   187 bits (476),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 144/203 (71%), Gaps = 20/203 (10%)
 Frame = +3

Query  90   MTNMLG------HGGLNLKETELCLGLPggsgggnenesMKTTGKRG--FSETVDLKLNL  245
            MT+++G      +  +N +ETEL LGLPGG   GN+ E+ K+ GKRG  FSETVDLKLNL
Sbjct  1    MTSVMGAEPAGTYSMMNFEETELRLGLPGGVSNGNDPEAAKSNGKRGQRFSETVDLKLNL  60

Query  246  QS-----DGSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
             +     DGS  + +  K +A      DP KPP+KAQVVGWPP+RS+RKNVMA  + SN 
Sbjct  61   STKDTGKDGSDQEKAAMKEKAVAPRPNDPAKPPSKAQVVGWPPIRSFRKNVMAVQKNSN-  119

Query  411  GEEGDQKS-----GNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGA  575
             +EG++ S     G  FVKVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+
Sbjct  120  -DEGEKASSSGATGAAFVKVSMDGAPYLRKVDLKLYKSYRELSDALGKMFSSFTIGNCGS  178

Query  576  QGMIDFMNERKLMDLLNTSEYVP  644
            QG  +FMNE KL+DLLN+SEYVP
Sbjct  179  QGTKEFMNESKLIDLLNSSEYVP  201



>ref|XP_004134096.1| PREDICTED: auxin-responsive protein IAA14 [Cucumis sativus]
 gb|KGN56916.1| hypothetical protein Csa_3G143570 [Cucumis sativus]
Length=237

 Score =   187 bits (474),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 131/196 (67%), Gaps = 18/196 (9%)
 Frame = +3

Query  78   TSVKMTNMLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-D  254
             S KM NML        ET+LCLGLPGG          K  GKRGFSETVDLKLN+QS  
Sbjct  3    VSRKMVNML--------ETDLCLGLPGGGAEPETP---KANGKRGFSETVDLKLNIQSKP  51

Query  255  GSCLDLSE-----TKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEE  419
            G  +DL+      +  +     +KDP KPPAKAQVVGWPPVRSYRKN M+        + 
Sbjct  52   GVTVDLTPQNNDTSTDEESLIASKDPAKPPAKAQVVGWPPVRSYRKNAMSQKSSEAGEKG  111

Query  420  GDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFT-TGNYGAQGMIDFM  596
            G       FVKV MDGAPYLRKVDLK+Y +Y +LS+ALA MFSSFT  G+YGAQGMIDFM
Sbjct  112  GSSGGSAMFVKVCMDGAPYLRKVDLKMYKSYQELSNALAKMFSSFTMAGDYGAQGMIDFM  171

Query  597  NERKLMDLLNTSEYVP  644
            NE KLMDLLN+SEYVP
Sbjct  172  NESKLMDLLNSSEYVP  187



>gb|EYU33008.1| hypothetical protein MIMGU_mgv1a012321mg [Erythranthe guttata]
Length=254

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 138/193 (72%), Gaps = 17/193 (9%)
 Frame = +3

Query  114  GLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-DGSCLDL------  272
            GLN KETEL      G GGG E +++K  GKRGFSETVDLKLNLQS D +  DL      
Sbjct  13   GLNFKETEL-CLGLPGGGGGGEPDAVKINGKRGFSETVDLKLNLQSNDSASTDLNNGGGG  71

Query  273  -------SETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQK--SNNGEEGD  425
                   S  K  A   P KDP+KPPAKAQVVGWPPVRS+RKN++  HQK  S++ E G 
Sbjct  72   GAMKNNNSAEKTAANMVPPKDPVKPPAKAQVVGWPPVRSFRKNIVMSHQKNSSSDEEAGG  131

Query  426  QKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNER  605
              +   FVKVSMDGAPYLRKVDLK+Y +Y + SDALA MFSSFT G YG++GMIDFMNER
Sbjct  132  GGAAAAFVKVSMDGAPYLRKVDLKMYKSYQEFSDALAKMFSSFTMGKYGSEGMIDFMNER  191

Query  606  KLMDLLNTSEYVP  644
            KLMD+LN++EYVP
Sbjct  192  KLMDVLNSTEYVP  204



>ref|XP_011649168.1| PREDICTED: auxin-responsive protein IAA14 [Cucumis sativus]
 gb|KGN61643.1| hypothetical protein Csa_2G200420 [Cucumis sativus]
Length=256

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 143/202 (71%), Gaps = 21/202 (10%)
 Frame = +3

Query  96   NMLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL---  266
            NM  +  ++LKETELCLGLPGG G G +  S+K +GKRGFSETVDLKLNLQS        
Sbjct  7    NMPNNQFVSLKETELCLGLPGGGGSGGDQTSLKASGKRGFSETVDLKLNLQSKDGGGGVG  66

Query  267  -----DLSETKMQAppep-------nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
                 DL+E                +KDP KPPAKAQVVGWPPVRSYRKNVMA  QK+ +
Sbjct  67   VGVGVDLNENIKNVSTNVDGEKSLCSKDPAKPPAKAQVVGWPPVRSYRKNVMA--QKNTS  124

Query  411  GEEGDQK----SGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQ  578
            G EG +K    S   FVKV MDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT G YG Q
Sbjct  125  GGEGTEKGNGGSSAAFVKVCMDGAPYLRKVDLKMYQSYQELSDALAKMFSSFTMGEYGTQ  184

Query  579  GMIDFMNERKLMDLLNTSEYVP  644
            GMIDFMNERKLMDLLN+SE+VP
Sbjct  185  GMIDFMNERKLMDLLNSSEFVP  206



>ref|NP_001275031.1| auxin-responsive protein IAA14-like [Solanum tuberosum]
 gb|ABK41009.1| auxin/indole-3-acetic acid [Solanum tuberosum]
Length=213

 Score =   186 bits (471),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 127/178 (71%), Gaps = 19/178 (11%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            LNLKETELCLG+PGG G        +   KRGFS+TVDLKLNL +         +     
Sbjct  3    LNLKETELCLGMPGGGGD-------RNIKKRGFSQTVDLKLNLDN--------PSININN  47

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGA  470
               N D +KPP KAQVVGWPPVRS+RKN+M+  QK NN  E  +K      FVKVSMDGA
Sbjct  48   TSSNNDSLKPPTKAQVVGWPPVRSFRKNIMS--QKGNNNVEISEKGEKTIAFVKVSMDGA  105

Query  471  PYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            PYLRKVDLK+Y +Y QLSD+L  MFSSFT GNYG+QGMIDFMNERKLMD+LN+S+YVP
Sbjct  106  PYLRKVDLKMYKSYQQLSDSLTKMFSSFTMGNYGSQGMIDFMNERKLMDVLNSSDYVP  163



>ref|XP_008438588.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=237

 Score =   186 bits (472),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 133/196 (68%), Gaps = 18/196 (9%)
 Frame = +3

Query  78   TSVKMTNMLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD-  254
             S KM NML        ET+LCLGLPGG          K  GKRGFSETVDLKLN+QS  
Sbjct  3    VSRKMVNML--------ETDLCLGLPGGGAEPETP---KANGKRGFSETVDLKLNIQSKT  51

Query  255  GSCLDL----SETKM-QAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEE  419
            G  +DL    S+T   +     +KDP KPPAKAQVVGWPPVRSYRKN M+     +  + 
Sbjct  52   GVTVDLTPKNSDTSTDEENLITSKDPAKPPAKAQVVGWPPVRSYRKNAMSQKSPDSGEKG  111

Query  420  GDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFT-TGNYGAQGMIDFM  596
            G       FVKV MDGAPYLRKVDLK+Y +Y +LS+ALA MFSSFT  G+YGAQGMIDFM
Sbjct  112  GSSGGSAMFVKVCMDGAPYLRKVDLKMYKSYQELSNALAKMFSSFTMAGDYGAQGMIDFM  171

Query  597  NERKLMDLLNTSEYVP  644
            NE KLMDLLN+SEYVP
Sbjct  172  NESKLMDLLNSSEYVP  187



>gb|AAM64837.1| putative auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
Length=228

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 131/188 (70%), Gaps = 17/188 (9%)
 Frame = +3

Query  102  LGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD------GSC  263
            +G   LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++       + 
Sbjct  1    MGSVELNLRETELCLGLPGGDTVAPV-----TGNKRGFSETVDLKLNLNNEPANKEGSTT  55

Query  264  LDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN  443
             D+     +      KDP KPPAKAQVVGWPPVRSYRKNVM   QKS+ G E        
Sbjct  56   HDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAA-----  110

Query  444  FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGA-QGMIDFMNERKLMDL  620
            FVKVSMDGAPYLRK+DL++Y +Y++LS+AL+NMFSSFT G +G  +GMIDFMNERKLMDL
Sbjct  111  FVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDL  170

Query  621  LNTSEYVP  644
            +N+ +YVP
Sbjct  171  VNSWDYVP  178



>emb|CDY63910.1| BnaC01g43640D [Brassica napus]
 emb|CDY30781.1| BnaC07g16810D [Brassica napus]
Length=240

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 128/185 (69%), Gaps = 10/185 (5%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS-CLDLSETKMQA  293
            +NLK TELCL LPGG+   +         KRGFSETVDL LNLQS+    +DL+      
Sbjct  6    MNLKATELCLSLPGGAETLDTPAKSAVGNKRGFSETVDLMLNLQSNKERAIDLNNATASK  65

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--------FV  449
                 KDP+KPPAKAQVVGWPPVR+YRKN+M + + S   E   +K+GN          V
Sbjct  66   QKTLLKDPVKPPAKAQVVGWPPVRNYRKNIMTNQKTSGADEASSEKAGNGGGGATGATLV  125

Query  450  KVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNT  629
            KVSMDGAPYLRKV LK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLMD LN+
Sbjct  126  KVSMDGAPYLRKVHLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNETKLMD-LNS  184

Query  630  SEYVP  644
            SEYVP
Sbjct  185  SEYVP  189



>ref|XP_010024036.1| PREDICTED: auxin-responsive protein IAA14-like [Eucalyptus grandis]
 gb|KCW60450.1| hypothetical protein EUGRSUZ_H03170 [Eucalyptus grandis]
Length=243

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 143/194 (74%), Gaps = 10/194 (5%)
 Frame = +3

Query  90   MTNMLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSET-VDLKLNLQSD--GS  260
            M  +LG   LN KETELCLGL  G GGG E E+ + TGKRGFSET VDLKLNLQ+    S
Sbjct  1    MAGLLGGVDLNFKETELCLGL-PGGGGGAEVEAPRATGKRGFSETEVDLKLNLQAKDASS  59

Query  261  CLDLSET------KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEG  422
             +DL E        + A   P KDP KPPAKAQVVGWPPVRSYRKN+M   + ++  EE 
Sbjct  60   VVDLKEAMKSNEKTLLAGASPAKDPAKPPAKAQVVGWPPVRSYRKNMMVAQKSTDPEEEK  119

Query  423  DQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNE  602
            ++ +   FVKVSMDGAPYLRKVDLK Y++Y QLSDAL  MFSSFT G+YGAQGMIDFMNE
Sbjct  120  EKAAAAAFVKVSMDGAPYLRKVDLKNYSSYKQLSDALGKMFSSFTMGSYGAQGMIDFMNE  179

Query  603  RKLMDLLNTSEYVP  644
             KLMDLLN+S+YVP
Sbjct  180  SKLMDLLNSSDYVP  193



>ref|NP_001266070.1| IAA14 [Solanum lycopersicum]
 gb|AEX00357.1| IAA14 [Solanum lycopersicum]
Length=236

 Score =   185 bits (469),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 117/159 (74%), Gaps = 12/159 (8%)
 Frame = +3

Query  192  KTTGKRGFSETVDLKLNLQ--SDGSCLDLSETKMQAppepnkdpi------kppAKAQVV  347
            K  GKRGFSETVDLKLN    SD     +   KM++     K+ +      KPPAKAQVV
Sbjct  32   KVNGKRGFSETVDLKLNFHQASDDISCAMENNKMKSSVTTTKEVVCNKDPIKPPAKAQVV  91

Query  348  GWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSD  527
            GWPPVRS+RKNVMA  QKSN  E   +K+   FVKV MDGAPYLRKVDLK+Y +Y +LSD
Sbjct  92   GWPPVRSFRKNVMA--QKSNTEES--EKTTAAFVKVCMDGAPYLRKVDLKMYKSYQELSD  147

Query  528  ALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            ALA MFSSFT GNYG+QGMIDFMNE KLMDLLN+SEYVP
Sbjct  148  ALAKMFSSFTNGNYGSQGMIDFMNESKLMDLLNSSEYVP  186



>ref|XP_009111119.1| PREDICTED: auxin-responsive protein IAA17 [Brassica rapa]
Length=229

 Score =   184 bits (468),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 131/189 (69%), Gaps = 17/189 (9%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD------GS  260
            M+G  GLNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++        
Sbjct  1    MMGSVGLNLRETELCLGLPGGDTASPV-----TGTKRGFSETVDLKLNLNNEPESKEGSK  55

Query  261  CLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN  440
              D+     +      KDP KPPAKAQVVGWPPVRSYRKNVM   QKS++  +       
Sbjct  56   SHDVVSAISKEKSSCPKDPTKPPAKAQVVGWPPVRSYRKNVMGSCQKSSSSADT-----A  110

Query  441  NFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTG-NYGAQGMIDFMNERKLMD  617
             FVKVSMDGAPYLRK+DLK+Y +Y++LSDAL+NMFSSFT G N G +GMIDFMNERK+MD
Sbjct  111  AFVKVSMDGAPYLRKIDLKMYKSYDELSDALSNMFSSFTMGKNGGEEGMIDFMNERKVMD  170

Query  618  LLNTSEYVP  644
             +++ +YVP
Sbjct  171  TVSSWDYVP  179



>emb|CDY63072.1| BnaCnng41350D [Brassica napus]
Length=398

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 130/189 (69%), Gaps = 17/189 (9%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD------GS  260
            M+G  GLNL+ETELCLGLPGG           T  KRGFSETVDLKLNL S+        
Sbjct  165  MMGSVGLNLRETELCLGLPGGDTASPV-----TGTKRGFSETVDLKLNLNSEPESKEGSK  219

Query  261  CLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN  440
              D+     +      KDP KP AKAQVVGWPPVRSYRKNVM   QKS++  E       
Sbjct  220  SHDVVSAVFKEKSSCPKDPTKPLAKAQVVGWPPVRSYRKNVMGSCQKSSSSAET-----A  274

Query  441  NFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGA-QGMIDFMNERKLMD  617
             FVKVSMDGAPYLRKVDLK+Y +Y++LSDAL+NMFSSFT GN G  +GMIDFMNERK+MD
Sbjct  275  AFVKVSMDGAPYLRKVDLKMYKSYDELSDALSNMFSSFTMGNNGGEEGMIDFMNERKVMD  334

Query  618  LLNTSEYVP  644
             +++ +YVP
Sbjct  335  TVSSWDYVP  343



>emb|CDY15493.1| BnaA08g27770D [Brassica napus]
Length=229

 Score =   184 bits (468),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 131/189 (69%), Gaps = 17/189 (9%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD------GS  260
            M+G  GLNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++        
Sbjct  1    MMGSVGLNLRETELCLGLPGGDTASPL-----TGTKRGFSETVDLKLNLNNEPESKEGSK  55

Query  261  CLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN  440
              D+     +      KDP KPPAKAQVVGWPPVRSYRKNVM   QKS++  +       
Sbjct  56   SHDVVSAISKEKSSCTKDPTKPPAKAQVVGWPPVRSYRKNVMGSCQKSSSSADT-----A  110

Query  441  NFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTG-NYGAQGMIDFMNERKLMD  617
             FVKVSMDGAPYLRK+DLK+Y +Y++LSDAL+NMFSSFT G N G +GMIDFMNERK+MD
Sbjct  111  AFVKVSMDGAPYLRKIDLKMYKSYDELSDALSNMFSSFTMGKNGGEEGMIDFMNERKVMD  170

Query  618  LLNTSEYVP  644
             +++ +YVP
Sbjct  171  TVSSWDYVP  179



>ref|XP_011073485.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=251

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 143/186 (77%), Gaps = 11/186 (6%)
 Frame = +3

Query  114  GLNLKETELCLGLPggsgggnenes--MKTTGKRGFSETVDLKLNLQ--SDGSCLDLSE-  278
            GLNLKETELCLGLPGG GGG    +  +K TGKRGFSETVDLKL L   ++ + LDL E 
Sbjct  18   GLNLKETELCLGLPGGGGGGESTATDPIKITGKRGFSETVDLKLKLHQSNEPAALDLKEN  77

Query  279  ---TKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFV  449
               +  + P  P KDPIKPPAKAQVVGWPPVRS+RKN M+H QKS+  EE     G  FV
Sbjct  78   IKNSSHENPMLPPKDPIKPPAKAQVVGWPPVRSFRKNAMSH-QKSDK-EEAACSGGAAFV  135

Query  450  KVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFT-TGNYGAQGMIDFMNERKLMDLLN  626
            KVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFS+FT  GNYG+QGMIDFMNE KLMDLLN
Sbjct  136  KVSMDGAPYLRKVDLKMYKSYQELSDALVKMFSAFTMAGNYGSQGMIDFMNEGKLMDLLN  195

Query  627  TSEYVP  644
            +SEYVP
Sbjct  196  SSEYVP  201



>ref|XP_006418149.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 dbj|BAJ33922.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36502.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=226

 Score =   184 bits (468),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 131/190 (69%), Gaps = 22/190 (12%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS----CL  266
            M+G   LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++ +    C 
Sbjct  1    MMGTVELNLRETELCLGLPGGDTAAPV-----TGNKRGFSETVDLKLNLNNEPANKEGCT  55

Query  267  D---LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSG  437
                ++ +  +      KDP KPPAKAQVVGWPPVRSYRKNV+   QKS           
Sbjct  56   THDVVTNSVSKEKSSSPKDPAKPPAKAQVVGWPPVRSYRKNVLVSSQKSEAAA-------  108

Query  438  NNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGA-QGMIDFMNERKLM  614
              FVKVSMDGAPYLRKVDLK+Y +Y++LS+AL+NMFSSFT G YG  +GMIDFMNERKLM
Sbjct  109  --FVKVSMDGAPYLRKVDLKMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERKLM  166

Query  615  DLLNTSEYVP  644
            DL+N+ +YVP
Sbjct  167  DLVNSWDYVP  176



>ref|XP_010556884.1| PREDICTED: auxin-responsive protein IAA17 [Tarenaya hassleriana]
Length=238

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 133/199 (67%), Gaps = 28/199 (14%)
 Frame = +3

Query  99   MLGHG-GLNLKETELCLGLPggsgggnenesMKTTGKRGFSETV-DLKLNLQSD------  254
            MLG G  LNLK+TELCLGLPGG           +  KRGFSETV DLKLNL ++      
Sbjct  1    MLGGGVDLNLKDTELCLGLPGGGETAAPV----SGNKRGFSETVVDLKLNLNNEPRDHKD  56

Query  255  -GSCL------DLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNG  413
             GS         L+           KDP KPPAKAQVVGWPPVRSYRKN+ A  QK++ G
Sbjct  57   LGSVTTEKDPSSLAAVPADNSSSCPKDPSKPPAKAQVVGWPPVRSYRKNMTAMSQKASGG  116

Query  414  EEGDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTT--GNYGAQGMI  587
                      FVKVSMDGAPYLRKVDLK+YN+Y  LS+ALA MFSSFTT  GNYGAQGMI
Sbjct  117  SA-------TFVKVSMDGAPYLRKVDLKMYNSYEDLSNALAKMFSSFTTEKGNYGAQGMI  169

Query  588  DFMNERKLMDLLNTSEYVP  644
            DFMNE KLMDLLN+S+YVP
Sbjct  170  DFMNESKLMDLLNSSDYVP  188



>emb|CDY10349.1| BnaC05g29300D [Brassica napus]
Length=246

 Score =   184 bits (468),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 127/184 (69%), Gaps = 10/184 (5%)
 Frame = +3

Query  123  LKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS-CLDLSETKMQApp  299
            L  TELCLGLPGG+             KRGFSETVDL LNLQS+    +DL+     +  
Sbjct  12   LYATELCLGLPGGAEANENLAKSAVGNKRGFSETVDLMLNLQSNKEGAVDLNNVASASKE  71

Query  300  epn-kdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--------FVK  452
                KDP KPPAKAQVVGWPPVR+YRKN++   + S   E   +K+GN+         VK
Sbjct  72   TTLLKDPAKPPAKAQVVGWPPVRNYRKNIITQQKTSGKEEASSEKAGNSGGGASGAALVK  131

Query  453  VSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTS  632
            VSMDGAPYLRKVDLK+Y +Y  LSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLN+S
Sbjct  132  VSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSS  191

Query  633  EYVP  644
            +YVP
Sbjct  192  DYVP  195



>gb|AAC39440.1| IAA17/AXR3-1 protein [Arabidopsis thaliana]
Length=229

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 131/189 (69%), Gaps = 17/189 (9%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD------GS  260
            M+G   LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++       +
Sbjct  1    MMGSVELNLRETELCLGLPGGDTVAPV-----TGNKRGFSETVDLKLNLNNEPANKEGST  55

Query  261  CLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN  440
              D+     +      KDP KPPAKAQVVGWP VRSYRKNVM   QKS+ G E       
Sbjct  56   THDVVTFDSKEKSACPKDPAKPPAKAQVVGWPLVRSYRKNVMVSCQKSSGGPEAAA----  111

Query  441  NFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGA-QGMIDFMNERKLMD  617
             FVKVSMDGAPYLRK+DL++Y +Y++LS+AL+NMFSSFT G +G  +GMIDFMNERKLMD
Sbjct  112  -FVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMD  170

Query  618  LLNTSEYVP  644
            L+N+ +YVP
Sbjct  171  LVNSWDYVP  179



>gb|KDO53919.1| hypothetical protein CISIN_1g026811mg [Citrus sinensis]
Length=200

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 115/189 (61%), Gaps = 27/189 (14%)
 Frame = +3

Query  117  LNLKETELCLGLP-------ggsgggnenesMKTTGKRGFSET--VDLKLNLQSDGSCLD  269
            ++ KETELCLGLP         +       + K + KRGF ET  +DLKLNLQS  S +D
Sbjct  8    MDFKETELCLGLPGGGNNKKDEAAALELTPTPKASNKRGFCETAVIDLKLNLQSKESSVD  67

Query  270  LSE----TKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSG  437
            L+E                      KAQVVGWPPVRSYRKN MA                
Sbjct  68   LNENFKNPPSNNKNHDKDPAKPSANKAQVVGWPPVRSYRKNAMAETAA------------  115

Query  438  NNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMD  617
              FVKV MDGAPYLRKVDLK Y +Y +LSDALA MFSSFT GNYG+QGMIDFMNE KLMD
Sbjct  116  --FVKVCMDGAPYLRKVDLKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMD  173

Query  618  LLNTSEYVP  644
            LLN+S+YVP
Sbjct  174  LLNSSDYVP  182



>gb|EPS64756.1| hypothetical protein M569_10024, partial [Genlisea aurea]
Length=214

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 127/176 (72%), Gaps = 17/176 (10%)
 Frame = +3

Query  132  TELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLD---LSETKMQAppe  302
            TELCLGLPG +         K TGKRGF +TVDLKL LQSD S L+   L+      P  
Sbjct  1    TELCLGLPGAAEP-------KVTGKRGFFQTVDLKLKLQSDQSDLEEENLTTPSSDKPHL  53

Query  303  pnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLR  482
            P K   KPP+KAQVVGWPPVRS+RKNV+ + +KS++ EE    S  ++VKVSMDGAPYLR
Sbjct  54   PPKHLSKPPSKAQVVGWPPVRSFRKNVICN-RKSSSVEE----STGSYVKVSMDGAPYLR  108

Query  483  KVDLKVYNTYNQLSDALANMFSSFT--TGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            KVDLK Y +Y QLSDALA MFSSFT   GNYG +GMIDFMNE K+M LLN+SEYVP
Sbjct  109  KVDLKTYGSYQQLSDALAKMFSSFTMNEGNYGVEGMIDFMNESKVMHLLNSSEYVP  164



>ref|XP_009119323.1| PREDICTED: auxin-responsive protein IAA17-like [Brassica rapa]
Length=224

 Score =   182 bits (461),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 132/189 (70%), Gaps = 22/189 (12%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSE  278
            M+G+  LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++    ++S+
Sbjct  1    MMGNIDLNLQETELCLGLPGGM----------TGTKRGFSETVDLKLNLNNEPESKEVSK  50

Query  279  TK------MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN  440
            T        +      KDP KPPAKAQVVGWPPVRSYRKNVM   QKSN   E       
Sbjct  51   THDVVISVSKEKNTCPKDPTKPPAKAQVVGWPPVRSYRKNVMGSCQKSNGVTETAV----  106

Query  441  NFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTG-NYGAQGMIDFMNERKLMD  617
             FVKVSMDGAPYLRKVDLK+Y +Y++LS+AL+NMF SFT G N G +GMIDFMNERK+ D
Sbjct  107  -FVKVSMDGAPYLRKVDLKMYKSYDELSNALSNMFGSFTMGKNGGEEGMIDFMNERKVRD  165

Query  618  LLNTSEYVP  644
            L+N+ +YVP
Sbjct  166  LVNSWDYVP  174



>emb|CDX89832.1| BnaA10g02500D [Brassica napus]
Length=224

 Score =   181 bits (460),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 132/189 (70%), Gaps = 22/189 (12%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSE  278
            M+G+  LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++    ++S+
Sbjct  1    MMGNIDLNLQETELCLGLPGGM----------TGTKRGFSETVDLKLNLNNEPESKEVSK  50

Query  279  TK------MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN  440
            T        +      KDP KPPAKAQVVGWPPVRSYRKNVM   QKSN   E       
Sbjct  51   THDVVISVSKEKNTCPKDPTKPPAKAQVVGWPPVRSYRKNVMGSCQKSNGVTETAV----  106

Query  441  NFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTG-NYGAQGMIDFMNERKLMD  617
             FVKVSMDGAPYLRKVDLK+Y +Y++LS+AL+NMF SFT G N G +GMIDFMNERK+ D
Sbjct  107  -FVKVSMDGAPYLRKVDLKMYKSYDELSNALSNMFGSFTMGKNGGEEGMIDFMNERKVRD  165

Query  618  LLNTSEYVP  644
            L+N+ +YVP
Sbjct  166  LVNSWDYVP  174



>ref|XP_006420094.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 ref|XP_006489503.1| PREDICTED: auxin-responsive protein IAA14-like [Citrus sinensis]
 gb|ESR33334.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 gb|KDO53918.1| hypothetical protein CISIN_1g026811mg [Citrus sinensis]
Length=232

 Score =   181 bits (459),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 116/189 (61%), Gaps = 27/189 (14%)
 Frame = +3

Query  117  LNLKETELCLGLP-------ggsgggnenesMKTTGKRGFSET--VDLKLNLQSDGSCLD  269
            ++ KETELCLGLP         +       + K + KRGF ET  +DLKLNLQS  S +D
Sbjct  8    MDFKETELCLGLPGGGNNKKDEAAALELTPTPKASNKRGFCETAVIDLKLNLQSKESSVD  67

Query  270  LSETKMQAppe----pnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSG  437
            L+E     P                KAQVVGWPPVRSYRKN MA                
Sbjct  68   LNENFKNPPSNNKNHDKDPAKPSANKAQVVGWPPVRSYRKNAMAETAA------------  115

Query  438  NNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMD  617
              FVKV MDGAPYLRKVDLK Y +Y +LSDALA MFSSFT GNYG+QGMIDFMNE KLMD
Sbjct  116  --FVKVCMDGAPYLRKVDLKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMD  173

Query  618  LLNTSEYVP  644
            LLN+S+YVP
Sbjct  174  LLNSSDYVP  182



>ref|XP_010278165.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=251

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 132/198 (67%), Gaps = 14/198 (7%)
 Frame = +3

Query  87   KMTNMLG----HGGLNLKETEL---CLGLPggsgggnenesMKTTGKRGFSETVDLKLNL  245
            KM NMLG       LN +ETEL     G  GGS G +     K  GKRGF ETVDLKLNL
Sbjct  6    KMANMLGAERDEYSLNFEETELRLGLPGGGGGSEGESTPSPTKNGGKRGFCETVDLKLNL  65

Query  246  QSDGSCLDLSETKMQAppep----nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNG  413
             S  S +D SE K     +       D  KPPAKAQVVGWPPVRS+RKN+++  + S   
Sbjct  66   PSKESVMDPSEKKNSPKEKNLLPCTNDLAKPPAKAQVVGWPPVRSFRKNILSVQKSST--  123

Query  414  EEGDQKSGNN-FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMID  590
            EEG++ S +  FVKVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G QGM D
Sbjct  124  EEGEKVSSSAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTIGNCGPQGMKD  183

Query  591  FMNERKLMDLLNTSEYVP  644
            FMNE KLMDLLN SEYVP
Sbjct  184  FMNESKLMDLLNGSEYVP  201



>ref|XP_006418150.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 gb|ESQ36503.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=229

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 129/194 (66%), Gaps = 27/194 (14%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS----CL  266
            M+G   LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++ +    C 
Sbjct  1    MMGTVELNLRETELCLGLPGGDTAAPV-----TGNKRGFSETVDLKLNLNNEPANKEGCT  55

Query  267  -------DLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGD  425
                    +S+ K  + P+    P    ++AQVVGWPPVRSYRKNV+   QKS       
Sbjct  56   THDVVTNSVSKEK-SSSPKDPAKPPAKISRAQVVGWPPVRSYRKNVLVSSQKSEAAA---  111

Query  426  QKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGA-QGMIDFMNE  602
                  FVKVSMDGAPYLRKVDLK+Y +Y++LS+AL+NMFSSFT G YG  +GMIDFMNE
Sbjct  112  ------FVKVSMDGAPYLRKVDLKMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNE  165

Query  603  RKLMDLLNTSEYVP  644
            RKLMDL+N+ +YVP
Sbjct  166  RKLMDLVNSWDYVP  179



>gb|EYU46510.1| hypothetical protein MIMGU_mgv1a013084mg [Erythranthe guttata]
Length=231

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 121/185 (65%), Gaps = 20/185 (11%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD----GSCLDLSETK  284
            +  +ETEL LGLP               GKRGFSETVDLKLNL S      S +DL E  
Sbjct  8    MGFEETELRLGLPNA-----------NYGKRGFSETVDLKLNLSSAEIGLDSAIDLKENN  56

Query  285  MQAp-----pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFV  449
                          D +KPPAKAQVVGWPPVRS+RKNVMA  +++++ E      G  FV
Sbjct  57   FNKEKNLLPSSSPTDSVKPPAKAQVVGWPPVRSFRKNVMAVQKRTDSDEAEKGTGGAAFV  116

Query  450  KVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNT  629
            KVSMDGAPYLRKVDLK+Y TY +LSDAL  MFSSFT G   +QGM+DFM+E KLMDLLN+
Sbjct  117  KVSMDGAPYLRKVDLKMYKTYKELSDALGKMFSSFTIGKCDSQGMMDFMSESKLMDLLNS  176

Query  630  SEYVP  644
            S+YVP
Sbjct  177  SDYVP  181



>ref|XP_007030567.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
 gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
Length=249

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 133/188 (71%), Gaps = 15/188 (8%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL-DLSET--KM  287
            +N +ETEL LGLPGG+G   E    K  GKRGFSETVDLKLNL +    + D +E   K 
Sbjct  15   INFEETELRLGLPGGNGNDGEMT--KNNGKRGFSETVDLKLNLSTAKEAVADEAEKVKKK  72

Query  288  QAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--------  443
                  + DP KPPAKAQVVGWPPVRS+RKN+MA  QK+++  EG++   +N        
Sbjct  73   STVAPRSADPAKPPAKAQVVGWPPVRSFRKNIMAV-QKNSSDVEGEKAGSSNTTTATVAA  131

Query  444  -FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDL  620
             FVKVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DFMNE KL+DL
Sbjct  132  AFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDL  191

Query  621  LNTSEYVP  644
            LN SEYVP
Sbjct  192  LNGSEYVP  199



>ref|XP_006443921.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 ref|XP_006479598.1| PREDICTED: auxin-induced protein AUX28-like [Citrus sinensis]
 gb|ESR57161.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=232

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 126/183 (69%), Gaps = 11/183 (6%)
 Frame = +3

Query  114  GLNL--KETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLS--ET  281
            GLN+  +ETEL LGLPG           + + KRGFSETVDLKLNL S  +   +   + 
Sbjct  5    GLNMGFEETELRLGLPGNRVRSEG----EGSRKRGFSETVDLKLNLSSKDTSEKVKSFQK  60

Query  282  KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKV  455
            +    P     P KPPAK QVVGWPPVRS+RKN++   QKS+ GEE D   GNN  FVKV
Sbjct  61   EKHPLPRATDPPAKPPAKTQVVGWPPVRSFRKNMLGVVQKSS-GEESDMAGGNNAAFVKV  119

Query  456  SMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSE  635
            SMDGAPYLRKVDL++YNTY  L DAL  MFSSFT GN G+QGM DFMNE KLMDLLN S+
Sbjct  120  SMDGAPYLRKVDLRMYNTYKDLYDALGKMFSSFTIGNCGSQGMKDFMNESKLMDLLNGSD  179

Query  636  YVP  644
            YVP
Sbjct  180  YVP  182



>ref|XP_004495802.1| PREDICTED: auxin-responsive protein IAA16-like [Cicer arietinum]
Length=252

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 133/202 (66%), Gaps = 14/202 (7%)
 Frame = +3

Query  78   TSVKMTNMLGHGGLNLKETELCLGLPggsgggnenesMKTTG-KRGFSET--VDLKLNLQ  248
            TSV  T    +  +N +ETEL LGLPGGS   +    +KT+G KRGFSET  VDLKLNL 
Sbjct  2    TSVTETERDNYSMINFEETELRLGLPGGSASEHSESPIKTSGGKRGFSETSNVDLKLNLS  61

Query  249  SDGSCLDLSET----KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGE  416
                 +  S T          +       P AKAQVVGWPPVRS+RKN++ + QKSNN  
Sbjct  62   PTNDSVSPSSTIPLVPANKVKDKTSTTAPPRAKAQVVGWPPVRSFRKNIV-NVQKSNNEV  120

Query  417  EGDQKS-----GNN-FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQ  578
            E ++K+     GN  FVKVSMDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT GN G+Q
Sbjct  121  EAEKKTSGSGGGNGAFVKVSMDGAPYLRKVDLKLYKSYQELSDALAKMFSSFTIGNCGSQ  180

Query  579  GMIDFMNERKLMDLLNTSEYVP  644
               DFMNE KL+DLLN S+YVP
Sbjct  181  VTKDFMNESKLIDLLNGSDYVP  202



>ref|NP_001288939.1| auxin-responsive protein IAA16 [Brassica rapa]
 gb|ABV89663.1| indoleacetic acid-induced protein 16 [Brassica rapa]
Length=231

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 129/190 (68%), Gaps = 24/190 (13%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDG----SCLDLSETK  284
            +N + TEL LGLPGG+ GG+    MK  GKRGFSETVDLKLNL S      S +DL   K
Sbjct  2    INFEATELRLGLPGGNHGGDMA--MKNNGKRGFSETVDLKLNLSSTALDSVSGVDLENMK  59

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQK-SNNGEEGDQKSGNN------  443
             +    P        AKAQVVGWPPVRS+RKNVM+  +  + +  EG +K+ ++      
Sbjct  60   EKVVKPP--------AKAQVVGWPPVRSFRKNVMSGQKPTAGDATEGTEKTSSSNGATSS  111

Query  444  ---FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLM  614
               +VKVSMDGAPYLRK+DLK+Y TY  LSDAL+ MFSSFT GNYG QGM DFMNE +L+
Sbjct  112  AAAYVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTLGNYGPQGMKDFMNESRLI  171

Query  615  DLLNTSEYVP  644
            DLLN S+YVP
Sbjct  172  DLLNGSDYVP  181



>ref|XP_010274203.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=252

 Score =   179 bits (455),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 141/199 (71%), Gaps = 15/199 (8%)
 Frame = +3

Query  87   KMTNMLGHG----GLNLKETELCLGLPggsgggnenesMKTT----GKRGFSETVDLKLN  242
            KM + LG G     LN +ETEL LGLPGG GGG+ + +   T     KRGF+ETVDLKLN
Sbjct  6    KMASRLGGGPDEYSLNFEETELRLGLPGGGGGGDGDTTPSATKINGAKRGFAETVDLKLN  65

Query  243  LQSDGSCLDLSETKMQAppep----nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN  410
            L +  S LD +E K     +     + DP KPPAKAQVVGWPPVRS+RKN+++ H+ S  
Sbjct  66   LPTKESVLDPAEKKNSPKEKNLLPCSNDPAKPPAKAQVVGWPPVRSFRKNILSVHKSST-  124

Query  411  GEEGDQKSGNN-FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMI  587
             EEG++ S +  FVKVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G QGM 
Sbjct  125  -EEGEKVSSSAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTIGNCGPQGMK  183

Query  588  DFMNERKLMDLLNTSEYVP  644
            DFMNE KLMDLLN SEYVP
Sbjct  184  DFMNESKLMDLLNGSEYVP  202



>emb|CDY32537.1| BnaA09g50590D [Brassica napus]
Length=228

 Score =   179 bits (453),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 131/189 (69%), Gaps = 18/189 (10%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSE  278
            M+G   LNL+ETELCLGLPGG  G        T  KRGFSETVDLKLNL ++    + S+
Sbjct  1    MMGTVELNLRETELCLGLPGGETGAPV-----TGTKRGFSETVDLKLNLNNEPESNEGSK  55

Query  279  TK------MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN  440
            T        +      KDP KPPAKAQVVGWPPVRSYRKNVM   QK + G E       
Sbjct  56   THDVVTSVSKEKSSSPKDPAKPPAKAQVVGWPPVRSYRKNVMGSCQKPSGGTET-----A  110

Query  441  NFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGA-QGMIDFMNERKLMD  617
            +FVKVSMDGAPYLRKVDLK+Y +Y++LS+AL+NMFSSFT G YG  +GMIDFMNER  M 
Sbjct  111  SFVKVSMDGAPYLRKVDLKMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERN-MA  169

Query  618  LLNTSEYVP  644
            L+NT +YVP
Sbjct  170  LVNTWDYVP  178



>ref|XP_009118658.1| PREDICTED: auxin-responsive protein IAA17-like [Brassica rapa]
Length=228

 Score =   179 bits (453),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 131/189 (69%), Gaps = 18/189 (10%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSE  278
            M+G   LNL+ETELCLGLPGG  G        T  KRGFSETVDLKLNL ++    + S+
Sbjct  1    MMGTVELNLRETELCLGLPGGETGAPV-----TGTKRGFSETVDLKLNLNNEPESNEGSK  55

Query  279  TK------MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN  440
            T        +      KDP KPPAKAQVVGWPPVRSYRKNVM   QK + G E       
Sbjct  56   THDVVTSVSKEKSSSPKDPAKPPAKAQVVGWPPVRSYRKNVMGSCQKPSGGTET-----A  110

Query  441  NFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGA-QGMIDFMNERKLMD  617
            +FVKVSMDGAPYLRKVDLK+Y +Y++LS+AL+NMFSSFT G YG  +GMIDFMNER  M 
Sbjct  111  SFVKVSMDGAPYLRKVDLKMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERN-MA  169

Query  618  LLNTSEYVP  644
            L+NT +YVP
Sbjct  170  LVNTWDYVP  178



>emb|CDY18214.1| BnaC05g02370D [Brassica napus]
Length=224

 Score =   178 bits (451),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 133/189 (70%), Gaps = 22/189 (12%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSE  278
            M+ +  LNL+ETELCLGLPGG           T  KRGFSETVDLKLNL ++    ++S+
Sbjct  1    MMDNIDLNLQETELCLGLPGGM----------TGTKRGFSETVDLKLNLNNEPESKEVSK  50

Query  279  TK------MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN  440
            T        +   +  KDP KPPAKAQVVGWPPVRSYRKNVM   QKSN+  E       
Sbjct  51   THDVVISVSKQKNKCPKDPTKPPAKAQVVGWPPVRSYRKNVMGSCQKSNDVTETAV----  106

Query  441  NFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTG-NYGAQGMIDFMNERKLMD  617
             FVKVSMDGAPYLRKVDLK+Y +Y++LS+AL+NMF SFT G N G +GMIDFMNER++ D
Sbjct  107  -FVKVSMDGAPYLRKVDLKMYKSYDELSNALSNMFGSFTMGKNGGEEGMIDFMNEREVRD  165

Query  618  LLNTSEYVP  644
            L+N+ +YVP
Sbjct  166  LVNSWDYVP  174



>emb|CDY50750.1| BnaAnng10570D [Brassica napus]
Length=291

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 129/190 (68%), Gaps = 24/190 (13%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDG----SCLDLSETK  284
            +N + TEL LGLPGG+ GG+    MK  GKRGFSETVDLKLNL S      S +DL   K
Sbjct  62   INFEATELRLGLPGGNHGGDMA--MKNNGKRGFSETVDLKLNLSSTALDSVSGVDLENMK  119

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQK-SNNGEEGDQKSGNN------  443
             +    P        AKAQVVGWPPVRS+RKNVM+  +  + +  EG +K+ ++      
Sbjct  120  EKVVKPP--------AKAQVVGWPPVRSFRKNVMSGQKPTAGDAAEGTEKTSSSNGATSS  171

Query  444  ---FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLM  614
               +VKVSMDGAPYLRK+DLK+Y TY  LSDAL+ MFSSFT GNYG QGM DFMNE +L+
Sbjct  172  AAAYVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNYGPQGMKDFMNESRLI  231

Query  615  DLLNTSEYVP  644
            DLLN S+YVP
Sbjct  232  DLLNGSDYVP  241



>ref|XP_006408158.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49611.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=223

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 130/190 (68%), Gaps = 21/190 (11%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLD-LSETKMQA  293
            +N + TEL LGLPGG+ GG+     K  GKRGFSETVDLKLNL S  + LD +SE  +Q 
Sbjct  2    INFEATELRLGLPGGNHGGDIAA--KNNGKRGFSETVDLKLNLSS--TALDSVSEVDIQ-  56

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN----------GEEGDQKSGNN  443
                 +  +KPPAK QVVGWPPVRS+RKNVM+  +++            G  G   S N 
Sbjct  57   --NLKEKVVKPPAKTQVVGWPPVRSFRKNVMSGQKQTTEVAAEGTEKTCGSSGATSSANA  114

Query  444  ---FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLM  614
               +VKVSMDGAPYLRK+DLK+Y TY  LSDAL+ MFSSFT GNYG QGM DFMNE KL+
Sbjct  115  AVAYVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNYGPQGMKDFMNESKLI  174

Query  615  DLLNTSEYVP  644
            DLLN S+YVP
Sbjct  175  DLLNGSDYVP  184



>ref|XP_006408159.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49612.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=234

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 130/190 (68%), Gaps = 21/190 (11%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLD-LSETKMQA  293
            +N + TEL LGLPGG+ GG+     K  GKRGFSETVDLKLNL S  + LD +SE  +Q 
Sbjct  2    INFEATELRLGLPGGNHGGDIAA--KNNGKRGFSETVDLKLNLSS--TALDSVSEVDIQ-  56

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN----------GEEGDQKSGNN  443
                 +  +KPPAK QVVGWPPVRS+RKNVM+  +++            G  G   S N 
Sbjct  57   --NLKEKVVKPPAKTQVVGWPPVRSFRKNVMSGQKQTTEVAAEGTEKTCGSSGATSSANA  114

Query  444  ---FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLM  614
               +VKVSMDGAPYLRK+DLK+Y TY  LSDAL+ MFSSFT GNYG QGM DFMNE KL+
Sbjct  115  AVAYVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNYGPQGMKDFMNESKLI  174

Query  615  DLLNTSEYVP  644
            DLLN S+YVP
Sbjct  175  DLLNGSDYVP  184



>ref|XP_002281771.1| PREDICTED: auxin-responsive protein IAA16-like [Vitis vinifera]
Length=244

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 130/183 (71%), Gaps = 15/183 (8%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLD------LSE  278
            LNL+ TEL LGLPGGS G       +   KRGFSETVDLKLNL    + +D      L +
Sbjct  20   LNLEATELRLGLPGGSEGS------EVVRKRGFSETVDLKLNLSGKEAGVDDNKVKSLQK  73

Query  279  TKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-FVKV  455
             K ++      DP +PPAKAQVVGWPPVRS+RKN++A  +     EEG++ S N  FVKV
Sbjct  74   EKSKSLLPCGNDPARPPAKAQVVGWPPVRSFRKNMLAGQK--GGSEEGEKVSCNAAFVKV  131

Query  456  SMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSE  635
            SMDGAPYLRKVDLK+Y +Y +LS+AL NMFSSFT GNYG+QGM DFMNE KLMDLLN  +
Sbjct  132  SMDGAPYLRKVDLKMYTSYQELSNALGNMFSSFTIGNYGSQGMKDFMNESKLMDLLNGFD  191

Query  636  YVP  644
            +VP
Sbjct  192  HVP  194



>ref|NP_001280973.1| auxin-responsive protein IAA16 [Malus domestica]
 gb|ABI36494.1| AUX/IAA16 B [Malus domestica]
Length=251

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 128/187 (68%), Gaps = 12/187 (6%)
 Frame = +3

Query  117  LNLKETELCLGLP--ggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS-------CLD  269
            +N +ETEL LGLP    S  G + E+ K TGKRGF+ETVDLKLN+ S+          +D
Sbjct  16   INFEETELRLGLPGGILSTAGKDGEASKNTGKRGFAETVDLKLNISSEDQSAGDEDQVVD  75

Query  270  LSETK-MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQK-SNNGEEGDQKSGNN  443
            + + K +   P  N       AKAQVVGWPPVRS+R N++A  +  S+ GE+ +  S   
Sbjct  76   MKKEKDVAPVPRSNDPTKPHAAKAQVVGWPPVRSFRXNILAVQKDVSDEGEKTNSXSA-A  134

Query  444  FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLL  623
            FVKVSMDGAPYLRKVDLK+Y +Y +LS AL  MFSSFT G+YG+QGM DFMNE KL+DLL
Sbjct  135  FVKVSMDGAPYLRKVDLKLYKSYQELSTALGKMFSSFTIGSYGSQGMKDFMNESKLIDLL  194

Query  624  NTSEYVP  644
            N SEYVP
Sbjct  195  NGSEYVP  201



>emb|CAN63268.1| hypothetical protein VITISV_013635 [Vitis vinifera]
 emb|CBI17932.3| unnamed protein product [Vitis vinifera]
Length=235

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 130/183 (71%), Gaps = 15/183 (8%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLD------LSE  278
            LNL+ TEL LGLPGGS G       +   KRGFSETVDLKLNL    + +D      L +
Sbjct  11   LNLEATELRLGLPGGSEGS------EVVRKRGFSETVDLKLNLSGKEAGVDDNKVKSLQK  64

Query  279  TKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-FVKV  455
             K ++      DP +PPAKAQVVGWPPVRS+RKN++A  +     EEG++ S N  FVKV
Sbjct  65   EKSKSLLPCGNDPARPPAKAQVVGWPPVRSFRKNMLAGQK--GGSEEGEKVSCNAAFVKV  122

Query  456  SMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSE  635
            SMDGAPYLRKVDLK+Y +Y +LS+AL NMFSSFT GNYG+QGM DFMNE KLMDLLN  +
Sbjct  123  SMDGAPYLRKVDLKMYTSYQELSNALGNMFSSFTIGNYGSQGMKDFMNESKLMDLLNGFD  182

Query  636  YVP  644
            +VP
Sbjct  183  HVP  185



>dbj|BAJ34138.1| unnamed protein product [Thellungiella halophila]
Length=234

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 129/190 (68%), Gaps = 21/190 (11%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLD-LSETKMQA  293
            +N + TEL LGLPGG+ GG+     K  GKRGFSETVDLKLNL S  + LD +SE  +Q 
Sbjct  2    INFEATELRLGLPGGNHGGDIAA--KNNGKRGFSETVDLKLNLSS--TALDSVSEVDIQ-  56

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN----------GEEGDQKSGNN  443
                    +KPPAK QVVGWPPVRS+RKNVM+  +++            G  G   S N 
Sbjct  57   --NLKGKVVKPPAKTQVVGWPPVRSFRKNVMSGQKQTTEVAAEGTEKTCGSSGATSSANA  114

Query  444  ---FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLM  614
               +VKVSMDGAPYLRK+DLK+Y TY  LSDAL+ MFSSFT GNYG QGM DFMNE KL+
Sbjct  115  AVAYVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNYGPQGMKDFMNESKLI  174

Query  615  DLLNTSEYVP  644
            DLLN S+YVP
Sbjct  175  DLLNGSDYVP  184



>ref|XP_009413916.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=244

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 133/194 (69%), Gaps = 20/194 (10%)
 Frame = +3

Query  114  GLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQA  293
            GL L+ETEL LGLPGG GGG + E++K +GKRGF+ETVDLKL LQ+    +D+ E   +A
Sbjct  4    GLGLEETELRLGLPGGGGGGGDAEAVKNSGKRGFAETVDLKLQLQTP---VDVKEAVAEA  60

Query  294  ppepnkdpikppA--------------KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK  431
              E  K  +   +              KAQVVGWPPVRS+RKN+++ + +  + EEG++ 
Sbjct  61   ASEKVKRSVSQKSLVSCGSDPEKPSAPKAQVVGWPPVRSFRKNILSVNSEKGSKEEGEKS  120

Query  432  S-GNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMI--DFMNE  602
            S    FVKVSMDGAPYLRKVDLK+Y +Y +L  AL  MF SFT GNYG+QG+   DFMNE
Sbjct  121  SISAAFVKVSMDGAPYLRKVDLKMYRSYQELFMALQKMFISFTGGNYGSQGLSGRDFMNE  180

Query  603  RKLMDLLNTSEYVP  644
             K+MDLLN SEYVP
Sbjct  181  SKVMDLLNGSEYVP  194



>ref|XP_009610435.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana tomentosiformis]
Length=240

 Score =   177 bits (449),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 119/174 (68%), Gaps = 4/174 (2%)
 Frame = +3

Query  129  ETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKM-QAppep  305
            ETEL LGLPG   G     + K  GKR FSETVDLKLNL S  S +D    KM +     
Sbjct  19   ETELRLGLPGAINGNEGEMTSKNNGKRVFSETVDLKLNLSSKDSTVDNQVDKMKEKKNIA  78

Query  306  nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN-NGEEGDQKSGNNFVKVSMDGAPYLR  482
              DP KPPAKAQVVGWPPVRS+RKNV+   +KS  NGE      G  FVKVS+DGAPYLR
Sbjct  79   PTDPSKPPAKAQVVGWPPVRSFRKNVLNVQKKSTGNGES--SGGGAAFVKVSVDGAPYLR  136

Query  483  KVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            KVDLK+Y +Y QLSDAL  MFSSFT GN G  G  DFMNE KL+DLLN S+YVP
Sbjct  137  KVDLKMYKSYQQLSDALGKMFSSFTIGNCGNHGFKDFMNESKLIDLLNGSDYVP  190



>ref|XP_002531288.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
 gb|EEF31101.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
Length=257

 Score =   177 bits (450),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 129/196 (66%), Gaps = 23/196 (12%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNL---QSDGSCLDLSETKM  287
            +N +ETEL LGLPGGS   +   + K  GKRGFSETVDLKLNL   +  G  + + E  M
Sbjct  15   INFEETELRLGLPGGSNVNDSEFA-KVNGKRGFSETVDLKLNLSTKEPSGKDVIVGEETM  73

Query  288  QAppepnkdp---ikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK---------  431
            +             KPPAKAQVVGWPP+RS+RKNVMA  +  N+ +EG++          
Sbjct  74   KEKATVPSSSNDPAKPPAKAQVVGWPPIRSFRKNVMAVQK--NSTDEGEKGTATSAPAAA  131

Query  432  -----SGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFM  596
                 +   FVKVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DFM
Sbjct  132  ATSGSTSAAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFM  191

Query  597  NERKLMDLLNTSEYVP  644
            NE KL+DLLN SEYVP
Sbjct  192  NESKLIDLLNGSEYVP  207



>emb|CDY10068.1| BnaC08g43830D [Brassica napus]
Length=228

 Score =   176 bits (446),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 129/189 (68%), Gaps = 18/189 (10%)
 Frame = +3

Query  99   MLGHGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-----  263
            M+G   LNL++TELCLGLPGG  G        T  KRGFSETVDLKLNL ++        
Sbjct  1    MMGTVELNLRDTELCLGLPGGETGAPV-----TGTKRGFSETVDLKLNLNNEPEINEGSK  55

Query  264  -LDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN  440
              D+  +  +      KDP KPPAKAQVVGWPPVRSYRKNVM  +QK + G E       
Sbjct  56   PHDVVTSVSKEKSSSPKDPAKPPAKAQVVGWPPVRSYRKNVMGSYQKPSGGTETAA----  111

Query  441  NFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGA-QGMIDFMNERKLMD  617
             FVKVSMDGAPYLRKVDLK+Y +Y++LS+AL+NMFSSFT G YG  +GMIDFMNER  M 
Sbjct  112  -FVKVSMDGAPYLRKVDLKMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERN-MA  169

Query  618  LLNTSEYVP  644
            L+ T +YVP
Sbjct  170  LVTTWDYVP  178



>gb|KDO68557.1| hypothetical protein CISIN_1g026823mg [Citrus sinensis]
Length=232

 Score =   176 bits (445),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 124/183 (68%), Gaps = 11/183 (6%)
 Frame = +3

Query  114  GLNL--KETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLS--ET  281
            GLN+  +ETEL LGLPG           +   KRGFSETVDLKLNL S  +   +   + 
Sbjct  5    GLNMGFEETELRLGLPGNRVLSEG----EGARKRGFSETVDLKLNLSSKDTSEKVKSFQK  60

Query  282  KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKV  455
            +    P     P KPPAK QVVGWPPVRS+RKN++   QKS+ GEE D   GNN  FVKV
Sbjct  61   EKNPLPRATDPPAKPPAKTQVVGWPPVRSFRKNMLGVVQKSS-GEESDMAGGNNAAFVKV  119

Query  456  SMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSE  635
            SMDGAPYLRKVDL++YNTY  L  AL  MFSSFT GN G+QGM DFMNE KLMDLLN S+
Sbjct  120  SMDGAPYLRKVDLRMYNTYQDLYHALGKMFSSFTIGNCGSQGMKDFMNESKLMDLLNGSD  179

Query  636  YVP  644
            YVP
Sbjct  180  YVP  182



>gb|KFK37887.1| hypothetical protein AALP_AA3G042100 [Arabis alpina]
Length=232

 Score =   175 bits (444),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 126/192 (66%), Gaps = 27/192 (14%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +N + TEL LGLPGG+ GG      K  GKRGFSETVDLKLNL S  S ++L   K +  
Sbjct  2    INFEATELRLGLPGGNHGGEIAG--KNNGKRGFSETVDLKLNLSSTVSEVELENMKEKVV  59

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGE--EGDQKSGNN---------  443
              P        AKAQVVGWPPVRS+RKNVM+  QK   G+  EG  K+  +         
Sbjct  60   KPP--------AKAQVVGWPPVRSFRKNVMSG-QKPTTGDAVEGTDKTSGSSGATSSASA  110

Query  444  -----FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERK  608
                 +VKVSMDGAPYLRK+DLK+Y TY  LSDAL+ MFSSFT GNYG QGM DFMNE K
Sbjct  111  GTTVAYVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNYGPQGMKDFMNESK  170

Query  609  LMDLLNTSEYVP  644
            L+DLLN S+YVP
Sbjct  171  LIDLLNGSDYVP  182



>ref|XP_010532600.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=229

 Score =   175 bits (444),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 119/149 (80%), Gaps = 9/149 (6%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQSDGS--CLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRK  377
            KRGFSETVDLKLNLQ++     +DL+        + +KDP KPP+KAQVVGWPPVR+YRK
Sbjct  38   KRGFSETVDLKLNLQTNKQEGVMDLTNA-----SKVSKDPAKPPSKAQVVGWPPVRNYRK  92

Query  378  NVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFT  557
            NVMA+ +  N+  E ++K+   FVKVSMDGAPYLRKVDLK++ +Y  LSDALA MFSSFT
Sbjct  93   NVMANQK--NSAMEEEEKAAAAFVKVSMDGAPYLRKVDLKMHKSYQDLSDALAKMFSSFT  150

Query  558  TGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
             G+YGAQGMIDFMNE KLMDLLN+SEYVP
Sbjct  151  MGSYGAQGMIDFMNESKLMDLLNSSEYVP  179



>ref|XP_007050422.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
 gb|EOX94579.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
Length=260

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 128/178 (72%), Gaps = 8/178 (4%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-DGSCLDLSETKMQA  293
            +  +ETEL LGLPG    G      +   KRGFSETVDLKLNL S + S +D +E K + 
Sbjct  71   MGFEETELRLGLPGNIRAGEG----EVARKRGFSETVDLKLNLSSKESSGVDPNE-KEKN  125

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN-NFVKVSMDGA  470
                  DP KPPAKAQVVGWPPVRS+RKN+ A  QKS++ E     +GN  FVKVSMDGA
Sbjct  126  LLPCATDPAKPPAKAQVVGWPPVRSFRKNMFA-TQKSSSEESEKGGAGNAAFVKVSMDGA  184

Query  471  PYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            PYLRKVDL++Y TY +LSDALA MFSSFT GN G+QG+ DFMNE KLMDLLN S+YVP
Sbjct  185  PYLRKVDLRMYKTYLELSDALAKMFSSFTIGNCGSQGVKDFMNESKLMDLLNGSDYVP  242



>ref|XP_012089266.1| PREDICTED: auxin-responsive protein IAA16 [Jatropha curcas]
 gb|KDP23667.1| hypothetical protein JCGZ_23500 [Jatropha curcas]
Length=248

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 133/191 (70%), Gaps = 18/191 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMK-------TTGKRGFSETVDLKLNLQSDGSCLDLS  275
            +N +ETEL LGLPGG GGG  N + +         GKRGFSETVDLKLNL +  S  +  
Sbjct  11   INFEETELRLGLPGGGGGGGGNTTNEGDQIAKINNGKRGFSETVDLKLNLSTKESGKE-E  69

Query  276  ETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN----  443
            + K +     + DP KPPAKAQVVGWPP+RS+RKNVM+  +  +NG+E ++ +       
Sbjct  70   KMKEKTDVPSSNDPAKPPAKAQVVGWPPIRSFRKNVMSVQK--SNGDEAEKAATATAAGS  127

Query  444  ----FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKL  611
                FVKVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DFMNE KL
Sbjct  128  SSAAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKL  187

Query  612  MDLLNTSEYVP  644
            +DLLN SEYVP
Sbjct  188  IDLLNGSEYVP  198



>ref|XP_011079949.1| PREDICTED: auxin-induced protein AUX28-like [Sesamum indicum]
Length=244

 Score =   174 bits (441),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 127/185 (69%), Gaps = 15/185 (8%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-DGSCLDLSETKMQA  293
            L  +ETEL LGLPG     N        GKRG+ ETVDLKLNL + D   LD S+ K + 
Sbjct  16   LGFEETELRLGLPGAGEKSNA-----NYGKRGYEETVDLKLNLSTKDVGNLDQSDLKEKT  70

Query  294  ppepnk------dpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FV  449
              +         D +KPPAKAQVVGWPPVRS+RKNVMA  QK ++ EE ++ SG    FV
Sbjct  71   LSKEKNLLPCPNDSVKPPAKAQVVGWPPVRSFRKNVMAV-QKVSDSEETEKGSGGAAAFV  129

Query  450  KVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNT  629
            KVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT G   +QGM+DFMNE KLMDLLN 
Sbjct  130  KVSMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTIGKCDSQGMMDFMNESKLMDLLNG  189

Query  630  SEYVP  644
            S+YVP
Sbjct  190  SDYVP  194



>gb|AFK44192.1| unknown [Medicago truncatula]
Length=253

 Score =   174 bits (442),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 123/190 (65%), Gaps = 15/190 (8%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSET--VDLKLNLQ-------SDGSCLD  269
            +N +ETEL LGLPG    G       + GKRGFSET  VDLKLNL        S  +   
Sbjct  15   INFEETELRLGLPGAGDHGESPVK-NSCGKRGFSETANVDLKLNLSPINDSASSSPTIAS  73

Query  270  LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK----SG  437
            ++E K +           P AKAQVVGWPPVRS+RKN++  HQKSN+  E D+      G
Sbjct  74   VAENKGKDTTTSATVSPPPRAKAQVVGWPPVRSFRKNIVNVHQKSNSETEVDKSISGGGG  133

Query  438  NN-FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLM  614
            N  FVKVSMDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT  N G+Q   DFMNE KL+
Sbjct  134  NGAFVKVSMDGAPYLRKVDLKLYKSYQELSDALAKMFSSFTIDNCGSQVTKDFMNESKLI  193

Query  615  DLLNTSEYVP  644
            DLLN S+YVP
Sbjct  194  DLLNGSDYVP  203



>ref|NP_001268036.1| uncharacterized protein LOC100250231 [Vitis vinifera]
 gb|ADR80321.1| indole-3-acetic acid-induced protein 16 [Vitis vinifera]
Length=238

 Score =   174 bits (440),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 132/177 (75%), Gaps = 3/177 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSET-KMQA  293
            LN +ETEL LGL    GGGN+ +  KT+GKRGFSETVDLKLNL S  S  D +E  K ++
Sbjct  14   LNYEETELRLGLGLPGGGGNDGDVSKTSGKRGFSETVDLKLNLLSKDSVADQAEKMKEKS  73

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAP  473
               P+ DP KPPAKAQVVGWPPVRS+RKN++   +  N+ EE    S   FVKVSMDGAP
Sbjct  74   ALPPSNDPAKPPAKAQVVGWPPVRSFRKNILTVQK--NSSEEEKASSSAAFVKVSMDGAP  131

Query  474  YLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            YLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DFMNE KL+DLLN S+YVP
Sbjct  132  YLRKVDLKMYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVP  188



>ref|XP_010418365.1| PREDICTED: auxin-responsive protein IAA16 [Camelina sativa]
Length=232

 Score =   174 bits (440),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 126/191 (66%), Gaps = 25/191 (13%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +N + TEL LGLPGGS GG  +  +K  GKRGFSETVDLKLNL S  S  DL   K +  
Sbjct  2    INFEATELRLGLPGGSHGGEMS--VKNNGKRGFSETVDLKLNLSSTVSEADLENMKEKVV  59

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQK-SNNGEEGDQKSGNN----------  443
              P        AK QVVGWPPVRS+RKNVM+  +  + +  EG+ K+  +          
Sbjct  60   KPP--------AKTQVVGWPPVRSFRKNVMSGQKPITGDAVEGNDKTSGSSGATSSASAC  111

Query  444  ----FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKL  611
                +VKVSMDGAPYLRK+DLK+Y TY  LS+AL+ MFSSFT GNYG QGM DFMNE KL
Sbjct  112  AAAAYVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKL  171

Query  612  MDLLNTSEYVP  644
            +DLLN S+YVP
Sbjct  172  IDLLNGSDYVP  182



>ref|XP_007050421.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
 gb|EOX94578.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
Length=305

 Score =   175 bits (444),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 128/178 (72%), Gaps = 8/178 (4%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-DGSCLDLSETKMQA  293
            +  +ETEL LGLPG    G      +   KRGFSETVDLKLNL S + S +D +E K + 
Sbjct  84   MGFEETELRLGLPGNIRAGEG----EVARKRGFSETVDLKLNLSSKESSGVDPNE-KEKN  138

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN-NFVKVSMDGA  470
                  DP KPPAKAQVVGWPPVRS+RKN+ A  QKS++ E     +GN  FVKVSMDGA
Sbjct  139  LLPCATDPAKPPAKAQVVGWPPVRSFRKNMFA-TQKSSSEESEKGGAGNAAFVKVSMDGA  197

Query  471  PYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            PYLRKVDL++Y TY +LSDALA MFSSFT GN G+QG+ DFMNE KLMDLLN S+YVP
Sbjct  198  PYLRKVDLRMYKTYLELSDALAKMFSSFTIGNCGSQGVKDFMNESKLMDLLNGSDYVP  255



>ref|XP_009761467.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana sylvestris]
Length=240

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 119/177 (67%), Gaps = 10/177 (6%)
 Frame = +3

Query  129  ETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLD-----LSETKMQA  293
            ETEL LGLPG   G     + K  GKR FSETVDLKLNL S  S +D     + E K  A
Sbjct  19   ETELRLGLPGAINGNEGEMTSKNNGKRVFSETVDLKLNLSSKDSTVDNQVDNIKEKKNIA  78

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAP  473
            P +P K P    AKAQVVGWPPVRS+RKNV+   QK++ G       G  FVKVS+DGAP
Sbjct  79   PTDPAKPP----AKAQVVGWPPVRSFRKNVLTV-QKNSTGNGESSGGGAAFVKVSVDGAP  133

Query  474  YLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            YLRKVDLK+Y +Y QLSDAL  MFSSFT GN G  G  DFMNE KL+DLLN S+YVP
Sbjct  134  YLRKVDLKMYKSYQQLSDALGKMFSSFTIGNCGTHGFKDFMNESKLIDLLNGSDYVP  190



>ref|XP_010485858.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 126/191 (66%), Gaps = 25/191 (13%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +N + TEL LGLPGGS GG  +  +K  GKRGFSETVDLKLNL S  S  DL   K +  
Sbjct  2    INFEATELRLGLPGGSHGGEMS--VKNNGKRGFSETVDLKLNLSSTVSEADLENMKEKVV  59

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQK-SNNGEEGDQKSGNN----------  443
              P        AK QVVGWPPVRS+RKNVM+  +  + +  EG+ K+  +          
Sbjct  60   KPP--------AKTQVVGWPPVRSFRKNVMSGQKPITGDAVEGNDKTPGSSGATSSASAC  111

Query  444  ----FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKL  611
                +VKVSMDGAPYLRK+DLK+Y TY  LS+AL+ MFSSFT GNYG QGM DF+NE KL
Sbjct  112  AAAAYVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFLNESKL  171

Query  612  MDLLNTSEYVP  644
            +DLLN S+YVP
Sbjct  172  IDLLNGSDYVP  182



>ref|XP_002306817.1| hypothetical protein POPTR_0005s23980g [Populus trichocarpa]
 gb|EEE93813.1| hypothetical protein POPTR_0005s23980g [Populus trichocarpa]
Length=229

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 111/150 (74%), Gaps = 3/150 (2%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQSDGSCLDLSETKMQAppep-nkdpikppAKAQVVGWPPVRSYRKN  380
            KRGFSETVDLKLNL S    +D +  K Q        DP KPPAKAQVVGWPPVRS+RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  381  VMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSF  554
            ++A  + S + E  D+  G N  FVKVSMDGAPYLRKVDLK+Y TY++LSDAL  MFSSF
Sbjct  96   MLAVQKSSTDQESTDKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYHELSDALGKMFSSF  155

Query  555  TTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            T GN G+ GM DF+NE KL+DLLN ++YVP
Sbjct  156  TIGNCGSHGMKDFLNESKLIDLLNGTDYVP  185



>ref|XP_006383686.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|ERP61483.1| auxin-induced protein aux28 [Populus trichocarpa]
Length=237

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 111/150 (74%), Gaps = 3/150 (2%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQSDGSCLDLSETKMQAppep-nkdpikppAKAQVVGWPPVRSYRKN  380
            KRGFSETVDLKLNL S    +D +  K Q        DP KPPAKAQVVGWPPVRS+RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  381  VMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSF  554
            ++A  + S + E  D+  G N  FVKVSMDGAPYLRKVDLK+Y TY++LSDAL  MFSSF
Sbjct  96   MLAVQKSSTDQESTDKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYHELSDALGKMFSSF  155

Query  555  TTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            T GN G+ GM DF+NE KL+DLLN ++YVP
Sbjct  156  TIGNCGSHGMKDFLNESKLIDLLNGTDYVP  185



>emb|CDY41894.1| BnaC05g47100D [Brassica napus]
Length=231

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 128/190 (67%), Gaps = 24/190 (13%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDG----SCLDLSETK  284
            +N + TEL LGLPGG+ GG+    MK  GKRGFSETVDLKLNL S      S +DL   K
Sbjct  2    INFEATELRLGLPGGNHGGDMA--MKNNGKRGFSETVDLKLNLSSTAMDSVSGVDLENMK  59

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQK-SNNGEEGDQKSGNN------  443
             +    P        AKAQVVGWPPVRS+RKNVM+  +  + +  EG +K+ ++      
Sbjct  60   EKVVKPP--------AKAQVVGWPPVRSFRKNVMSGQKPTAGDAAEGTEKTSSSNAATSS  111

Query  444  ---FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLM  614
               +VKVS+DGAPYLRK+DLK+Y TY  LSDAL+ MFSSFT GN G QGM DFMNE +L+
Sbjct  112  AAAYVKVSLDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNCGPQGMKDFMNESRLI  171

Query  615  DLLNTSEYVP  644
            DLLN S+YVP
Sbjct  172  DLLNGSDYVP  181



>gb|AEE25650.1| auxin-responsive protein [Gossypium hirsutum]
Length=253

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 117/155 (75%), Gaps = 10/155 (6%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQS--DGSCLDLSETKMQAppe------pnkdpikppAKAQVVGWPP  359
            KRGFSETVDLKLNL S  D S +D ++ K++   +         DP KPPAKAQVVGWPP
Sbjct  51   KRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVVGWPP  110

Query  360  VRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALAN  539
            VRS+RKN++A   + ++ EE  +K+    VKVSMDGAPYLRKVDL++Y +Y+QLSDALA 
Sbjct  111  VRSFRKNMLATTTQKSSSEESGEKAA--LVKVSMDGAPYLRKVDLRMYTSYHQLSDALAK  168

Query  540  MFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            MFSSFT GN G+QGM DFMNE KLMDLLN S+YVP
Sbjct  169  MFSSFTIGNCGSQGMKDFMNESKLMDLLNGSDYVP  203



>ref|NP_187124.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
 sp|O24407.1|IAA16_ARATH RecName: Full=Auxin-responsive protein IAA16; AltName: Full=Indoleacetic 
acid-induced protein 16 [Arabidopsis thaliana]
 gb|AAF04899.1|AC011437_14 auxin-induced protein [Arabidopsis thaliana]
 gb|AAG48764.1|AF332400_1 auxin-induced protein IAA16 [Arabidopsis thaliana]
 gb|AAK53004.1|AF375420_1 AT3g04730/F7O18_22 [Arabidopsis thaliana]
 gb|AAB84353.1| IAA16 [Arabidopsis thaliana]
 gb|AAM64751.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AAN38694.1| At3g04730/F7O18_22 [Arabidopsis thaliana]
 dbj|BAF01307.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AEE74127.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
Length=236

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 124/199 (62%), Gaps = 37/199 (19%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDG----SCLDLSETK  284
            +N + TEL LGLPGG+ GG      K  GKRGFSETVDLKLNL S      S +DL   K
Sbjct  2    INFEATELRLGLPGGNHGGEMAG--KNNGKRGFSETVDLKLNLSSTAMDSVSKVDLENMK  59

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-------  443
             +    P        AKAQVVGWPPVRS+RKNVM+  + +     GD   GN+       
Sbjct  60   EKVVKPP--------AKAQVVGWPPVRSFRKNVMSGQKPTT----GDATEGNDKTSGSSG  107

Query  444  ------------FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMI  587
                        +VKVSMDGAPYLRK+DLK+Y TY  LS+AL+ MFSSFT GNYG QGM 
Sbjct  108  ATSSASACATVAYVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMK  167

Query  588  DFMNERKLMDLLNTSEYVP  644
            DFMNE KL+DLLN S+YVP
Sbjct  168  DFMNESKLIDLLNGSDYVP  186



>ref|XP_008218270.1| PREDICTED: auxin-responsive protein IAA16 [Prunus mume]
Length=256

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 124/191 (65%), Gaps = 15/191 (8%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnen-esMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQ-  290
            +N +ETEL LGLPGG     ++ E+ K  GKRGFSETVDLKLN+ S     D S  + Q 
Sbjct  16   INFEETELRLGLPGGIANPGKDGEAAKNNGKRGFSETVDLKLNISSQDQSADRSADQDQQ  75

Query  291  ------------AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN-GEEGDQK  431
                          P  N     P +KAQVVGWPPVRS+RKN++   +KS+   E+G+  
Sbjct  76   LMELKREKNAAAPAPSANDPSKPPASKAQVVGWPPVRSFRKNIVTVQKKSSEEAEKGNSN  135

Query  432  SGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKL  611
                FVKVSMDGAPYLRKVDLK+Y +Y +LS AL  MFSSFT GN G+ GM DFMNE KL
Sbjct  136  ISAAFVKVSMDGAPYLRKVDLKLYKSYQELSTALGKMFSSFTIGNCGSDGMKDFMNESKL  195

Query  612  MDLLNTSEYVP  644
            +DLLN S+YVP
Sbjct  196  IDLLNGSDYVP  206



>ref|NP_001275398.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
 gb|ACV31209.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
Length=249

 Score =   172 bits (436),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 131/200 (66%), Gaps = 16/200 (8%)
 Frame = +3

Query  90   MTNMLGHGGLNLK-----ETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-  251
            MT++LG     ++     ETEL LGLPG +G   E+ + K  GKR FSETVDLKLNL + 
Sbjct  1    MTSVLGAECDKIRLDYEAETELRLGLPGANGNEVESTN-KNNGKRVFSETVDLKLNLSNS  59

Query  252  -DGSCLD-------LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSN  407
             D + +D       + E K       + DP K PAKAQVVGWPPVRS+RKNVM   + + 
Sbjct  60   KDSTLMDNINQVDNMKEKKNNIVVPSSNDPAKSPAKAQVVGWPPVRSFRKNVMTVQKNTT  119

Query  408  N-GEEGDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGM  584
              GE     +G  FVKVS+DGAPYLRKVDLK+Y +Y QLSDAL  MFSSFT GN G QG 
Sbjct  120  GAGESSGTGTGAAFVKVSVDGAPYLRKVDLKMYKSYQQLSDALGKMFSSFTIGNCGTQGF  179

Query  585  IDFMNERKLMDLLNTSEYVP  644
             DFMNE KL+DLLN S+YVP
Sbjct  180  KDFMNESKLIDLLNGSDYVP  199



>gb|KJB11141.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
 gb|KJB11144.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=253

 Score =   172 bits (435),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 117/155 (75%), Gaps = 10/155 (6%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQS--DGSCLDLSETKMQAppe------pnkdpikppAKAQVVGWPP  359
            KRGFSETVDLKLNL S  D S +D ++ K++   +         DP KPPAKAQVVGWPP
Sbjct  51   KRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVVGWPP  110

Query  360  VRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALAN  539
            VRS+RKN++A   + ++ EE  +K+    VKVSMDGAPYLRKVDL++Y +Y+QLSDALA 
Sbjct  111  VRSFRKNMLAATTQKSSSEESGEKAA--LVKVSMDGAPYLRKVDLRMYTSYHQLSDALAK  168

Query  540  MFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            MFSSFT GN G+QG+ DFMNE KLMDLLN S+YVP
Sbjct  169  MFSSFTIGNCGSQGIKDFMNESKLMDLLNGSDYVP  203



>ref|XP_010522504.1| PREDICTED: auxin-responsive protein IAA17-like [Tarenaya hassleriana]
Length=235

 Score =   171 bits (433),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 131/195 (67%), Gaps = 23/195 (12%)
 Frame = +3

Query  99   MLGHG-GLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD-----GS  260
            MLG G  LN+KETELCLGLPGG              KRGFSETVDLKLNL ++     GS
Sbjct  1    MLGGGVDLNMKETELCLGLPGGETAAPV-----AGNKRGFSETVDLKLNLNNEPHKDVGS  55

Query  261  CL-DLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSG  437
             L +   + + + P  +    KPPAKAQVVGWPPVR+YRKN+M          EG++ + 
Sbjct  56   ALSEQDPSSLVSVPNDSSSCPKPPAKAQVVGWPPVRTYRKNMMGR-----TSSEGEKATA  110

Query  438  NNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFT------TGNYGAQGMIDFMN  599
            N FVKVS+DGAPYLRKVDLK Y++Y+ LS AL+ MFSSFT       G  G +GMIDFM+
Sbjct  111  NAFVKVSIDGAPYLRKVDLKTYSSYDDLSTALSTMFSSFTNTGNYGGGGGGGEGMIDFMS  170

Query  600  ERKLMDLLNTSEYVP  644
            ERKLMDLLN+SEYVP
Sbjct  171  ERKLMDLLNSSEYVP  185



>gb|KJB11142.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
 gb|KJB11143.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=227

 Score =   171 bits (432),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 117/155 (75%), Gaps = 10/155 (6%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQS--DGSCLDLSETKMQAppe------pnkdpikppAKAQVVGWPP  359
            KRGFSETVDLKLNL S  D S +D ++ K++   +         DP KPPAKAQVVGWPP
Sbjct  51   KRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVVGWPP  110

Query  360  VRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALAN  539
            VRS+RKN++A   + ++ EE  +K+    VKVSMDGAPYLRKVDL++Y +Y+QLSDALA 
Sbjct  111  VRSFRKNMLAATTQKSSSEESGEKAA--LVKVSMDGAPYLRKVDLRMYTSYHQLSDALAK  168

Query  540  MFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            MFSSFT GN G+QG+ DFMNE KLMDLLN S+YVP
Sbjct  169  MFSSFTIGNCGSQGIKDFMNESKLMDLLNGSDYVP  203



>gb|KJB44872.1| hypothetical protein B456_007G276900 [Gossypium raimondii]
Length=210

 Score =   170 bits (431),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 118/185 (64%), Gaps = 16/185 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +N +ETEL LGLP G    NE    K  GKRG+S+ VDLKLNL +          KM+  
Sbjct  15   INFEETELRLGLPTGIENDNETA--KNNGKRGYSDMVDLKLNLSTTKEASVDEAEKMKEK  72

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--------FVK  452
                       AKAQVVGWPPVRS+RKN+M   + S++ +     SGN         FVK
Sbjct  73   NTAKPP-----AKAQVVGWPPVRSFRKNIMTVQKNSSDNKGEKTGSGNTINTAVPAAFVK  127

Query  453  VSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNY-GAQGMIDFMNERKLMDLLNT  629
            VSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN  G+QGM DFMNE KL+DLLN 
Sbjct  128  VSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTVGNCGGSQGMKDFMNEGKLIDLLNG  187

Query  630  SEYVP  644
            SEYVP
Sbjct  188  SEYVP  192



>gb|KJB11145.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=261

 Score =   172 bits (435),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 117/155 (75%), Gaps = 10/155 (6%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQS--DGSCLDLSETKMQAppe------pnkdpikppAKAQVVGWPP  359
            KRGFSETVDLKLNL S  D S +D ++ K++   +         DP KPPAKAQVVGWPP
Sbjct  51   KRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVVGWPP  110

Query  360  VRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALAN  539
            VRS+RKN++A   + ++ EE  +K+    VKVSMDGAPYLRKVDL++Y +Y+QLSDALA 
Sbjct  111  VRSFRKNMLAATTQKSSSEESGEKAA--LVKVSMDGAPYLRKVDLRMYTSYHQLSDALAK  168

Query  540  MFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            MFSSFT GN G+QG+ DFMNE KLMDLLN S+YVP
Sbjct  169  MFSSFTIGNCGSQGIKDFMNESKLMDLLNGSDYVP  203



>emb|CAN72026.1| hypothetical protein VITISV_014421 [Vitis vinifera]
Length=285

 Score =   172 bits (436),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 132/177 (75%), Gaps = 3/177 (2%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSET-KMQA  293
            LN +ETEL LGL    GGGN+ +  K++GKRGFSETVDLKLNL S  S  D +E  K ++
Sbjct  14   LNYEETELRLGLGLPGGGGNDGDVSKSSGKRGFSETVDLKLNLLSKDSVADQAEKMKEKS  73

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAP  473
               P+ DP KPPAKAQVVGWPPVRS+RKN++   +  N+ EE    S   FVKVSMDGAP
Sbjct  74   ALPPSNDPAKPPAKAQVVGWPPVRSFRKNILTVQK--NSSEEEKASSSAAFVKVSMDGAP  131

Query  474  YLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            YLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DFMNE KL+DLLN S+YVP
Sbjct  132  YLRKVDLKMYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVP  188



>ref|XP_011042427.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score =   171 bits (432),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 110/150 (73%), Gaps = 3/150 (2%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQSDGSCLDLSETKMQAppep-nkdpikppAKAQVVGWPPVRSYRKN  380
            KRGFSETVDLKLNL S    +D +  K Q        DP KPPAKAQVVGWPPVRS+RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  381  VMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSF  554
            ++A  + S + E  D+  G N  FVKVSMDGAPYLRKVDLK+Y TY++LSDAL  MFSSF
Sbjct  96   MLAVQKSSTDQESTDKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYHELSDALGEMFSSF  155

Query  555  TTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            T GN G+ GM DF+NE KL+DLL  ++YVP
Sbjct  156  TIGNCGSHGMKDFLNESKLIDLLTGTDYVP  185



>ref|XP_011082603.1| PREDICTED: auxin-responsive protein IAA14-like [Sesamum indicum]
Length=215

 Score =   170 bits (430),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 120/175 (69%), Gaps = 18/175 (10%)
 Frame = +3

Query  126  KETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAppep  305
            +ETEL LG+PGG        +     KRGF ET+D KLN  S+G  ++ S          
Sbjct  7    EETELRLGMPGGLHKIAGAGN-SYGAKRGFEETLDFKLNFASNGENINDS----------  55

Query  306  nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYL  479
                +KPPAKAQVVGWPPVRS+RKN+MA  +KS + E+ ++ SG    FVKVSMDGAPYL
Sbjct  56   ----VKPPAKAQVVGWPPVRSFRKNIMAV-KKSGDSEDNEKGSGGGGAFVKVSMDGAPYL  110

Query  480  RKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            RK+DLK+Y TY +LSDAL  MFSSFT G    QGM+DFMNE KLMDLLN+SEYVP
Sbjct  111  RKIDLKMYKTYQELSDALGKMFSSFTMGKCDTQGMMDFMNESKLMDLLNSSEYVP  165



>ref|XP_009364490.1| PREDICTED: auxin-responsive protein IAA16 [Pyrus x bretschneideri]
Length=252

 Score =   171 bits (433),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 129/188 (69%), Gaps = 14/188 (7%)
 Frame = +3

Query  117  LNLKETELCLGLPggs--gggnenesMKTTGKRGFSETVDLKLNL----QSDGSCLDLSE  278
            +N +ETEL LGLPGG     G + E+ K TGKRGF+ETVDLKLN+    QS G    + E
Sbjct  16   INFEETELRLGLPGGILGTAGKDGEASKNTGKRGFAETVDLKLNISSEDQSAGDEDQVEE  75

Query  279  TKMQ----AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSG--N  440
             K +      P  N     P AKAQ VGWPPVRS+RKN++A  +  N  EEG++ +    
Sbjct  76   MKKEKNVAPVPRSNNPTKPPAAKAQAVGWPPVRSFRKNILAVQK--NGSEEGEKTNSITA  133

Query  441  NFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDL  620
             FVKVS+DGAPYLRKVDLK+Y +Y +LS AL+ MFSSFT GN G+QGM DF+NE KL+DL
Sbjct  134  AFVKVSVDGAPYLRKVDLKLYKSYQELSTALSKMFSSFTIGNCGSQGMKDFVNESKLIDL  193

Query  621  LNTSEYVP  644
            L+ SEYVP
Sbjct  194  LSGSEYVP  201



>ref|XP_002517023.1| Auxin-responsive protein IAA7, putative [Ricinus communis]
 gb|EEF45186.1| Auxin-responsive protein IAA7, putative [Ricinus communis]
Length=181

 Score =   169 bits (427),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 87/105 (83%), Gaps = 3/105 (3%)
 Frame = +3

Query  330  AKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVDLKVYNT  509
            AKAQVVGWPPVRSYRKN+MA     N  EEG++ S   FVKV MDGAPYLRKVDLK+Y +
Sbjct  30   AKAQVVGWPPVRSYRKNIMAQK---NTSEEGEKASSAAFVKVCMDGAPYLRKVDLKMYKS  86

Query  510  YNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            Y +LSDALA MFSSFT GNYG QGMIDFMNE KLMDLLN+SEYVP
Sbjct  87   YQELSDALAKMFSSFTMGNYGTQGMIDFMNESKLMDLLNSSEYVP  131



>ref|XP_007205640.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
 gb|EMJ06839.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
Length=299

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 128/190 (67%), Gaps = 14/190 (7%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnen-esMKTTGKRGFSETVDLKLNLQS----------DGSC  263
            +N +ETEL LGLPGG     ++ E+ K  GKRGFSETVDLKLN+ S          D   
Sbjct  60   INFEETELRLGLPGGIANPGKDGEAAKNNGKRGFSETVDLKLNISSQDETADEDDQDQQL  119

Query  264  LDLSETKMQAppepnkd--pikppAKAQVVGWPPVRSYRKNVMAHHQKSNN-GEEGDQKS  434
            L+L + K  A P P  +     P +KAQVVGWPPVRS+RKN+    +KS++ GE+ +   
Sbjct  120  LELKKEKNAAAPAPGANDPSKPPASKAQVVGWPPVRSFRKNIATVQKKSSDEGEKSNSNI  179

Query  435  GNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLM  614
               FVKVSMDGAPYLRKVDLK+Y +Y +LS AL  MFSSFT GN G+ GM DFMNE KL+
Sbjct  180  SAAFVKVSMDGAPYLRKVDLKLYKSYQELSTALGKMFSSFTIGNCGSDGMKDFMNESKLI  239

Query  615  DLLNTSEYVP  644
            DLLN S+YVP
Sbjct  240  DLLNGSDYVP  249



>gb|KJB11146.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=285

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 117/155 (75%), Gaps = 10/155 (6%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQS--DGSCLDLSETKMQAppe------pnkdpikppAKAQVVGWPP  359
            KRGFSETVDLKLNL S  D S +D ++ K++   +         DP KPPAKAQVVGWPP
Sbjct  51   KRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVVGWPP  110

Query  360  VRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALAN  539
            VRS+RKN++A   + ++ EE  +K+    VKVSMDGAPYLRKVDL++Y +Y+QLSDALA 
Sbjct  111  VRSFRKNMLAATTQKSSSEESGEKAA--LVKVSMDGAPYLRKVDLRMYTSYHQLSDALAK  168

Query  540  MFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            MFSSFT GN G+QG+ DFMNE KLMDLLN S+YVP
Sbjct  169  MFSSFTIGNCGSQGIKDFMNESKLMDLLNGSDYVP  203



>gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tabacum]
Length=240

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 117/177 (66%), Gaps = 10/177 (6%)
 Frame = +3

Query  129  ETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLD-----LSETKMQA  293
            ETEL LGL     G     + K  GKR FSETVDLKLNL S  S +D     + E K  A
Sbjct  19   ETELRLGLRSAINGNEGEMTSKNNGKRVFSETVDLKLNLSSKDSTVDNQVDNIKEKKNIA  78

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAP  473
            P +P K P    AKAQVVGWPPVRS+RKNV+   QK++ G       G  FVKVS+DGAP
Sbjct  79   PTDPAKPP----AKAQVVGWPPVRSFRKNVLTV-QKNSTGNGESSGGGAAFVKVSVDGAP  133

Query  474  YLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            YLRKVDLK+Y +Y QLSDAL  MFSSFT GN G  G  DFMNE KL+DLLN S+YVP
Sbjct  134  YLRKVDLKMYKSYQQLSDALGKMFSSFTIGNCGTHGFKDFMNESKLIDLLNGSDYVP  190



>ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum]
 gb|AEX00359.1| IAA16 [Solanum lycopersicum]
Length=251

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 132/202 (65%), Gaps = 18/202 (9%)
 Frame = +3

Query  90   MTNMLGHGGLNLK-----ETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-  251
            MT++LG     ++     ETEL LGLPG +G   E+ + K  GKR FSETVDLKLNL + 
Sbjct  1    MTSVLGAECDKIRLDYEAETELRLGLPGANGNELESSN-KNNGKRVFSETVDLKLNLSNS  59

Query  252  -DGSCLD---------LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQK  401
             D + +D         + E K       + DP KPPAKAQVVGWPPVRS+RKNVM   + 
Sbjct  60   KDSTLMDNININQVDNMKEKKNNIVVPSSNDPAKPPAKAQVVGWPPVRSFRKNVMTVQKN  119

Query  402  SNN-GEEGDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQ  578
            +   GE     +G  FVKVS+DGAPYLRKVDLK+Y +Y QLSDAL  MFSSFT GN G Q
Sbjct  120  TTGAGEISGTGTGAAFVKVSVDGAPYLRKVDLKMYKSYQQLSDALGKMFSSFTIGNCGTQ  179

Query  579  GMIDFMNERKLMDLLNTSEYVP  644
            G  DFMNE KL+DLLN S+YVP
Sbjct  180  GFKDFMNESKLIDLLNGSDYVP  201



>gb|KJB44873.1| hypothetical protein B456_007G276900 [Gossypium raimondii]
Length=254

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 123/185 (66%), Gaps = 16/185 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +N +ETEL LGLP G    NE    K  GKRG+S+ VDLKLNL +          KM+  
Sbjct  15   INFEETELRLGLPTGIENDNETA--KNNGKRGYSDMVDLKLNLSTTKEASVDEAEKMK--  70

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--------FVK  452
                K+  KPPAKAQVVGWPPVRS+RKN+M   + S++ +     SGN         FVK
Sbjct  71   ---EKNTAKPPAKAQVVGWPPVRSFRKNIMTVQKNSSDNKGEKTGSGNTINTAVPAAFVK  127

Query  453  VSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNY-GAQGMIDFMNERKLMDLLNT  629
            VSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN  G+QGM DFMNE KL+DLLN 
Sbjct  128  VSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTVGNCGGSQGMKDFMNEGKLIDLLNG  187

Query  630  SEYVP  644
            SEYVP
Sbjct  188  SEYVP  192



>ref|XP_010463960.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score =   169 bits (428),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 126/192 (66%), Gaps = 27/192 (14%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +N + TEL LGLPGGS GG  +  +K  GKRGFSETVDLKLNL S  S  DL   K +  
Sbjct  2    INFEATELRLGLPGGSHGGEMS--VKNNGKRGFSETVDLKLNLSSTVSEADLENMKEKVV  59

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGE--EGDQKSGNN---------  443
              P        AK QVVGWPPVRS+RKNVM+  QK   G+  EG+ K+  +         
Sbjct  60   KPP--------AKTQVVGWPPVRSFRKNVMSG-QKPITGDTVEGNDKTSGSSGATSSASA  110

Query  444  -----FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERK  608
                 +VKVSMDGAPYLRK+DLK+Y TY  LS+AL+ MFSSFT GNYG QGM DFMNE K
Sbjct  111  CAAAAYVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESK  170

Query  609  LMDLLNTSEYVP  644
            L+DLLN S+ VP
Sbjct  171  LIDLLNGSDCVP  182



>ref|XP_002302075.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|EEE81348.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|AFZ78622.1| hypothetical protein [Populus tomentosa]
Length=237

 Score =   169 bits (429),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 125/182 (69%), Gaps = 11/182 (6%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +  +ETEL LGLPG  GG       +   KRGFSETVDLKL L S  S  D +  K  + 
Sbjct  9    MGFEETELRLGLPGNGGGAEG----EMVRKRGFSETVDLKLKLSSKESGADPNHEKTSSL  64

Query  297  pep----nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVS  458
                     DP KPPAKAQVVGWPPVRS+RKN++A  QKS+  +E ++  G N  FVKVS
Sbjct  65   QREKNLLATDPAKPPAKAQVVGWPPVRSFRKNMLAV-QKSSTDQECEKVPGGNATFVKVS  123

Query  459  MDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEY  638
            MDGAPYLRKVDLK+Y TY +LSDAL  MFSSFT GN G+ G+ DF+NE KL+DLLN ++Y
Sbjct  124  MDGAPYLRKVDLKMYKTYQELSDALGKMFSSFTIGNCGSHGLKDFLNESKLIDLLNGTDY  183

Query  639  VP  644
            VP
Sbjct  184  VP  185



>gb|KEH43016.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=243

 Score =   169 bits (427),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 122/190 (64%), Gaps = 15/190 (8%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSET--VDLKLNLQS-------DGSCLD  269
            +N +ETEL LGLPG    G       + GKRGFSET  VDLKLNL           +   
Sbjct  15   INFEETELRLGLPGAGDHGESPVK-NSCGKRGFSETANVDLKLNLSPINDSASSSSTIAS  73

Query  270  LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK----SG  437
            ++E K +           P AKAQVVGWPPVRS+RKN++  HQKSN+  E D+      G
Sbjct  74   VAENKGKDTTTSATVSPPPRAKAQVVGWPPVRSFRKNIVNVHQKSNSETEVDKSISGGGG  133

Query  438  NN-FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLM  614
            N  FVKVSMDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT  N G+Q   DFMNE KL+
Sbjct  134  NGAFVKVSMDGAPYLRKVDLKLYKSYQELSDALAKMFSSFTIDNCGSQVTKDFMNESKLI  193

Query  615  DLLNTSEYVP  644
            DLLN S+YVP
Sbjct  194  DLLNGSDYVP  203



>ref|XP_009124981.1| PREDICTED: auxin-responsive protein IAA16-like [Brassica rapa]
 emb|CDY21111.1| BnaA01g33420D [Brassica napus]
Length=236

 Score =   168 bits (426),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 128/193 (66%), Gaps = 25/193 (13%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD--GSCLDLSETKMQ  290
            +N + TEL LGLPG + GG      K  GKRGFSETVDLKLNL S   GS  ++    M+
Sbjct  2    INFEATELRLGLPGENHGGGMAA--KNNGKRGFSETVDLKLNLSSTAMGSVSEVDLVNMK  59

Query  291  AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNG--EEGDQKSGNN-------  443
                  +  +KPPAKAQVVGWPPVRS+RKNVM+  + +     +  ++ SG+N       
Sbjct  60   ------EKVVKPPAKAQVVGWPPVRSFRKNVMSGPKPTTGDAVQATEKTSGSNGATSSAS  113

Query  444  ------FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNER  605
                  +VKVSMDGAPYLRK+DLK+Y TY  LSDAL+ MFSSFT G+YG QGM D +NE 
Sbjct  114  IGATAAYVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGSYGPQGMKDIVNEG  173

Query  606  KLMDLLNTSEYVP  644
            KL+DLLN S+YVP
Sbjct  174  KLIDLLNGSDYVP  186



>gb|KHG04941.1| Auxin-induced AUX28 [Gossypium arboreum]
Length=235

 Score =   168 bits (426),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 122/177 (69%), Gaps = 16/177 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +  +ETEL LGLPG           +   KR FS TVDLKLNL S     D  +  + + 
Sbjct  24   MGYEETELRLGLPGDG---------EVVRKRDFSHTVDLKLNLISTSPTDDKDKNIVPSH  74

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPY  476
             +P K P    AKAQVVGWPPVRS+RKN++A  QKS+  E+  +K+   FVKVSMDGAPY
Sbjct  75   LDPAKPPP---AKAQVVGWPPVRSFRKNMLAT-QKSSGSEDSGEKAA--FVKVSMDGAPY  128

Query  477  LRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMI-DFMNERKLMDLLNTSEYVP  644
            LRKVDL++Y TY QLSDALA MFSSFT GN G+QG++ DFMNE KLMDLLN S+YVP
Sbjct  129  LRKVDLRMYKTYQQLSDALAKMFSSFTIGNCGSQGLLKDFMNESKLMDLLNGSDYVP  185



>ref|XP_002884465.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60724.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
Length=236

 Score =   168 bits (426),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 122/199 (61%), Gaps = 37/199 (19%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDG----SCLDLSETK  284
            +N + TEL LGLPGG+ GG      K  GKRGFSETVDLKLNL S      S +DL   K
Sbjct  2    INFEATELRLGLPGGNHGGEMVG--KYNGKRGFSETVDLKLNLSSTAMDSVSKVDLENMK  59

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-------  443
             +    P        AKAQVVGWPPVRS+RKNVM+  + +     GD   GN+       
Sbjct  60   EKVVKPP--------AKAQVVGWPPVRSFRKNVMSGQKPTT----GDATVGNDKTSGSSG  107

Query  444  ------------FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMI  587
                        +VKVSMDGAPYLRK+DLK+Y TY  LSDAL+ MFSSFT G YG QGM 
Sbjct  108  ATSSASVCAAVAYVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGTYGPQGMK  167

Query  588  DFMNERKLMDLLNTSEYVP  644
            DFMNE  L+DLLN S+YVP
Sbjct  168  DFMNESILIDLLNGSDYVP  186



>gb|KEH43017.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=253

 Score =   169 bits (427),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 122/190 (64%), Gaps = 15/190 (8%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSET--VDLKLNLQS-------DGSCLD  269
            +N +ETEL LGLPG    G       + GKRGFSET  VDLKLNL           +   
Sbjct  15   INFEETELRLGLPGAGDHGESPVK-NSCGKRGFSETANVDLKLNLSPINDSASSSSTIAS  73

Query  270  LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK----SG  437
            ++E K +           P AKAQVVGWPPVRS+RKN++  HQKSN+  E D+      G
Sbjct  74   VAENKGKDTTTSATVSPPPRAKAQVVGWPPVRSFRKNIVNVHQKSNSETEVDKSISGGGG  133

Query  438  NN-FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLM  614
            N  FVKVSMDGAPYLRKVDLK+Y +Y +LSDALA MFSSFT  N G+Q   DFMNE KL+
Sbjct  134  NGAFVKVSMDGAPYLRKVDLKLYKSYQELSDALAKMFSSFTIDNCGSQVTKDFMNESKLI  193

Query  615  DLLNTSEYVP  644
            DLLN S+YVP
Sbjct  194  DLLNGSDYVP  203



>gb|KJB42200.1| hypothetical protein B456_007G141900 [Gossypium raimondii]
Length=235

 Score =   168 bits (425),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 122/177 (69%), Gaps = 16/177 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +  +ETEL LGLPG           +   KR FS TVDLKLNL S     D  +  + + 
Sbjct  24   MGYEETELRLGLPGDG---------EVVRKRDFSHTVDLKLNLISTSPTDDKDKNIVPSH  74

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPY  476
             +P K P    AKAQVVGWPPVRS+RKN++A  QKS+  E+  +K+   FVKVSMDGAPY
Sbjct  75   LDPAKPPP---AKAQVVGWPPVRSFRKNMLAT-QKSSASEDSGEKAA--FVKVSMDGAPY  128

Query  477  LRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMI-DFMNERKLMDLLNTSEYVP  644
            LRKVDL++Y TY QLSDALA MFSSFT GN G+QG++ DFMNE KLMDLLN S+YVP
Sbjct  129  LRKVDLRMYKTYQQLSDALAKMFSSFTIGNCGSQGLLKDFMNESKLMDLLNGSDYVP  185



>ref|XP_010917602.1| PREDICTED: auxin-responsive protein IAA30 isoform X2 [Elaeis 
guineensis]
Length=238

 Score =   168 bits (426),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 117/186 (63%), Gaps = 21/186 (11%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-DGSCLDLSETKMQA  293
            L  +ETEL LGLPG           + T KRGFSET+DLKL LQ+ D   ++    KM+ 
Sbjct  14   LGFEETELRLGLPGDG---------EATKKRGFSETIDLKLKLQTVDSKDIEAEAEKMKR  64

Query  294  ppepn-------kdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVK  452
                             P  KAQVVGWPPVRS+RKN+M+      N EEG++ +   FVK
Sbjct  65   SASQKNLLACSNDPEKPPAPKAQVVGWPPVRSFRKNIMSVQSDKGNKEEGEKSA--TFVK  122

Query  453  VSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGM--IDFMNERKLMDLLN  626
            VSMDGAPYLRK+DLK+Y +Y +LS AL  MFSSFT GN  +QG+   DFMNE KLMDL+N
Sbjct  123  VSMDGAPYLRKIDLKMYRSYQELSVALEKMFSSFTIGNCSSQGIKGRDFMNESKLMDLIN  182

Query  627  TSEYVP  644
             SEYVP
Sbjct  183  GSEYVP  188



>ref|XP_006298436.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
 gb|EOA31334.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
Length=241

 Score =   168 bits (426),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 131/194 (68%), Gaps = 22/194 (11%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +N + TEL LGLPGG+ GG+    +K  GKRGFSETVDLKLNL S  + +D S +  Q  
Sbjct  2    INFEATELRLGLPGGNHGGDMAA-VKNNGKRGFSETVDLKLNLSS--TAMD-SVSGAQLE  57

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQK-SNNGEEGDQKSGNN----------  443
                KD +KPPAK QVVGWPPVRS+RKNVM+  +  + +  EG+ K+  +          
Sbjct  58   DIKEKDVVKPPAKTQVVGWPPVRSFRKNVMSGQKPITGDAVEGNDKTSGSSGATSSASAC  117

Query  444  -------FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNE  602
                   +VKVSMDGAPYLRK+DLK+Y TY  LSDAL+ MFSSFT GN G QGM DFMNE
Sbjct  118  AAAAAAAYVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNCGPQGMKDFMNE  177

Query  603  RKLMDLLNTSEYVP  644
             KL+DLLN S+YVP
Sbjct  178  SKLIDLLNGSDYVP  191



>ref|XP_010917600.1| PREDICTED: auxin-responsive protein IAA30 isoform X1 [Elaeis 
guineensis]
Length=246

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 117/186 (63%), Gaps = 21/186 (11%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS-DGSCLDLSETKMQA  293
            L  +ETEL LGLPG           + T KRGFSET+DLKL LQ+ D   ++    KM+ 
Sbjct  14   LGFEETELRLGLPGDG---------EATKKRGFSETIDLKLKLQTVDSKDIEAEAEKMKR  64

Query  294  ppepn-------kdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVK  452
                             P  KAQVVGWPPVRS+RKN+M+      N EEG++ +   FVK
Sbjct  65   SASQKNLLACSNDPEKPPAPKAQVVGWPPVRSFRKNIMSVQSDKGNKEEGEKSA--TFVK  122

Query  453  VSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGM--IDFMNERKLMDLLN  626
            VSMDGAPYLRK+DLK+Y +Y +LS AL  MFSSFT GN  +QG+   DFMNE KLMDL+N
Sbjct  123  VSMDGAPYLRKIDLKMYRSYQELSVALEKMFSSFTIGNCSSQGIKGRDFMNESKLMDLIN  182

Query  627  TSEYVP  644
             SEYVP
Sbjct  183  GSEYVP  188



>emb|CAC84711.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=229

 Score =   166 bits (421),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 110/150 (73%), Gaps = 3/150 (2%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQSDGSCLDLSETKMQAppep-nkdpikppAKAQVVGWPPVRSYRKN  380
            KRGFSETVDLKLNL S    +D +  K +        DP KPPAKAQVVGWPPVRS+RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTRREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  381  VMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSF  554
            ++A  + S + E  ++  G N  FVKVSMDGAPYLRKVDL +Y TY++LSDAL  MFSSF
Sbjct  96   MLAVQKSSTDQESTNKVPGGNATFVKVSMDGAPYLRKVDLNMYKTYHELSDALGKMFSSF  155

Query  555  TTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            T GN G+ GM DF+NE KL+DLLN ++YVP
Sbjct  156  TIGNCGSHGMKDFLNESKLIDLLNGTDYVP  185



>ref|XP_010102292.1| Auxin-responsive protein IAA16 [Morus notabilis]
 gb|EXB93235.1| Auxin-responsive protein IAA16 [Morus notabilis]
Length=257

 Score =   166 bits (421),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 114/161 (71%), Gaps = 10/161 (6%)
 Frame = +3

Query  192  KTTGKRGFSETVDLKLNLQS-DGSCLDLSETK--MQAppepnkdpikppAKAQVVGWPPV  362
            K  GKRGF ETVDLKLNL S D   LD  + K    +P  P+ D +KPPAKAQVVGWPPV
Sbjct  47   KNNGKRGFPETVDLKLNLSSKDSGSLDQVDKKEIKTSPVSPSTDSVKPPAKAQVVGWPPV  106

Query  363  RSYRKNVMAHHQKSNNGE-------EGDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQL  521
            RS+RKN+++  + S + E        G   S   FVKVSMDGAPYLRKVDLK+Y +Y +L
Sbjct  107  RSFRKNIVSAQKNSGDHEAVKAGGGGGGSSSSAAFVKVSMDGAPYLRKVDLKLYKSYQEL  166

Query  522  SDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            SDAL  MFSSFT GN G+QGM DFMNE KL+DLLN SEYVP
Sbjct  167  SDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVP  207



>ref|XP_006443920.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 gb|ESR57160.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=226

 Score =   166 bits (419),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 121/183 (66%), Gaps = 17/183 (9%)
 Frame = +3

Query  114  GLNL--KETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLS--ET  281
            GLN+  +ETEL LGLPG           + + KRGFSETVDLKLNL S  +   +   + 
Sbjct  5    GLNMGFEETELRLGLPGNRVRSEG----EGSRKRGFSETVDLKLNLSSKDTSEKVKSFQK  60

Query  282  KMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKV  455
            +    P     P KPPAK QVVGWPPVRS+RKN++   QKS+ GEE D   GNN  FVKV
Sbjct  61   EKHPLPRATDPPAKPPAKTQVVGWPPVRSFRKNMLGVVQKSS-GEESDMAGGNNAAFVKV  119

Query  456  SMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSE  635
            SMDGAPYLRKVDL++YNTY  L DAL  MFSSFT       GM DFMNE KLMDLLN S+
Sbjct  120  SMDGAPYLRKVDLRMYNTYKDLYDALGKMFSSFTI------GMKDFMNESKLMDLLNGSD  173

Query  636  YVP  644
            YVP
Sbjct  174  YVP  176



>dbj|BAI94494.1| Aux/IAA protein [Dianthus caryophyllus]
Length=238

 Score =   166 bits (419),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 104/149 (70%), Gaps = 11/149 (7%)
 Frame = +3

Query  207  RGFSETVDLKLNLQSDGSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVM  386
            RGFS+TVDL  N +        ++ K         D +KPPAKAQVVGWPPVRSYRKNVM
Sbjct  48   RGFSDTVDLMKNDKK-------ADVKDVCSKVVVTDSVKPPAKAQVVGWPPVRSYRKNVM  100

Query  387  AHHQKSNNGEEG---DQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFT  557
               QK   GEEG   D+ S    VKVSMDGAPYLRKV LK+Y +Y +LSDAL  MFS FT
Sbjct  101  TL-QKGTAGEEGETVDKSSSGGLVKVSMDGAPYLRKVHLKMYKSYQELSDALGKMFSFFT  159

Query  558  TGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
             GNYG QGMIDFMNERKLMDLLN S+YVP
Sbjct  160  LGNYGEQGMIDFMNERKLMDLLNDSDYVP  188



>ref|XP_006471686.1| PREDICTED: auxin-responsive protein IAA16-like isoform X3 [Citrus 
sinensis]
Length=217

 Score =   165 bits (418),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 133/197 (68%), Gaps = 24/197 (12%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTG-----------KRGFSETV-DLKLNL--QSD  254
            +N + TEL LGLPGG+GG +E       G           KRGF++TV DLKLNL  +  
Sbjct  2    INFEATELRLGLPGGNGGSSEGGGGGGGGEKAKNNNINGMKRGFADTVVDLKLNLSTKES  61

Query  255  GSCLDLSETKMQ-AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK  431
            G    + +TK + A      D  KPPAKAQVVGWPPVRS+RKN+MA  QK N  EEGD K
Sbjct  62   GGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSFRKNIMAV-QKDN--EEGDNK  118

Query  432  SGNN------FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDF  593
            + ++      FVKVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DF
Sbjct  119  ASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDF  178

Query  594  MNERKLMDLLNTSEYVP  644
            MNE KL+DLLN S+YVP
Sbjct  179  MNESKLIDLLNGSDYVP  195



>ref|XP_006432921.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 gb|ESR46161.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=213

 Score =   165 bits (417),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 133/197 (68%), Gaps = 24/197 (12%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTG-----------KRGFSETV-DLKLNL--QSD  254
            +N + TEL LGLPGG+GG +E       G           KRGF++TV DLKLNL  +  
Sbjct  2    INFEATELRLGLPGGNGGSSEGGGGGGGGEKAKNNNINGMKRGFADTVVDLKLNLSTKES  61

Query  255  GSCLDLSETKMQ-AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK  431
            G    + +TK + A      D  KPPAKAQVVGWPPVRS+RKN+MA  QK N  EEGD K
Sbjct  62   GGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSFRKNIMAV-QKDN--EEGDNK  118

Query  432  SGNN------FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDF  593
            + ++      FVKVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DF
Sbjct  119  ASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDF  178

Query  594  MNERKLMDLLNTSEYVP  644
            MNE KL+DLLN S+YVP
Sbjct  179  MNESKLIDLLNGSDYVP  195



>gb|ACJ83896.1| unknown [Medicago truncatula]
 gb|AFK48514.1| unknown [Medicago truncatula]
 gb|KEH42620.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=245

 Score =   166 bits (419),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 124/186 (67%), Gaps = 21/186 (11%)
 Frame = +3

Query  129  ETELCLGLPggsgggnenesMKTTGKRGFSET--------VDLKLNLQSDGSCLDLSETK  284
            ETEL LGL      G   ++ +   KRGFSET        VDLKLNL +     D     
Sbjct  17   ETELRLGL------GLPGKTTEVVRKRGFSETESESETNTVDLKLNLSTKEGATDPQFKP  70

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNG-EEGDQKSGNN----FV  449
             +     +    KPPAKAQVVGWPPVRS+RKN+ A  QKSN G EE ++K+ NN    FV
Sbjct  71   KEKALLLSDSGAKPPAKAQVVGWPPVRSFRKNMFAA-QKSNEGSEESEKKNSNNNPISFV  129

Query  450  KVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNE-RKLMDLLN  626
            KVSMDGAPYLRKVDLK+Y +Y +LSDALA MF+SFTTGN  +QG+ DFMNE  KLMDLLN
Sbjct  130  KVSMDGAPYLRKVDLKMYKSYPELSDALAKMFNSFTTGNCESQGIKDFMNESNKLMDLLN  189

Query  627  TSEYVP  644
            +S+YVP
Sbjct  190  SSDYVP  195



>gb|AAC49055.1| IAA14, partial [Arabidopsis thaliana]
Length=164

 Score =   163 bits (413),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 88/107 (82%), Gaps = 3/107 (3%)
 Frame = +3

Query  330  AKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRKVDLKVY  503
            AKAQVVGWPPVR+YRKNVMA+ QKS   EE     G    FVKVSMDGAPYLRKVDLK+Y
Sbjct  9    AKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDGAPYLRKVDLKMY  67

Query  504  NTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
             +Y  LSDALA MFSSFT G+YGAQGMIDFMNE K+MDLLN+SEYVP
Sbjct  68   TSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVP  114



>ref|XP_010936171.1| PREDICTED: auxin-responsive protein IAA30-like [Elaeis guineensis]
Length=251

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 111/168 (66%), Gaps = 20/168 (12%)
 Frame = +3

Query  192  KTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAppepnkdpikp--------------p  329
            K +GKRGFSET+DLKL L +     D  E  M+A  +  + P                  
Sbjct  37   KNSGKRGFSETIDLKLKLHT---VADSKEVVMEASEKMKRSPPSQNNILTCTNDPEKPPA  93

Query  330  AKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN-FVKVSMDGAPYLRKVDLKVYN  506
             KAQVVGWPPVRS+RKN+MA H    + E G++ S +  FVKVSMDGAPYLRKVDLK+Y+
Sbjct  94   PKAQVVGWPPVRSFRKNMMASHSDKGSKEAGEKSSNSAAFVKVSMDGAPYLRKVDLKMYS  153

Query  507  TYNQLSDALANMFSSFTTGNYGAQGM--IDFMNERKLMDLLNTSEYVP  644
            +Y +LS AL  MFSSFT+GN G+QGM   DFMNE KLMDLLN SEYVP
Sbjct  154  SYKELSMALEKMFSSFTSGNCGSQGMNGRDFMNESKLMDLLNGSEYVP  201



>ref|XP_004493739.1| PREDICTED: auxin-induced protein AUX28-like [Cicer arietinum]
Length=246

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 125/190 (66%), Gaps = 19/190 (10%)
 Frame = +3

Query  117  LNLKETELCLG--LPggsgggnenesMKTTGKRGFSET------VDLKLNLQ------SD  254
            +  +ETEL LG  LP       E        KRGFSET      +DL LNL       S+
Sbjct  11   MRFEETELRLGIGLPRNGSATEEL----VVRKRGFSETETQDHTMDLMLNLSTNKEPTSE  66

Query  255  GSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS  434
               +D ++   +       DP KPPAKAQVVGWPPVRSYRKN++A  QKS+N   G++ +
Sbjct  67   VDPIDNTKILQKENTLLPADPAKPPAKAQVVGWPPVRSYRKNMLAM-QKSSNDVVGEENN  125

Query  435  GNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLM  614
              +FVKVSMDGAPYLRKVDLK+YN+Y+QLSD+L  MFSSFT GN  +QGM DFMNE KLM
Sbjct  126  AISFVKVSMDGAPYLRKVDLKIYNSYSQLSDSLGKMFSSFTIGNCESQGMKDFMNESKLM  185

Query  615  DLLNTSEYVP  644
            DLLN S+YVP
Sbjct  186  DLLNNSDYVP  195



>gb|EPS60474.1| hypothetical protein M569_14329, partial [Genlisea aurea]
Length=212

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 118/178 (66%), Gaps = 9/178 (5%)
 Frame = +3

Query  126  KETELCLGLP---ggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            +ETEL LGLP           + S    GKRGF+ETVDLKLNL +    LD  E + +  
Sbjct  1    EETELRLGLPGAGVDQFQAVSSASAAACGKRGFAETVDLKLNLAAKEMNLD-KEKEKKKN  59

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGA  470
             + + D  KPP KAQVVGWPPVR++R+N +   +KS    E  +K+  +   VKVSMDGA
Sbjct  60   LQISADSSKPPMKAQVVGWPPVRAFRRNAICSQKKSTEPAEETEKASPSPALVKVSMDGA  119

Query  471  PYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            PYLRK+DLK+Y TY QLSDALA MFSSFT G   +QGM+DFMNE K   LLNTS+YVP
Sbjct  120  PYLRKIDLKMYKTYQQLSDALAKMFSSFTIGKCESQGMLDFMNESK---LLNTSDYVP  174



>gb|KDO48906.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=217

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 133/197 (68%), Gaps = 24/197 (12%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTG-----------KRGFSETV-DLKLNL--QSD  254
            +N + TEL LGLPGG+GG +E       G           KRGF++TV DLKLNL  +  
Sbjct  2    INFEATELRLGLPGGNGGSSEGGGGGGGGEKAKNNNINGMKRGFADTVVDLKLNLSTKES  61

Query  255  GSCLDLSETKMQ-AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK  431
            G    + +TK + A      D  KPPAK+QVVGWPPVRS+RKN+MA  QK N  EEGD K
Sbjct  62   GGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSFRKNIMAV-QKDN--EEGDNK  118

Query  432  SGNN------FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDF  593
            + ++      FVKVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DF
Sbjct  119  ASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDF  178

Query  594  MNERKLMDLLNTSEYVP  644
            MNE KL+DLLN S+YVP
Sbjct  179  MNESKLIDLLNGSDYVP  195



>ref|XP_006432923.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 ref|XP_006471684.1| PREDICTED: auxin-responsive protein IAA16-like isoform X1 [Citrus 
sinensis]
 gb|ESR46163.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=245

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 133/197 (68%), Gaps = 24/197 (12%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTG-----------KRGFSETV-DLKLNL--QSD  254
            +N + TEL LGLPGG+GG +E       G           KRGF++TV DLKLNL  +  
Sbjct  2    INFEATELRLGLPGGNGGSSEGGGGGGGGEKAKNNNINGMKRGFADTVVDLKLNLSTKES  61

Query  255  GSCLDLSETKMQ-AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK  431
            G    + +TK + A      D  KPPAKAQVVGWPPVRS+RKN+MA  QK N  EEGD K
Sbjct  62   GGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSFRKNIMAV-QKDN--EEGDNK  118

Query  432  SGNN------FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDF  593
            + ++      FVKVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DF
Sbjct  119  ASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDF  178

Query  594  MNERKLMDLLNTSEYVP  644
            MNE KL+DLLN S+YVP
Sbjct  179  MNESKLIDLLNGSDYVP  195



>gb|KDO48907.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=213

 Score =   163 bits (413),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 133/197 (68%), Gaps = 24/197 (12%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTG-----------KRGFSETV-DLKLNL--QSD  254
            +N + TEL LGLPGG+GG +E       G           KRGF++TV DLKLNL  +  
Sbjct  2    INFEATELRLGLPGGNGGSSEGGGGGGGGEKAKNNNINGMKRGFADTVVDLKLNLSTKES  61

Query  255  GSCLDLSETKMQ-AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK  431
            G    + +TK + A      D  KPPAK+QVVGWPPVRS+RKN+MA  QK N  EEGD K
Sbjct  62   GGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSFRKNIMAV-QKDN--EEGDNK  118

Query  432  SGNN------FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDF  593
            + ++      FVKVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DF
Sbjct  119  ASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDF  178

Query  594  MNERKLMDLLNTSEYVP  644
            MNE KL+DLLN S+YVP
Sbjct  179  MNESKLIDLLNGSDYVP  195



>emb|CAH59413.1| auxin resistance protein [Plantago major]
Length=227

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 107/148 (72%), Gaps = 7/148 (5%)
 Frame = +3

Query  201  GKRGFSETVDLKLNLQSDGSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKN  380
            GKRG+ +TVDLKLNL S     DL      A  + N  P+KPPAKAQVVGWPPVR++RKN
Sbjct  37   GKRGYEQTVDLKLNLSSK----DLPNQTDLAENKKNDQPVKPPAKAQVVGWPPVRNFRKN  92

Query  381  VMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTT  560
            VMA  QK+   EE    +   FVKVSMDGAPYLRKVDLK+Y TY +LSDAL  MFSSFT 
Sbjct  93   VMAV-QKTEKAEESGGSAA--FVKVSMDGAPYLRKVDLKMYKTYEELSDALGKMFSSFTM  149

Query  561  GNYGAQGMIDFMNERKLMDLLNTSEYVP  644
                AQGM+DFMNE KLMDLLN S+YVP
Sbjct  150  SKCDAQGMMDFMNESKLMDLLNGSDYVP  177



>gb|ABM53874.1| IAA6 [Cestrum elegans]
Length=153

 Score =   161 bits (407),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 86/105 (82%), Gaps = 6/105 (6%)
 Frame = +3

Query  342  VVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS----GNNFVKVSMDGAPYLRKVDLKVYNT  509
            VVGWPPVRS+RKNVMA  QKSN  +E ++ S       FVKV MDGAPYLRKVDLK+Y +
Sbjct  1    VVGWPPVRSFRKNVMA--QKSNTDQENEKNSITTAAAAFVKVCMDGAPYLRKVDLKMYKS  58

Query  510  YNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            Y QLSDALA MFSSFT GNYGAQGMIDFMNE KLMDLLNTSEYVP
Sbjct  59   YKQLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNTSEYVP  103



>ref|XP_003521753.1| PREDICTED: auxin-responsive protein IAA16-like [Glycine max]
Length=243

 Score =   164 bits (414),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 129/188 (69%), Gaps = 17/188 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSET-VDLKLNLQSDGSCL--DLSETK-  284
            +N +ETEL LGLP       +     +TGKR FS+T VDLKLNL S  +    DL++ K 
Sbjct  11   INFEETELRLGLPLSGNETLKTTC--STGKRVFSDTAVDLKLNLSSTSNSASSDLTKEKN  68

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN--GEEGDQKSGNN-----  443
            + A   P  DP KPPAKAQVVGWPPVRS+RKN++   Q+SNN  GE+    S NN     
Sbjct  69   ITAAAPPANDPAKPPAKAQVVGWPPVRSFRKNIV---QRSNNNEGEKAATSSSNNVNTGA  125

Query  444  -FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDL  620
             FVKVSMDGAPYLRKVDLK+Y +Y +L DALA MFSSFT    G+QGM DFMNE KL+DL
Sbjct  126  AFVKVSMDGAPYLRKVDLKLYKSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDL  185

Query  621  LNTSEYVP  644
            LN S+YVP
Sbjct  186  LNGSDYVP  193



>ref|XP_011026048.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score =   163 bits (413),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 124/182 (68%), Gaps = 11/182 (6%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD----GSCLDLSETK  284
            +  +ETEL LGLPG  GG       +   KRGFSETVDLKL L S     G   + + + 
Sbjct  9    MGFEETELRLGLPGNGGGAEG----EMVRKRGFSETVDLKLKLSSKERGAGPNHEKTRSL  64

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVS  458
             +       DP KPPAKAQVVGWPPVRS+RKN++A  QKS+  +E ++  G N  FVKVS
Sbjct  65   QREKNILATDPAKPPAKAQVVGWPPVRSFRKNMLAV-QKSSTDQECEKVPGGNATFVKVS  123

Query  459  MDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEY  638
            MDGAPYLRKVDLK+Y TY +LS AL  MFSSFT GN G+ G+ DF+NE KL+DLLN ++Y
Sbjct  124  MDGAPYLRKVDLKMYKTYQELSGALEEMFSSFTIGNCGSHGLKDFLNESKLIDLLNGTDY  183

Query  639  VP  644
            VP
Sbjct  184  VP  185



>ref|NP_001266039.1| IAA7 protein [Solanum lycopersicum]
 gb|AEX00351.1| IAA7 [Solanum lycopersicum]
Length=218

 Score =   162 bits (411),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 111/151 (74%), Gaps = 8/151 (5%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQSDGSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNV  383
            KRGFS+TVDLKLNL  + +   ++       P  +    KPP KAQVVGWPPVRS+RKN+
Sbjct  22   KRGFSQTVDLKLNLHHNDNIPSMNIN----NPPKDNSSNKPPTKAQVVGWPPVRSFRKNM  77

Query  384  MAHH--QKSNNGEEGDQKSGNN--FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSS  551
            ++      +NN EE  +K      FVKVSMDGAPYLRKVDLK+Y +Y QLS +L NMFSS
Sbjct  78   LSQKGNNNNNNNEEISEKDEKTIAFVKVSMDGAPYLRKVDLKMYKSYQQLSHSLTNMFSS  137

Query  552  FTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            FT GNYG+QGMIDFMNERKLMD+LN+S+YVP
Sbjct  138  FTMGNYGSQGMIDFMNERKLMDVLNSSDYVP  168



>gb|KHN31465.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=243

 Score =   163 bits (413),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 130/188 (69%), Gaps = 17/188 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSET-VDLKLNLQSDGSCL--DLSETK-  284
            +N +ETEL LGLP       +N    +TGKR FS+T VDLKLNL S  +    DL++ K 
Sbjct  11   INFEETELRLGLPLSGNETLKNTC--STGKRVFSDTAVDLKLNLSSTSNSASSDLAKEKN  68

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN--GEEGDQKSGNN-----  443
            + A   P  DP KPPAKAQVVGWPPVRS+RKN++   Q+SNN  GE+    S NN     
Sbjct  69   ITAAAPPANDPAKPPAKAQVVGWPPVRSFRKNIV---QRSNNNEGEKAATSSSNNVNTGA  125

Query  444  -FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDL  620
             FVKVSMDGAPYLRKVDLK+Y +Y +L DALA MFSSFT    G+QGM DFMNE KL+DL
Sbjct  126  AFVKVSMDGAPYLRKVDLKLYKSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDL  185

Query  621  LNTSEYVP  644
            LN S+YVP
Sbjct  186  LNGSDYVP  193



>ref|XP_006838867.1| PREDICTED: auxin-responsive protein IAA16 [Amborella trichopoda]
 gb|ERN01436.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
Length=238

 Score =   163 bits (412),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 119/189 (63%), Gaps = 20/189 (11%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDG-----------SC  263
            LN + TEL LG PG           K  GKRGFSETVDLKLNL               + 
Sbjct  7    LNFEATELRLGPPGNGDSAG-----KGIGKRGFSETVDLKLNLMEPAPLDVPASTVKDTG  61

Query  264  LDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHH--QKSNNGEEGDQKSG  437
            +DL+E K++           P  KAQVVGWPPVRS+R+N++A    + +N  EEG++ +G
Sbjct  62   VDLTE-KLRGSNAVADPAKPPAHKAQVVGWPPVRSFRRNMLATQSSKGNNRSEEGEKNAG  120

Query  438  NNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMD  617
              +VKVSMDGAPYLRKVDL +Y +Y  LS++L  MFS FT G  G+QG I+F+NE KLMD
Sbjct  121  ATYVKVSMDGAPYLRKVDLNMYKSYQDLSNSLEKMFSCFTMGQCGSQG-INFLNESKLMD  179

Query  618  LLNTSEYVP  644
            LLN SEYVP
Sbjct  180  LLNGSEYVP  188



>gb|KDO48905.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=245

 Score =   163 bits (413),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 133/197 (68%), Gaps = 24/197 (12%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTG-----------KRGFSETV-DLKLNL--QSD  254
            +N + TEL LGLPGG+GG +E       G           KRGF++TV DLKLNL  +  
Sbjct  2    INFEATELRLGLPGGNGGSSEGGGGGGGGEKAKNNNINGMKRGFADTVVDLKLNLSTKES  61

Query  255  GSCLDLSETKMQ-AppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK  431
            G    + +TK + A      D  KPPAK+QVVGWPPVRS+RKN+MA  QK N  EEGD K
Sbjct  62   GGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSFRKNIMAV-QKDN--EEGDNK  118

Query  432  SGNN------FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDF  593
            + ++      FVKVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN G+QGM DF
Sbjct  119  ASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDF  178

Query  594  MNERKLMDLLNTSEYVP  644
            MNE KL+DLLN S+YVP
Sbjct  179  MNESKLIDLLNGSDYVP  195



>ref|XP_010679165.1| PREDICTED: auxin-responsive protein IAA14-like [Beta vulgaris 
subsp. vulgaris]
Length=278

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 111/178 (62%), Gaps = 32/178 (18%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQSD-------------------GSCLDLSETKMQAppepnkdpikp  326
            KRGFSETVDLKLN  ++                    + LDL +   +A    +K+    
Sbjct  52   KRGFSETVDLKLNFSTNNNKNDHNNNINSGKEQTATSAPLDLMKNDNKADVSADKEISSK  111

Query  327  p--------AKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS----GNNFVKVSMDGA  470
                     AKAQVVGWPPVRSYRKN++A  QK+  G + + +     G   VKVSMDGA
Sbjct  112  VNADSVKPPAKAQVVGWPPVRSYRKNMLAV-QKTTGGPDSETEKPMNGGGALVKVSMDGA  170

Query  471  PYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            PYLRKVDLK+Y +Y  LSDAL  MFSSFT GNYGAQGMIDFMNE KLMDLLN S+YVP
Sbjct  171  PYLRKVDLKMYKSYQDLSDALGKMFSSFTLGNYGAQGMIDFMNESKLMDLLNDSDYVP  228



>emb|CDY30017.1| BnaC01g39910D [Brassica napus]
Length=237

 Score =   161 bits (408),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 119/196 (61%), Gaps = 30/196 (15%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDG----SCLDLSETK  284
            +N + TEL LGLPG + GG      K  GKRGFSETVDLKLNL S      S LDL   K
Sbjct  2    INFEATELRLGLPGENHGGGMAA--KNNGKRGFSETVDLKLNLSSTAMDSVSELDLVNMK  59

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMA-------------HHQKSNNGEEGD  425
             +    P        AKAQVVGWPPVRS+RKNVM+              +  S+NG    
Sbjct  60   EKVVKPP--------AKAQVVGWPPVRSFRKNVMSGPKPTTGDAFQATENTSSSNGATSS  111

Query  426  QKSGNN--FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMN  599
               G    +VK+SMDGAPYLRK+DLK+Y  Y  LSD L+ MFSSFT G+YG QGM D +N
Sbjct  112  ASIGATAAYVKISMDGAPYLRKIDLKLYKAYQDLSDTLSKMFSSFTIGSYGPQGMKDIVN  171

Query  600  ERKLM-DLLNTSEYVP  644
            E KLM DLLN S+YVP
Sbjct  172  EGKLMIDLLNGSDYVP  187



>ref|XP_010025014.1| PREDICTED: auxin-responsive protein IAA16-like [Eucalyptus grandis]
 gb|KCW61599.1| hypothetical protein EUGRSUZ_H04335 [Eucalyptus grandis]
Length=270

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 126/210 (60%), Gaps = 34/210 (16%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggn-enesMKTTGKRGFSETVDLKLNLQS--DGSCLD------  269
            ++ +ETEL LGL   +G  +    + ++ GKR F ETVDLKLN  S  DG  ++      
Sbjct  11   IDFEETELRLGLGRPAGVSSNGEGATRSGGKRVFLETVDLKLNFSSKEDGGSVEKIRASA  70

Query  270  LSETKMQAppepnkd------------------pikppAKAQVVGWPPVRSYRKNVMAHH  395
             +E KM +     K                     KPPAKAQVVGWPPVRS+RKN+MA  
Sbjct  71   PAEKKMNSSDGKEKSVAAAAAAAAPPPPSSSSEVAKPPAKAQVVGWPPVRSFRKNIMAVQ  130

Query  396  QKSNNGEE-------GDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSF  554
            +  ++  E       G   SG  FVKVSMDGAPYLRKVDLK+Y +Y  LSDALA MFSSF
Sbjct  131  KSGSDEAEKGGSSGNGAATSGAAFVKVSMDGAPYLRKVDLKLYKSYQDLSDALAKMFSSF  190

Query  555  TTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            T GN G+ GM DFMNE KL+DLLN S+YVP
Sbjct  191  TIGNCGSGGMKDFMNESKLIDLLNGSDYVP  220



>ref|XP_010923479.1| PREDICTED: auxin-responsive protein IAA30-like isoform X2 [Elaeis 
guineensis]
Length=232

 Score =   161 bits (407),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 111/167 (66%), Gaps = 19/167 (11%)
 Frame = +3

Query  192  KTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAppepnkdpik-------------ppA  332
            K +GKRGFSET+DLKL L +    +D  E +M+   +  + P +                
Sbjct  37   KNSGKRGFSETIDLKLKLHT---VVDSKEVEMEVWDKMKRLPSQKNLLPCTNDPEKPSAP  93

Query  333  KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN-NFVKVSMDGAPYLRKVDLKVYNT  509
            KAQVVGWPPVRS+RKN++A H    +  EG++ S +   VKVSMDGAPYLRKVDLK+Y +
Sbjct  94   KAQVVGWPPVRSFRKNILATHSDKGSKVEGEKSSNSVALVKVSMDGAPYLRKVDLKMYRS  153

Query  510  YNQLSDALANMFSSFTTGNYGAQGMI--DFMNERKLMDLLNTSEYVP  644
            Y +LS AL  MFSSFT+GN G+QGM   DFMNE KLMDLLN SEYVP
Sbjct  154  YQELSMALEKMFSSFTSGNCGSQGMSGRDFMNESKLMDLLNGSEYVP  200



>ref|XP_009398568.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=248

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 105/162 (65%), Gaps = 12/162 (7%)
 Frame = +3

Query  192  KTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQ-------AppepnkdpikppAKAQVVG  350
            K +GKR F ETVDLKL LQ+     +++  KM+                     KAQVVG
Sbjct  38   KNSGKRAFEETVDLKLKLQTTVDVEEVAAEKMKRSPSHKNVAASATDPERPRAPKAQVVG  97

Query  351  WPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRKVDLKVYNTYNQLS  524
            WPPVRSYRKN++A   +  + EEG +K GN   FVKV MDGAPYLRKVDLK+Y +Y +LS
Sbjct  98   WPPVRSYRKNILAVQSEKASKEEG-EKPGNTAAFVKVCMDGAPYLRKVDLKMYRSYQELS  156

Query  525  DALANMFSSFTTGNYGAQGM--IDFMNERKLMDLLNTSEYVP  644
             AL  MFSSFT+ N G+QGM   DF NE KLMDL+N SEYVP
Sbjct  157  MALEKMFSSFTSANCGSQGMNGRDFTNEGKLMDLINGSEYVP  198



>ref|XP_007147174.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
 gb|ESW19168.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
Length=272

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 127/208 (61%), Gaps = 32/208 (15%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKT-----TGKRGFSET----VDLKLNLQSDGSCLD  269
            ++ +ETEL LGLP  +          T     TGKRGFS+T    VDLKLNL S  + + 
Sbjct  15   IDFEETELRLGLPLSANETESTLIRNTSSASFTGKRGFSDTTTASVDLKLNLSSTSNNVS  74

Query  270  LSETKMQA--------------ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHH-QKS  404
             + +   A                 P KDP KPPAKAQVVGWPPVRS+RKN++ ++ QKS
Sbjct  75   ATPSSDMAKDNTASAAANTTTPSSPPVKDPAKPPAKAQVVGWPPVRSFRKNIVNNNVQKS  134

Query  405  NNGEE--------GDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTT  560
            NN EE            +G  FVKVSMDGAPYLRKVDLKVY +Y +LSD+LA MFSSFT 
Sbjct  135  NNKEEVQGGTSGRNHGNTGAAFVKVSMDGAPYLRKVDLKVYKSYQELSDSLAKMFSSFTI  194

Query  561  GNYGAQGMIDFMNERKLMDLLNTSEYVP  644
                +QGM DFMNE KL+D LN S+YVP
Sbjct  195  DKCESQGMKDFMNETKLIDFLNGSDYVP  222



>ref|XP_010923478.1| PREDICTED: auxin-responsive protein IAA30-like isoform X1 [Elaeis 
guineensis]
Length=250

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 109/167 (65%), Gaps = 19/167 (11%)
 Frame = +3

Query  192  KTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAppepnk-------------dpikppA  332
            K +GKRGFSET+DLKL L +    +D  E +M+   +  +                    
Sbjct  37   KNSGKRGFSETIDLKLKLHT---VVDSKEVEMEVWDKMKRLPSQKNLLPCTNDPEKPSAP  93

Query  333  KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN-NFVKVSMDGAPYLRKVDLKVYNT  509
            KAQVVGWPPVRS+RKN++A H    +  EG++ S +   VKVSMDGAPYLRKVDLK+Y +
Sbjct  94   KAQVVGWPPVRSFRKNILATHSDKGSKVEGEKSSNSVALVKVSMDGAPYLRKVDLKMYRS  153

Query  510  YNQLSDALANMFSSFTTGNYGAQGMI--DFMNERKLMDLLNTSEYVP  644
            Y +LS AL  MFSSFT+GN G+QGM   DFMNE KLMDLLN SEYVP
Sbjct  154  YQELSMALEKMFSSFTSGNCGSQGMSGRDFMNESKLMDLLNGSEYVP  200



>ref|XP_009367750.1| PREDICTED: auxin-induced protein AUX28-like [Pyrus x bretschneideri]
Length=259

 Score =   162 bits (409),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 127/210 (60%), Gaps = 35/210 (17%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnene---sMKTTGKRGFSET-----------VDLKLNLQS-  251
            +  +ETEL LGLPGG GGG        +    KRGFSET           VDLKLNL S 
Sbjct  1    MGFEETELRLGLPGGGGGGGGVRDGDQVIVMRKRGFSETESDISTDTSTCVDLKLNLSSN  60

Query  252  ----------DGSCLDLSETKMQAppe----pnkdpikppAKAQVVGWPPVRSYRKNVMA  389
                      DGS  + S+T  +         +     P AKAQVVGWPPVRS+RKN+  
Sbjct  61   SKEANSTGGKDGSA-EKSKTNKEKNNNLDFPASDPAKPPAAKAQVVGWPPVRSFRKNMFT  119

Query  390  HHQKSNNGEEGDQ--KSGNN---FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSF  554
              Q S N  E +Q  K GNN    VKVSMDGAPYLRKVDLK+Y +Y +LSDALA MFSSF
Sbjct  120  AVQNSTNDGESEQMNKGGNNNAVLVKVSMDGAPYLRKVDLKMYKSYPELSDALAKMFSSF  179

Query  555  TTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            T GN G+QGM DFMNE KLMD+LN S+Y+P
Sbjct  180  TIGNCGSQGMKDFMNESKLMDVLNGSDYIP  209



>ref|XP_002520980.1| Auxin-induced protein AUX28, putative [Ricinus communis]
 gb|EEF41397.1| Auxin-induced protein AUX28, putative [Ricinus communis]
Length=244

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 110/153 (72%), Gaps = 9/153 (6%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQSDGSCLDLSE----TKMQAppepnkdpikppAKAQVVGWPPVRSY  371
            KRGFSETVDLKLNL S    +D ++       +       DP KPPAKAQVVGWPPVRS+
Sbjct  45   KRGFSETVDLKLNLSSKEPGIDPNDNTKTISRENNLLSADDPAKPPAKAQVVGWPPVRSF  104

Query  372  RKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMF  545
            RK+++   + SN   E  +K G N  FVKVSMDGAPYLRKVDLK+Y +Y +LSDAL  MF
Sbjct  105  RKHMLTVQKSSN---EETEKLGLNPTFVKVSMDGAPYLRKVDLKMYKSYQELSDALGKMF  161

Query  546  SSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            SSFT GN G+QGM DF+NE KL+DLLN ++YVP
Sbjct  162  SSFTIGNCGSQGMKDFLNESKLIDLLNGTDYVP  194



>ref|XP_008810170.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score =   161 bits (407),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 120/191 (63%), Gaps = 28/191 (15%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAp  296
            L  +ETEL LGLPG +         + T KRGFS+T+DLKL L++    +D  + K +A 
Sbjct  14   LGFEETELRLGLPGDA---------EATKKRGFSKTIDLKLKLRT----VDSKDAKPEAE  60

Query  297  pepnkdpik------------ppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN  440
                    K            P  KAQVVGWPPVRS+RKN+M+        +EG++ + +
Sbjct  61   KMKRSASQKNLLACSSDPEKPPAPKAQVVGWPPVRSFRKNIMSIQSDKGKKDEGEKSATS  120

Query  441  -NFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGM--IDFMNERKL  611
              FVKVSMDGAPYLRK+DLK+Y++Y +LS AL  MFSSFT GN  +QG+   DFMNE KL
Sbjct  121  ATFVKVSMDGAPYLRKIDLKMYSSYQELSVALEKMFSSFTIGNCSSQGIKGRDFMNESKL  180

Query  612  MDLLNTSEYVP  644
            MDLLN SEYVP
Sbjct  181  MDLLNGSEYVP  191



>ref|NP_001239753.1| uncharacterized protein LOC100781847 [Glycine max]
 gb|ACU21611.1| unknown [Glycine max]
Length=231

 Score =   160 bits (406),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 121/189 (64%), Gaps = 22/189 (12%)
 Frame = +3

Query  117  LNLKETELCLGLP--ggsgggnenesMKTTGKRGFSET--VDLKLNLQSDGSCL------  266
            +N +ETEL LGLP    S          + GKRGFSET  VDLKLNL S           
Sbjct  2    INFEETELRLGLPGGSASDHNESTTVKGSGGKRGFSETASVDLKLNLSSSDDSASDSPSS  61

Query  267  ---DLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSG  437
               + + T    PP    DP KPPAKAQVVGWPPVRS+RKN++   Q++ N EE      
Sbjct  62   ASTEKTTTAAPPPPSRANDPAKPPAKAQVVGWPPVRSFRKNIV---QRNKNEEEA-----  113

Query  438  NNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMD  617
              FVKVSMDGAPYLRKVD+K+Y +Y +LSDALA MFSSFT    G+QGM DFMNE KL+D
Sbjct  114  -AFVKVSMDGAPYLRKVDIKLYKSYQELSDALAKMFSSFTIEKCGSQGMKDFMNETKLID  172

Query  618  LLNTSEYVP  644
            LLN S+YVP
Sbjct  173  LLNGSDYVP  181



>gb|ACU19136.1| unknown [Glycine max]
Length=243

 Score =   161 bits (407),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 127/188 (68%), Gaps = 17/188 (9%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSET-VDLKLNLQSDGSCL--DLSETK-  284
            +N +ETEL LGLP       +     +TGKR FS+T VDLKLNL S  +    DL++ K 
Sbjct  11   INFEETELRLGLPLSGNETLKTTC--STGKRVFSDTAVDLKLNLSSTSNSASSDLTKEKN  68

Query  285  MQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN--GEEGDQKSGNN-----  443
            + A   P  DP KPPAKAQVVGWPPVRS+RKN++   Q+SNN  GE+    S NN     
Sbjct  69   ITAAAPPANDPAKPPAKAQVVGWPPVRSFRKNIV---QRSNNNEGEKAATSSSNNVNTGA  125

Query  444  -FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDL  620
             FVKVSMDGAPYLRKVDLK+Y +Y +L DALA MFSSFT    G+QGM DFMNE KL+D 
Sbjct  126  AFVKVSMDGAPYLRKVDLKLYKSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDF  185

Query  621  LNTSEYVP  644
             N S+YVP
Sbjct  186  FNGSDYVP  193



>ref|XP_007162490.1| hypothetical protein PHAVU_001G156600g [Phaseolus vulgaris]
 gb|ESW34484.1| hypothetical protein PHAVU_001G156600g [Phaseolus vulgaris]
Length=246

 Score =   161 bits (407),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 122/191 (64%), Gaps = 21/191 (11%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSET--------VDLKLNLQSDGSCLDL  272
            +  +ETEL LGLPG +    E    +   KRGFSET        VDL LNL S       
Sbjct  10   MGFEETELRLGLPGNAASATE----EVLRKRGFSETETQDDTATVDLMLNLSSKEPTTGA  65

Query  273  SETKM-----QAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSG  437
              T       +       DP KPPAKAQVVGWPPVRS+RKN++A  +  + GEE ++ S 
Sbjct  66   DPTHKHNTLPKEKTLLPADPAKPPAKAQVVGWPPVRSFRKNMLAVQK--SVGEESEKNSS  123

Query  438  NN--FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKL  611
             N  FVKVSMDGAPYLRKVDLK+Y +Y +LSD+L  MFSSFT GN  +QGM DFMNE KL
Sbjct  124  PNASFVKVSMDGAPYLRKVDLKMYQSYRELSDSLGKMFSSFTIGNCESQGMKDFMNESKL  183

Query  612  MDLLNTSEYVP  644
            MDLLN+S+YVP
Sbjct  184  MDLLNSSDYVP  194



>gb|KHN18836.1| Auxin-induced protein AUX28 [Glycine soja]
Length=246

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 126/195 (65%), Gaps = 22/195 (11%)
 Frame = +3

Query  123  LKETELCLGL----PggsgggnenesMKTTG--KRGFSET-------VDLKLNLQ-----  248
             +ETEL LGL    PG         +    G  KRGFSET       VDL LNL      
Sbjct  3    FEETELRLGLGLCLPGNGTTATTEAAAAELGVRKRGFSETETDETATVDLMLNLSPKEAA  62

Query  249  -SDGS-CLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEG  422
             +DG+   +  +T  +       DP KPPAKAQVVGWPPVRS+RKN+ A  QKS+ GEE 
Sbjct  63   AADGADPREKPKTSPKEKTLLLPDPAKPPAKAQVVGWPPVRSFRKNMFA-AQKSSGGEES  121

Query  423  DQKSGN-NFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMN  599
            ++ S N +FVKVSMDGAPYLRKVDLK+Y +Y +LSDAL  MFSSFT GN  +QG  DFMN
Sbjct  122  EKSSPNASFVKVSMDGAPYLRKVDLKMYKSYPELSDALGKMFSSFTIGNCESQGFKDFMN  181

Query  600  ERKLMDLLNTSEYVP  644
            E KLMDLLN+S+YVP
Sbjct  182  ESKLMDLLNSSDYVP  196



>gb|ACU18407.1| unknown [Glycine max]
Length=246

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 114/162 (70%), Gaps = 16/162 (10%)
 Frame = +3

Query  204  KRGFSET-------VDLKLNLQ------SDGS-CLDLSETKMQAppepnkdpikppAKAQ  341
            KRGFSET       VDL LNL       +DG+   +  +T  +       DP KPPAKAQ
Sbjct  36   KRGFSETETDETATVDLMLNLSPKEAAAADGADPREKPKTSPKEKTLLLPDPAKPPAKAQ  95

Query  342  VVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN-NFVKVSMDGAPYLRKVDLKVYNTYNQ  518
            VVGWPPVRS+RKN+ A  QKS+ GEE ++ S N +FVKVSMDGAPYLRKVDLK+Y +Y +
Sbjct  96   VVGWPPVRSFRKNMFA-AQKSSGGEESEKSSPNASFVKVSMDGAPYLRKVDLKMYKSYPE  154

Query  519  LSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            LSDAL  MFSSFT GN  +QG  DFMNE KLMDLLN+S+YVP
Sbjct  155  LSDALGKMFSSFTIGNCESQGFKDFMNESKLMDLLNSSDYVP  196



>ref|XP_009354870.1| PREDICTED: auxin-induced protein AUX28-like [Pyrus x bretschneideri]
Length=257

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 113/178 (63%), Gaps = 32/178 (18%)
 Frame = +3

Query  204  KRGFSET-----------VDLKLNLQS-----------DGSCLDLSETKMQApp----ep  305
            KRGFSET           VDLKLNL +           DGS  D S+T  +         
Sbjct  31   KRGFSETESKISTDTSTCVDLKLNLSNSSKAANSTGGKDGSA-DKSKTDKEKNNHLDLPA  89

Query  306  nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQ--KSGNN---FVKVSMDGA  470
            +     P AKAQVVGWPPVRS+RKN+    QKS+N  E +Q  K GNN    VKVSMDGA
Sbjct  90   SDPAKPPAAKAQVVGWPPVRSFRKNMFTAVQKSSNDGESEQMNKGGNNNAVLVKVSMDGA  149

Query  471  PYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            PYLRKVDLK+Y +Y +LSDALA MFSSFT GN G+QGM DFMNE KLMD+LN S+Y+P
Sbjct  150  PYLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVLNGSDYIP  207



>ref|XP_008341049.1| PREDICTED: auxin-responsive protein IAA7-like [Malus domestica]
Length=173

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 108/167 (65%), Gaps = 9/167 (5%)
 Frame = +3

Query  90   MTNMLG-HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSCL  266
            MT+MLG    LNL+ETELCLGLPGG          K TGKRGFSETVDLKL LQS     
Sbjct  1    MTSMLGVECDLNLRETELCLGLPGGGTSTVAEPETKATGKRGFSETVDLKLKLQSKDDLN  60

Query  267  D----LSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS  434
            D    ++  +        KDP KPPAKAQVVGWPPVRSYRKN+MA    S    E     
Sbjct  61   DNVKNIASREKNDLLSCTKDPAKPPAKAQVVGWPPVRSYRKNIMAQKNTSEENTEKATVG  120

Query  435  GNN----FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTG  563
            G      FVKV MDGAPYLRKVDLK+Y +Y +LS+ALA MFSSFTTG
Sbjct  121  GGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNALAKMFSSFTTG  167



>ref|XP_009774251.1| PREDICTED: auxin-responsive protein IAA16-like [Nicotiana sylvestris]
Length=195

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 110/177 (62%), Gaps = 33/177 (19%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTT-GKRGFSETVDLKLNLQSDGSCLDLSETKMQA  293
            ++ +ETEL LGLP G      +E+   + GKR FSE VDLKLNL S      L+E +   
Sbjct  1    MDFEETELRLGLPCGGERKKAHETYNNSNGKRDFSEEVDLKLNLSSK-----LTENQ---  52

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAP  473
                        AKAQVVGWPPVRS+RKN++               +    VKVSMDGAP
Sbjct  53   -----------AAKAQVVGWPPVRSFRKNIL-------------HVAAAALVKVSMDGAP  88

Query  474  YLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            YLRKVDL +Y  Y QLSDAL+NMFSSFT GN   QGM DFMNERKLMDLLN+ ++VP
Sbjct  89   YLRKVDLNMYKNYQQLSDALSNMFSSFTIGNCEVQGMKDFMNERKLMDLLNSCDFVP  145



>ref|XP_009417112.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=247

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 122/194 (63%), Gaps = 17/194 (9%)
 Frame = +3

Query  114  GLNLKETELCLGLPggsgggn----enesMKTTGKRGFSETVDLKLNLQSDGSC------  263
            GL ++ETEL LGLPGG GGG     E ES K +GKRGF E VDLKL LQ+          
Sbjct  4    GLRMEETELRLGLPGGGGGGGGGGGEVESGKNSGKRGFVEIVDLKLQLQTPVGVQEAAAE  63

Query  264  ----LDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQK  431
                +  S          +      P KAQVVGWPPVRS+RKN+++ H +    EEG++ 
Sbjct  64   AAEKVKRSPNDDSIVSCGSDPEKPSPPKAQVVGWPPVRSFRKNILSVHSEKGRKEEGEKS  123

Query  432  SG-NNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGM--IDFMNE  602
            S     VKVSMDGAPYLRKVDLK + +Y +L  AL  MF SFTTG+YG+QGM   DFMNE
Sbjct  124  SSLAALVKVSMDGAPYLRKVDLKTHRSYQELFVALQKMFDSFTTGDYGSQGMSGRDFMNE  183

Query  603  RKLMDLLNTSEYVP  644
            RK+ DLL+ SEYVP
Sbjct  184  RKVKDLLHGSEYVP  197



>ref|XP_004289900.1| PREDICTED: auxin-induced protein AUX28-like [Fragaria vesca subsp. 
vesca]
Length=250

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 129/202 (64%), Gaps = 33/202 (16%)
 Frame = +3

Query  129  ETELCLGLPggsgggnenesMKTTG--------KRGFSET-------------VDLKLNL  245
            ETEL LGLPGG GGG      +  G        KR FSET             VDLKLNL
Sbjct  2    ETELRLGLPGGGGGGGGGGGGEGGGDQVVVMMRKRVFSETESQITTDDESSACVDLKLNL  61

Query  246  QS-DGS-CLDLSETKM-----QAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKS  404
             S DGS   + S++ M     +   +   DP KPPAKAQVVGWPPVRS+RKN+++  + S
Sbjct  62   SSKDGSSTAEKSKSLMMNKNKEKNVDLPADPAKPPAKAQVVGWPPVRSFRKNMLSAQKSS  121

Query  405  NNGEEGDQKSGNN--FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQ  578
               E    K+G N   VKVSMDGAPYLRKVDL +Y TY QLSDALA MFSSFT GN G+Q
Sbjct  122  TTDE---SKAGGNAALVKVSMDGAPYLRKVDLNMYKTYPQLSDALAKMFSSFTIGNCGSQ  178

Query  579  GMIDFMNERKLMDLLNTSEYVP  644
            G IDFMNERKLMDLLN S+Y+P
Sbjct  179  GTIDFMNERKLMDLLNDSDYIP  200



>ref|XP_009420668.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=241

 Score =   159 bits (402),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 123/191 (64%), Gaps = 17/191 (9%)
 Frame = +3

Query  114  GLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGS----------C  263
            GL L+ETEL   L    GGG E E+ K  GKRGF+ET+DLKL LQ+              
Sbjct  4    GLGLEETEL--RLGLPGGGGGEAEAGKNCGKRGFAETIDLKLQLQTPADAEEAAVEAAET  61

Query  264  LDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN  443
            +  S +        +     P  KAQVVGWPPVRS+RKNV++ H      EEG +KSG +
Sbjct  62   MKRSLSHKNVVSCGSDPEKPPAPKAQVVGWPPVRSFRKNVLSVHSVKGGKEEG-EKSGTS  120

Query  444  --FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMI--DFMNERKL  611
              FVKVSMDGAPYLRKVDLK+Y +Y++LS AL  MFS+FT GN G+QGM   DFMNE K+
Sbjct  121  AAFVKVSMDGAPYLRKVDLKMYRSYHELSMALQKMFSTFTGGNCGSQGMSGRDFMNESKV  180

Query  612  MDLLNTSEYVP  644
            MDLLN SEYVP
Sbjct  181  MDLLNGSEYVP  191



>gb|KHN22078.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=231

 Score =   158 bits (400),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 120/189 (63%), Gaps = 22/189 (12%)
 Frame = +3

Query  117  LNLKETELCLGLP--ggsgggnenesMKTTGKRGFSET--VDLKLNLQSDGSCL------  266
            +N +ETEL LGLP    S          + GKRGF ET  VDLKLNL S           
Sbjct  2    INFEETELRLGLPGGSASDHNESTTVKGSGGKRGFPETASVDLKLNLSSSDDSASDSPSS  61

Query  267  ---DLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSG  437
               + + T    PP    DP KPPAKAQVVGWPPVRS+RKN++   Q++ N EE      
Sbjct  62   ASTEKTTTAAPLPPSRANDPAKPPAKAQVVGWPPVRSFRKNIV---QRNKNEEEA-----  113

Query  438  NNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMD  617
              FVKVSMDGAPYLRKVD+K+Y +Y +LSDALA MFSSFT    G+QGM DFMNE KL+D
Sbjct  114  -AFVKVSMDGAPYLRKVDIKLYKSYQELSDALAKMFSSFTIEKCGSQGMKDFMNETKLID  172

Query  618  LLNTSEYVP  644
            LLN S+YVP
Sbjct  173  LLNGSDYVP  181



>ref|XP_008382962.1| PREDICTED: auxin-induced protein AUX28-like [Malus domestica]
Length=257

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 112/178 (63%), Gaps = 32/178 (18%)
 Frame = +3

Query  204  KRGFSET-----------VDLKLNLQS-----------DGSCLDLSETKMQApp----ep  305
            KRGFSET           VDLKLNL +           DGS  + S+T  +         
Sbjct  31   KRGFSETESDISTDASTCVDLKLNLSNNSKETNSTGGKDGSA-EKSKTNKEKNNNLDFRA  89

Query  306  nkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQ--KSGNN---FVKVSMDGA  470
            +     P AKAQVVGWPPVRS+RKN+    QKS N  E +Q  K  NN    VKVSMDGA
Sbjct  90   SDPAKPPAAKAQVVGWPPVRSFRKNMFTAVQKSTNDGESEQMNKGSNNNAVLVKVSMDGA  149

Query  471  PYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            PYLRKVDLK+Y +Y +LSDALA MFSSFT GN G+QGM DFMNERKLMD+LN S+Y+P
Sbjct  150  PYLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNERKLMDVLNGSDYIP  207



>ref|NP_001241599.1| uncharacterized protein LOC100803065 [Glycine max]
 gb|ACU20028.1| unknown [Glycine max]
 gb|KHN03840.1| Auxin-induced protein AUX28 [Glycine soja]
Length=248

 Score =   158 bits (400),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 115/165 (70%), Gaps = 19/165 (12%)
 Frame = +3

Query  204  KRGFSET-------VDLKLNLQ---------SDGS-CLDLSETKMQAppepnkdpikppA  332
            KRGFSET       VDL LNL          +DG+   +  +T  +    P  DP KPPA
Sbjct  35   KRGFSETETDETTSVDLMLNLSPKEASAAATTDGADPRENPKTSPKEKNLPLLDPAKPPA  94

Query  333  KAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGN-NFVKVSMDGAPYLRKVDLKVYNT  509
            KAQVVGWPPVRS+RKN+ A  QKS+ GEE ++ S N +FVKVSMDGAPYLRKVDLK+Y +
Sbjct  95   KAQVVGWPPVRSFRKNMFA-AQKSSGGEESEKNSPNASFVKVSMDGAPYLRKVDLKMYKS  153

Query  510  YNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            Y +LSDAL  MFSSFT GN  +QG  DFMNE KLMDLLN+S+YVP
Sbjct  154  YPELSDALGKMFSSFTIGNCESQGFKDFMNESKLMDLLNSSDYVP  198



>ref|XP_010674855.1| PREDICTED: auxin-induced protein AUX28 [Beta vulgaris subsp. 
vulgaris]
Length=297

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 90/111 (81%), Gaps = 7/111 (6%)
 Frame = +3

Query  330  AKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN------FVKVSMDGAPYLRKVD  491
            AKAQVVGWPPVR++RKN++A  +KS+  E+ DQK+ NN      FVKVSMDGAPYLRKVD
Sbjct  138  AKAQVVGWPPVRAFRKNIVAVQKKSSE-EQADQKASNNTIASAAFVKVSMDGAPYLRKVD  196

Query  492  LKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            LK+Y +Y +LSDAL  MFSSFT GN G+QGM DFMNE KL+DLLN S+YVP
Sbjct  197  LKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVP  247



>ref|XP_003554705.1| PREDICTED: auxin-responsive protein IAA16-like isoform 1 [Glycine 
max]
 gb|KHN43187.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=230

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 120/185 (65%), Gaps = 24/185 (13%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSET-VDLKLNLQSDGSCLDLSETKMQA  293
            +N +ETEL LGLP          +  +TGKR FS+T VDLKLNL S  +           
Sbjct  11   INFEETELRLGLPLSGNETTLKNTC-STGKRVFSDTSVDLKLNLSSTSN-----------  58

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN--GEEGDQKSGNN------FV  449
                   P KPPAKAQVVGWPPVRS+RKN++ + Q+SNN  GE+    S NN      FV
Sbjct  59   ---NAPPPAKPPAKAQVVGWPPVRSFRKNIVNNVQRSNNNDGEKAATSSSNNVNMGAAFV  115

Query  450  KVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNT  629
            KVSMDGAPYLRKVDLK+Y ++ +L DALA MFSSFT     +QGM DFMNE KL+DLLN 
Sbjct  116  KVSMDGAPYLRKVDLKMYKSHQELLDALAKMFSSFTIDKCSSQGMKDFMNEGKLIDLLNG  175

Query  630  SEYVP  644
            S+YVP
Sbjct  176  SDYVP  180



>gb|ACL81167.1| auxin-responsive protein IAA1, partial [Mirabilis jalapa]
Length=263

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 111/178 (62%), Gaps = 31/178 (17%)
 Frame = +3

Query  204  KRGFSET-VDLKLNL--------------------------QSDGSCL--DLSETKMQAp  296
            KRGFSET VDLKLNL                          +S G  +  D+++      
Sbjct  36   KRGFSETLVDLKLNLNNKSSPPSDLDQTATSDLIMMKNDMNKSGGGVIAKDVNDNTKVNG  95

Query  297  pepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGA  470
               N D  KPPAKAQVVGWPPVRSYRKN++A  + +   E   +K   N   VKVSMDGA
Sbjct  96   ANNNADLAKPPAKAQVVGWPPVRSYRKNMLAVQKSTGAPESESEKPAANGGLVKVSMDGA  155

Query  471  PYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            PYLRKVDLK+Y +Y  LSDAL  MFSSFT GNYG+QGMIDFMNE KLMDL+N S+YVP
Sbjct  156  PYLRKVDLKLYKSYQDLSDALGKMFSSFTLGNYGSQGMIDFMNESKLMDLINGSDYVP  213



>gb|ACU19616.1| unknown [Glycine max]
Length=230

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 120/185 (65%), Gaps = 24/185 (13%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSET-VDLKLNLQSDGSCLDLSETKMQA  293
            +N +ETEL LGLP          +  +TGKR FS+T VDLKLNL S  +           
Sbjct  11   INFEETELRLGLPLSGNETTLKNTC-STGKRVFSDTSVDLKLNLSSTSN-----------  58

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNN--GEEGDQKSGNN------FV  449
                   P KPPAKAQVVGWPPVRS+RKN++ + Q+SNN  GE+    S NN      FV
Sbjct  59   ---NAPPPAKPPAKAQVVGWPPVRSFRKNIVNNVQRSNNNDGEKAATSSSNNVNMGAAFV  115

Query  450  KVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNT  629
            KVSMDGAPYLRKVDLK+Y ++ +L DALA MFSSFT     +QGM DFMNE KL+DLLN 
Sbjct  116  KVSMDGAPYLRKVDLKMYKSHQELLDALAKMFSSFTIDKCSSQGMKDFMNEGKLIDLLNG  175

Query  630  SEYVP  644
            S+YVP
Sbjct  176  SDYVP  180



>ref|XP_009418923.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=243

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 110/168 (65%), Gaps = 21/168 (13%)
 Frame = +3

Query  192  KTTGKRGFSETVDLKLNLQSDGSCLDLSETKMQAppep------------nkdpikppAK  335
            K + KRGF+ET+DLKL LQ+    +D  E  ++                 +     P  K
Sbjct  30   KNSCKRGFAETIDLKLKLQTP---VDAEEQIIEKARGSLPSQRNLGVFCGSDPEKPPAPK  86

Query  336  AQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN---FVKVSMDGAPYLRKVDLKVYN  506
            AQVVGWPPVRS+RKN+++ H +  + +EG +K GN    FVKVSMDGAPYLRKVDLK+Y 
Sbjct  87   AQVVGWPPVRSFRKNILSAHSEKGS-KEGGEKPGNPVAAFVKVSMDGAPYLRKVDLKMYR  145

Query  507  TYNQLSDALANMFSSFTTGNYGAQGMI--DFMNERKLMDLLNTSEYVP  644
            +Y +LS  L  MF SFT+GN G+QGM   DFMNER++MDLLN SEYVP
Sbjct  146  SYQELSMGLQKMFGSFTSGNCGSQGMSGRDFMNEREVMDLLNGSEYVP  193



>dbj|BAG55005.1| auxin-responsive Aux/IAA gene family member [Ipomoea nil]
Length=225

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 104/155 (67%), Gaps = 7/155 (5%)
 Frame = +3

Query  189  MKTTGKRGFSETVDLKLNLQSDGSCLDLSET---KMQAppepnkdpikppAKAQVVGWPP  359
            +K+ GKR FS+TVDLKL L S  S +D  E              D  KPPAKAQVVGWPP
Sbjct  25   VKSNGKRAFSDTVDLKLKLSSKESNVDQVENLKDNNNNVVTSPSDSTKPPAKAQVVGWPP  84

Query  360  VRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALAN  539
            VRSYRKN+++  + +     G    G   VKVS+DGAPYLRKVDLK+Y +Y++LS+AL  
Sbjct  85   VRSYRKNILSGQKAAGESSGG----GAALVKVSVDGAPYLRKVDLKMYKSYHELSEALGK  140

Query  540  MFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            MFSSFT GN G  G  DFMNE KL+DLLN S+YVP
Sbjct  141  MFSSFTIGNCGTHGFKDFMNESKLIDLLNGSDYVP  175



>ref|XP_010550916.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA16 
[Tarenaya hassleriana]
Length=212

 Score =   155 bits (392),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 117/180 (65%), Gaps = 23/180 (13%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQS---DGSCLDLSETKM  287
            +N + TEL LGLPG           K  GKRGFSETVDLKLNL S   D   +D SE KM
Sbjct  2    INFEATELRLGLPGADHEEKAA---KNNGKRGFSETVDLKLNLSSMATDSGSMDGSE-KM  57

Query  288  QAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNNFVKVSMDG  467
            +      K  +KPPAK+QVVGWPPVR   +   A    S++           FVKVSMDG
Sbjct  58   K-----EKTTVKPPAKSQVVGWPPVRXADE---AEKPTSSSAAAA-------FVKVSMDG  102

Query  468  APYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNE-RKLMDLLNTSEYVP  644
            APYLRKVDLK+YN+Y++LSDAL  MFSSFT+GN+  QGM DFMNE  KL+DLLN SEY P
Sbjct  103  APYLRKVDLKLYNSYHELSDALGKMFSSFTSGNHEQQGMNDFMNENNKLIDLLNGSEYAP  162



>dbj|BAH56942.1| AT4G14550 [Arabidopsis thaliana]
Length=183

 Score =   154 bits (389),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 105/152 (69%), Gaps = 4/152 (3%)
 Frame = +3

Query  117  LNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSDGSC-LDLSETKMQA  293
            +NLKETELCLGLPGG+             KRGFSETVDLKLNLQS+    +DL+      
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  294  ppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDG  467
                 KDP KPPAKAQVVGWPPVR+YRKNVMA+ QKS   EE     G    FVKVSMDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  468  APYLRKVDLKVYNTYNQLSDALANMFSSFTTG  563
            APYLRKVDLK+Y +Y  LSDALA MFSSFT G
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTMG  151



>gb|ABD98055.1| auxin-regulated protein [Striga asiatica]
Length=248

 Score =   155 bits (393),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 120/190 (63%), Gaps = 19/190 (10%)
 Frame = +3

Query  117  LNLKETELCLG--LPggsgggnenesMKTTGKRGFSETVDLKLNLQS------DGSCLDL  272
            L  +ETEL LG  LPG     +      + GKRGF+ETVDLKL L S      D   L+ 
Sbjct  14   LGFEETELRLGIGLPGAGDQKSSG----SYGKRGFAETVDLKLKLSSKEIGDLDRGGLER  69

Query  273  SE-TKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQ-----KS  434
             +  K +       +  +PPAKAQVVGWPPVRS+RKNVMA  +KS   E+ ++       
Sbjct  70   KDLCKEKNLMPSPTESARPPAKAQVVGWPPVRSFRKNVMAVQKKSE-AEDAEKVAAASGG  128

Query  435  GNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLM  614
            G  FVKVSMDGAPYLRKVDLK+Y  Y +L DAL  MFSSFT     ++GM+DFMNE KLM
Sbjct  129  GAAFVKVSMDGAPYLRKVDLKMYKAYQELYDALGKMFSSFTMVKCDSEGMMDFMNESKLM  188

Query  615  DLLNTSEYVP  644
            DLLN S+YVP
Sbjct  189  DLLNGSDYVP  198



>gb|KJB82526.1| hypothetical protein B456_013G200700 [Gossypium raimondii]
Length=194

 Score =   154 bits (389),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 121/175 (69%), Gaps = 21/175 (12%)
 Frame = +3

Query  90   MTNMLG-----HGGLNLKETELCLGLPggsgggnenesMKTTGKRGFSETVDLKLNLQSD  254
            MT+++G     +  +N +ETEL LGLPG +G   E    K  GKRGFSETV+LKLNL S 
Sbjct  1    MTSIMGTEDDKYSTINFEETELRLGLPGANGNDGETT--KNNGKRGFSETVNLKLNLSSK  58

Query  255  GSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKS  434
             +  + SE KM+   + + DP KPPAKAQVVGWPPVRS+RKN+MA  + S+  E G +K+
Sbjct  59   ETVAEDSE-KMK--EKSSTDPAKPPAKAQVVGWPPVRSFRKNIMAVQKASSEEEGGSKKA  115

Query  435  GNN-----------FVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFTTGN  566
            GN+           FVKVSMDGAPYLRKVDLK+Y +Y QLSDAL+ MFSSFT GN
Sbjct  116  GNSAAATTTTTAAAFVKVSMDGAPYLRKVDLKLYKSYQQLSDALSKMFSSFTIGN  170



>emb|CDP06818.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   155 bits (392),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 105/149 (70%), Gaps = 4/149 (3%)
 Frame = +3

Query  204  KRGFSETVDLKLNLQSDGSCLDLSETKMQAppepnkdpikppAKAQVVGWPPVRSYRKNV  383
            KRGFSETVDLKLNL S  S  D  E +       +  P KPPAK QVVGWPPVRS+RKN+
Sbjct  49   KRGFSETVDLKLNLASKNSQAD--EEEKSVAASSSSSPSKPPAKTQVVGWPPVRSFRKNI  106

Query  384  MAHHQKSNNGEE--GDQKSGNNFVKVSMDGAPYLRKVDLKVYNTYNQLSDALANMFSSFT  557
            ++  + SN   E  G   +   FVKVS+DGAPYLRKVDLK + +Y +LS AL+ MFSS T
Sbjct  107  LSVQKNSNTEAEKSGTGSAAAAFVKVSVDGAPYLRKVDLKNFKSYQELSQALSKMFSSST  166

Query  558  TGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
             G+YG+Q   DFMNERKL+DLLN SEYVP
Sbjct  167  IGSYGSQEFKDFMNERKLIDLLNGSEYVP  195



>ref|XP_008372303.1| PREDICTED: auxin-induced protein AUX28-like [Malus domestica]
Length=257

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 109/177 (62%), Gaps = 30/177 (17%)
 Frame = +3

Query  204  KRGFSET-----------VDLKLNLQS-----------DGSCLDLSETKMQApp---epn  308
            KRGFSET           VDLKLNL +           DG  +     K +        +
Sbjct  31   KRGFSETESKISTDTSTCVDLKLNLSNSSKEANSTGGKDGIAVKSKTNKEKNNHLDLPAS  90

Query  309  kdpikppAKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQ--KSGNN---FVKVSMDGAP  473
                 P AKAQVVGWPPVRS+RKN+    QKS+N  E +Q  K GNN    VKVSMDGAP
Sbjct  91   DPAKPPAAKAQVVGWPPVRSFRKNMFTGVQKSSNDGESEQMNKGGNNNAVLVKVSMDGAP  150

Query  474  YLRKVDLKVYNTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
            YLRKVDLK+Y +Y +LSDALA MFSSFT GN G+QGM DFMNE KLMD+LN S+Y P
Sbjct  151  YLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVLNGSDYTP  207



>gb|AAM96891.1| auxin-responsive protein IAA1 [Mirabilis jalapa]
Length=194

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 84/107 (79%), Gaps = 2/107 (2%)
 Frame = +3

Query  330  AKAQVVGWPPVRSYRKNVMAHHQKSNNGEEGDQKSGNN--FVKVSMDGAPYLRKVDLKVY  503
            AKAQVVGWPPVRSYRKN++A  + +   E   +K   N   VKVSMDGAPYLRKVDLK+Y
Sbjct  38   AKAQVVGWPPVRSYRKNMLAVQKSTGAPESESEKPAANGGLVKVSMDGAPYLRKVDLKLY  97

Query  504  NTYNQLSDALANMFSSFTTGNYGAQGMIDFMNERKLMDLLNTSEYVP  644
             +Y  LSDAL  MFSSFT GNYG+QGMIDFMNE KLMDL+N S+YVP
Sbjct  98   KSYQDLSDALGKMFSSFTLGNYGSQGMIDFMNESKLMDLINGSDYVP  144



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1012179015936