BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10182

Length=777
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009619635.1|  PREDICTED: bifunctional aspartate aminotrans...    267   2e-82   Nicotiana tomentosiformis
ref|XP_011090466.1|  PREDICTED: bifunctional aspartate aminotrans...    266   4e-82   Sesamum indicum [beniseed]
ref|NP_001234609.1|  prephenate aminotransferase                        265   7e-82   Solanum lycopersicum
ref|XP_010261209.1|  PREDICTED: bifunctional aspartate aminotrans...    265   1e-81   Nelumbo nucifera [Indian lotus]
ref|XP_009776150.1|  PREDICTED: bifunctional aspartate aminotrans...    265   1e-81   Nicotiana sylvestris
ref|XP_010652828.1|  PREDICTED: bifunctional aspartate aminotrans...    261   7e-81   Vitis vinifera
ref|XP_002277000.2|  PREDICTED: bifunctional aspartate aminotrans...    262   9e-81   Vitis vinifera
gb|AII23743.1|  prephenate aminotransferase                             263   1e-80   Antirrhinum majus [garden snapdragon]
ref|XP_006366482.1|  PREDICTED: bifunctional aspartate aminotrans...    262   1e-80   Solanum tuberosum [potatoes]
sp|E9L7A5.1|PAT_PETHY  RecName: Full=Bifunctional aspartate amino...    261   3e-80   Petunia x hybrida [garden petunia]
ref|XP_010090566.1|  Bifunctional aspartate aminotransferase and ...    261   3e-80   Morus notabilis
emb|CDP01418.1|  unnamed protein product                                261   4e-80   Coffea canephora [robusta coffee]
gb|KJB79025.1|  hypothetical protein B456_013G030300                    253   1e-78   Gossypium raimondii
gb|KDO47026.1|  hypothetical protein CISIN_1g012095mg                   255   1e-78   Citrus sinensis [apfelsine]
ref|XP_007048023.1|  Aspartate aminotransferase isoform 4               254   2e-78   
ref|XP_007207431.1|  hypothetical protein PRUPE_ppa005032mg             256   2e-78   Prunus persica
ref|XP_006464262.1|  PREDICTED: bifunctional aspartate aminotrans...    255   4e-78   Citrus sinensis [apfelsine]
ref|XP_006464261.1|  PREDICTED: bifunctional aspartate aminotrans...    255   5e-78   Citrus sinensis [apfelsine]
ref|XP_003525066.1|  PREDICTED: bifunctional aspartate aminotrans...    255   5e-78   Glycine max [soybeans]
gb|KDO47024.1|  hypothetical protein CISIN_1g012095mg                   255   5e-78   Citrus sinensis [apfelsine]
ref|XP_003531365.1|  PREDICTED: bifunctional aspartate aminotrans...    254   5e-78   Glycine max [soybeans]
gb|KDO47025.1|  hypothetical protein CISIN_1g012095mg                   255   6e-78   Citrus sinensis [apfelsine]
gb|AET04530.2|  aspartate aminotransferase                              254   8e-78   Medicago truncatula
ref|XP_008346990.1|  PREDICTED: bifunctional aspartate aminotrans...    255   8e-78   
ref|XP_009378544.1|  PREDICTED: bifunctional aspartate aminotrans...    255   8e-78   Pyrus x bretschneideri [bai li]
ref|XP_008358516.1|  PREDICTED: bifunctional aspartate aminotrans...    255   9e-78   
ref|XP_003630054.1|  Aspartate aminotransferase                         255   9e-78   
gb|KHN29088.1|  Bifunctional aspartate aminotransferase and gluta...    254   1e-77   Glycine soja [wild soybean]
ref|XP_008233417.1|  PREDICTED: bifunctional aspartate aminotrans...    254   2e-77   Prunus mume [ume]
gb|AET06146.1|  PLP-dependent aminotransferase                          254   2e-77   Papaver somniferum
gb|KHN38197.1|  Bifunctional aspartate aminotransferase and gluta...    253   2e-77   Glycine soja [wild soybean]
ref|XP_007048020.1|  Aspartate aminotransferase isoform 1               254   2e-77   
ref|XP_009369904.1|  PREDICTED: bifunctional aspartate aminotrans...    253   3e-77   Pyrus x bretschneideri [bai li]
ref|XP_002307109.2|  hypothetical protein POPTR_0005s08100g             253   3e-77   Populus trichocarpa [western balsam poplar]
ref|XP_006428145.1|  hypothetical protein CICLE_v10025279mg             255   3e-77   
ref|XP_006428144.1|  hypothetical protein CICLE_v10025279mg             255   3e-77   
ref|XP_007048021.1|  Aspartate aminotransferase isoform 2               251   4e-77   
ref|XP_004504047.1|  PREDICTED: bifunctional aspartate aminotrans...    253   4e-77   Cicer arietinum [garbanzo]
gb|KJB79023.1|  hypothetical protein B456_013G030300                    251   4e-77   Gossypium raimondii
gb|KJB79022.1|  hypothetical protein B456_013G030300                    253   4e-77   Gossypium raimondii
ref|XP_004152277.1|  PREDICTED: bifunctional aspartate aminotrans...    252   6e-77   Cucumis sativus [cucumbers]
ref|XP_011008595.1|  PREDICTED: bifunctional aspartate aminotrans...    253   6e-77   Populus euphratica
ref|XP_002310582.2|  hypothetical protein POPTR_0007s05880g             252   7e-77   Populus trichocarpa [western balsam poplar]
gb|KJB79026.1|  hypothetical protein B456_013G030300                    252   8e-77   Gossypium raimondii
ref|XP_011039537.1|  PREDICTED: bifunctional aspartate aminotrans...    252   8e-77   Populus euphratica
ref|XP_010269179.1|  PREDICTED: bifunctional aspartate aminotrans...    252   1e-76   Nelumbo nucifera [Indian lotus]
ref|XP_009369901.1|  PREDICTED: bifunctional aspartate aminotrans...    251   3e-76   Pyrus x bretschneideri [bai li]
ref|XP_010695651.1|  PREDICTED: bifunctional aspartate aminotrans...    250   4e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010664298.1|  PREDICTED: bifunctional aspartate aminotrans...    249   9e-76   Vitis vinifera
gb|AFK38188.1|  unknown                                                 249   1e-75   Medicago truncatula
ref|XP_008454394.1|  PREDICTED: bifunctional aspartate aminotrans...    249   1e-75   Cucumis melo [Oriental melon]
gb|KJB44245.1|  hypothetical protein B456_007G241800                    249   2e-75   Gossypium raimondii
ref|XP_002528972.1|  aspartate aminotransferase, putative               248   3e-75   Ricinus communis
ref|XP_012093235.1|  PREDICTED: bifunctional aspartate aminotrans...    247   1e-74   Jatropha curcas
ref|XP_007159724.1|  hypothetical protein PHAVU_002G262100g             246   2e-74   Phaseolus vulgaris [French bean]
ref|XP_004302193.2|  PREDICTED: bifunctional aspartate aminotrans...    245   6e-74   Fragaria vesca subsp. vesca
ref|XP_007163632.1|  hypothetical protein PHAVU_001G250600g             243   2e-73   Phaseolus vulgaris [French bean]
gb|EYU31038.1|  hypothetical protein MIMGU_mgv1a005497mg                243   3e-73   Erythranthe guttata [common monkey flower]
gb|KHN44325.1|  Bifunctional aspartate aminotransferase and gluta...    239   2e-72   Glycine soja [wild soybean]
gb|KCW54448.1|  hypothetical protein EUGRSUZ_I00395                     241   2e-72   Eucalyptus grandis [rose gum]
ref|XP_010027823.1|  PREDICTED: bifunctional aspartate aminotrans...    241   2e-72   Eucalyptus grandis [rose gum]
gb|KCW54449.1|  hypothetical protein EUGRSUZ_I00395                     241   2e-72   Eucalyptus grandis [rose gum]
gb|KEH24289.1|  aspartate aminotransferase                              239   6e-72   Medicago truncatula
ref|XP_009402635.1|  PREDICTED: bifunctional aspartate aminotrans...    239   6e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001242772.1|  uncharacterized protein LOC100780254               238   1e-71   
ref|XP_010911890.1|  PREDICTED: bifunctional aspartate aminotrans...    234   2e-70   Elaeis guineensis
ref|XP_006591408.1|  PREDICTED: bifunctional aspartate aminotrans...    233   5e-70   
ref|XP_010911889.1|  PREDICTED: bifunctional aspartate aminotrans...    234   8e-70   Elaeis guineensis
ref|XP_008783401.1|  PREDICTED: bifunctional aspartate aminotrans...    234   8e-70   Phoenix dactylifera
ref|XP_006826992.1|  PREDICTED: bifunctional aspartate aminotrans...    233   9e-70   Amborella trichopoda
ref|XP_003538514.1|  PREDICTED: bifunctional aspartate aminotrans...    233   1e-69   
gb|KHN44324.1|  Bifunctional aspartate aminotransferase and gluta...    233   1e-69   Glycine soja [wild soybean]
gb|EYU24011.1|  hypothetical protein MIMGU_mgv1a006790mg                232   1e-69   Erythranthe guttata [common monkey flower]
ref|XP_007163631.1|  hypothetical protein PHAVU_001G250500g             233   1e-69   Phaseolus vulgaris [French bean]
gb|ABR17976.1|  unknown                                                 233   2e-69   Picea sitchensis
ref|XP_010027824.1|  PREDICTED: bifunctional aspartate aminotrans...    230   5e-69   Eucalyptus grandis [rose gum]
gb|EPS71875.1|  prephenate aminotransferase                             232   7e-69   Genlisea aurea
gb|AFW81840.1|  hypothetical protein ZEAMMB73_129784                    229   7e-69   
ref|XP_002441156.1|  hypothetical protein SORBIDRAFT_09g021360          231   1e-68   Sorghum bicolor [broomcorn]
ref|NP_001142303.1|  uncharacterized protein LOC100274472               230   2e-68   Zea mays [maize]
ref|XP_004961976.1|  PREDICTED: bifunctional aspartate aminotrans...    229   2e-68   Setaria italica
gb|AFW81839.1|  hypothetical protein ZEAMMB73_129784                    229   4e-68   
ref|XP_010030428.1|  PREDICTED: bifunctional aspartate aminotrans...    229   6e-68   
gb|KCW54453.1|  hypothetical protein EUGRSUZ_I00398                     228   6e-68   Eucalyptus grandis [rose gum]
gb|ACG37512.1|  aspartate aminotransferase                              228   6e-68   Zea mays [maize]
ref|XP_003564718.1|  PREDICTED: bifunctional aspartate aminotrans...    228   8e-68   Brachypodium distachyon [annual false brome]
ref|XP_003568386.2|  PREDICTED: bifunctional aspartate aminotrans...    229   9e-68   Brachypodium distachyon [annual false brome]
ref|XP_010555356.1|  PREDICTED: bifunctional aspartate aminotrans...    228   1e-67   Tarenaya hassleriana [spider flower]
ref|XP_006646517.1|  PREDICTED: bifunctional aspartate aminotrans...    228   1e-67   
ref|XP_009140341.1|  PREDICTED: bifunctional aspartate aminotrans...    228   2e-67   Brassica rapa
ref|XP_001763787.1|  predicted protein                                  226   3e-67   
ref|NP_850022.1|  aspartate aminotransferase                            224   2e-66   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61164.1|  putative aspartate aminotransferase                     225   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565529.1|  aspartate aminotransferase                            225   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294125.1|  hypothetical protein CARUB_v10023120mg             225   3e-66   
sp|Q5F4K8.1|PAT_PINPS  RecName: Full=Aspartate aminotransferase; ...    225   3e-66   Pinus pinaster [cluster pine]
ref|XP_008809315.1|  PREDICTED: bifunctional aspartate aminotrans...    224   4e-66   Phoenix dactylifera
ref|NP_001044936.1|  Os01g0871300                                       224   4e-66   
ref|XP_010905916.1|  PREDICTED: bifunctional aspartate aminotrans...    224   5e-66   Elaeis guineensis
ref|XP_010429140.1|  PREDICTED: bifunctional aspartate aminotrans...    223   5e-66   Camelina sativa [gold-of-pleasure]
ref|XP_008809314.1|  PREDICTED: bifunctional aspartate aminotrans...    224   5e-66   Phoenix dactylifera
ref|XP_010472217.1|  PREDICTED: bifunctional aspartate aminotrans...    223   1e-65   Camelina sativa [gold-of-pleasure]
ref|NP_001143769.1|  hypothetical protein                               221   2e-65   Zea mays [maize]
ref|XP_002456709.1|  hypothetical protein SORBIDRAFT_03g041180          221   2e-65   
gb|KFK32831.1|  hypothetical protein AALP_AA6G292800                    222   4e-65   Arabis alpina [alpine rockcress]
ref|XP_009112541.1|  PREDICTED: bifunctional aspartate aminotrans...    221   6e-65   Brassica rapa
ref|XP_009112542.1|  PREDICTED: bifunctional aspartate aminotrans...    220   1e-64   Brassica rapa
ref|XP_010416982.1|  PREDICTED: bifunctional aspartate aminotrans...    216   5e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010416981.1|  PREDICTED: bifunctional aspartate aminotrans...    216   5e-63   Camelina sativa [gold-of-pleasure]
ref|XP_002880438.1|  AAT/ATAAT/MEE17                                    213   5e-62   Arabidopsis lyrata subsp. lyrata
gb|KCW54515.1|  hypothetical protein EUGRSUZ_I004631                    202   6e-61   Eucalyptus grandis [rose gum]
ref|XP_006404683.1|  hypothetical protein EUTSA_v10000093mg             213   9e-61   
gb|EMT16326.1|  Aspartate aminotransferase A                            206   9e-60   
ref|XP_010674468.1|  PREDICTED: bifunctional aspartate aminotrans...    203   9e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002965520.1|  hypothetical protein SELMODRAFT_143343             197   1e-56   
ref|XP_002982998.1|  hypothetical protein SELMODRAFT_234146             196   3e-56   
ref|XP_002502760.1|  aspartate aminotransferase                         193   1e-54   Micromonas commoda
ref|XP_002946497.1|  hypothetical protein VOLCADRAFT_103084             194   2e-54   Volvox carteri f. nagariensis
gb|KJB44246.1|  hypothetical protein B456_007G241800                    193   2e-54   Gossypium raimondii
ref|XP_005851526.1|  hypothetical protein CHLNCDRAFT_48481              192   5e-54   Chlorella variabilis
gb|ACG35175.1|  hypothetical protein                                    184   6e-52   Zea mays [maize]
ref|WP_014065957.1|  aspartate aminotransferase                         183   3e-51   Rhodothermus marinus
ref|WP_012842775.1|  aspartate aminotransferase                         183   4e-51   Rhodothermus marinus
ref|XP_003060871.1|  aspartate aminotransferase                         182   3e-50   Micromonas pusilla CCMP1545
dbj|BAB86539.1|  putative aspartate aminotransferase                    171   1e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007512171.1|  aspartate aminotransferase                         169   2e-45   Bathycoccus prasinos
ref|WP_029422218.1|  aspartate aminotransferase                         166   1e-44   Alicyclobacillus macrosporangiidus
ref|WP_016407351.1|  aminotransferase class I and II                    164   5e-44   
ref|WP_035163584.1|  aspartate aminotransferase                         163   1e-43   Caloranaerobacter azorensis
ref|WP_018661627.1|  Aspartate aminotransferase                         162   4e-43   Thermobrachium celere
ref|WP_027307500.1|  aspartate aminotransferase                         162   4e-43   Caloramator sp. ALD01
ref|WP_026962644.1|  aspartate aminotransferase                         162   4e-43   Alicyclobacillus herbarius
ref|WP_013061531.1|  aspartate aminotransferase                         160   1e-42   Salinibacter ruber
ref|WP_011403699.1|  aspartate aminotransferase                         160   2e-42   Salinibacter ruber
ref|WP_015236764.1|  aspartate/tyrosine/aromatic aminotransferase       159   2e-42   Deinococcus peraridilitoris
ref|WP_004036359.1|  hypothetical protein                               159   3e-42   Clostridium sp. ASF356
ref|WP_034345639.1|  aspartate aminotransferase                         158   8e-42   Deinococcus misasensis
ref|WP_027425082.1|  aspartate aminotransferase                         157   1e-41   Lachnospiraceae bacterium NC2004
ref|WP_022834450.1|  aspartate aminotransferase                         157   2e-41   Salisaeta longa
ref|WP_035380127.1|  aspartate aminotransferase                         157   2e-41   Fervidicella metallireducens
ref|XP_001421566.1|  predicted protein                                  157   3e-41   Ostreococcus lucimarinus CCE9901
ref|WP_036944317.1|  aspartate aminotransferase                         156   4e-41   Pseudobacteroides cellulosolvens
ref|XP_003083519.1|  putative aspartate aminotransferase (ISS)          157   4e-41   Ostreococcus tauri
ref|WP_031217917.1|  aspartate aminotransferase                         156   4e-41   Alicyclobacillus acidoterrestris
ref|WP_005402964.1|  aspartate aminotransferase                         150   4e-41   
ref|WP_029689086.1|  aspartate aminotransferase                         149   6e-41   
ref|WP_010250355.1|  aspartate aminotransferase                         155   6e-41   Hungateiclostridium cellulolyticum
gb|EXD71750.1|  aminotransferase class I and II family protein          149   7e-41   Acinetobacter baumannii 662545-1347
ref|WP_011025536.1|  aspartate aminotransferase                         155   7e-41   Caldanaerobacter subterraneus
gb|EPZ52609.1|  hypothetical protein N007_20245                         156   8e-41   Alicyclobacillus acidoterrestris ATCC 49025
ref|WP_028308020.1|  aspartate aminotransferase                         155   9e-41   Desulfitibacter alkalitolerans
ref|XP_011399542.1|  Bifunctional aspartate aminotransferase and ...    156   9e-41   Auxenochlorella protothecoides
ref|WP_039682453.1|  aspartate aminotransferase                         155   1e-40   Deinococcus swuensis
gb|EMS62834.1|  Aspartate aminotransferase                              155   1e-40   Triticum urartu
ref|WP_035580186.1|  aspartate aminotransferase                         155   1e-40   Hyphomonas jannaschiana
gb|ETR62168.1|  aminotransferase, class I/II domain protein             149   2e-40   Acinetobacter baumannii UH8907
ref|WP_043884136.1|  aspartate aminotransferase                         154   2e-40   Caldanaerobacter subterraneus
ref|WP_011025660.1|  aspartate aminotransferase                         154   2e-40   Caldanaerobacter subterraneus
ref|WP_009147598.1|  aspartate aminotransferase                         154   4e-40   Thiorhodovibrio sp. 970
ref|WP_026963667.1|  aspartate aminotransferase                         154   4e-40   Alicyclobacillus pomorum
ref|WP_012693528.1|  aspartate aminotransferase                         153   4e-40   Deinococcus deserti
ref|WP_012281785.1|  aspartate aminotransferase                         153   6e-40   Heliobacterium modesticaldum
ref|WP_003866779.1|  aspartate aminotransferase                         153   8e-40   Thermoanaerobacter ethanolicus
ref|WP_038290506.1|  aspartate aminotransferase [                       153   9e-40   Hungateiclostridium straminisolvens
ref|WP_007194976.1|  aspartate aminotransferase                         152   9e-40   Thiocapsa marina
ref|WP_015280728.1|  aspartate/tyrosine/aromatic aminotransferase       152   9e-40   Thioflavicoccus mobilis
ref|WP_003869112.1|  aspartate aminotransferase                         152   1e-39   
ref|WP_035617440.1|  aspartate aminotransferase                         152   1e-39   Hyphomonas johnsonii
ref|WP_004396233.1|  MULTISPECIES: Aspartate/tyrosine/aromatic am...    152   1e-39   Thermoanaerobacter
gb|ACJ58006.1|  Aspartate aminotransferase A(Transaminase A) (AspAT)    149   1e-39   
ref|WP_022587741.1|  aspartate aminotransferase                         152   1e-39   Caldanaerobacter subterraneus
ref|WP_034769206.1|  aspartate aminotransferase                         152   1e-39   Hyphomonas sp. CY54-11-8
ref|WP_038169349.1|  aspartate aminotransferase                         152   1e-39   Verrucomicrobium sp. BvORR106
ref|WP_009962470.1|  aspartate aminotransferase                         152   2e-39   Verrucomicrobium spinosum
gb|EEG73126.1|  aminotransferase, class I/II [ [                        152   2e-39   [Clostridium] hylemonae DSM 15053
ref|WP_022175526.1|  aspartate/tyrosine/aromatic aminotransferase       152   2e-39   
ref|WP_003516296.1|  aspartate aminotransferase                         152   2e-39   Hungateiclostridium thermocellum
ref|WP_040435223.1|  aspartate aminotransferase [                       152   2e-39   
ref|WP_027981308.1|  aspartate aminotransferase                         152   2e-39   gamma proteobacterium L18
ref|WP_042681840.1|  aspartate aminotransferase                         152   2e-39   Anaerosalibacter massiliensis
ref|WP_038961179.1|  aspartate aminotransferase                         152   2e-39   
ref|WP_022450889.1|  aspartate transaminase                             151   3e-39   
ref|WP_042757927.1|  aspartate aminotransferase                         149   3e-39   Acinetobacter baumannii
ref|WP_014759002.1|  MULTISPECIES: aspartate aminotransferase           151   3e-39   Thermoanaerobacterium aotearoense
ref|WP_034735961.1|  aspartate aminotransferase                         151   4e-39   Hyphomonas chukchiensis
ref|WP_042833036.1|  aspartate aminotransferase                         151   4e-39   Thermoanaerobacter sp. YS13
ref|WP_026476078.1|  aspartate aminotransferase                         151   4e-39   Alkaliphilus transvaalensis
ref|WP_016846691.1|  hypothetical protein                               146   4e-39   
ref|WP_027099478.1|  aspartate aminotransferase                         150   5e-39   Clostridium paraputrificum
ref|WP_026975467.1|  aspartate aminotransferase                         150   6e-39   Alicyclobacillus contaminans
ref|WP_027417534.1|  aspartate aminotransferase                         150   6e-39   Aneurinibacillus terranovensis
ref|WP_023414707.1|  aspartate aminotransferase                         150   6e-39   
ref|WP_022224362.1|  aspartate transaminase                             150   6e-39   
ref|WP_006570420.1|  aspartate aminotransferase                         150   6e-39   Thermoanaerobacter siderophilus
ref|WP_004663094.1|  hypothetical protein                               150   6e-39   Acinetobacter sp. NIPH 236
ref|WP_044559633.1|  aspartate aminotransferase                         146   6e-39   
ref|WP_028991905.1|  aspartate aminotransferase                         150   7e-39   Thermoanaerobacter thermocopriae
ref|WP_005157664.1|  MULTISPECIES: hypothetical protein                 150   7e-39   Acinetobacter
ref|WP_039046918.1|  aspartate aminotransferase                         150   7e-39   Acinetobacter junii
ref|WP_012995221.1|  MULTISPECIES: aspartate aminotransferase           150   7e-39   Thermoanaerobacter
ref|WP_004953091.1|  hypothetical protein                               150   8e-39   Acinetobacter junii
ref|WP_042890603.1|  aspartate aminotransferase                         150   8e-39   Acinetobacter junii
ref|WP_028880326.1|  aspartate aminotransferase                         150   8e-39   Terasakiella pusilla
ref|WP_004913437.1|  hypothetical protein                               150   8e-39   Acinetobacter junii
ref|WP_045656454.1|  aspartate aminotransferase                         150   9e-39   
ref|WP_035672188.1|  aspartate aminotransferase                         143   9e-39   
ref|WP_018703726.1|  MULTISPECIES: aspartate aminotransferase           150   1e-38   Sporomusaceae
ref|WP_014758717.1|  MULTISPECIES: aspartate aminotransferase           150   1e-38   Thermoanaerobacterium aotearoense
ref|WP_014062870.1|  aspartate aminotransferase                         149   1e-38   Thermoanaerobacter wiegelii
ref|WP_008516640.1|  aspartate aminotransferase                         149   1e-38   Dethiobacter alkaliphilus
ref|WP_014254999.1|  aspartate aminotransferase [                       149   1e-38   Hungateiclostridium clariflavum
ref|WP_035696301.1|  aspartate aminotransferase                         142   1e-38   
ref|WP_014967681.1|  aspartate aminotransferase                         149   2e-38   Gottschalkia acidurici
ref|WP_042050304.1|  aspartate aminotransferase                         149   2e-38   Acinetobacter baumannii
ref|WP_000383204.1|  aspartate aminotransferase                         149   2e-38   Acinetobacter baumannii
ref|WP_000383203.1|  aspartate aminotransferase                         149   2e-38   Acinetobacter baumannii
ref|WP_031978052.1|  aspartate aminotransferase                         149   2e-38   Acinetobacter baumannii
ref|WP_000383198.1|  aspartate aminotransferase                         149   2e-38   Acinetobacter baumannii
ref|WP_031963257.1|  aspartate aminotransferase                         149   2e-38   Acinetobacter baumannii
ref|WP_036548224.1|  aspartate aminotransferase                         149   2e-38   Nitrincola lacisaponensis
ref|WP_015451593.1|  aspartate aminotransferase A                       149   2e-38   Acinetobacter baumannii
ref|WP_032029528.1|  aspartate aminotransferase                         149   2e-38   Acinetobacter baumannii
ref|WP_004707562.1|  MULTISPECIES: hypothetical protein                 149   2e-38   Acinetobacter
ref|WP_002069248.1|  aminotransferase, class I/II                       149   2e-38   Acinetobacter baumannii
ref|WP_000383205.1|  aspartate aminotransferase                         149   2e-38   Acinetobacter
ref|WP_000383202.1|  aspartate aminotransferase                         149   2e-38   Acinetobacter
ref|WP_005131091.1|  hypothetical protein                               149   2e-38   Acinetobacter baumannii
ref|WP_031952052.1|  aspartate aminotransferase                         149   2e-38   Acinetobacter baumannii
ref|WP_000383200.1|  aspartate aminotransferase                         149   2e-38   Acinetobacter
ref|WP_032002345.1|  aspartate aminotransferase                         149   2e-38   Acinetobacter baumannii
ref|WP_031972650.1|  aspartate aminotransferase                         149   2e-38   Acinetobacter baumannii
ref|WP_031954187.1|  aspartate aminotransferase                         149   2e-38   Acinetobacter baumannii
ref|WP_000383197.1|  aspartate aminotransferase                         149   2e-38   Acinetobacter baumannii
ref|WP_000383199.1|  aspartate aminotransferase                         149   2e-38   Acinetobacter baumannii
ref|WP_038348431.1|  aspartate aminotransferase                         149   2e-38   Acinetobacter baumannii
ref|WP_031965185.1|  aspartate aminotransferase                         149   2e-38   Acinetobacter baumannii
ref|WP_008428412.1|  aspartate/tyrosine/aromatic aminotransferase       149   2e-38   Clostridium sp. LS
ref|WP_031995740.1|  aspartate aminotransferase                         149   2e-38   Acinetobacter baumannii
gb|EEB75560.1|  aminotransferase, classes I and II superfamily          149   2e-38   
ref|WP_035535287.1|  aspartate aminotransferase                         149   2e-38   Hyphomonas oceanitis
ref|WP_044927429.1|  aspartate aminotransferase                         149   2e-38   Hungatella hathewayi
ref|WP_022015081.1|  aspartate transaminase                             149   2e-38   
ref|WP_026291982.1|  aspartate aminotransferase                         149   2e-38   Marinobacterium rhizophilum
ref|WP_013822400.1|  aspartate aminotransferase                         149   2e-38   
ref|WP_014778995.1|  aspartate aminotransferase                         149   3e-38   Thiocystis violascens
ref|WP_022364144.1|  aminotransferase class I and II                    149   3e-38   
ref|WP_011195162.1|  aspartate aminotransferase                         149   3e-38   Symbiobacterium thermophilum
ref|WP_034130426.1|  aspartate aminotransferase                         149   3e-38   
ref|WP_022254028.1|  aminotransferase class I and II                    149   3e-38   
ref|WP_032012250.1|  aspartate aminotransferase                         149   4e-38   Acinetobacter calcoaceticus/baumannii complex
ref|WP_006581845.1|  MULTISPECIES: aspartate aminotransferase           149   4e-38   Acinetobacter
ref|WP_008909077.1|  aspartate aminotransferase                         148   4e-38   Caloramator australicus
ref|WP_004885855.1|  hypothetical protein                               149   4e-38   Acinetobacter nosocomialis
gb|EKE22634.1|  hypothetical protein ACD_6C00770G0008                   144   4e-38   uncultured bacterium
ref|WP_018969731.1|  hypothetical protein                               148   4e-38   Rubritalea marina
ref|WP_034824479.1|  aspartate aminotransferase                         148   4e-38   Hyphomonas
ref|WP_021875181.1|  Putative Aspartate aminotransferase                148   4e-38   Clostridium chauvoei
ref|WP_011530756.1|  aspartate aminotransferase                         148   4e-38   Deinococcus geothermalis
ref|WP_006581328.1|  aspartate aminotransferase                         148   4e-38   Acinetobacter nosocomialis
ref|WP_017391856.1|  aspartate aminotransferase                         148   5e-38   Acinetobacter calcoaceticus
ref|WP_004668841.1|  hypothetical protein                               148   5e-38   Acinetobacter sp. CIP-A165
gb|KCZ65615.1|  hypothetical protein L53_15585                          145   5e-38   Hyphomonas sp. L-53-1-40
ref|WP_038965401.1|  aspartate aminotransferase                         141   5e-38   
ref|WP_035762173.1|  aspartate aminotransferase                         148   5e-38   Clostridium
ref|WP_027637174.1|  aspartate aminotransferase                         148   5e-38   Clostridium butyricum
ref|WP_002582036.1|  hypothetical protein                               148   6e-38   Clostridium
ref|WP_008861287.1|  aspartate aminotransferase                         148   6e-38   Bacteroidales
ref|WP_013788031.1|  aspartate aminotransferase                         148   6e-38   Thermoanaerobacterium xylanolyticum
ref|WP_043663366.1|  aspartate aminotransferase                         148   6e-38   Clostridium butyricum
ref|WP_005295765.1|  hypothetical protein                               148   6e-38   Acinetobacter sp. NIPH 2100
ref|WP_029009111.1|  aspartate aminotransferase                         148   6e-38   Azospirillum halopraeferens
ref|WP_029014076.1|  aspartate aminotransferase                         148   6e-38   Niveispirillum irakense
ref|WP_046008665.1|  aspartate aminotransferase                         147   6e-38   Oleispira antarctica
ref|WP_019555267.1|  hypothetical protein                               148   6e-38   Propionispira raffinosivorans
ref|WP_004759661.1|  hypothetical protein                               148   7e-38   Acinetobacter sp. CIP 102129
ref|WP_018677247.1|  aspartate aminotransferase                         148   7e-38   Acinetobacter tjernbergiae
ref|WP_005145403.1|  hypothetical protein                               148   7e-38   Acinetobacter sp. ANC 3929
ref|WP_004681168.1|  MULTISPECIES: aspartate aminotransferase           148   7e-38   Acinetobacter
ref|WP_008677994.1|  aspartate aminotransferase                         147   7e-38   Clostridium
ref|WP_035551075.1|  aspartate aminotransferase                         148   7e-38   
gb|KFZ91464.1|  aspartate aminotransferase                              148   7e-38   
ref|WP_032051346.1|  aspartate aminotransferase                         148   7e-38   
ref|WP_004798649.1|  hypothetical protein                               148   7e-38   
ref|WP_026380028.1|  aspartate aminotransferase                         147   7e-38   
gb|ABO12926.2|  aspartate aminotransferase A                            148   7e-38   
ref|WP_005287898.1|  hypothetical protein                               148   7e-38   
ref|WP_032874352.1|  aspartate aminotransferase                         148   7e-38   
ref|WP_016651780.1|  aspartate aminotransferase                         148   7e-38   
ref|WP_005195867.1|  hypothetical protein                               148   8e-38   
ref|WP_004652675.1|  MULTISPECIES: hypothetical protein                 148   8e-38   
ref|WP_023174345.1|  aspartate aminotransferase                         147   8e-38   
ref|WP_043853312.1|  aspartate aminotransferase                         147   8e-38   
ref|WP_005054885.1|  hypothetical protein                               148   8e-38   
ref|WP_005062573.1|  hypothetical protein                               148   8e-38   
ref|WP_004773691.1|  MULTISPECIES: hypothetical protein                 148   8e-38   
ref|WP_009511299.1|  aminotransferase, class I/II                       148   8e-38   
ref|WP_011553419.1|  aspartate aminotransferase                         147   8e-38   
ref|WP_005243238.1|  MULTISPECIES: aspartate aminotransferase           148   8e-38   
gb|KFX71924.1|  aspartate aminotransferase                              141   8e-38   
ref|WP_038932191.1|  aspartate aminotransferase                         140   8e-38   
ref|WP_025641143.1|  aspartate aminotransferase                         147   8e-38   
gb|EGB90995.1|  aspartate transaminase                                  147   8e-38   
ref|WP_032866346.1|  aspartate aminotransferase                         147   9e-38   
ref|WP_013939947.1|  aspartate aminotransferase                         147   9e-38   
ref|WP_013029914.1|  aspartate aminotransferase                         147   9e-38   
ref|WP_004752777.1|  hypothetical protein                               147   9e-38   
ref|WP_004901171.1|  hypothetical protein                               147   9e-38   
ref|WP_034795382.1|  aspartate aminotransferase                         147   9e-38   
ref|WP_022306373.1|  hypothetical protein                               147   1e-37   
ref|WP_013558211.1|  aspartate aminotransferase                         147   1e-37   
ref|WP_022464610.1|  hypothetical protein                               147   1e-37   
ref|WP_040847017.1|  aspartate aminotransferase                         147   1e-37   
ref|WP_004640008.1|  MULTISPECIES: aspartate aminotransferase           147   1e-37   
ref|WP_035710397.1|  aspartate aminotransferase                         140   1e-37   
ref|WP_011111398.1|  aspartate aminotransferase                         147   1e-37   
ref|WP_016655460.1|  aspartate aminotransferase                         147   1e-37   
gb|EIJ33226.1|  aminotransferase class I and II                         147   1e-37   
ref|WP_045698484.1|  aspartate aminotransferase                         147   1e-37   
ref|WP_007479924.1|  MULTISPECIES: aspartate aminotransferase           147   1e-37   
ref|WP_035314403.1|  aspartate aminotransferase                         147   1e-37   
ref|WP_022101399.1|  aspartate transaminase                             147   1e-37   
ref|WP_043118438.1|  aspartate aminotransferase                         147   1e-37   
ref|WP_013297861.1|  aspartate aminotransferase                         147   1e-37   
ref|WP_023012406.1|  aspartate aminotransferase                         147   1e-37   
ref|WP_035570292.1|  aspartate aminotransferase                         147   1e-37   
ref|WP_004880738.1|  hypothetical protein                               147   1e-37   
ref|WP_018078526.1|  aspartate aminotransferase                         147   1e-37   
ref|WP_026329666.1|  aspartate aminotransferase                         147   1e-37   
ref|WP_004678034.1|  hypothetical protein                               147   1e-37   
ref|WP_018273579.1|  aspartate aminotransferase                         147   1e-37   
ref|WP_028340563.1|  aspartate aminotransferase                         147   1e-37   
ref|WP_015311596.1|  aspartate/tyrosine/aromatic aminotransferase       147   1e-37   
ref|WP_003408961.1|  aspartate aminotransferase                         147   1e-37   
ref|WP_038382215.1|  aspartate aminotransferase                         147   1e-37   
ref|WP_035401598.1|  aspartate aminotransferase                         147   2e-37   
ref|WP_043107759.1|  aspartate aminotransferase                         147   2e-37   
ref|WP_022572090.1|  aspartate/tyrosine/aromatic aminotransferase       147   2e-37   
gb|EUJ22105.1|  aspartate aminotransferase                              141   2e-37   
ref|WP_005019381.1|  MULTISPECIES: aspartate aminotransferase           147   2e-37   
ref|WP_005406545.1|  aspartate aminotransferase                         147   2e-37   
ref|WP_028471333.1|  aspartate aminotransferase                         146   2e-37   
ref|WP_021080689.1|  aspartate aminotransferase                         147   2e-37   
ref|WP_005183802.1|  hypothetical protein                               147   2e-37   
ref|WP_029083465.1|  aspartate aminotransferase                         146   2e-37   
ref|WP_009052380.1|  MULTISPECIES: aspartate aminotransferase           146   2e-37   
ref|WP_038342248.1|  aspartate aminotransferase                         147   2e-37   
ref|WP_016804925.1|  aspartate aminotransferase                         147   2e-37   
ref|WP_010887268.1|  aspartate aminotransferase                         146   2e-37   
ref|WP_011628834.1|  aspartate aminotransferase                         146   2e-37   
ref|WP_027854478.1|  aspartate aminotransferase                         146   2e-37   
ref|WP_009172171.1|  aspartate aminotransferase                         146   2e-37   
ref|WP_026757718.1|  aspartate aminotransferase                         146   2e-37   
ref|WP_033855457.1|  aspartate aminotransferase                         147   2e-37   
ref|WP_005213530.1|  hypothetical protein                               147   2e-37   
ref|WP_004808509.1|  MULTISPECIES: hypothetical protein                 147   2e-37   
ref|WP_024585134.1|  MULTISPECIES: aspartate aminotransferase           146   2e-37   
ref|WP_039255324.1|  aspartate aminotransferase                         147   2e-37   
ref|WP_018133049.1|  hypothetical protein                               146   2e-37   
ref|WP_019457670.1|  MULTISPECIES: aspartate aminotransferase           147   2e-37   
ref|WP_002052714.1|  aminotransferase, class I/II                       147   2e-37   
ref|WP_044539491.1|  MULTISPECIES: aspartate aminotransferase           146   2e-37   
ref|WP_034582349.1|  aspartate aminotransferase                         146   2e-37   
ref|WP_005011222.1|  hypothetical protein                               146   2e-37   
ref|WP_028163865.1|  aspartate aminotransferase                         146   2e-37   
ref|WP_025026808.1|  aspartate aminotransferase                         146   2e-37   
ref|WP_016208891.1|  aspartate aminotransferase                         146   2e-37   
ref|WP_022025965.1|  hypothetical protein                               146   2e-37   
ref|WP_011634158.1|  aspartate aminotransferase                         146   2e-37   
ref|WP_040839942.1|  aspartate aminotransferase                         146   3e-37   
ref|WP_010325417.1|  aspartate aminotransferase                         146   3e-37   
ref|WP_035265512.1|  aspartate aminotransferase                         146   3e-37   
ref|WP_027284842.1|  aspartate aminotransferase                         146   3e-37   
ref|WP_036129429.1|  aspartate aminotransferase                         146   3e-37   
ref|WP_029478348.1|  aspartate aminotransferase                         146   3e-37   
ref|WP_024506208.1|  aspartate aminotransferase                         146   3e-37   
ref|WP_027536921.1|  aspartate aminotransferase                         146   3e-37   
ref|WP_002055810.1|  aminotransferase, class I/II                       146   3e-37   
ref|WP_042394308.1|  aspartate aminotransferase                         146   3e-37   
ref|WP_003466086.1|  aspartate aminotransferase                         146   3e-37   
gb|EXJ10286.1|  Aspartate aminotransferase                              146   3e-37   
ref|WP_011647942.1|  MULTISPECIES: aspartate aminotransferase           146   3e-37   
dbj|GAN32950.1|  aspartate aminotransferase                             146   3e-37   
ref|WP_016166828.1|  aspartate aminotransferase                         146   3e-37   
ref|WP_044740238.1|  aspartate aminotransferase                         146   3e-37   
ref|WP_036512425.1|  aspartate aminotransferase                         146   3e-37   
gb|EKD76810.1|  hypothetical protein ACD_42C00598G0002                  142   3e-37   
ref|WP_012139420.1|  aspartate aminotransferase A                       146   3e-37   
ref|WP_004582627.1|  aspartate aminotransferase A                       145   3e-37   
gb|AEJ45021.1|  aminotransferase class I and II                         146   3e-37   
ref|WP_005640078.1|  aspartate aminotransferase                         146   4e-37   
ref|WP_018249160.1|  hypothetical protein                               145   4e-37   
ref|WP_024327361.1|  aspartate aminotransferase                         145   4e-37   
ref|WP_026485724.1|  aspartate aminotransferase                         145   4e-37   
ref|WP_045795111.1|  aspartate aminotransferase                         146   4e-37   
ref|WP_019644320.1|  aspartate aminotransferase                         145   4e-37   
ref|WP_034705088.1|  aspartate aminotransferase                         146   4e-37   
ref|WP_038002555.1|  MULTISPECIES: aspartate aminotransferase           145   4e-37   
ref|WP_016660038.1|  aspartate aminotransferase                         146   4e-37   
ref|WP_011504307.1|  aspartate aminotransferase                         145   4e-37   
ref|WP_008172055.1|  aspartate aminotransferase                         145   4e-37   
ref|WP_005236666.1|  MULTISPECIES: hypothetical protein                 146   4e-37   
ref|WP_025278319.1|  aspartate aminotransferase                         145   4e-37   
ref|WP_041695532.1|  aspartate aminotransferase                         145   4e-37   
ref|WP_023438187.1|  aspartate aminotransferase                         145   4e-37   
ref|WP_027837309.1|  aspartate aminotransferase                         145   4e-37   
ref|WP_004971708.1|  MULTISPECIES: hypothetical protein                 145   4e-37   
ref|WP_039720668.1|  aspartate aminotransferase                         145   4e-37   
ref|WP_005176698.1|  hypothetical protein                               145   4e-37   
ref|WP_004784496.1|  hypothetical protein                               145   4e-37   
ref|WP_002633513.1|  aspartate aminotransferase                         145   4e-37   
ref|WP_032035922.1|  aspartate aminotransferase                         145   4e-37   
ref|WP_005038909.1|  hypothetical protein                               145   4e-37   
ref|WP_014576796.1|  aspartate aminotransferase                         145   5e-37   
ref|WP_027461741.1|  aspartate aminotransferase                         145   5e-37   
ref|WP_040053758.1|  aspartate aminotransferase                         142   5e-37   
gb|EGQ62843.1|  aspartate aminotransferase                              144   5e-37   
ref|WP_010114912.1|  aspartate aminotransferase                         145   5e-37   
ref|WP_045125835.1|  aspartate aminotransferase                         145   5e-37   
ref|WP_004939227.1|  hypothetical protein                               145   5e-37   
ref|WP_007043081.1|  aspartate aminotransferase                         145   5e-37   
ref|WP_013951357.1|  aspartate aminotransferase                         145   5e-37   
ref|WP_027581106.1|  aspartate aminotransferase                         145   5e-37   
ref|WP_045429641.1|  aspartate aminotransferase                         145   5e-37   
ref|WP_042898097.1|  aspartate aminotransferase                         145   5e-37   
ref|WP_017387882.1|  aspartate aminotransferase                         145   5e-37   
ref|WP_005045863.1|  hypothetical protein                               145   5e-37   
ref|WP_004790755.1|  MULTISPECIES: hypothetical protein                 145   5e-37   
ref|WP_004721317.1|  MULTISPECIES: hypothetical protein                 145   5e-37   
ref|WP_020365180.1|  aspartate aminotransferase                         139   5e-37   
ref|WP_002118408.1|  MULTISPECIES: aspartate aminotransferase           145   5e-37   
ref|WP_017386248.1|  MULTISPECIES: aspartate aminotransferase           145   5e-37   
ref|WP_015688485.1|  aspartate aminotransferase                         145   6e-37   
ref|WP_004699990.1|  hypothetical protein                               145   6e-37   
ref|WP_013278826.1|  aspartate aminotransferase                         145   6e-37   
ref|WP_006564181.1|  aspartate aminotransferase                         145   6e-37   
ref|WP_004820670.1|  hypothetical protein                               145   6e-37   
ref|WP_002625998.1|  Aspartate aminotransferase                         145   6e-37   
ref|WP_041381646.1|  aspartate aminotransferase                         145   6e-37   
ref|WP_044100366.1|  aspartate aminotransferase                         145   6e-37   
gb|AHK02017.1|  aspartate aminotransferase                              145   6e-37   
ref|WP_029583399.1|  aspartate aminotransferase                         145   6e-37   
ref|WP_013787635.1|  aspartate aminotransferase                         145   6e-37   
ref|WP_004693649.1|  MULTISPECIES: aspartate aminotransferase           145   6e-37   
ref|WP_041527382.1|  aspartate aminotransferase                         145   6e-37   
ref|WP_038086745.1|  aspartate aminotransferase                         145   6e-37   
ref|WP_005399684.1|  aspartate aminotransferase                         145   6e-37   
ref|WP_005029711.1|  MULTISPECIES: aspartate aminotransferase           145   6e-37   
ref|WP_003522859.1|  aspartate aminotransferase                         145   6e-37   
ref|WP_038127896.1|  aspartate aminotransferase                         145   7e-37   
ref|WP_004831257.1|  hypothetical protein                               145   7e-37   
gb|EFD89737.1|  aspartate aminotransferase                              139   7e-37   
ref|WP_041883692.1|  aspartate aminotransferase                         140   7e-37   
ref|WP_028350796.1|  aspartate aminotransferase                         145   7e-37   
ref|WP_018880637.1|  MULTISPECIES: aspartate aminotransferase           145   7e-37   
ref|WP_018866312.1|  MULTISPECIES: aspartate aminotransferase           145   7e-37   
ref|WP_009570984.1|  aspartate aminotransferase                         145   7e-37   
ref|WP_018875475.1|  aspartate aminotransferase                         145   7e-37   
ref|WP_040501129.1|  aspartate aminotransferase                         145   7e-37   
ref|WP_012474535.1|  aspartate aminotransferase                         145   8e-37   
ref|WP_004892285.1|  hypothetical protein                               145   8e-37   
ref|WP_018877392.1|  MULTISPECIES: aspartate aminotransferase           145   8e-37   
ref|WP_028302103.1|  aspartate aminotransferase                         145   8e-37   
ref|WP_004430390.1|  aspartate aminotransferase                         145   8e-37   
ref|WP_038492900.1|  aspartate aminotransferase                         145   8e-37   
ref|WP_005265762.1|  MULTISPECIES: hypothetical protein                 145   8e-37   
ref|WP_010659659.1|  MULTISPECIES: aspartate aminotransferase           145   8e-37   
ref|WP_036182198.1|  aspartate aminotransferase                         145   8e-37   
ref|WP_025589128.1|  aspartate aminotransferase                         145   8e-37   
ref|WP_011440195.1|  aspartate aminotransferase                         145   8e-37   
ref|WP_045019190.1|  aspartate aminotransferase                         145   8e-37   
ref|WP_027298088.1|  aspartate aminotransferase                         145   8e-37   
ref|WP_012502484.1|  aspartate aminotransferase                         145   8e-37   
ref|WP_008930037.1|  aspartate aminotransferase                         145   9e-37   
ref|WP_035593069.1|  aspartate aminotransferase                         145   9e-37   
ref|WP_045017365.1|  aspartate aminotransferase                         145   9e-37   
ref|WP_035263659.1|  aspartate aminotransferase                         145   9e-37   
ref|WP_003513431.1|  MULTISPECIES: aspartate aminotransferase           145   9e-37   
ref|WP_009764602.1|  aspartate aminotransferase                         145   9e-37   
ref|WP_005103791.1|  MULTISPECIES: hypothetical protein                 145   9e-37   
ref|WP_044112165.1|  aspartate aminotransferase                         145   9e-37   
ref|WP_004645610.1|  MULTISPECIES: hypothetical protein                 145   9e-37   
ref|WP_005097537.1|  MULTISPECIES: hypothetical protein                 145   9e-37   
ref|WP_004815219.1|  MULTISPECIES: aspartate aminotransferase           145   9e-37   
ref|WP_005106458.1|  hypothetical protein                               145   9e-37   
ref|WP_004279052.1|  MULTISPECIES: aspartate aminotransferase           145   9e-37   
ref|WP_031953064.1|  aspartate aminotransferase                         145   9e-37   
ref|WP_007148312.1|  aspartate aminotransferase                         144   9e-37   
ref|WP_004731654.1|  MULTISPECIES: hypothetical protein                 145   1e-36   
ref|WP_012536913.1|  aspartate aminotransferase                         144   1e-36   
ref|WP_010972134.1|  MULTISPECIES: aspartate aminotransferase           144   1e-36   
dbj|GAE19494.1|  aspartate aminotransferase                             139   1e-36   
ref|WP_006316372.1|  aspartate aminotransferase                         144   1e-36   
ref|WP_033752614.1|  aspartate aminotransferase                         139   1e-36   
ref|WP_042441707.1|  aspartate aminotransferase                         144   1e-36   
ref|WP_039670144.1|  aspartate aminotransferase                         144   1e-36   
ref|WP_014421816.1|  aspartate aminotransferase                         144   1e-36   
ref|WP_007505575.1|  aspartate aminotransferase                         144   1e-36   
ref|WP_005864845.1|  aspartate aminotransferase                         144   1e-36   
ref|WP_040726045.1|  aspartate aminotransferase                         144   1e-36   
ref|WP_021813964.1|  Aspartate aminotransferase                         144   1e-36   



>ref|XP_009619635.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Nicotiana tomentosiformis]
Length=478

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 139/157 (89%), Gaps = 2/157 (1%)
 Frame = +2

Query  308  KRQTYPSSVNQVARVRC--SMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLA  481
            KRQ Y      V   +    +EVDISLSPRVN+VKPSKTVAITDQATALAQAGVPVIRLA
Sbjct  49   KRQLYSPRTGAVVITQSMDRVEVDISLSPRVNSVKPSKTVAITDQATALAQAGVPVIRLA  108

Query  482  AGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVS  661
            AGEPDFDTP PIAEAGINAIREGHTRYTPNAGTME+R AICHKLKEENGL+YTPDQILVS
Sbjct  109  AGEPDFDTPVPIAEAGINAIREGHTRYTPNAGTMELRSAICHKLKEENGLSYTPDQILVS  168

Query  662  NGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            NGAKQSI+QAVLAVCSPGDEVLIPAPFWVSYPE  ++
Sbjct  169  NGAKQSIVQAVLAVCSPGDEVLIPAPFWVSYPEMARM  205



>ref|XP_011090466.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Sesamum indicum]
Length=481

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 141/157 (90%), Gaps = 3/157 (2%)
 Frame = +2

Query  311  RQTYPSSVNQVARVRC---SMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLA  481
            RQ +   V+ V R      +MEVDISLSPRVN+VKPSKTVAITDQATALAQAGVPVIRLA
Sbjct  52   RQLHLQRVSAVVRAEINSHTMEVDISLSPRVNSVKPSKTVAITDQATALAQAGVPVIRLA  111

Query  482  AGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVS  661
            AGEPDFDTPA IAEAGINAIREG+TRYTPNAGT+E+R AICHKLKEENG++YTPDQILVS
Sbjct  112  AGEPDFDTPAAIAEAGINAIREGYTRYTPNAGTLELRTAICHKLKEENGISYTPDQILVS  171

Query  662  NGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            NGAKQSILQAVLAVCSPGDEV+IPAPFWVSYPE  ++
Sbjct  172  NGAKQSILQAVLAVCSPGDEVIIPAPFWVSYPEMARL  208



>ref|NP_001234609.1| prephenate aminotransferase [Solanum lycopersicum]
 gb|ADQ00383.1| prephenate aminotransferase [Solanum lycopersicum]
Length=480

 Score =   265 bits (678),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 140/157 (89%), Gaps = 2/157 (1%)
 Frame = +2

Query  308  KRQTYPSSVNQV--ARVRCSMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLA  481
            KRQ Y      V  A+    +EVD+SLSPRVN+VKPSKTVAITDQATAL QAGVPVIRLA
Sbjct  51   KRQLYSRGTGSVVIAQNMDRVEVDLSLSPRVNSVKPSKTVAITDQATALVQAGVPVIRLA  110

Query  482  AGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVS  661
            AGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTME+R AICHKLKEENGL+YTPDQI+VS
Sbjct  111  AGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMELRSAICHKLKEENGLSYTPDQIVVS  170

Query  662  NGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            NGAKQSI+QAVLAVCSPGDEVLIPAP+WVSYPE  ++
Sbjct  171  NGAKQSIVQAVLAVCSPGDEVLIPAPYWVSYPEMARM  207



>ref|XP_010261209.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Nelumbo nucifera]
Length=486

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 139/153 (91%), Gaps = 3/153 (2%)
 Frame = +2

Query  323  PSSVNQVARVRCS---MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEP  493
            P   + V R  CS   M++DISLSPRVN+VKPSKTVAITDQATALAQAGVPVIRLAAGEP
Sbjct  61   PFKTSAVVRAECSPEKMQIDISLSPRVNSVKPSKTVAITDQATALAQAGVPVIRLAAGEP  120

Query  494  DFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAK  673
            DFDTPA IAEAGINAIREG+TRYTPNAGT+E+R+AICHKLKEENGLTYTPDQILVSNGAK
Sbjct  121  DFDTPAVIAEAGINAIREGYTRYTPNAGTLELRKAICHKLKEENGLTYTPDQILVSNGAK  180

Query  674  QSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            Q ILQAVLAVCSPGDEV+IPAPFWVSYPE  ++
Sbjct  181  QCILQAVLAVCSPGDEVIIPAPFWVSYPEMARL  213



>ref|XP_009776150.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Nicotiana sylvestris]
Length=480

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 139/157 (89%), Gaps = 2/157 (1%)
 Frame = +2

Query  308  KRQTYPSSVNQVARVRC--SMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLA  481
            K+Q Y      V   +    +EVDISLSPRVN+VKPSKTVAITDQATALAQAGVPVIRLA
Sbjct  51   KKQLYSRRAGAVVITQTMDRVEVDISLSPRVNSVKPSKTVAITDQATALAQAGVPVIRLA  110

Query  482  AGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVS  661
            AGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTME+R AICHKLKEEN L+YTPDQILVS
Sbjct  111  AGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMELRSAICHKLKEENELSYTPDQILVS  170

Query  662  NGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            NGAKQSI+QAVLAVCSPGDEVLIPAPFWVSYPE  ++
Sbjct  171  NGAKQSIVQAVLAVCSPGDEVLIPAPFWVSYPEMARM  207



>ref|XP_010652828.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase isoform X2 [Vitis 
vinifera]
Length=410

 Score =   261 bits (666),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            MEVDISLSPRVN+VKPSKTVAITDQATAL QAGVPVIRLAAGEPDFDTPA IAEAGINAI
Sbjct  1    MEVDISLSPRVNSVKPSKTVAITDQATALVQAGVPVIRLAAGEPDFDTPAVIAEAGINAI  60

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG+TRYTPNAGT+E+R AICHKLKEENGL+YTPD+ILVSNGAKQSILQAVLAVCSPGDE
Sbjct  61   REGYTRYTPNAGTLEVRSAICHKLKEENGLSYTPDEILVSNGAKQSILQAVLAVCSPGDE  120

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAPFWVSYPE  ++
Sbjct  121  VIIPAPFWVSYPEMARL  137



>ref|XP_002277000.2| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase isoform X1 [Vitis 
vinifera]
 emb|CBI21453.3| unnamed protein product [Vitis vinifera]
Length=476

 Score =   262 bits (670),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 140/157 (89%), Gaps = 3/157 (2%)
 Frame = +2

Query  311  RQTYPSSVNQVARVRCS---MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLA  481
            RQ   S ++ + R   +   MEVDISLSPRVN+VKPSKTVAITDQATAL QAGVPVIRLA
Sbjct  47   RQVQSSRLDVIVRAGGTSEKMEVDISLSPRVNSVKPSKTVAITDQATALVQAGVPVIRLA  106

Query  482  AGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVS  661
            AGEPDFDTPA IAEAGINAIREG+TRYTPNAGT+E+R AICHKLKEENGL+YTPD+ILVS
Sbjct  107  AGEPDFDTPAVIAEAGINAIREGYTRYTPNAGTLEVRSAICHKLKEENGLSYTPDEILVS  166

Query  662  NGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            NGAKQSILQAVLAVCSPGDEV+IPAPFWVSYPE  ++
Sbjct  167  NGAKQSILQAVLAVCSPGDEVIIPAPFWVSYPEMARL  203



>gb|AII23743.1| prephenate aminotransferase [Antirrhinum majus]
Length=487

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  326  SSVNQVARVRCSMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDT  505
            S+V +  ++  +MEVD+SLSPRVN+VKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDT
Sbjct  66   SAVLKTEKIIDTMEVDLSLSPRVNSVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDT  125

Query  506  PAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSIL  685
            PA IAEAG+ AIREGHTRYTPNAGT+E+R AICHKLKEENG++YTPDQILVSNGAKQSI+
Sbjct  126  PAVIAEAGMKAIREGHTRYTPNAGTLELRTAICHKLKEENGISYTPDQILVSNGAKQSIV  185

Query  686  QAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            QAVLAVCSPGDEVLIPAPFWVSYPE  ++
Sbjct  186  QAVLAVCSPGDEVLIPAPFWVSYPEMARL  214



>ref|XP_006366482.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Solanum tuberosum]
Length=480

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 139/157 (89%), Gaps = 2/157 (1%)
 Frame = +2

Query  308  KRQTYPSSVNQV--ARVRCSMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLA  481
            KRQ Y      V  A+    +EVD+SLSPRVN+VKPSKTVAITDQATAL QAGVPVIRLA
Sbjct  51   KRQLYSRGTGSVVIAQNMDRVEVDLSLSPRVNSVKPSKTVAITDQATALVQAGVPVIRLA  110

Query  482  AGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVS  661
            AGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTME+R AICHKLKEENGL+YTPDQI+VS
Sbjct  111  AGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMELRLAICHKLKEENGLSYTPDQIVVS  170

Query  662  NGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            NGAKQS +QAVLAVCSPGDEVLIPAP+WVSYPE  ++
Sbjct  171  NGAKQSSVQAVLAVCSPGDEVLIPAPYWVSYPEMARM  207



>sp|E9L7A5.1|PAT_PETHY RecName: Full=Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase; Short=PhPPA-AT; 
Flags: Precursor [Petunia x hybrida]
 gb|ADM67557.1| prephenate aminotransferase [Petunia x hybrida]
Length=479

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 138/157 (88%), Gaps = 2/157 (1%)
 Frame = +2

Query  308  KRQTYPSSVNQVARVRC--SMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLA  481
            +RQ Y      V  ++    +EVDISLSPRVN+VKPSKTVAITDQATAL QAGVPVIRLA
Sbjct  50   RRQLYSRRTGAVVIMQSMDKVEVDISLSPRVNSVKPSKTVAITDQATALVQAGVPVIRLA  109

Query  482  AGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVS  661
            AGEPDFDTPAPI EAGINAIREGHTRYTPNAGTME+R AI HKLKEENGL+YTPDQILVS
Sbjct  110  AGEPDFDTPAPIVEAGINAIREGHTRYTPNAGTMELRSAISHKLKEENGLSYTPDQILVS  169

Query  662  NGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            NGAKQSI+QAVLAVCSPGDEVLIPAP+WVSYPE  ++
Sbjct  170  NGAKQSIIQAVLAVCSPGDEVLIPAPYWVSYPEMARL  206



>ref|XP_010090566.1| Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Morus notabilis]
 gb|EXB39772.1| Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Morus notabilis]
Length=478

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            +EVDISLSPRVN+VKPSKTVAITDQATALAQAG+PVIRLAAGEPDFDTPAPIAEAGINAI
Sbjct  69   VEVDISLSPRVNSVKPSKTVAITDQATALAQAGIPVIRLAAGEPDFDTPAPIAEAGINAI  128

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REGHTRYTPNAGT+E+R+AIC KLKEENG++YTPDQILVSNGAKQ ILQAVLAVCSPGDE
Sbjct  129  REGHTRYTPNAGTLEVREAICRKLKEENGISYTPDQILVSNGAKQGILQAVLAVCSPGDE  188

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAPFWVSYPE  ++
Sbjct  189  VIIPAPFWVSYPEIARL  205



>emb|CDP01418.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   261 bits (667),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 140/159 (88%), Gaps = 3/159 (2%)
 Frame = +2

Query  308  KRQTYPSSVNQVARVRCS---MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRL  478
            +R+   + +N V R + S   MEVDISLSPRVN+VKPSKTVAITDQATAL QAGVPVIRL
Sbjct  58   RRELDSNRLNAVVRAQSSLGTMEVDISLSPRVNSVKPSKTVAITDQATALVQAGVPVIRL  117

Query  479  AAGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILV  658
            AAGEPDFDTPA IAEAGINAIREG+TRYTPNAGT E+R AIC KLKEENGL+YTPDQILV
Sbjct  118  AAGEPDFDTPAVIAEAGINAIREGYTRYTPNAGTSELRSAICRKLKEENGLSYTPDQILV  177

Query  659  SNGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKVG  775
            SNGAKQSILQAV+AVCSPGDEVLIPAPFWVSYPE  ++ 
Sbjct  178  SNGAKQSILQAVIAVCSPGDEVLIPAPFWVSYPEMARLA  216



>gb|KJB79025.1| hypothetical protein B456_013G030300 [Gossypium raimondii]
Length=338

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            ++VDISLSPRVN+VKPSKTVAITD ATALAQAGVPVIRLAAGEPDFDTPA IAEAGINAI
Sbjct  70   VKVDISLSPRVNSVKPSKTVAITDHATALAQAGVPVIRLAAGEPDFDTPAIIAEAGINAI  129

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG+TRY+PNAGT+E+R AICHKLKEENG++YTPDQI+VSNGAKQSILQAVLAVCSPGDE
Sbjct  130  REGYTRYSPNAGTLELRTAICHKLKEENGISYTPDQIVVSNGAKQSILQAVLAVCSPGDE  189

Query  722  VLIPAPFWVSYPENGKVG  775
            V+IPAP+WVSYPE  ++ 
Sbjct  190  VIIPAPYWVSYPEMARLA  207



>gb|KDO47026.1| hypothetical protein CISIN_1g012095mg [Citrus sinensis]
Length=429

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 136/150 (91%), Gaps = 5/150 (3%)
 Frame = +2

Query  338  QVARVR-CS----MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFD  502
            +V RV  CS    ++VD+SLSPRVNAVKPSKTVAITDQATALAQAGV VIRLAAGEPDFD
Sbjct  49   RVLRVMACSGVEEVQVDVSLSPRVNAVKPSKTVAITDQATALAQAGVSVIRLAAGEPDFD  108

Query  503  TPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSI  682
            TP  IAEAGINAIREG TRYTPNAGT+E+R AICHKLKEENGL+YTPDQILVSNGAKQSI
Sbjct  109  TPVLIAEAGINAIREGFTRYTPNAGTLELRSAICHKLKEENGLSYTPDQILVSNGAKQSI  168

Query  683  LQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            LQAVLAVCSPGDEV+IPAPFWVSYPE  ++
Sbjct  169  LQAVLAVCSPGDEVIIPAPFWVSYPEMARI  198



>ref|XP_007048023.1| Aspartate aminotransferase isoform 4 [Theobroma cacao]
 gb|EOX92180.1| Aspartate aminotransferase isoform 4 [Theobroma cacao]
Length=401

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 143/159 (90%), Gaps = 6/159 (4%)
 Frame = +2

Query  308  KRQTYPSSVNQVARVRCS----MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIR  475
            ++Q+Y   ++ +++V  S    ++VDISLSPRVN+VKPSKTVAITD ATAL QAG+PVIR
Sbjct  51   RQQSY--RISAMSKVESSSFEQVKVDISLSPRVNSVKPSKTVAITDHATALVQAGIPVIR  108

Query  476  LAAGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQIL  655
            LAAGEPDFDTPA IAEAGINAIREG+TRYTPNAGT+E+R AICHKLKEENG++YTPDQIL
Sbjct  109  LAAGEPDFDTPAVIAEAGINAIREGYTRYTPNAGTLELRTAICHKLKEENGISYTPDQIL  168

Query  656  VSNGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            VSNGAKQSI+QAVLAVCSPGDEV+IPAP+WVSYPE  ++
Sbjct  169  VSNGAKQSIIQAVLAVCSPGDEVIIPAPYWVSYPEMARL  207



>ref|XP_007207431.1| hypothetical protein PRUPE_ppa005032mg [Prunus persica]
 gb|EMJ08630.1| hypothetical protein PRUPE_ppa005032mg [Prunus persica]
Length=480

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +2

Query  365  EVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIR  544
            EVDISLSPRVN+VKPSKTVAITDQATAL QAGVPVIRLAAGEPDFDTP+ IAEAGINAIR
Sbjct  77   EVDISLSPRVNSVKPSKTVAITDQATALVQAGVPVIRLAAGEPDFDTPSIIAEAGINAIR  136

Query  545  EGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEV  724
            EG+TRYTPNAGT+E+RQAICHKLKEENG++YTPDQI+VSNGAKQSI+QAVLAVCSPGDEV
Sbjct  137  EGYTRYTPNAGTLELRQAICHKLKEENGISYTPDQIVVSNGAKQSIVQAVLAVCSPGDEV  196

Query  725  LIPAPFWVSYPENGKV  772
            +IPAPFWVSYPE  ++
Sbjct  197  IIPAPFWVSYPEMARL  212



>ref|XP_006464262.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like isoform X2 [Citrus 
sinensis]
Length=470

 Score =   255 bits (652),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 139/162 (86%), Gaps = 8/162 (5%)
 Frame = +2

Query  311  RQTYPSSVNQVARVR----CS----MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVP  466
            R  +  ++N   RV     CS    ++VD+SLSPRVNAVKPSKTVAITDQATALAQAGV 
Sbjct  36   RYLHNFNLNNDGRVLRVMACSGVEEVQVDVSLSPRVNAVKPSKTVAITDQATALAQAGVS  95

Query  467  VIRLAAGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPD  646
            VIRLAAGEPDFDTP  IAEAGINAIREG TRYTPNAGT+E+R AICHKLKEENGL+YTPD
Sbjct  96   VIRLAAGEPDFDTPVLIAEAGINAIREGFTRYTPNAGTLELRSAICHKLKEENGLSYTPD  155

Query  647  QILVSNGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            QILVSNGAKQSILQAVLAVCSPGDEV+IPAPFWVSYPE  ++
Sbjct  156  QILVSNGAKQSILQAVLAVCSPGDEVIIPAPFWVSYPEMARI  197



>ref|XP_006464261.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like isoform X1 [Citrus 
sinensis]
Length=471

 Score =   255 bits (651),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            ++VD+SLSPRVNAVKPSKTVAITDQATALAQAGV VIRLAAGEPDFDTP  IAEAGINAI
Sbjct  62   VQVDVSLSPRVNAVKPSKTVAITDQATALAQAGVSVIRLAAGEPDFDTPVLIAEAGINAI  121

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG TRYTPNAGT+E+R AICHKLKEENGL+YTPDQILVSNGAKQSILQAVLAVCSPGDE
Sbjct  122  REGFTRYTPNAGTLELRSAICHKLKEENGLSYTPDQILVSNGAKQSILQAVLAVCSPGDE  181

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAPFWVSYPE  ++
Sbjct  182  VIIPAPFWVSYPEMARI  198



>ref|XP_003525066.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Glycine max]
Length=464

 Score =   255 bits (651),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +2

Query  323  PSSVNQVARVRCSMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFD  502
            P+++   A      +VD+SLSPRVNAVKPSKTVAI+D ATAL QAGVPVIRLAAGEPDFD
Sbjct  42   PNAIAVKASSHSDFDVDLSLSPRVNAVKPSKTVAISDHATALVQAGVPVIRLAAGEPDFD  101

Query  503  TPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSI  682
            TPAPIAEAGINAIREG+TRYTPNAGTME+RQAICHKLKEENG+TYTPDQ++VSNGAKQSI
Sbjct  102  TPAPIAEAGINAIREGYTRYTPNAGTMELRQAICHKLKEENGITYTPDQVVVSNGAKQSI  161

Query  683  LQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
             QAVLAV SPGDEV+IPAPFWVSYPE  ++
Sbjct  162  AQAVLAVSSPGDEVIIPAPFWVSYPEMARL  191



>gb|KDO47024.1| hypothetical protein CISIN_1g012095mg [Citrus sinensis]
Length=471

 Score =   255 bits (651),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            ++VD+SLSPRVNAVKPSKTVAITDQATALAQAGV VIRLAAGEPDFDTP  IAEAGINAI
Sbjct  62   VQVDVSLSPRVNAVKPSKTVAITDQATALAQAGVSVIRLAAGEPDFDTPVLIAEAGINAI  121

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG TRYTPNAGT+E+R AICHKLKEENGL+YTPDQILVSNGAKQSILQAVLAVCSPGDE
Sbjct  122  REGFTRYTPNAGTLELRSAICHKLKEENGLSYTPDQILVSNGAKQSILQAVLAVCSPGDE  181

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAPFWVSYPE  ++
Sbjct  182  VIIPAPFWVSYPEMARI  198



>ref|XP_003531365.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Glycine max]
Length=464

 Score =   254 bits (650),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 137/154 (89%), Gaps = 2/154 (1%)
 Frame = +2

Query  311  RQTYPSSVNQVARVRCSMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGE  490
            +Q+Y  +V   A      +VD+SLSPRVNAVKPSKTVAI+D ATAL QAGVPVIRLAAGE
Sbjct  40   KQSYAFAVK--ASSHSDFDVDLSLSPRVNAVKPSKTVAISDHATALFQAGVPVIRLAAGE  97

Query  491  PDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGA  670
            PDFDTPAPIAEAGINAIREG+TRYTPNAGTME+RQAIC KLKEENG++YTPDQ++VSNGA
Sbjct  98   PDFDTPAPIAEAGINAIREGYTRYTPNAGTMELRQAICRKLKEENGISYTPDQVVVSNGA  157

Query  671  KQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            KQSI QAVLAVCSPGDEV+IPAPFWVSYPE  ++
Sbjct  158  KQSIAQAVLAVCSPGDEVIIPAPFWVSYPEMARL  191



>gb|KDO47025.1| hypothetical protein CISIN_1g012095mg [Citrus sinensis]
Length=470

 Score =   255 bits (651),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            ++VD+SLSPRVNAVKPSKTVAITDQATALAQAGV VIRLAAGEPDFDTP  IAEAGINAI
Sbjct  61   VQVDVSLSPRVNAVKPSKTVAITDQATALAQAGVSVIRLAAGEPDFDTPVLIAEAGINAI  120

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG TRYTPNAGT+E+R AICHKLKEENGL+YTPDQILVSNGAKQSILQAVLAVCSPGDE
Sbjct  121  REGFTRYTPNAGTLELRSAICHKLKEENGLSYTPDQILVSNGAKQSILQAVLAVCSPGDE  180

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAPFWVSYPE  ++
Sbjct  181  VIIPAPFWVSYPEMARI  197



>gb|AET04530.2| aspartate aminotransferase [Medicago truncatula]
Length=475

 Score =   254 bits (650),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            +EVDISLSPRVNAVKPS+TVAITDQATAL QAGVPVIRLAAGEPDFDTPA IAEAG+NAI
Sbjct  66   LEVDISLSPRVNAVKPSRTVAITDQATALVQAGVPVIRLAAGEPDFDTPAVIAEAGVNAI  125

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
             EGHTRYTPNAGT+EIRQAICHKLKEENGL YTPDQI+V+NGAKQSI QAV+AVCSPGDE
Sbjct  126  CEGHTRYTPNAGTLEIRQAICHKLKEENGLDYTPDQIVVTNGAKQSITQAVIAVCSPGDE  185

Query  722  VLIPAPFWVSYPENGKVG  775
            V+IPAPFWVSYPE  ++ 
Sbjct  186  VIIPAPFWVSYPEMARLA  203



>ref|XP_008346990.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Malus domestica]
Length=484

 Score =   255 bits (651),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            +EVD+SLSPRVN+VKPSKTVAITDQATAL QAGVPVIRLAAGEPDFDTP+ +AEAGINAI
Sbjct  73   VEVDVSLSPRVNSVKPSKTVAITDQATALVQAGVPVIRLAAGEPDFDTPSIVAEAGINAI  132

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG TRYTPNAGT+E+RQAICHKLKEENG+TYTPDQI+VSNGAKQSI+QAVLAVCSPGDE
Sbjct  133  REGFTRYTPNAGTLELRQAICHKLKEENGITYTPDQIVVSNGAKQSIVQAVLAVCSPGDE  192

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAPFWVSYPE  ++
Sbjct  193  VMIPAPFWVSYPEMARM  209



>ref|XP_009378544.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Pyrus x bretschneideri]
Length=483

 Score =   255 bits (651),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            +EVD+SLSPRVN+VKPSKTVAITDQATAL QAGVPVIRLAAGEPDFDTP+ IAEAGINAI
Sbjct  72   VEVDVSLSPRVNSVKPSKTVAITDQATALVQAGVPVIRLAAGEPDFDTPSIIAEAGINAI  131

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG TRYTPNAGT+E+RQAICHKLKEENG+TYTPDQI+VSNGAKQSI+QAVLAVCSPGDE
Sbjct  132  REGFTRYTPNAGTLELRQAICHKLKEENGITYTPDQIVVSNGAKQSIVQAVLAVCSPGDE  191

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAPFWVSYPE  ++
Sbjct  192  VIIPAPFWVSYPEMARM  208



>ref|XP_008358516.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Malus domestica]
Length=484

 Score =   255 bits (651),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            +EVD+SLSPRVN+VKPSKTVAITDQATAL QAGVPVIRLAAGEPDFDTP+ IAEAGINAI
Sbjct  75   VEVDVSLSPRVNSVKPSKTVAITDQATALVQAGVPVIRLAAGEPDFDTPSVIAEAGINAI  134

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG TRYTPNAGT+E+RQAICHKLKEENG+TYTPDQI+VSNGAKQSI+QAVLAVCSPGDE
Sbjct  135  REGFTRYTPNAGTLELRQAICHKLKEENGITYTPDQIVVSNGAKQSIVQAVLAVCSPGDE  194

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAPFWVSYPE  ++
Sbjct  195  VIIPAPFWVSYPEMARM  211



>ref|XP_003630054.1| Aspartate aminotransferase [Medicago truncatula]
Length=486

 Score =   255 bits (651),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            +EVDISLSPRVNAVKPS+TVAITDQATAL QAGVPVIRLAAGEPDFDTPA IAEAG+NAI
Sbjct  66   LEVDISLSPRVNAVKPSRTVAITDQATALVQAGVPVIRLAAGEPDFDTPAVIAEAGVNAI  125

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
             EGHTRYTPNAGT+EIRQAICHKLKEENGL YTPDQI+V+NGAKQSI QAV+AVCSPGDE
Sbjct  126  CEGHTRYTPNAGTLEIRQAICHKLKEENGLDYTPDQIVVTNGAKQSITQAVIAVCSPGDE  185

Query  722  VLIPAPFWVSYPENGKVG  775
            V+IPAPFWVSYPE  ++ 
Sbjct  186  VIIPAPFWVSYPEMARLA  203



>gb|KHN29088.1| Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Glycine soja]
Length=470

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 137/154 (89%), Gaps = 2/154 (1%)
 Frame = +2

Query  311  RQTYPSSVNQVARVRCSMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGE  490
            +Q+Y  +V   A      +VD+SLSPRVNAVKPSKTVAI+D ATAL QAGVPVIRLAAGE
Sbjct  46   KQSYAFAVK--ASSHSDFDVDLSLSPRVNAVKPSKTVAISDHATALFQAGVPVIRLAAGE  103

Query  491  PDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGA  670
            PDFDTPAPIAEAGINAIREG+TRYTPNAGTME+RQAIC KLKEENG++YTPDQ++VSNGA
Sbjct  104  PDFDTPAPIAEAGINAIREGYTRYTPNAGTMELRQAICRKLKEENGISYTPDQVVVSNGA  163

Query  671  KQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            KQSI QAVLAVCSPGDEV+IPAPFWVSYPE  ++
Sbjct  164  KQSIAQAVLAVCSPGDEVIIPAPFWVSYPEMARL  197



>ref|XP_008233417.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Prunus mume]
Length=481

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/136 (87%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +2

Query  365  EVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIR  544
            EVDISLSPRVN++KPSKTVAITDQATAL QAGVPVIRLAAGEPDFDTP+ IAEAGINAIR
Sbjct  78   EVDISLSPRVNSLKPSKTVAITDQATALVQAGVPVIRLAAGEPDFDTPSVIAEAGINAIR  137

Query  545  EGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEV  724
            EGHTRYTPNAGT+E+R+AIC+KLKEENG++YTPDQI+VSNGAKQSI+QAVLAVCSPGDEV
Sbjct  138  EGHTRYTPNAGTLELREAICYKLKEENGISYTPDQIVVSNGAKQSIVQAVLAVCSPGDEV  197

Query  725  LIPAPFWVSYPENGKV  772
            +IPAPFWVSYPE  ++
Sbjct  198  IIPAPFWVSYPEMARL  213



>gb|AET06146.1| PLP-dependent aminotransferase [Papaver somniferum]
Length=476

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +2

Query  329  SVNQVARVRCSMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTP  508
            S+   A VR  M+VDISLSPRVN+VKPSKTVAITDQATAL QAGVPVIRLAAGEPDFDTP
Sbjct  56   SLRTSATVRAEMQVDISLSPRVNSVKPSKTVAITDQATALVQAGVPVIRLAAGEPDFDTP  115

Query  509  APIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQ  688
            A I EAGI AIREGHTRY+PNAGTME+R AICHKL+EENGLTYTPDQI+VSNGAKQ I Q
Sbjct  116  AVITEAGIKAIREGHTRYSPNAGTMELRTAICHKLQEENGLTYTPDQIVVSNGAKQCIAQ  175

Query  689  AVLAVCSPGDEVLIPAPFWVSYPE  760
            A++AVCSPGDEV+IPAPFWVSYPE
Sbjct  176  ALIAVCSPGDEVIIPAPFWVSYPE  199



>gb|KHN38197.1| Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Glycine soja]
Length=464

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +2

Query  323  PSSVNQVARVRCSMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFD  502
            P+++   A      + D+SLSPRVNAVKPSKTVAI+D ATAL QAGVPVIRLAAGEPDFD
Sbjct  42   PNAIAVKASSHSDFDFDLSLSPRVNAVKPSKTVAISDHATALVQAGVPVIRLAAGEPDFD  101

Query  503  TPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSI  682
            TPAPIAEAGINAIREG+TRYTPNAGTME+RQAICHKLKEENG+TYTPDQ++VSNGAKQSI
Sbjct  102  TPAPIAEAGINAIREGYTRYTPNAGTMELRQAICHKLKEENGITYTPDQVVVSNGAKQSI  161

Query  683  LQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
             QAVLAV SPGDEV+IPAPFWVSYPE  ++
Sbjct  162  AQAVLAVSSPGDEVIIPAPFWVSYPEMARL  191



>ref|XP_007048020.1| Aspartate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007048022.1| Aspartate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOX92177.1| Aspartate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOX92179.1| Aspartate aminotransferase isoform 1 [Theobroma cacao]
Length=480

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 143/159 (90%), Gaps = 6/159 (4%)
 Frame = +2

Query  308  KRQTYPSSVNQVARVRCS----MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIR  475
            ++Q+Y   ++ +++V  S    ++VDISLSPRVN+VKPSKTVAITD ATAL QAG+PVIR
Sbjct  51   RQQSY--RISAMSKVESSSFEQVKVDISLSPRVNSVKPSKTVAITDHATALVQAGIPVIR  108

Query  476  LAAGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQIL  655
            LAAGEPDFDTPA IAEAGINAIREG+TRYTPNAGT+E+R AICHKLKEENG++YTPDQIL
Sbjct  109  LAAGEPDFDTPAVIAEAGINAIREGYTRYTPNAGTLELRTAICHKLKEENGISYTPDQIL  168

Query  656  VSNGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            VSNGAKQSI+QAVLAVCSPGDEV+IPAP+WVSYPE  ++
Sbjct  169  VSNGAKQSIIQAVLAVCSPGDEVIIPAPYWVSYPEMARL  207



>ref|XP_009369904.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Pyrus x bretschneideri]
Length=485

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            +EVD+SLSPRVN+VKPSKTVAITDQATAL QAGVPVIRLAAGEPDFDTP+ IAEAGINAI
Sbjct  76   VEVDVSLSPRVNSVKPSKTVAITDQATALVQAGVPVIRLAAGEPDFDTPSVIAEAGINAI  135

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG TRYTPNAGT+E+RQAICHKLKEENG+TYTPDQILVSNGAKQSI+QAVLAVCSPGDE
Sbjct  136  REGFTRYTPNAGTLELRQAICHKLKEENGITYTPDQILVSNGAKQSIVQAVLAVCSPGDE  195

Query  722  VLIPAPFWVSYPE  760
            V+IPAPFWVSY E
Sbjct  196  VIIPAPFWVSYTE  208



>ref|XP_002307109.2| hypothetical protein POPTR_0005s08100g [Populus trichocarpa]
 gb|EEE94105.2| hypothetical protein POPTR_0005s08100g [Populus trichocarpa]
Length=480

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 136/157 (87%), Gaps = 3/157 (2%)
 Frame = +2

Query  311  RQTYPSSVNQVARVRC---SMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLA  481
            RQ+  S V+ V +       M+VDISLSPRV AVKPSKTVAITDQATALAQAGVPVIRLA
Sbjct  51   RQSQLSRVSVVVKAESRSEEMQVDISLSPRVTAVKPSKTVAITDQATALAQAGVPVIRLA  110

Query  482  AGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVS  661
            AGEPDFDTPA IAEAGINAIREGHTRYTPNAGT E+R AIC KLKEENG++Y PDQILVS
Sbjct  111  AGEPDFDTPAVIAEAGINAIREGHTRYTPNAGTQELRVAICQKLKEENGISYKPDQILVS  170

Query  662  NGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            NGAKQSI QA+LAVCSPGDEV+IPAPFWVSYPE  ++
Sbjct  171  NGAKQSIYQAILAVCSPGDEVIIPAPFWVSYPEMARL  207



>ref|XP_006428145.1| hypothetical protein CICLE_v10025279mg [Citrus clementina]
 gb|ESR41385.1| hypothetical protein CICLE_v10025279mg [Citrus clementina]
Length=566

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 139/162 (86%), Gaps = 8/162 (5%)
 Frame = +2

Query  311  RQTYPSSVNQVARVR----CS----MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVP  466
            R  +  ++N   RV     CS    ++VD+SLSPRVNAVKPSKTVAITDQATALAQAGV 
Sbjct  132  RYLHNFNLNNDGRVLRVMACSGVEEVQVDVSLSPRVNAVKPSKTVAITDQATALAQAGVS  191

Query  467  VIRLAAGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPD  646
            VIRLAAGEPDFDTP  IAEAGINAIREG TRYTPNAGT+E+R AICHKLKEENGL+YTPD
Sbjct  192  VIRLAAGEPDFDTPVLIAEAGINAIREGFTRYTPNAGTLELRSAICHKLKEENGLSYTPD  251

Query  647  QILVSNGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            QILVSNGAKQSILQAVLAVCSPGDEV+IPAPFWVSYPE  ++
Sbjct  252  QILVSNGAKQSILQAVLAVCSPGDEVIIPAPFWVSYPEMARI  293



>ref|XP_006428144.1| hypothetical protein CICLE_v10025279mg [Citrus clementina]
 gb|ESR41384.1| hypothetical protein CICLE_v10025279mg [Citrus clementina]
Length=567

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 136/150 (91%), Gaps = 5/150 (3%)
 Frame = +2

Query  338  QVARVR-CS----MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFD  502
            +V RV  CS    ++VD+SLSPRVNAVKPSKTVAITDQATALAQAGV VIRLAAGEPDFD
Sbjct  145  RVLRVMACSGVEEVQVDVSLSPRVNAVKPSKTVAITDQATALAQAGVSVIRLAAGEPDFD  204

Query  503  TPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSI  682
            TP  IAEAGINAIREG TRYTPNAGT+E+R AICHKLKEENGL+YTPDQILVSNGAKQSI
Sbjct  205  TPVLIAEAGINAIREGFTRYTPNAGTLELRSAICHKLKEENGLSYTPDQILVSNGAKQSI  264

Query  683  LQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            LQAVLAVCSPGDEV+IPAPFWVSYPE  ++
Sbjct  265  LQAVLAVCSPGDEVIIPAPFWVSYPEMARI  294



>ref|XP_007048021.1| Aspartate aminotransferase isoform 2 [Theobroma cacao]
 gb|EOX92178.1| Aspartate aminotransferase isoform 2 [Theobroma cacao]
Length=421

 Score =   251 bits (642),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            ++VDISLSPRVN+VKPSKTVAITD ATAL QAG+PVIRLAAGEPDFDTPA IAEAGINAI
Sbjct  12   VKVDISLSPRVNSVKPSKTVAITDHATALVQAGIPVIRLAAGEPDFDTPAVIAEAGINAI  71

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG+TRYTPNAGT+E+R AICHKLKEENG++YTPDQILVSNGAKQSI+QAVLAVCSPGDE
Sbjct  72   REGYTRYTPNAGTLELRTAICHKLKEENGISYTPDQILVSNGAKQSIIQAVLAVCSPGDE  131

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAP+WVSYPE  ++
Sbjct  132  VIIPAPYWVSYPEMARL  148



>ref|XP_004504047.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Cicer arietinum]
Length=482

 Score =   253 bits (646),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            +++DISLSPRVNAVKPS+TVAITDQATAL QAGVPVIRLAAGEPDFDTPA I EAGINAI
Sbjct  73   LDLDISLSPRVNAVKPSRTVAITDQATALVQAGVPVIRLAAGEPDFDTPAVIVEAGINAI  132

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REGHTRYTPNAGT+E+RQAICHKLKEENG+ YTPDQ+++SNGAKQSI QA++AVCSPGDE
Sbjct  133  REGHTRYTPNAGTLELRQAICHKLKEENGIDYTPDQVVISNGAKQSIAQAIIAVCSPGDE  192

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAPFWVSYPE  ++
Sbjct  193  VIIPAPFWVSYPEMARL  209



>gb|KJB79023.1| hypothetical protein B456_013G030300 [Gossypium raimondii]
 gb|KJB79027.1| hypothetical protein B456_013G030300 [Gossypium raimondii]
Length=421

 Score =   251 bits (641),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            ++VDISLSPRVN+VKPSKTVAITD ATALAQAGVPVIRLAAGEPDFDTPA IAEAGINAI
Sbjct  12   VKVDISLSPRVNSVKPSKTVAITDHATALAQAGVPVIRLAAGEPDFDTPAIIAEAGINAI  71

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG+TRY+PNAGT+E+R AICHKLKEENG++YTPDQI+VSNGAKQSILQAVLAVCSPGDE
Sbjct  72   REGYTRYSPNAGTLELRTAICHKLKEENGISYTPDQIVVSNGAKQSILQAVLAVCSPGDE  131

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAP+WVSYPE  ++
Sbjct  132  VIIPAPYWVSYPEMARL  148



>gb|KJB79022.1| hypothetical protein B456_013G030300 [Gossypium raimondii]
 gb|KJB79024.1| hypothetical protein B456_013G030300 [Gossypium raimondii]
Length=479

 Score =   253 bits (646),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            ++VDISLSPRVN+VKPSKTVAITD ATALAQAGVPVIRLAAGEPDFDTPA IAEAGINAI
Sbjct  70   VKVDISLSPRVNSVKPSKTVAITDHATALAQAGVPVIRLAAGEPDFDTPAIIAEAGINAI  129

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG+TRY+PNAGT+E+R AICHKLKEENG++YTPDQI+VSNGAKQSILQAVLAVCSPGDE
Sbjct  130  REGYTRYSPNAGTLELRTAICHKLKEENGISYTPDQIVVSNGAKQSILQAVLAVCSPGDE  189

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAP+WVSYPE  ++
Sbjct  190  VIIPAPYWVSYPEMARL  206



>ref|XP_004152277.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Cucumis sativus]
 gb|KGN52768.1| hypothetical protein Csa_4G000870 [Cucumis sativus]
Length=475

 Score =   252 bits (644),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            + VDISLSPRVN+VKPSKTVAI+DQATAL QAGVPVIRLAAGEPDFDTPAPI EAGINAI
Sbjct  66   VSVDISLSPRVNSVKPSKTVAISDQATALVQAGVPVIRLAAGEPDFDTPAPITEAGINAI  125

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            R+G+TRYT NAGT+E+RQAICHKLK+ENGL+YTPDQILVSNGAKQSILQAV+AVCSPGDE
Sbjct  126  RDGYTRYTANAGTLELRQAICHKLKDENGLSYTPDQILVSNGAKQSILQAVVAVCSPGDE  185

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAPFWVSYPE  ++
Sbjct  186  VIIPAPFWVSYPEMARL  202



>ref|XP_011008595.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Populus euphratica]
Length=481

 Score =   253 bits (645),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  326  SSVNQVARVRCSMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDT  505
            S V +  R    M++DISLSPRVNAVKPSKTVAITDQATAL QAGVPVIRLAAGEPDFDT
Sbjct  60   SVVVKAERRSEEMQLDISLSPRVNAVKPSKTVAITDQATALVQAGVPVIRLAAGEPDFDT  119

Query  506  PAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSIL  685
            P  IAEAGINAIREG TRYTPNAGT E+R AICHKLKEENG++YTPDQILVSNGAKQSI 
Sbjct  120  PVVIAEAGINAIREGFTRYTPNAGTQELRVAICHKLKEENGISYTPDQILVSNGAKQSIY  179

Query  686  QAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            QA+LAVCSPGDEV+IPAPFWVSYPE  ++
Sbjct  180  QAMLAVCSPGDEVIIPAPFWVSYPEMARL  208



>ref|XP_002310582.2| hypothetical protein POPTR_0007s05880g [Populus trichocarpa]
 gb|EEE91032.2| hypothetical protein POPTR_0007s05880g [Populus trichocarpa]
Length=481

 Score =   252 bits (644),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            M++DISLSPRVNAVKPSKTVAITDQATAL QAGVPVIRLAAGEPDFDTP  IAEAGINAI
Sbjct  72   MQLDISLSPRVNAVKPSKTVAITDQATALVQAGVPVIRLAAGEPDFDTPVVIAEAGINAI  131

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG TRYTPNAGT E+R AICHKLKEENG++YTPDQILVSNGAKQSI QA+LAVCSPGDE
Sbjct  132  REGFTRYTPNAGTQELRVAICHKLKEENGISYTPDQILVSNGAKQSIYQAMLAVCSPGDE  191

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAPFWVSYPE  ++
Sbjct  192  VIIPAPFWVSYPEMARL  208



>gb|KJB79026.1| hypothetical protein B456_013G030300 [Gossypium raimondii]
Length=482

 Score =   252 bits (644),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            ++VDISLSPRVN+VKPSKTVAITD ATALAQAGVPVIRLAAGEPDFDTPA IAEAGINAI
Sbjct  70   VKVDISLSPRVNSVKPSKTVAITDHATALAQAGVPVIRLAAGEPDFDTPAIIAEAGINAI  129

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG+TRY+PNAGT+E+R AICHKLKEENG++YTPDQI+VSNGAKQSILQAVLAVCSPGDE
Sbjct  130  REGYTRYSPNAGTLELRTAICHKLKEENGISYTPDQIVVSNGAKQSILQAVLAVCSPGDE  189

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAP+WVSYPE  ++
Sbjct  190  VIIPAPYWVSYPEMARL  206



>ref|XP_011039537.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Populus euphratica]
Length=480

 Score =   252 bits (644),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 136/157 (87%), Gaps = 3/157 (2%)
 Frame = +2

Query  311  RQTYPSSVNQVARVRC---SMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLA  481
            RQ+  S ++ V +       M+VDISLSPRV AVKPSKTVAITDQATALAQAGVPVIRLA
Sbjct  51   RQSQLSRISVVVKAESRSEEMQVDISLSPRVTAVKPSKTVAITDQATALAQAGVPVIRLA  110

Query  482  AGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVS  661
            AGEPDFDTPA IAEAGINAIREGHTRYTPNAGT E+R AIC KLKEENG++Y PDQ+LVS
Sbjct  111  AGEPDFDTPAVIAEAGINAIREGHTRYTPNAGTQELRVAICQKLKEENGISYKPDQVLVS  170

Query  662  NGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            NGAKQSI QA+LAVCSPGDEV+IPAPFWVSYPE  ++
Sbjct  171  NGAKQSIYQAILAVCSPGDEVIIPAPFWVSYPEMARL  207



>ref|XP_010269179.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Nelumbo nucifera]
Length=482

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  326  SSVNQVARVRCSMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDT  505
            S+V +   +  +M+VDISLSPRVN+VKPSKT+AITDQATALAQAGVPVIRLAAGEPDFDT
Sbjct  61   SAVVRAQSIFENMQVDISLSPRVNSVKPSKTMAITDQATALAQAGVPVIRLAAGEPDFDT  120

Query  506  PAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSIL  685
            PA IAEAGI AIREG+TRYTPNAGT+E+R AICHKLKEENGLTYTP+QILVSNGAKQ IL
Sbjct  121  PAVIAEAGIRAIREGYTRYTPNAGTLELRTAICHKLKEENGLTYTPEQILVSNGAKQCIL  180

Query  686  QAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            QAVLAVCSP DEV+IPAP+WVSYPE  ++
Sbjct  181  QAVLAVCSPDDEVIIPAPYWVSYPEMARL  209



>ref|XP_009369901.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Pyrus x bretschneideri]
Length=488

 Score =   251 bits (641),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            +EVD+SLSPRVN+VKPSKTVAITDQATAL QAGVPVIRLAAGEPDFDTP+ IAEAGINAI
Sbjct  79   VEVDVSLSPRVNSVKPSKTVAITDQATALVQAGVPVIRLAAGEPDFDTPSVIAEAGINAI  138

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG TRYTPNAGT+E+RQAICHKLKEENG+TYTPDQI+VSNGAKQS++QAVLAVCSPGDE
Sbjct  139  REGFTRYTPNAGTLELRQAICHKLKEENGITYTPDQIVVSNGAKQSVVQAVLAVCSPGDE  198

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAPF+VSYPE  ++
Sbjct  199  VIIPAPFYVSYPEMARM  215



>ref|XP_010695651.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Beta vulgaris subsp. 
vulgaris]
Length=474

 Score =   250 bits (639),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            +E+DI LSPRVN+VKPSKTVAITDQATAL QAGVPVIRLAAGEPDFDTP+ IAEAGINAI
Sbjct  65   VELDILLSPRVNSVKPSKTVAITDQATALVQAGVPVIRLAAGEPDFDTPSVIAEAGINAI  124

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
             EGHTRYTPNAGT+E+R AICHKLKEENG++Y+PDQILVSNGAKQSILQAVLAVCSPGDE
Sbjct  125  HEGHTRYTPNAGTLELRSAICHKLKEENGISYSPDQILVSNGAKQSILQAVLAVCSPGDE  184

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAP+WVSYPE  ++
Sbjct  185  VVIPAPYWVSYPEMARL  201



>ref|XP_010664298.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Vitis vinifera]
 emb|CBI19119.3| unnamed protein product [Vitis vinifera]
Length=478

 Score =   249 bits (636),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            +EVDISLSPRVN+VKPSKT+A+TD ATAL QAGVPVIRLAAGEPDFDTP  +AEAGINAI
Sbjct  69   VEVDISLSPRVNSVKPSKTIAVTDLATALVQAGVPVIRLAAGEPDFDTPTVVAEAGINAI  128

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG+TRYTPNAGT+E+R AICHKLKEENGLTYTPDQILVSNGAKQS+LQAVLAVCSPGDE
Sbjct  129  REGYTRYTPNAGTLELRTAICHKLKEENGLTYTPDQILVSNGAKQSVLQAVLAVCSPGDE  188

Query  722  VLIPAPFWVSYPENGKV  772
            V+IP PF+VSYPE  ++
Sbjct  189  VIIPGPFYVSYPEMARL  205



>gb|AFK38188.1| unknown [Medicago truncatula]
Length=475

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            +EV ISLSPRVNAVKPS+TVAITDQATAL QAGVPVIRLAAGEPDFDTPA IAEAG+NAI
Sbjct  66   LEVGISLSPRVNAVKPSRTVAITDQATALVQAGVPVIRLAAGEPDFDTPAVIAEAGVNAI  125

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
             EG+TRYTPNAGT+EIRQAICHKLKEENGL YTPDQI+V+NGAKQSI QAV+AVCSPGDE
Sbjct  126  CEGYTRYTPNAGTLEIRQAICHKLKEENGLDYTPDQIVVTNGAKQSITQAVIAVCSPGDE  185

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAPFWVSYPE  ++
Sbjct  186  VIIPAPFWVSYPEMARL  202



>ref|XP_008454394.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Cucumis melo]
Length=477

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            + VDISLSPRVN+VKPSKTVAI+DQATAL QAGVPVIRLAAGEPDFDTPAPI EAGINAI
Sbjct  68   VSVDISLSPRVNSVKPSKTVAISDQATALVQAGVPVIRLAAGEPDFDTPAPITEAGINAI  127

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            R+G+TRYT NAGT+E+RQAIC KLK+ENGL+YTPDQILVSNGAKQSILQAV+AVCSPGDE
Sbjct  128  RDGYTRYTANAGTLEVRQAICRKLKDENGLSYTPDQILVSNGAKQSILQAVVAVCSPGDE  187

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAPFWVSYPE  ++
Sbjct  188  VIIPAPFWVSYPEMARL  204



>gb|KJB44245.1| hypothetical protein B456_007G241800 [Gossypium raimondii]
Length=480

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            +++DISLSPRVN+VKPSKTVAITD ATALAQAGVPVIRLAAGEPDFDTPA IAEAGINAI
Sbjct  71   VKLDISLSPRVNSVKPSKTVAITDHATALAQAGVPVIRLAAGEPDFDTPAIIAEAGINAI  130

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG+TRYTPNAGT+E+R AICHKLKEENG++Y+ DQI+VSNGAKQSILQAVLAVCSPGDE
Sbjct  131  REGYTRYTPNAGTLELRTAICHKLKEENGISYSHDQIVVSNGAKQSILQAVLAVCSPGDE  190

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAP+WVSYPE  ++
Sbjct  191  VIIPAPYWVSYPEMARL  207



>ref|XP_002528972.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF33391.1| aspartate aminotransferase, putative [Ricinus communis]
Length=484

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            ME+DISLSPRVN++KPSKTVAI D AT+L +AG+PVIRLAAGEPDFDTP PIAEAGINAI
Sbjct  75   MELDISLSPRVNSLKPSKTVAIMDHATSLLEAGIPVIRLAAGEPDFDTPTPIAEAGINAI  134

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG+TRYTPNAGT+E+R AICHKLKEENGL+Y P++ILVSNGAKQSI+QAVLAVCSPGDE
Sbjct  135  REGYTRYTPNAGTLEVRTAICHKLKEENGLSYAPNEILVSNGAKQSIVQAVLAVCSPGDE  194

Query  722  VLIPAPFWVSYPENGKV  772
            VLIPAPFWVSYPE  ++
Sbjct  195  VLIPAPFWVSYPEIARL  211



>ref|XP_012093235.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Jatropha curcas]
 gb|KDP46883.1| hypothetical protein JCGZ_24092 [Jatropha curcas]
Length=485

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 136/157 (87%), Gaps = 3/157 (2%)
 Frame = +2

Query  311  RQTYPSSVNQVARVRCS---MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLA  481
            RQ + S ++ V +       ME+DISLSPRVN++KPSKTVAI D ATAL +AGVPVIRLA
Sbjct  56   RQVWSSRISAVTKPESGIEEMELDISLSPRVNSMKPSKTVAIMDHATALVEAGVPVIRLA  115

Query  482  AGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVS  661
            AGEPDFDTPA IAEAGINAIREG+TRYTPNAGT+E+R AICHKLKEENGL+Y P++ILVS
Sbjct  116  AGEPDFDTPAIIAEAGINAIREGYTRYTPNAGTLEVRTAICHKLKEENGLSYAPNEILVS  175

Query  662  NGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            NGAKQSI QAVLAVCSPGDEV+IPAPFWVSYPE  ++
Sbjct  176  NGAKQSITQAVLAVCSPGDEVIIPAPFWVSYPEIARL  212



>ref|XP_007159724.1| hypothetical protein PHAVU_002G262100g [Phaseolus vulgaris]
 gb|ESW31718.1| hypothetical protein PHAVU_002G262100g [Phaseolus vulgaris]
Length=463

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD S+SPRVNAVKPSKTVAI+D AT+L QAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE
Sbjct  56   VDPSISPRVNAVKPSKTVAISDLATSLVQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  115

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G+TRYTPNAGTME+RQAIC KLKEENG+TYTPDQ++VSNGAKQS+ QAVLAVCSPGDEV+
Sbjct  116  GYTRYTPNAGTMELRQAICRKLKEENGITYTPDQVVVSNGAKQSLAQAVLAVCSPGDEVI  175

Query  728  IPAPFWVSYPENGKV  772
            IPAPFWVSYPE  ++
Sbjct  176  IPAPFWVSYPEMARL  190



>ref|XP_004302193.2| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Fragaria vesca subsp. 
vesca]
Length=505

 Score =   245 bits (626),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  359  SMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINA  538
            +ME+DISLSPRVN++KPSKTVAITDQATAL QAGVPVIRLAAGEPDFDTPA IAEAGINA
Sbjct  95   AMELDISLSPRVNSIKPSKTVAITDQATALVQAGVPVIRLAAGEPDFDTPAVIAEAGINA  154

Query  539  IREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGD  718
            IREG+TRY+PNAGT+E+RQAIC KL+EENG++YTPDQ+LVSNGAKQSI QAV AVC+PGD
Sbjct  155  IREGYTRYSPNAGTLELRQAICRKLQEENGISYTPDQVLVSNGAKQSIDQAVQAVCAPGD  214

Query  719  EVLIPAPFWVSYPE  760
            EV+IPAPFWVSYPE
Sbjct  215  EVIIPAPFWVSYPE  228



>ref|XP_007163632.1| hypothetical protein PHAVU_001G250600g [Phaseolus vulgaris]
 gb|ESW35626.1| hypothetical protein PHAVU_001G250600g [Phaseolus vulgaris]
Length=469

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            +EVD+SLS RVNAVKPSKT+AI+D ATAL+QAGVPVIRLAAGEPDFDTPA IA+AG+NAI
Sbjct  63   IEVDVSLSHRVNAVKPSKTMAISDHATALSQAGVPVIRLAAGEPDFDTPAVIAQAGMNAI  122

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            R+G+TRYTPNAGT+E+RQAICHKLKEENG+TYTPD+I+VSNGAKQS++QAVLAVCSPGDE
Sbjct  123  RDGYTRYTPNAGTLELRQAICHKLKEENGITYTPDEIVVSNGAKQSVVQAVLAVCSPGDE  182

Query  722  VLIPAPFWVSYPENGKV  772
            V+IP PF+VSYPE  ++
Sbjct  183  VIIPGPFYVSYPEMARL  199



>gb|EYU31038.1| hypothetical protein MIMGU_mgv1a005497mg [Erythranthe guttata]
Length=481

 Score =   243 bits (620),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 138/157 (88%), Gaps = 3/157 (2%)
 Frame = +2

Query  311  RQTYPSSVNQVARVRC---SMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLA  481
            RQ +   V  V R      +MEVDISLSPRVN+VKPSKTVAITDQATAL QAGVPVIRLA
Sbjct  52   RQLHLQRVGAVVRAEVNSGAMEVDISLSPRVNSVKPSKTVAITDQATALVQAGVPVIRLA  111

Query  482  AGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVS  661
            AGEPDFDTPA IAEAG NAIREG+TRYTPNAGT+E+R AICHKLKEENG++YTPDQILVS
Sbjct  112  AGEPDFDTPAAIAEAGANAIREGYTRYTPNAGTLELRSAICHKLKEENGISYTPDQILVS  171

Query  662  NGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            NGAKQSI+QAVLAVCSPGDEV+IPAPFWVSYPE  ++
Sbjct  172  NGAKQSIVQAVLAVCSPGDEVIIPAPFWVSYPEMARL  208



>gb|KHN44325.1| Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Glycine soja]
Length=420

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = +2

Query  365  EVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIR  544
            +VDISLS RVNAVKPSKTVAI+D ATAL Q+GVPVIRLAAGEPDFDTPA IAEAG+NAIR
Sbjct  11   DVDISLSHRVNAVKPSKTVAISDHATALLQSGVPVIRLAAGEPDFDTPAVIAEAGMNAIR  70

Query  545  EGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEV  724
            EG+TRYTPNAGT+E+RQAICHKLKEEN +TYTPD+I+VSNGAKQS++QAVLAVCSPGDEV
Sbjct  71   EGYTRYTPNAGTLELRQAICHKLKEENEITYTPDEIVVSNGAKQSVVQAVLAVCSPGDEV  130

Query  725  LIPAPFWVSYPENGKV  772
            +IPAPF+ SYPE  ++
Sbjct  131  IIPAPFYTSYPEMARL  146



>gb|KCW54448.1| hypothetical protein EUGRSUZ_I00395 [Eucalyptus grandis]
Length=483

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            M++D++LSPRVN+VKPSKTVAITDQA ALA+AGVPVI LAAGEPDFDTPA IAEAGINAI
Sbjct  74   MDIDLTLSPRVNSVKPSKTVAITDQAAALARAGVPVIALAAGEPDFDTPAVIAEAGINAI  133

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG+TRYTPN GT+E+R AIC KLKEENG++YTPDQI+VSNGAKQSI QAVLAVCSPGDE
Sbjct  134  REGYTRYTPNTGTLELRTAICQKLKEENGISYTPDQIVVSNGAKQSIFQAVLAVCSPGDE  193

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAP+WVSYPE  ++
Sbjct  194  VIIPAPYWVSYPEIARL  210



>ref|XP_010027823.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Eucalyptus grandis]
 gb|KCW54450.1| hypothetical protein EUGRSUZ_I00395 [Eucalyptus grandis]
Length=483

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            M++D++LSPRVN+VKPSKTVAITDQA ALA+AGVPVI LAAGEPDFDTPA IAEAGINAI
Sbjct  74   MDIDLTLSPRVNSVKPSKTVAITDQAAALARAGVPVIALAAGEPDFDTPAVIAEAGINAI  133

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG+TRYTPN GT+E+R AIC KLKEENG++YTPDQI+VSNGAKQSI QAVLAVCSPGDE
Sbjct  134  REGYTRYTPNTGTLELRTAICQKLKEENGISYTPDQIVVSNGAKQSIFQAVLAVCSPGDE  193

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAP+WVSYPE  ++
Sbjct  194  VIIPAPYWVSYPEIARL  210



>gb|KCW54449.1| hypothetical protein EUGRSUZ_I00395 [Eucalyptus grandis]
Length=483

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            M++D++LSPRVN+VKPSKTVAITDQA ALA+AGVPVI LAAGEPDFDTPA IAEAGINAI
Sbjct  74   MDIDLTLSPRVNSVKPSKTVAITDQAAALARAGVPVIALAAGEPDFDTPAVIAEAGINAI  133

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG+T+YT NAGT+E+R AIC KLKEENG+ YTPDQ++VSNGAKQSILQAVLAVCSPGDE
Sbjct  134  REGYTKYTSNAGTLELRTAICQKLKEENGILYTPDQVVVSNGAKQSILQAVLAVCSPGDE  193

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAPFWVSYPE  ++
Sbjct  194  VIIPAPFWVSYPEIARL  210



>gb|KEH24289.1| aspartate aminotransferase [Medicago truncatula]
Length=473

 Score =   239 bits (610),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            +EVDISLSPRVNAVKPS+TVAITDQATAL QAGVPVI LAAGEPDFD+PA IA+AGINAI
Sbjct  64   LEVDISLSPRVNAVKPSRTVAITDQATALVQAGVPVILLAAGEPDFDSPAVIAQAGINAI  123

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
             EG TRYTPNAGT+E+RQAICHKLKEEN + YTPDQ++VSNGAKQSI QA+LAVCSPGDE
Sbjct  124  HEGQTRYTPNAGTLELRQAICHKLKEENEIAYTPDQVIVSNGAKQSIAQAMLAVCSPGDE  183

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAPF+VSYPE  ++
Sbjct  184  VIIPAPFYVSYPEMARM  200



>ref|XP_009402635.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Musa acuminata subsp. 
malaccensis]
Length=475

 Score =   239 bits (610),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD+S+SPRV+++KPSKT+AITDQATAL QAGVPVIRLAAGEPDFDTPA IAEAGINAIRE
Sbjct  68   VDLSVSPRVSSLKPSKTMAITDQATALVQAGVPVIRLAAGEPDFDTPAAIAEAGINAIRE  127

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G+TRYTPNAGT+E+R+AICHKL+ ENGL+YTPDQILVSNGAKQ  LQAV+AVCSPGDEVL
Sbjct  128  GYTRYTPNAGTLELRKAICHKLEVENGLSYTPDQILVSNGAKQCSLQAVVAVCSPGDEVL  187

Query  728  IPAPFWVSYPENGKV  772
            IPAP+WVSYPE  ++
Sbjct  188  IPAPYWVSYPEMARL  202



>ref|NP_001242772.1| uncharacterized protein LOC100780254 [Glycine max]
 gb|ACU20263.1| unknown [Glycine max]
Length=438

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = +2

Query  365  EVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIR  544
            +VDISLS RVNAVKPSKTVAI+D ATAL Q+GVPVIRLAAG+PDFDTPA IAEAG+NAIR
Sbjct  65   DVDISLSHRVNAVKPSKTVAISDHATALLQSGVPVIRLAAGDPDFDTPAVIAEAGMNAIR  124

Query  545  EGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEV  724
            EG+TRYTPNAGT+E+RQAICHKLKEEN +TYTPD+I+VSNGAKQS++QAVLAVCSPGDEV
Sbjct  125  EGYTRYTPNAGTLELRQAICHKLKEENEITYTPDEIVVSNGAKQSVVQAVLAVCSPGDEV  184

Query  725  LIPAPFWVSYPENGKV  772
            +IPAPF+ SYPE  ++
Sbjct  185  IIPAPFYTSYPEMARL  200



>ref|XP_010911890.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like isoform X2 [Elaeis 
guineensis]
Length=412

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD ++SPRV++V+PSKT+AITDQATAL Q+GVPVI LAAGEPDFDTPA IAEAGINAIRE
Sbjct  4    VDPTVSPRVSSVRPSKTMAITDQATALVQSGVPVIGLAAGEPDFDTPAAIAEAGINAIRE  63

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G+TRYTPNAGT+E+R+AICHKL+EENGL+YTPDQILVSNGAKQ I QAVLAVCSPGDEV+
Sbjct  64   GYTRYTPNAGTLELRKAICHKLQEENGLSYTPDQILVSNGAKQCINQAVLAVCSPGDEVI  123

Query  728  IPAPFWVSYPENGKV  772
            IPAP+WVSYPE  ++
Sbjct  124  IPAPYWVSYPEMARL  138



>ref|XP_006591408.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like isoform X2 [Glycine 
max]
Length=407

 Score =   233 bits (593),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  365  EVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIR  544
            +VDISLS RVNAVK SKT++I D ATAL QAGVPVIRL  GE DFDTP  IAEAG+NAIR
Sbjct  64   DVDISLSHRVNAVKLSKTLSICDHATALLQAGVPVIRLFFGESDFDTPGAIAEAGMNAIR  123

Query  545  EGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEV  724
            EG+TRYTPNAGT+E+RQAICHKLKEENG+TY+PDQI+VSNGAKQSI+QAVLAVCSPGDEV
Sbjct  124  EGYTRYTPNAGTLELRQAICHKLKEENGITYSPDQIVVSNGAKQSIVQAVLAVCSPGDEV  183

Query  725  LIPAPFWVSYPENGKV  772
            +IPAPF+VSYPE  ++
Sbjct  184  IIPAPFYVSYPEMARL  199



>ref|XP_010911889.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like isoform X1 [Elaeis 
guineensis]
Length=493

 Score =   234 bits (598),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 137/159 (86%), Gaps = 5/159 (3%)
 Frame = +2

Query  308  KRQTYPSSVNQVARVRCSME----VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIR  475
            +R+  PS V   AR   S +    VD ++SPRV++V+PSKT+AITDQATAL Q+GVPVI 
Sbjct  62   RRERVPS-VKASARSELSADPMAPVDPTVSPRVSSVRPSKTMAITDQATALVQSGVPVIG  120

Query  476  LAAGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQIL  655
            LAAGEPDFDTPA IAEAGINAIREG+TRYTPNAGT+E+R+AICHKL+EENGL+YTPDQIL
Sbjct  121  LAAGEPDFDTPAAIAEAGINAIREGYTRYTPNAGTLELRKAICHKLQEENGLSYTPDQIL  180

Query  656  VSNGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            VSNGAKQ I QAVLAVCSPGDEV+IPAP+WVSYPE  ++
Sbjct  181  VSNGAKQCINQAVLAVCSPGDEVIIPAPYWVSYPEMARL  219



>ref|XP_008783401.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Phoenix dactylifera]
Length=491

 Score =   234 bits (597),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD ++SPRV++VKPSKT+AITDQATAL Q+GVPVI LAAGEPDFDTPA I+EAGINAIR+
Sbjct  83   VDPTVSPRVSSVKPSKTMAITDQATALVQSGVPVIGLAAGEPDFDTPAAISEAGINAIRQ  142

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G+TRYTPNAGT+E+R+AICHK +EENGL+Y PDQILVSNGAKQSI+QAVLAVCSPGDEV+
Sbjct  143  GYTRYTPNAGTLELRKAICHKFQEENGLSYAPDQILVSNGAKQSIMQAVLAVCSPGDEVI  202

Query  728  IPAPFWVSYPENGKV  772
            IPAP+WVSYPE  ++
Sbjct  203  IPAPYWVSYPEMARL  217



>ref|XP_006826992.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Amborella trichopoda]
 gb|ERM94229.1| hypothetical protein AMTR_s00010p00210410 [Amborella trichopoda]
Length=470

 Score =   233 bits (595),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +2

Query  359  SMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINA  538
            SM+ D S+SPR N++KPSKT+AI+D ATAL Q GVPVIRLAAGEPDFDTP  IAEAGI A
Sbjct  60   SMDFDTSVSPRANSIKPSKTMAISDHATALVQKGVPVIRLAAGEPDFDTPTAIAEAGIRA  119

Query  539  IREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGD  718
            I++G+TRYTPNAGT+E+R AICHKLKEENGL+YTPDQILVSNGAKQ ILQ+VLAVCSP D
Sbjct  120  IQQGYTRYTPNAGTLELRTAICHKLKEENGLSYTPDQILVSNGAKQCILQSVLAVCSPSD  179

Query  719  EVLIPAPFWVSYPENGKV  772
            EV+IPAP+WVSYPE  ++
Sbjct  180  EVIIPAPYWVSYPEIARL  197



>ref|XP_003538514.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like isoform X1 [Glycine 
max]
Length=437

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  365  EVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIR  544
            +VDISLS RVNAVK SKT++I D ATAL QAGVPVIRL  GE DFDTP  IAEAG+NAIR
Sbjct  64   DVDISLSHRVNAVKLSKTLSICDHATALLQAGVPVIRLFFGESDFDTPGAIAEAGMNAIR  123

Query  545  EGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEV  724
            EG+TRYTPNAGT+E+RQAICHKLKEENG+TY+PDQI+VSNGAKQSI+QAVLAVCSPGDEV
Sbjct  124  EGYTRYTPNAGTLELRQAICHKLKEENGITYSPDQIVVSNGAKQSIVQAVLAVCSPGDEV  183

Query  725  LIPAPFWVSYPENGKV  772
            +IPAPF+VSYPE  ++
Sbjct  184  IIPAPFYVSYPEMARL  199



>gb|KHN44324.1| Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Glycine soja]
Length=472

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  365  EVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIR  544
            +VDISLS RVNAVK SKT++I D ATAL QAGVPVIRL  GE DFDTP  IAEAG+NAIR
Sbjct  64   DVDISLSHRVNAVKLSKTLSICDHATALLQAGVPVIRLFFGESDFDTPGAIAEAGMNAIR  123

Query  545  EGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEV  724
            EG+TRYTPNAGT+E+RQAICHKLKEENG+TY+PDQI+VSNGAKQSI+QAVLAVCSPGDEV
Sbjct  124  EGYTRYTPNAGTLELRQAICHKLKEENGITYSPDQIVVSNGAKQSIVQAVLAVCSPGDEV  183

Query  725  LIPAPFWVSYPENGKV  772
            +IPAPF+VSYPE  ++
Sbjct  184  IIPAPFYVSYPEMARL  199



>gb|EYU24011.1| hypothetical protein MIMGU_mgv1a006790mg [Erythranthe guttata]
Length=431

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (91%), Gaps = 1/138 (1%)
 Frame = +2

Query  362  MEVDISL-SPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINA  538
            MEVD+ L +PRVN+VK SK+VAITDQA AL QAGVPVIRL+AGEPDFDTP+ IAEAGINA
Sbjct  1    MEVDMKLINPRVNSVKLSKSVAITDQAAALTQAGVPVIRLSAGEPDFDTPSIIAEAGINA  60

Query  539  IREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGD  718
            IREG+TRYT NAGT+E+R AIC KLKEENG++Y  DQI+VSNGAKQSILQAVLAVCSPGD
Sbjct  61   IREGYTRYTNNAGTLELRTAICRKLKEENGISYATDQIVVSNGAKQSILQAVLAVCSPGD  120

Query  719  EVLIPAPFWVSYPENGKV  772
            EVLIPAPFWVSYPE  K+
Sbjct  121  EVLIPAPFWVSYPEIAKL  138



>ref|XP_007163631.1| hypothetical protein PHAVU_001G250500g [Phaseolus vulgaris]
 gb|ESW35625.1| hypothetical protein PHAVU_001G250500g [Phaseolus vulgaris]
Length=452

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VDISLS RV+AVKPSKT+AI D ATAL Q+GVPVIRL  GE DFDTPA IAEAG+NAIR+
Sbjct  51   VDISLSHRVDAVKPSKTLAICDHATALLQSGVPVIRLFFGESDFDTPAVIAEAGMNAIRD  110

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            GHTRYTPNAGT+E+RQAICHKLKEENG+ Y+PDQI+VSNGAKQSI+QAVLAVCSPGDEV+
Sbjct  111  GHTRYTPNAGTVELRQAICHKLKEENGIIYSPDQIVVSNGAKQSIVQAVLAVCSPGDEVI  170

Query  728  IPAPFWVSYPENGKV  772
            IPAPF+VSYPE  ++
Sbjct  171  IPAPFYVSYPEMARL  185



>gb|ABR17976.1| unknown [Picea sitchensis]
Length=491

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +2

Query  365  EVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIR  544
            ++DISLSPRV A+KPSKT+AITD ATAL QAG+PVI LAAGEPDFDTP  I EAGI AI+
Sbjct  79   QLDISLSPRVAALKPSKTMAITDHATALKQAGIPVIGLAAGEPDFDTPDAIVEAGIKAIQ  138

Query  545  EGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEV  724
            EG+TRYTPNAGTMEIR AICHKLKEENGL+YTPDQILVSNGAKQSI+QAVLAVCS GDEV
Sbjct  139  EGYTRYTPNAGTMEIRTAICHKLKEENGLSYTPDQILVSNGAKQSIMQAVLAVCSTGDEV  198

Query  725  LIPAPFWVSYPE  760
            +IPAPFWVSY E
Sbjct  199  IIPAPFWVSYAE  210



>ref|XP_010027824.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Eucalyptus grandis]
 ref|XP_010027825.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Eucalyptus grandis]
 ref|XP_010027826.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Eucalyptus grandis]
 ref|XP_010027827.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Eucalyptus grandis]
 gb|KCW54451.1| hypothetical protein EUGRSUZ_I00395 [Eucalyptus grandis]
Length=410

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            M+VD++LS RV+AVKP KT+AI DQAT L +AGVPVI LAAGEPDFDTP+ IAEAGINAI
Sbjct  1    MDVDLTLSSRVDAVKPCKTLAILDQATDLLKAGVPVIMLAAGEPDFDTPSVIAEAGINAI  60

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG+T+YT NAGT+E+R AIC KLKEENG+ YTPDQ++VSNGAKQSILQAVLAVCSPGDE
Sbjct  61   REGYTKYTSNAGTLELRTAICQKLKEENGILYTPDQVVVSNGAKQSILQAVLAVCSPGDE  120

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAPFWVSYPE  ++
Sbjct  121  VIIPAPFWVSYPEIARL  137



>gb|EPS71875.1| prephenate aminotransferase, partial [Genlisea aurea]
Length=495

 Score =   232 bits (591),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 127/150 (85%), Gaps = 17/150 (11%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            MEVDI+LSPRVN++KPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTP  IA+AG+NAI
Sbjct  72   MEVDITLSPRVNSMKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPPQIAQAGVNAI  131

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            +EG+TRYTPN+GT+E+R AI HKLKEENGL+YTPD+ILVSNGAKQSI+QAVLAVCS GDE
Sbjct  132  QEGYTRYTPNSGTLELRTAISHKLKEENGLSYTPDEILVSNGAKQSIVQAVLAVCSSGDE  191

Query  722  -----------------VLIPAPFWVSYPE  760
                             VLIP PFWVSYPE
Sbjct  192  ACLFFSFFLLDPLCFFSVLIPGPFWVSYPE  221



>gb|AFW81840.1| hypothetical protein ZEAMMB73_129784 [Zea mays]
Length=386

 Score =   229 bits (583),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD ++SPRVNA++PSKT+AITDQATAL QAGVPVI LAAGEPDFDTPA IAEAGINAIR+
Sbjct  54   VDTTISPRVNALRPSKTMAITDQATALRQAGVPVIGLAAGEPDFDTPAVIAEAGINAIRD  113

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G TRYTPNAGT+E+R+AIC KL+EENGL+Y+ DQ+LVSNGAKQ I QAVLAVCSPGDEVL
Sbjct  114  GATRYTPNAGTLELRKAICKKLEEENGLSYSADQVLVSNGAKQCITQAVLAVCSPGDEVL  173

Query  728  IPAPFWVSYPENGKV  772
            IPAP+WVSYPE  ++
Sbjct  174  IPAPYWVSYPEMARL  188



>ref|XP_002441156.1| hypothetical protein SORBIDRAFT_09g021360 [Sorghum bicolor]
 gb|EES19586.1| hypothetical protein SORBIDRAFT_09g021360 [Sorghum bicolor]
Length=462

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD ++SPRV+A++PSKT+AITDQATAL QAGVPVI LAAGEPDFDTPA IAEAG+NAIR+
Sbjct  55   VDTTISPRVSALRPSKTMAITDQATALRQAGVPVIGLAAGEPDFDTPAVIAEAGMNAIRD  114

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G TRYTPNAGT+E+R+AIC KL+EENGL+YTPDQ+LVSNGAKQ I QAVLAVCSPGDEVL
Sbjct  115  GATRYTPNAGTLELRKAICKKLEEENGLSYTPDQVLVSNGAKQCITQAVLAVCSPGDEVL  174

Query  728  IPAPFWVSYPENGKV  772
            IPAP+WVSYPE  ++
Sbjct  175  IPAPYWVSYPEMARL  189



>ref|NP_001142303.1| uncharacterized protein LOC100274472 [Zea mays]
 gb|ACF88138.1| unknown [Zea mays]
 gb|ACR38533.1| unknown [Zea mays]
 gb|AFW81838.1| aspartate aminotransferase [Zea mays]
Length=461

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD ++SPRVNA++PSKT+AITDQATAL QAGVPVI LAAGEPDFDTPA IAEAGINAIR+
Sbjct  54   VDTTISPRVNALRPSKTMAITDQATALRQAGVPVIGLAAGEPDFDTPAVIAEAGINAIRD  113

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G TRYTPNAGT+E+R+AIC KL+EENGL+Y+ DQ+LVSNGAKQ I QAVLAVCSPGDEVL
Sbjct  114  GATRYTPNAGTLELRKAICKKLEEENGLSYSADQVLVSNGAKQCITQAVLAVCSPGDEVL  173

Query  728  IPAPFWVSYPENGKV  772
            IPAP+WVSYPE  ++
Sbjct  174  IPAPYWVSYPEMARL  188



>ref|XP_004961976.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Setaria italica]
Length=460

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 129/148 (87%), Gaps = 3/148 (2%)
 Frame = +2

Query  338  QVARVRCSME---VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTP  508
            Q  R R ++    VD ++SPRV+A++PSKT+AITDQATAL QAGVPVI LAAGEPDFDTP
Sbjct  40   QKCRARMAVRAEAVDTTISPRVSALRPSKTMAITDQATALRQAGVPVIGLAAGEPDFDTP  99

Query  509  APIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQ  688
            A IAEAG+NAIR+G TRYTPNAGT+E+R AIC KL+EENGL+YTPDQ+LVSNGAKQ I Q
Sbjct  100  AVIAEAGMNAIRDGATRYTPNAGTLELRNAICKKLQEENGLSYTPDQVLVSNGAKQCITQ  159

Query  689  AVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            AVLAVCSPGDEVLIPAP+WVSYPE  ++
Sbjct  160  AVLAVCSPGDEVLIPAPYWVSYPEMARL  187



>gb|AFW81839.1| hypothetical protein ZEAMMB73_129784 [Zea mays]
Length=452

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD ++SPRVNA++PSKT+AITDQATAL QAGVPVI LAAGEPDFDTPA IAEAGINAIR+
Sbjct  54   VDTTISPRVNALRPSKTMAITDQATALRQAGVPVIGLAAGEPDFDTPAVIAEAGINAIRD  113

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G TRYTPNAGT+E+R+AIC KL+EENGL+Y+ DQ+LVSNGAKQ I QAVLAVCSPGDEVL
Sbjct  114  GATRYTPNAGTLELRKAICKKLEEENGLSYSADQVLVSNGAKQCITQAVLAVCSPGDEVL  173

Query  728  IPAPFWVSYPENGKV  772
            IPAP+WVSYPE  ++
Sbjct  174  IPAPYWVSYPEMARL  188



>ref|XP_010030428.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Eucalyptus grandis]
Length=463

 Score =   229 bits (583),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            M++D++LSPRVNAVKPSKT+AI  QATAL +AGVPVI LA GEPDFDTP+ IA+AG NAI
Sbjct  74   MDIDLTLSPRVNAVKPSKTLAIIAQATALLKAGVPVISLAIGEPDFDTPSVIADAGFNAI  133

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG+TRYTPNAGT+E+R AIC +LKEENG++YTPDQILVSNGAKQSI QAVL VCSPGDE
Sbjct  134  REGYTRYTPNAGTLELRTAICQRLKEENGISYTPDQILVSNGAKQSIFQAVLVVCSPGDE  193

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAP WVSYPE  ++
Sbjct  194  VIIPAPCWVSYPEMARL  210



>gb|KCW54453.1| hypothetical protein EUGRSUZ_I00398 [Eucalyptus grandis]
Length=446

 Score =   228 bits (581),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            M++D++LSPRVNAVKPSKT+AI DQATAL +AGVPVI LA GEPDFDTP+ IA+AG NAI
Sbjct  74   MDIDLTLSPRVNAVKPSKTLAIIDQATALLKAGVPVISLAIGEPDFDTPSVIADAGFNAI  133

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG+TRYTPNAGT+E+R AIC +LKEENG++YTPD ILVSNGAKQ+I QAVL VCSPGDE
Sbjct  134  REGYTRYTPNAGTLELRTAICQRLKEENGISYTPDLILVSNGAKQNIFQAVLVVCSPGDE  193

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAP WVSYPE  ++
Sbjct  194  VIIPAPCWVSYPEMARL  210



>gb|ACG37512.1| aspartate aminotransferase [Zea mays]
Length=461

 Score =   228 bits (582),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD ++SPRVNA++PSKT+AITDQATAL QAG+PVI LAAGEPDFDTPA IAEAGINAIR+
Sbjct  54   VDTTISPRVNALRPSKTMAITDQATALRQAGMPVIGLAAGEPDFDTPAVIAEAGINAIRD  113

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G TRYTPNAGT+E+R+AIC KL+EENGL+Y+ DQ+LVSNGAKQ I QAVLAVCSPGDEVL
Sbjct  114  GATRYTPNAGTLELRKAICKKLEEENGLSYSADQVLVSNGAKQCITQAVLAVCSPGDEVL  173

Query  728  IPAPFWVSYPENGKV  772
            IPAP+WVSYPE  ++
Sbjct  174  IPAPYWVSYPEMARL  188



>ref|XP_003564718.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Brachypodium 
distachyon]
Length=459

 Score =   228 bits (581),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD S+SP V+A++PSKT+AITDQATAL QAGVPVI LAAGEPDFDTPA IAEAG+NAIR+
Sbjct  52   VDASISPTVSALRPSKTMAITDQATALRQAGVPVIGLAAGEPDFDTPASIAEAGMNAIRD  111

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G+TRYTPNAGT+E+R+AIC+KL+EENG++Y+PDQ+LVSNGAKQ I QAVLAVCSPGDEVL
Sbjct  112  GYTRYTPNAGTLELRKAICNKLQEENGISYSPDQVLVSNGAKQCITQAVLAVCSPGDEVL  171

Query  728  IPAPFWVSYPE  760
            IPAP+WVSYPE
Sbjct  172  IPAPYWVSYPE  182



>ref|XP_003568386.2| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Brachypodium 
distachyon]
Length=514

 Score =   229 bits (585),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD S+SPRV+A++PSKT+AITDQA+AL QAGVPVI LAAGEPDFDTPA I+EAG+NA+++
Sbjct  57   VDTSISPRVSALRPSKTMAITDQASALRQAGVPVIGLAAGEPDFDTPAAISEAGMNAVKD  116

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G TRYTPNAGTME+R+AIC+KL+E+NGL+Y+PDQ+LVSNGAKQ I QAVLAVCSPGDEVL
Sbjct  117  GFTRYTPNAGTMELRKAICNKLQEDNGLSYSPDQVLVSNGAKQCITQAVLAVCSPGDEVL  176

Query  728  IPAPFWVSYPENGKV  772
            IPAPFWVSYPE  ++
Sbjct  177  IPAPFWVSYPEMARL  191



>ref|XP_010555356.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Tarenaya hassleriana]
Length=484

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  365  EVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIR  544
            E+D+SLSPRV+++KPSKT+AI+DQA  L QAGVPVI LAAGEPDFDTPA I+EAGI AIR
Sbjct  74   ELDVSLSPRVDSLKPSKTMAISDQAATLVQAGVPVIPLAAGEPDFDTPAVISEAGITAIR  133

Query  545  EGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEV  724
            EGHTRYT NAGT E+R+AIC KLKEENGL+Y P+QILVSNGAKQSI+QAVLAVCSPGDEV
Sbjct  134  EGHTRYTLNAGTTELREAICRKLKEENGLSYAPNQILVSNGAKQSIIQAVLAVCSPGDEV  193

Query  725  LIPAPFWVSYPENGKV  772
            +IPAP+WVSYPE  ++
Sbjct  194  IIPAPYWVSYPEMARL  209



>ref|XP_006646517.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Oryza brachyantha]
Length=459

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD ++SP V+A++PSKT+AITDQATAL QAGVPVI LAAGEPDFDTPA IAEAG+NAI++
Sbjct  52   VDATISPTVSALRPSKTMAITDQATALKQAGVPVIGLAAGEPDFDTPAVIAEAGMNAIKD  111

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G+TRYTPNAGT+E+R+AIC+KL+EENG++YTPDQ+LVSNGAKQ I QAVLAVCSPGDEVL
Sbjct  112  GYTRYTPNAGTLELRKAICNKLQEENGISYTPDQVLVSNGAKQCITQAVLAVCSPGDEVL  171

Query  728  IPAPFWVSYPE  760
            IPAP+WVSYPE
Sbjct  172  IPAPYWVSYPE  182



>ref|XP_009140341.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Brassica rapa]
Length=466

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = +2

Query  326  SSVNQVARVRCSMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDT  505
            S ++ +A+   ++ VD SLSPRV A+KPSKT+ ITD A+ L Q+GVPVIRLAAGEPDFDT
Sbjct  45   SRISAMAKPNDALSVDTSLSPRVKALKPSKTMVITDLASTLVQSGVPVIRLAAGEPDFDT  104

Query  506  PAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSIL  685
            P  +AEAG+NAIR+G TRYT NAG  E+R+AICHKLKEENGL+Y PDQILVSNGAKQS+L
Sbjct  105  PQIVAEAGMNAIRDGFTRYTLNAGITELREAICHKLKEENGLSYAPDQILVSNGAKQSLL  164

Query  686  QAVLAVCSPGDEVLIPAPFWVSYPENGKVG  775
            QAVLAVCSPGDEV+IPAP+WVSY E  ++ 
Sbjct  165  QAVLAVCSPGDEVIIPAPYWVSYTEQARLA  194



>ref|XP_001763787.1| predicted protein [Physcomitrella patens]
 gb|EDQ71429.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD ++SPRV A+KPSKT+AI D ATAL ++GVPVIRLAAGEPDFDTP  I EAG  AI+E
Sbjct  17   VDTTISPRVAALKPSKTMAIADAATALVESGVPVIRLAAGEPDFDTPKAIVEAGTKAIQE  76

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G TRYTPNAGT+E+R+AICHKL+EENGL+Y PD+ILVSNGAKQSI+QAVLAVCSPGDEV+
Sbjct  77   GFTRYTPNAGTLELRKAICHKLQEENGLSYKPDEILVSNGAKQSIMQAVLAVCSPGDEVI  136

Query  728  IPAPFWVSYPENGKV  772
            +PAPFWVSYPE  ++
Sbjct  137  VPAPFWVSYPEMARL  151



>ref|NP_850022.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEC07283.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=428

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = +2

Query  359  SMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINA  538
            S  VD+SLSPRV ++KPSKT+ ITD A  L Q+GVPVIRLAAGEPDFDTP  +AEAGINA
Sbjct  18   SSSVDMSLSPRVQSLKPSKTMVITDLAATLVQSGVPVIRLAAGEPDFDTPKVVAEAGINA  77

Query  539  IREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGD  718
            IREG TRYT NAG  E+R+AIC KLKEENGL+Y PDQILVSNGAKQS+LQAVLAVCSPGD
Sbjct  78   IREGFTRYTLNAGITELREAICRKLKEENGLSYAPDQILVSNGAKQSLLQAVLAVCSPGD  137

Query  719  EVLIPAPFWVSYPENGKV  772
            EV+IPAP+WVSY E  ++
Sbjct  138  EVIIPAPYWVSYTEQARL  155



>gb|AAM61164.1| putative aspartate aminotransferase [Arabidopsis thaliana]
Length=475

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 128/163 (79%), Gaps = 12/163 (7%)
 Frame = +2

Query  317  TYPSSVNQVARVRCSM-----------EVDISLSPRVNAVKPSKTVAITDQATALAQAGV  463
            +Y  S N  +R+ C+M            VD+SLSPRV ++KPSKT+ ITD A  L Q+GV
Sbjct  41   SYCKSGNMSSRI-CAMAKPNDAETLSSSVDMSLSPRVQSLKPSKTMVITDLAATLVQSGV  99

Query  464  PVIRLAAGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTP  643
            PVIRLAAGEPDFDTP  +AEAGINAIREG TRYT NAG  E+R+AIC KLKEENGL+Y P
Sbjct  100  PVIRLAAGEPDFDTPKVVAEAGINAIREGFTRYTLNAGITELREAICRKLKEENGLSYAP  159

Query  644  DQILVSNGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            DQILVSNGAKQS+LQAVLAVCSPGDEV+IPAP+WVSY E  ++
Sbjct  160  DQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARL  202



>ref|NP_565529.1| aspartate aminotransferase [Arabidopsis thaliana]
 ref|NP_001031394.1| aspartate aminotransferase [Arabidopsis thaliana]
 sp|Q9SIE1.2|PAT_ARATH RecName: Full=Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase; Short=AtAAT; Short=AtPPA-AT; 
AltName: Full=Protein MATERNAL EFFECT EMBRYO 
ARREST 17; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL36058.1| At2g22250/T26C19.9 [Arabidopsis thaliana]
 gb|AAD23617.2| putative aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAM70520.1| At2g22250/T26C19.9 [Arabidopsis thaliana]
 gb|ADM67558.1| prephenate aminotransferase [Arabidopsis thaliana]
 gb|AEC07284.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEC07285.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=475

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 128/163 (79%), Gaps = 12/163 (7%)
 Frame = +2

Query  317  TYPSSVNQVARVRCSM-----------EVDISLSPRVNAVKPSKTVAITDQATALAQAGV  463
            +Y  S N  +R+ C+M            VD+SLSPRV ++KPSKT+ ITD A  L Q+GV
Sbjct  41   SYCKSGNMSSRI-CAMAKPNDAETLSSSVDMSLSPRVQSLKPSKTMVITDLAATLVQSGV  99

Query  464  PVIRLAAGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTP  643
            PVIRLAAGEPDFDTP  +AEAGINAIREG TRYT NAG  E+R+AIC KLKEENGL+Y P
Sbjct  100  PVIRLAAGEPDFDTPKVVAEAGINAIREGFTRYTLNAGITELREAICRKLKEENGLSYAP  159

Query  644  DQILVSNGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            DQILVSNGAKQS+LQAVLAVCSPGDEV+IPAP+WVSY E  ++
Sbjct  160  DQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARL  202



>ref|XP_006294125.1| hypothetical protein CARUB_v10023120mg [Capsella rubella]
 gb|EOA27023.1| hypothetical protein CARUB_v10023120mg [Capsella rubella]
Length=476

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 130/163 (80%), Gaps = 12/163 (7%)
 Frame = +2

Query  317  TYPSSVNQVARVRCSM-----------EVDISLSPRVNAVKPSKTVAITDQATALAQAGV  463
            +Y  S N  +R+ C+M            VD+SLSPRV ++KPSKT+AITD A  L Q+GV
Sbjct  42   SYGKSGNMSSRI-CAMAKPNDAEALPSSVDMSLSPRVQSLKPSKTMAITDLAATLVQSGV  100

Query  464  PVIRLAAGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTP  643
            P+IRLAAGEPDFDTP  +AEAG+NAIREG TRY+ NAGT E+R+AIC KLKEENGL+Y P
Sbjct  101  PIIRLAAGEPDFDTPKIVAEAGVNAIREGFTRYSLNAGTTELREAICRKLKEENGLSYAP  160

Query  644  DQILVSNGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            +QILVSNGAKQSILQAVLAVCSPGDEV+IPAP+WVSY E  ++
Sbjct  161  NQILVSNGAKQSILQAVLAVCSPGDEVIIPAPYWVSYTEQARL  203



>sp|Q5F4K8.1|PAT_PINPS RecName: Full=Aspartate aminotransferase; Short=PpAAT; Flags: 
Precursor [Pinus pinaster]
 emb|CAF31327.1| aspartate aminotransferase [Pinus pinaster]
Length=492

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +2

Query  365  EVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIR  544
            ++DISLSPRV A+KPSKT+AITD ATAL QAGVPVI LAAGEPDF+TP  +AEAGI AI+
Sbjct  79   QLDISLSPRVAALKPSKTMAITDLATALKQAGVPVIGLAAGEPDFNTPDAVAEAGIKAIQ  138

Query  545  EGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSIL-QAVLAVCSPGDE  721
            +G+TRYTPNAGTMEIR AICHKLKEENGL+YTPDQILVSNGAKQ I+  AVLAVCSPGDE
Sbjct  139  DGYTRYTPNAGTMEIRTAICHKLKEENGLSYTPDQILVSNGAKQCIMAAAVLAVCSPGDE  198

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAPFWVSY E  ++
Sbjct  199  VIIPAPFWVSYTEMARL  215



>ref|XP_008809315.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like isoform X2 [Phoenix 
dactylifera]
Length=469

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  359  SMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINA  538
            +M VD  +SPR N++KPSKT+ I DQATAL ++GVP+I+LAAGEPDFDTP  ++EAGINA
Sbjct  59   AMAVDTLVSPRANSLKPSKTMVIADQATALKESGVPIIKLAAGEPDFDTPKVVSEAGINA  118

Query  539  IREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGD  718
            IREG+TRYTPNAGT+E+R+AICHKL+ ENGL+YTPDQILVSNG+KQS LQAVLAVCSPGD
Sbjct  119  IREGYTRYTPNAGTLELRKAICHKLEAENGLSYTPDQILVSNGSKQSALQAVLAVCSPGD  178

Query  719  EVLIPAPFWVSYPENGKV  772
            EV++PAP++VSYPE  ++
Sbjct  179  EVIVPAPYYVSYPEMARL  196



>ref|NP_001044936.1| Os01g0871300 [Oryza sativa Japonica Group]
 dbj|BAD81719.1| putative aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF06850.1| Os01g0871300 [Oryza sativa Japonica Group]
 gb|EAY76646.1| hypothetical protein OsI_04601 [Oryza sativa Indica Group]
 gb|EAZ14314.1| hypothetical protein OsJ_04240 [Oryza sativa Japonica Group]
 dbj|BAG86884.1| unnamed protein product [Oryza sativa Japonica Group]
Length=458

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 126/144 (88%), Gaps = 8/144 (6%)
 Frame = +2

Query  353  RCSME--------VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTP  508
            RC M         VD ++SP V+A++PSKT+AITDQATAL QAGVPVI LAAGEPDFDTP
Sbjct  37   RCRMASVVVRAEAVDATISPTVSALRPSKTMAITDQATALRQAGVPVIGLAAGEPDFDTP  96

Query  509  APIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQ  688
              IAEAG+NAI++G+TRYTPNAGT+E+R+AIC+KL+EENG++Y+PDQ+LVSNGAKQ I Q
Sbjct  97   HVIAEAGMNAIKDGYTRYTPNAGTLELRKAICNKLQEENGISYSPDQVLVSNGAKQCITQ  156

Query  689  AVLAVCSPGDEVLIPAPFWVSYPE  760
            AVLAVCSPGDEVLIPAP+WVSYPE
Sbjct  157  AVLAVCSPGDEVLIPAPYWVSYPE  180



>ref|XP_010905916.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Elaeis guineensis]
Length=474

 Score =   224 bits (571),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +2

Query  359  SMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINA  538
            +M VD S+SPR N++KPSKT+ I D+ATAL ++GVP+I+LAAGEPDFDTP  + EAGINA
Sbjct  64   AMAVDTSVSPRANSLKPSKTMVIADRATALKESGVPIIKLAAGEPDFDTPKVVFEAGINA  123

Query  539  IREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGD  718
            IR+G+TRYTPNAG +E+R+AICHKLKEENGL+Y PDQILVSNGAKQS LQAVLAVCSPGD
Sbjct  124  IRKGYTRYTPNAGNLELRKAICHKLKEENGLSYNPDQILVSNGAKQSALQAVLAVCSPGD  183

Query  719  EVLIPAPFWVSYPENGKV  772
            EV++PAP++VSYPE  ++
Sbjct  184  EVIVPAPYYVSYPEMARL  201



>ref|XP_010429140.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Camelina sativa]
 ref|XP_010429141.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Camelina sativa]
Length=438

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD+SLSPRV ++KPSKT+A+TD A  LAQ+GVP+IRLAAGEPDFDTP  +AEAGINAIRE
Sbjct  31   VDMSLSPRVQSLKPSKTMAVTDLAATLAQSGVPIIRLAAGEPDFDTPKVVAEAGINAIRE  90

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G TRY+ N G  E+R+AIC KLKEENGL+Y PDQILVSNGAKQSI QAVLAVCSPGDEV+
Sbjct  91   GFTRYSLNTGITELREAICRKLKEENGLSYAPDQILVSNGAKQSIFQAVLAVCSPGDEVI  150

Query  728  IPAPFWVSYPENGKV  772
            IPAP+WVSY E  ++
Sbjct  151  IPAPYWVSYTEQARL  165



>ref|XP_008809314.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like isoform X1 [Phoenix 
dactylifera]
Length=474

 Score =   224 bits (570),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  359  SMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINA  538
            +M VD  +SPR N++KPSKT+ I DQATAL ++GVP+I+LAAGEPDFDTP  ++EAGINA
Sbjct  64   AMAVDTLVSPRANSLKPSKTMVIADQATALKESGVPIIKLAAGEPDFDTPKVVSEAGINA  123

Query  539  IREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGD  718
            IREG+TRYTPNAGT+E+R+AICHKL+ ENGL+YTPDQILVSNG+KQS LQAVLAVCSPGD
Sbjct  124  IREGYTRYTPNAGTLELRKAICHKLEAENGLSYTPDQILVSNGSKQSALQAVLAVCSPGD  183

Query  719  EVLIPAPFWVSYPENGKV  772
            EV++PAP++VSYPE  ++
Sbjct  184  EVIVPAPYYVSYPEMARL  201



>ref|XP_010472217.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Camelina sativa]
Length=482

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD+SLSPRV ++KPSKT+AITD A  L Q+GVP+IRLAAGEPDFDTP  +AEAGINAIRE
Sbjct  75   VDMSLSPRVQSLKPSKTMAITDLAATLVQSGVPIIRLAAGEPDFDTPKVVAEAGINAIRE  134

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G TRY+ NAG  E+R+AIC KLKEENGL+Y PDQILVSNGAKQSI QAVLAVCSPGDEV+
Sbjct  135  GFTRYSLNAGITELREAICRKLKEENGLSYAPDQILVSNGAKQSIFQAVLAVCSPGDEVI  194

Query  728  IPAPFWVSYPENGKV  772
            IPAP+WVSY E  ++
Sbjct  195  IPAPYWVSYTEQARL  209



>ref|NP_001143769.1| hypothetical protein [Zea mays]
 gb|ACF87080.1| unknown [Zea mays]
 tpg|DAA56614.1| TPA: hypothetical protein ZEAMMB73_333099 [Zea mays]
Length=416

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD S+SPRV+A++PSKT+AITDQA AL QAGVPVI LAAGEPDFDTP  IAEAG++AIR 
Sbjct  9    VDTSISPRVSALRPSKTMAITDQAMALRQAGVPVIGLAAGEPDFDTPPAIAEAGMDAIRN  68

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G+TRYTPNAGT+E+R+AIC KL+EENG++Y PD++LVSNGAKQ I QAVLAVCSPGDEVL
Sbjct  69   GYTRYTPNAGTLELRKAICTKLQEENGVSYLPDEVLVSNGAKQCITQAVLAVCSPGDEVL  128

Query  728  IPAPFWVSYPENGKV  772
            IPAP+WVSYPE  ++
Sbjct  129  IPAPYWVSYPEMARL  143



>ref|XP_002456709.1| hypothetical protein SORBIDRAFT_03g041180 [Sorghum bicolor]
 gb|EES01829.1| hypothetical protein SORBIDRAFT_03g041180 [Sorghum bicolor]
Length=416

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD S+SPRV+A++PSKT+AITDQA AL QAGVPVI LA GEPDFDTP  IAEAG+NAIR+
Sbjct  9    VDTSISPRVSALRPSKTMAITDQAMALRQAGVPVIGLAVGEPDFDTPPAIAEAGMNAIRD  68

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G+TRYTPNAGT+E+R+AIC KL+ ENG++Y PDQ+LVSNGAKQ I QAVLAVCSPGDEVL
Sbjct  69   GYTRYTPNAGTLELRKAICAKLQGENGISYLPDQVLVSNGAKQCITQAVLAVCSPGDEVL  128

Query  728  IPAPFWVSYPENGKV  772
            IPAP+WVSYPE  ++
Sbjct  129  IPAPYWVSYPEMARL  143



>gb|KFK32831.1| hypothetical protein AALP_AA6G292800 [Arabis alpina]
Length=480

 Score =   222 bits (565),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD SLSPRV ++KPSKT+ ITD A  L Q+GVP+IRLAAGEPDFDTP  +AEAGINAIRE
Sbjct  73   VDTSLSPRVKSLKPSKTMVITDLAATLVQSGVPIIRLAAGEPDFDTPKIVAEAGINAIRE  132

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G TRYT NAGT E+R+AIC KL+EENGL+Y PDQILVSNGAKQS+LQAVLAVCSPGDEV+
Sbjct  133  GFTRYTLNAGTTELREAICRKLQEENGLSYAPDQILVSNGAKQSLLQAVLAVCSPGDEVI  192

Query  728  IPAPFWVSYPENGKV  772
            IPAP+WVSY E  ++
Sbjct  193  IPAPYWVSYTEQARL  207



>ref|XP_009112541.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase isoform X1 [Brassica 
rapa]
Length=476

 Score =   221 bits (563),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 126/162 (78%), Gaps = 10/162 (6%)
 Frame = +2

Query  317  TYPSSVNQVARVRCSME----------VDISLSPRVNAVKPSKTVAITDQATALAQAGVP  466
            +Y S   +V+   C+M           VD SLSPRV ++KPSKT+ ITD A  L Q+GVP
Sbjct  42   SYCSKSGKVSSRICAMSKPNDAETLSSVDTSLSPRVKSLKPSKTMVITDLAATLVQSGVP  101

Query  467  VIRLAAGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPD  646
            V+RLAAGEPDFDTP  +AEAGINAIR+G TRY+ NAG  E+R+AIC KLKEENGL+Y PD
Sbjct  102  VVRLAAGEPDFDTPKIVAEAGINAIRDGFTRYSLNAGITELREAICRKLKEENGLSYAPD  161

Query  647  QILVSNGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            QILVSNGAKQSILQAVLAVCSPGDEV+IPAP+WVSY E  ++
Sbjct  162  QILVSNGAKQSILQAVLAVCSPGDEVIIPAPYWVSYTEQARL  203



>ref|XP_009112542.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase isoform X2 [Brassica 
rapa]
Length=473

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD SLSPRV ++KPSKT+ ITD A  L Q+GVPV+RLAAGEPDFDTP  +AEAGINAIR+
Sbjct  66   VDTSLSPRVKSLKPSKTMVITDLAATLVQSGVPVVRLAAGEPDFDTPKIVAEAGINAIRD  125

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G TRY+ NAG  E+R+AIC KLKEENGL+Y PDQILVSNGAKQSILQAVLAVCSPGDEV+
Sbjct  126  GFTRYSLNAGITELREAICRKLKEENGLSYAPDQILVSNGAKQSILQAVLAVCSPGDEVI  185

Query  728  IPAPFWVSYPENGKV  772
            IPAP+WVSY E  ++
Sbjct  186  IPAPYWVSYTEQARL  200



>ref|XP_010416982.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase isoform X2 [Camelina 
sativa]
Length=466

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +2

Query  386  PRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTRYT  565
            PRV ++KPSKT+AITD A  LAQ+GVP+IRLAAGEPDFDTP  +AEAGINAIREG TRY+
Sbjct  65   PRVQSLKPSKTMAITDLAATLAQSGVPIIRLAAGEPDFDTPKVVAEAGINAIREGFTRYS  124

Query  566  PNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAPFW  745
             NAG  E+R+AIC KLKEENGL+Y PDQILVSNGAKQSILQAVLAVCSPGDEV+IPAP+W
Sbjct  125  LNAGITELREAICRKLKEENGLSYAPDQILVSNGAKQSILQAVLAVCSPGDEVIIPAPYW  184

Query  746  VSYPENGKV  772
            VSY E  ++
Sbjct  185  VSYTEQARL  193



>ref|XP_010416981.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase isoform X1 [Camelina 
sativa]
Length=479

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +2

Query  386  PRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTRYT  565
            PRV ++KPSKT+AITD A  LAQ+GVP+IRLAAGEPDFDTP  +AEAGINAIREG TRY+
Sbjct  78   PRVQSLKPSKTMAITDLAATLAQSGVPIIRLAAGEPDFDTPKVVAEAGINAIREGFTRYS  137

Query  566  PNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAPFW  745
             NAG  E+R+AIC KLKEENGL+Y PDQILVSNGAKQSILQAVLAVCSPGDEV+IPAP+W
Sbjct  138  LNAGITELREAICRKLKEENGLSYAPDQILVSNGAKQSILQAVLAVCSPGDEVIIPAPYW  197

Query  746  VSYPENGKV  772
            VSY E  ++
Sbjct  198  VSYTEQARL  206



>ref|XP_002880438.1| AAT/ATAAT/MEE17 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56697.1| AAT/ATAAT/MEE17 [Arabidopsis lyrata subsp. lyrata]
Length=478

 Score =   213 bits (543),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = +2

Query  386  PRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTRYT  565
            PRV ++KPSKT+ ITD A  L Q+GVPVIRLAAGEPDFDTP  +AEAG+NAIREG TRYT
Sbjct  77   PRVQSLKPSKTMVITDLAATLVQSGVPVIRLAAGEPDFDTPKVVAEAGVNAIREGFTRYT  136

Query  566  PNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAPFW  745
             NAG  E+R+AIC KLKEENGL+Y PDQILVSNGAKQS+LQAVLAVCSPGDEV+IPAP+W
Sbjct  137  LNAGITELREAICRKLKEENGLSYAPDQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYW  196

Query  746  VSYPENGKV  772
            VSY E  ++
Sbjct  197  VSYTEQARL  205



>gb|KCW54515.1| hypothetical protein EUGRSUZ_I004631, partial [Eucalyptus grandis]
Length=193

 Score =   202 bits (514),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            M++D++LSPRVNAVKPSKT+AI  QATAL +AGVPVI LA GEPDFDTP+ IA+AG NAI
Sbjct  74   MDIDLTLSPRVNAVKPSKTLAIIAQATALLKAGVPVISLAIGEPDFDTPSVIADAGFNAI  133

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG+TRYTPNAGT+E+R AIC +LKEENG++YTPDQILVSNGAKQSI QAVL VCSPGDE
Sbjct  134  REGYTRYTPNAGTLELRTAICQRLKEENGISYTPDQILVSNGAKQSIFQAVLVVCSPGDE  193



>ref|XP_006404683.1| hypothetical protein EUTSA_v10000093mg [Eutrema salsugineum]
 gb|ESQ46136.1| hypothetical protein EUTSA_v10000093mg [Eutrema salsugineum]
Length=616

 Score =   213 bits (543),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = +2

Query  386  PRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTRYT  565
            PRV ++KPSKT+ ITD A  L Q+GVPVIRLAAGEPDFDTP  ++EAGINAIREG TRYT
Sbjct  215  PRVKSLKPSKTMVITDLAATLVQSGVPVIRLAAGEPDFDTPKTVSEAGINAIREGFTRYT  274

Query  566  PNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAPFW  745
             NAG  E+R+AIC KLKEENGL+Y PDQILVSNGAKQSILQAVLAVCSPGDEV+IPAP+W
Sbjct  275  LNAGITELREAICRKLKEENGLSYAPDQILVSNGAKQSILQAVLAVCSPGDEVIIPAPYW  334

Query  746  VSYPENGKV  772
            VSY E  ++
Sbjct  335  VSYTEQARL  343



>gb|EMT16326.1| Aspartate aminotransferase A [Aegilops tauschii]
Length=421

 Score =   206 bits (524),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  419  VAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQA  598
            +AIT  A+AL QAGVPVI LAAGEPDFDTPA IAEAGINAIR+G TRYTPNAGTME+R+A
Sbjct  1    MAITHMASALRQAGVPVIGLAAGEPDFDTPAVIAEAGINAIRDGSTRYTPNAGTMELRKA  60

Query  599  ICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            IC+KL+EENGLTY+PDQ+LVSNGAKQ I QAVLAVCSPGDEVLIPAPFWVSYPE  ++
Sbjct  61   ICNKLQEENGLTYSPDQVLVSNGAKQCITQAVLAVCSPGDEVLIPAPFWVSYPEMARL  118



>ref|XP_010674468.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=410

 Score =   203 bits (517),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            ME+D+SL+PRVN+++PSKT  I +QAT L QAG+PVI L  G+PDFDTP+ IA+AGI AI
Sbjct  1    MELDMSLNPRVNSLEPSKTAVIAEQATDLQQAGIPVISLTTGQPDFDTPSIIAKAGIRAI  60

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
                T+YTP AGT E+R AICHKLKEENG++YTPD+IL SNGAKQSI QAVLAVCSPGDE
Sbjct  61   EGSCTKYTPIAGTAELRTAICHKLKEENGISYTPDEILASNGAKQSIFQAVLAVCSPGDE  120

Query  722  VLIPAPFWVSYPENGKVG  775
            V+IPAP+WVSY +  ++ 
Sbjct  121  VIIPAPYWVSYLDIARLA  138



>ref|XP_002965520.1| hypothetical protein SELMODRAFT_143343 [Selaginella moellendorffii]
 gb|EFJ32940.1| hypothetical protein SELMODRAFT_143343 [Selaginella moellendorffii]
Length=388

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +2

Query  419  VAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQA  598
            +AI+DQATAL QAGVP++RLAAGEPDFDTP  IAEAG  AI+EG TRYTPNAGTME+R A
Sbjct  1    MAISDQATALVQAGVPIVRLAAGEPDFDTPEVIAEAGRKAIQEGFTRYTPNAGTMELRSA  60

Query  599  ICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            I HKL+EENGLTY  D+ILVSNGAKQ I QAVL+VCSPGDEV+IPAP+WVSYPE  ++
Sbjct  61   IVHKLQEENGLTYKTDEILVSNGAKQCITQAVLSVCSPGDEVIIPAPYWVSYPEMARL  118



>ref|XP_002982998.1| hypothetical protein SELMODRAFT_234146 [Selaginella moellendorffii]
 gb|EFJ15807.1| hypothetical protein SELMODRAFT_234146 [Selaginella moellendorffii]
Length=388

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +2

Query  419  VAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQA  598
            +AI+DQATAL QAGVP++RLAAGEPDFDTP  IAEAG  AI+EG TRYTPNAGTME+R A
Sbjct  1    MAISDQATALVQAGVPIVRLAAGEPDFDTPEVIAEAGRMAIQEGFTRYTPNAGTMELRSA  60

Query  599  ICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            I HKL+EENGLTY  D+ILVSNGAKQ I QAVL+VCSPGDEV+IPAP+WVSYPE  ++
Sbjct  61   IVHKLQEENGLTYKTDEILVSNGAKQCITQAVLSVCSPGDEVIIPAPYWVSYPEMARL  118



>ref|XP_002502760.1| aspartate aminotransferase [Micromonas sp. RCC299]
 gb|ACO64018.1| aspartate aminotransferase [Micromonas sp. RCC299]
Length=459

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 116/145 (80%), Gaps = 3/145 (2%)
 Frame = +2

Query  335  NQVARVRC---SMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDT  505
            ++ AR  C     EVD +L+PRV A++PSKT+A+TD+A  + ++G+PVI LAAGEPDFDT
Sbjct  37   HRQARAGCLSTRAEVDQTLNPRVAALRPSKTMALTDKAREMKESGLPVIGLAAGEPDFDT  96

Query  506  PAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSIL  685
            PA I  AG +AI+ GHTRY+PN GT  +R+A+C KLKEENGL Y+P +I++SNGAKQS+ 
Sbjct  97   PAEIVRAGCDAIKNGHTRYSPNTGTAALREAVCAKLKEENGLEYSPSEIVLSNGAKQSVA  156

Query  686  QAVLAVCSPGDEVLIPAPFWVSYPE  760
            Q V+A C PGDEV++PAP+WVSYPE
Sbjct  157  QGVIATCGPGDEVIVPAPYWVSYPE  181



>ref|XP_002946497.1| hypothetical protein VOLCADRAFT_103084 [Volvox carteri f. nagariensis]
 gb|EFJ52424.1| hypothetical protein VOLCADRAFT_103084 [Volvox carteri f. nagariensis]
Length=480

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD +L+P V +VKPSKT+A+TD AT++ +AG+ VI LAAGEPDFDTPAPI EAG+ A+R 
Sbjct  68   VDTTLNPLVASVKPSKTMALTDLATSMKEAGIDVIGLAAGEPDFDTPAPIVEAGVAALRA  127

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G+TRYTPN GT  +R+AIC KL+++NGL+Y+PD+++VSNGAKQSI QAVLA  SPGDEV+
Sbjct  128  GYTRYTPNTGTTALRKAICKKLQDDNGLSYSPDEVVVSNGAKQSIWQAVLATVSPGDEVI  187

Query  728  IPAPFWVSYPE  760
            IPAP+WVSY E
Sbjct  188  IPAPYWVSYTE  198



>gb|KJB44246.1| hypothetical protein B456_007G241800 [Gossypium raimondii]
Length=455

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 107/137 (78%), Gaps = 25/137 (18%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            +++DISLSPRVN+VKPSKTVAITD ATALAQAGVPVIRLAAGEPDFDTPA IAEAGINAI
Sbjct  71   VKLDISLSPRVNSVKPSKTVAITDHATALAQAGVPVIRLAAGEPDFDTPAIIAEAGINAI  130

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG+TRYTPNAGT+E+R AICHKLK                         VLAVCSPGDE
Sbjct  131  REGYTRYTPNAGTLELRTAICHKLK-------------------------VLAVCSPGDE  165

Query  722  VLIPAPFWVSYPENGKV  772
            V+IPAP+WVSYPE  ++
Sbjct  166  VIIPAPYWVSYPEMARL  182



>ref|XP_005851526.1| hypothetical protein CHLNCDRAFT_48481 [Chlorella variabilis]
 gb|EFN59424.1| hypothetical protein CHLNCDRAFT_48481 [Chlorella variabilis]
Length=452

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD +L+PRV A+KPSKT+A+TD AT L + G  +I LAAGEPDFDTPAPI EAG+ A+R 
Sbjct  11   VDTTLNPRVAALKPSKTMALTDLATKLKEEGADIIGLAAGEPDFDTPAPIVEAGVEALRL  70

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G TRYTPN GT  +R+A+C KL+ ENG+ Y PDQI+VSNGAKQ I QA+LAVC+P DEV+
Sbjct  71   GLTRYTPNTGTSALRKAVCAKLEAENGVRYDPDQIVVSNGAKQCIWQALLAVCAPEDEVI  130

Query  728  IPAPFWVSYPENGKV  772
            IPAPFWVSYPE  ++
Sbjct  131  IPAPFWVSYPEMARL  145



>gb|ACG35175.1| hypothetical protein [Zea mays]
Length=384

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +2

Query  443  ALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEE  622
            AL QAGVPVI LAAGEPDFDTP  IAEAG++AIR G+TRYTPNAGT+E+R+AIC KL+EE
Sbjct  2    ALRQAGVPVIGLAAGEPDFDTPPAIAEAGMDAIRNGYTRYTPNAGTLELRKAICTKLQEE  61

Query  623  NGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPENGKV  772
            NG++Y PD++LVSNGAKQ I QAVLAVCSPGDEVLIPAP+WVSYPE  ++
Sbjct  62   NGVSYLPDEVLVSNGAKQCITQAVLAVCSPGDEVLIPAPYWVSYPEMARL  111



>ref|WP_014065957.1| aspartate aminotransferase [Rhodothermus marinus]
 gb|AEN72188.1| Aspartate transaminase [Rhodothermus marinus SG0.5JP17-172]
Length=402

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 107/134 (80%), Gaps = 1/134 (1%)
 Frame = +2

Query  359  SMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINA  538
            S+++D + +PRV AV+PS T+A+T +A  L + G PVI L+AGEPDFDTPAPIAEA I A
Sbjct  2    SLQLD-TFNPRVMAVQPSATLAMTARAKQLRREGKPVIGLSAGEPDFDTPAPIAEAAIQA  60

Query  539  IREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGD  718
            IREG T YT NAG +E+R+AIC KL EENGLTY PDQIL +NGAKQ++  A+  +C P D
Sbjct  61   IREGFTHYTENAGMLELREAICRKLAEENGLTYEPDQILCTNGAKQAVAMAIEVLCRPED  120

Query  719  EVLIPAPFWVSYPE  760
            EVLIPAP+WVSYPE
Sbjct  121  EVLIPAPYWVSYPE  134



>ref|WP_012842775.1| aspartate aminotransferase [Rhodothermus marinus]
 gb|ACY47163.1| aminotransferase class I and II [Rhodothermus marinus DSM 4252]
Length=402

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 107/134 (80%), Gaps = 1/134 (1%)
 Frame = +2

Query  359  SMEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINA  538
            S+++D + +PRV AV+PS T+A+T +A  L + G PVI L+AGEPDFDTPAPIAEA I A
Sbjct  2    SLQLD-TFNPRVMAVQPSATLAMTARAKQLRREGKPVIGLSAGEPDFDTPAPIAEAAIQA  60

Query  539  IREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGD  718
            IREG T YT NAG +E+R+AIC KL EENGLTY PDQIL +NGAKQ++  A+  +C P D
Sbjct  61   IREGFTHYTENAGMLELREAICRKLAEENGLTYEPDQILCTNGAKQAVAMAIEVLCRPED  120

Query  719  EVLIPAPFWVSYPE  760
            EVLIPAP+WVSYPE
Sbjct  121  EVLIPAPYWVSYPE  134



>ref|XP_003060871.1| aspartate aminotransferase [Micromonas pusilla CCMP1545]
 gb|EEH54521.1| aspartate aminotransferase [Micromonas pusilla CCMP1545]
Length=464

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 108/132 (82%), Gaps = 3/132 (2%)
 Frame = +2

Query  365  EVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIR  544
            EVD SL+PRV A++PSKT+A+TD A A+ ++G+PVI LAAGEPDFDTPA I EAG +AI 
Sbjct  58   EVDQSLNPRVAALRPSKTMALTDLARAMKESGLPVIGLAAGEPDFDTPAAIVEAGRDAIT  117

Query  545  EGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEV  724
             G TRY+PN GT  +R+A+C KLKEENGL Y P++I++SNGAKQS   +V+A   PGDEV
Sbjct  118  RGFTRYSPNTGTEALRKAVCEKLKEENGLVYAPEEIVLSNGAKQS---SVMATTGPGDEV  174

Query  725  LIPAPFWVSYPE  760
            +IPAP+WVSYPE
Sbjct  175  IIPAPYWVSYPE  186



>dbj|BAB86539.1| putative aspartate aminotransferase [Oryza sativa Japonica Group]
Length=536

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 106/144 (74%), Gaps = 30/144 (21%)
 Frame = +2

Query  353  RCSME--------VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTP  508
            RC M         VD ++SP V+A++PSKT+AITDQATAL QAGVPVI LAAGEPDFDTP
Sbjct  137  RCRMASVVVRAEAVDATISPTVSALRPSKTMAITDQATALRQAGVPVIGLAAGEPDFDTP  196

Query  509  APIAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQ  688
              IAEAG+NAI++G+TRYTPNAGT+E+R+AIC+KL+EENG++Y+PDQ+L           
Sbjct  197  HVIAEAGMNAIKDGYTRYTPNAGTLELRKAICNKLQEENGISYSPDQVL-----------  245

Query  689  AVLAVCSPGDEVLIPAPFWVSYPE  760
                       VLIPAP+WVSYPE
Sbjct  246  -----------VLIPAPYWVSYPE  258



>ref|XP_007512171.1| aspartate aminotransferase [Bathycoccus prasinos]
 emb|CCO66259.1| aspartate aminotransferase [Bathycoccus prasinos]
Length=466

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD SL+PRV  +  SKTVA+TD A  L + G  VI LAAGEPDF+TP   A+AGI AI  
Sbjct  52   VDRSLNPRVRDLNESKTVALTDLARTLKERGEDVIGLAAGEPDFETPDVCAKAGIRAIEC  111

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+Y+PN GT+ +R AIC KLK ENG+ Y P++I++SNGAKQS+ QAVL  C PGDEV+
Sbjct  112  GKTKYSPNPGTVPLRAAICEKLKRENGVEYKPNEIVISNGAKQSVTQAVLTCCGPGDEVI  171

Query  728  IPAPFWVSYPE  760
            +PAP+WVSYPE
Sbjct  172  VPAPYWVSYPE  182



>ref|WP_029422218.1| aspartate aminotransferase [Alicyclobacillus macrosporangiidus]
Length=395

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = +2

Query  380  LSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTR  559
            LS RV A+ PS T+++  +  AL + G PV+ ++ GEPDFDTP P A AGI AI +G+TR
Sbjct  5    LSSRVRAIAPSATMSVDAKTKALIREGRPVVNMSVGEPDFDTPVPAAFAGIRAITDGNTR  64

Query  560  YTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAP  739
            YTP+AGT+++R+AI  KL EENGL Y P+QI+VSNGAK S+    L +C PGDEV++PAP
Sbjct  65   YTPSAGTLDLRRAIAAKLMEENGLLYKPEQIVVSNGAKHSLFNVFLTICDPGDEVILPAP  124

Query  740  FWVSYPENGKV  772
            +WVSYPE  ++
Sbjct  125  YWVSYPEQIRL  135



>ref|WP_016407351.1| aminotransferase class I and II [Firmicutes bacterium CAG:102]
 emb|CCX39902.1| aminotransferase class I and II [Firmicutes bacterium CAG:102]
Length=398

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + LS +  ++KPS T+AI+ +A  +  AGV V+   AGEPDFDTPA IA+AGI+AI+ G 
Sbjct  1    MELSKKAMSIKPSTTMAISSRAAEMKAAGVDVVSFGAGEPDFDTPAHIAQAGIDAIQNGQ  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            TRYTP AGT E+RQA+C KLK +NGL Y P Q+++SNGAK S++   +A+   GDEV+IP
Sbjct  61   TRYTPAAGTPELRQAVCDKLKRDNGLEYEPAQVVISNGAKHSLMNTFMAILHEGDEVIIP  120

Query  734  APFWVSYPENGKV  772
            APFW+SY E  ++
Sbjct  121  APFWLSYAEMVRI  133



>ref|WP_035163584.1| aspartate aminotransferase [Caloranaerobacter azorensis]
 gb|KGG80273.1| aspartate aminotransferase [Caloranaerobacter azorensis H53214]
Length=396

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D  LS +  ++ PS T+ IT +A  + Q G+ VI   AGEPDFDTP  I EAGI  I+E
Sbjct  1    MDFKLSEKALSISPSVTLEITAKAKEMKQRGIEVISFGAGEPDFDTPKNIQEAGIKTIKE  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G+TRYT +AG +E+R+AIC KLK++N + YTP  I+VSNGAK SI  A+ A+ + GDEV+
Sbjct  61   GNTRYTASAGVLELREAICQKLKKDNNIEYTPQNIIVSNGAKHSIFNALTAILNQGDEVI  120

Query  728  IPAPFWVSYPENGKV  772
            IP P+WVSYPE  K+
Sbjct  121  IPVPYWVSYPEMVKL  135



>ref|WP_018661627.1| Aspartate aminotransferase [Thermobrachium celere]
 emb|CDF57976.1| Aspartate aminotransferase [Thermobrachium celere DSM 8682]
Length=397

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + LS +  A+ PS T+AIT +A  +   G+ VI   AGEPDFDTP  + +A  +AI +G 
Sbjct  1    MELSRKAKAITPSTTLAITAKAKKMKSEGINVISFGAGEPDFDTPQFVKDAAFDAINKGL  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            TRYTP +G +E+++AIC KLKEEN L Y+P +I++SNGAK SI  A++A+C+PGDEV+IP
Sbjct  61   TRYTPASGIIELKEAICMKLKEENNLEYSPAEIVISNGAKHSIYNALMAICNPGDEVIIP  120

Query  734  APFWVSYPE  760
             P+WVSYPE
Sbjct  121  VPYWVSYPE  129



>ref|WP_027307500.1| aspartate aminotransferase [Caloramator sp. ALD01]
Length=397

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + LS +   + PS T+AIT +A  +   G+ VI   AGEPDFDTP  I +A I+AI  G 
Sbjct  1    MELSKKAKQIAPSTTLAITAKAKKMKSEGINVISFGAGEPDFDTPQYIKDAAIDAINNGL  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            TRYTP +G +E+++AIC+KL++ENGL Y+ ++I++SNGAK SI  A++A+C+PGDEV+IP
Sbjct  61   TRYTPASGIIELKEAICNKLRKENGLEYSANEIVISNGAKHSIYNALMAICNPGDEVIIP  120

Query  734  APFWVSYPENGKV  772
             P+WVSYPE  K+
Sbjct  121  VPYWVSYPELAKL  133



>ref|WP_026962644.1| aspartate aminotransferase [Alicyclobacillus herbarius]
Length=395

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = +2

Query  380  LSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTR  559
            LS RV  + PS T++I  +  AL + G PV+ ++ GEPDFDTP   A AGI AI  G TR
Sbjct  5    LSSRVRQITPSATISIDTKTKALIREGKPVVNMSVGEPDFDTPVAAAFAGIRAITSGQTR  64

Query  560  YTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAP  739
            YTP AG +E+R+AI HKL  ENGL+Y P+QI+VS+GAK S+    LA+C PGDEV++PAP
Sbjct  65   YTPAAGLLELRKAIAHKLMVENGLSYAPEQIIVSSGAKHSLFNIFLAICEPGDEVILPAP  124

Query  740  FWVSYPEN  763
            +WVSYPE 
Sbjct  125  YWVSYPEQ  132



>ref|WP_013061531.1| aspartate aminotransferase [Salinibacter ruber]
 emb|CBH24053.1| Aspartate aminotransferase [Salinibacter ruber M8]
Length=404

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + L+ RV A++PS T+A+  +A    + G PV+ L+AGEPDF+TP PI++AG+ AIR G 
Sbjct  8    VRLNDRVAAMQPSATLAMKARAEERRRQGHPVVALSAGEPDFETPKPISDAGVEAIRSGF  67

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T YT N GT+E+R+AIC KL  +N L+YTP+Q++ SNGAKQS+  A+ A+C  GDEVLIP
Sbjct  68   TNYTENPGTLELREAICSKLDRDNDLSYTPEQVVCSNGAKQSLALAIHALCDEGDEVLIP  127

Query  734  APFWVSYPENGKV  772
            AP+WVSYPE  + 
Sbjct  128  APYWVSYPEMARF  140



>ref|WP_011403699.1| aspartate aminotransferase [Salinibacter ruber]
 ref|YP_445071.1| aspartate aminotransferase [Salinibacter ruber DSM 13855]
 gb|ABC45510.1| aspartate aminotransferase [Salinibacter ruber DSM 13855]
Length=404

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            +  + RV A++PS T+A+  +A    + G PV+ L+AGEPDF+TP PI++AG+ AIR G 
Sbjct  8    VRFNDRVAAMQPSATLAMKSRAEERRRQGHPVVALSAGEPDFETPKPISDAGVQAIRNGF  67

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T YT N GT+E+R+AIC KL  +N L+YTP+Q++ SNGAKQS+  A+ A+C  GDEVLIP
Sbjct  68   TNYTENPGTLELREAICSKLDRDNDLSYTPEQVVCSNGAKQSLALAIHALCDEGDEVLIP  127

Query  734  APFWVSYPENGKV  772
            AP+WVSYPE  + 
Sbjct  128  APYWVSYPEMARF  140



>ref|WP_015236764.1| aspartate/tyrosine/aromatic aminotransferase [Deinococcus peraridilitoris]
 gb|AFZ68463.1| aspartate/tyrosine/aromatic aminotransferase [Deinococcus peraridilitoris 
DSM 19664]
Length=387

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 94/131 (72%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
             +  LS +V ++KPS T+A+T +A  L +AGV V+ +AAGEPDFDTP  + EA   AIR 
Sbjct  2    FEFKLSDKVRSLKPSSTIAVTGRALELQRAGVDVVSMAAGEPDFDTPEHVKEAAYAAIRA  61

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G TRYTP  G  E+R+ IC K + ENGLTY+P+Q+ VS G KQ++  A  A+  PGDEV+
Sbjct  62   GKTRYTPVQGIPELRETICAKFERENGLTYSPEQVTVSTGGKQALFNAFFALLDPGDEVI  121

Query  728  IPAPFWVSYPE  760
            IPAP+WVSYPE
Sbjct  122  IPAPYWVSYPE  132



>ref|WP_004036359.1| hypothetical protein [Clostridium sp. ASF356]
 gb|EMZ13529.1| hypothetical protein C820_01688 [Clostridium sp. ASF356]
Length=398

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 0/134 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + LS R   +KPS T+AI+ +A  L   G+ V+    GEPDFDTP  I +A I AI+ G 
Sbjct  1    MELSKRALKIKPSSTLAISAKAAQLKSEGIDVVTFGVGEPDFDTPKHICDAAIEAIKSGE  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            TRYTP +GTME+RQA+C KLK++N + Y P+QI++SNGAK S++   +A+ + GDEV+IP
Sbjct  61   TRYTPASGTMELRQAVCEKLKKDNDILYQPEQIIISNGAKHSLMNTFMAILNEGDEVIIP  120

Query  734  APFWVSYPENGKVG  775
            AP+W+SY E  K+ 
Sbjct  121  APYWLSYSEMVKIA  134



>ref|WP_034345639.1| aspartate aminotransferase [Deinococcus misasensis]
Length=382

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +2

Query  380  LSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTR  559
            LS ++ A+KPS TVA+T +A  L + GV VI ++ GEPDFDTP  + +A   AI+EG T+
Sbjct  6    LSQKIQALKPSSTVAVTSRALELKRQGVDVISMSVGEPDFDTPEHVKQAAYRAIQEGKTK  65

Query  560  YTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAP  739
            YTP  G  E+R+ I  KL+ ENGLTY+P+Q+ V++G KQ+I  A++A+  PGDEV+IPAP
Sbjct  66   YTPVNGIFELRETISEKLQRENGLTYSPEQVTVTSGGKQAIFNALIALIDPGDEVIIPAP  125

Query  740  FWVSYPE  760
            FWVSYPE
Sbjct  126  FWVSYPE  132



>ref|WP_027425082.1| aspartate aminotransferase [Lachnospiraceae bacterium NC2004]
Length=399

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            + + LS +  AVKPS T+AIT +A  L   G+ V+   AGEPDF+TP  I +A I AI E
Sbjct  1    MSLELSKKALAVKPSSTLAITAKAKELKAEGIDVVGFGAGEPDFNTPDNICQAAIKAINE  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YTP AGT+ +++A+C K KE NGL YTPDQI++SNG K S+     A+ +PGDEV+
Sbjct  61   GFTKYTPAAGTVSLKKAVCKKFKEFNGLDYTPDQIVISNGGKHSLTNIFNAILNPGDEVM  120

Query  728  IPAPFWVSYPENGKV  772
            IPAP+W+SYPE  K+
Sbjct  121  IPAPYWLSYPEMVKM  135



>ref|WP_022834450.1| aspartate aminotransferase [Salisaeta longa]
Length=403

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + L+ RV+A++PS T+A+  +A A+ +AG PVI L+AGEPDF+TPAPI EAGI AI+ G 
Sbjct  7    LRLNRRVDAMQPSATLAMKARAGAMRRAGHPVIALSAGEPDFNTPAPIREAGIAAIQNGF  66

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T YT NAG   +R+AI  KL  +NGL+Y+ DQIL SNGAKQS+   +  +C  GDEVLIP
Sbjct  67   TNYTENAGMPALREAIAAKLAADNGLSYSADQILCSNGAKQSVALGIHVLCDAGDEVLIP  126

Query  734  APFWVSYPENGKV  772
            AP+WVSYPE  + 
Sbjct  127  APYWVSYPEMARF  139



>ref|WP_035380127.1| aspartate aminotransferase [Fervidicella metallireducens]
 gb|EYE88203.1| aspartate aminotransferase [Fervidicella metallireducens AeB]
Length=394

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + LS +   +  S T+AIT +A  L + GV VI   AGEPDF+TP  I +  ++AIR G 
Sbjct  1    MELSRKGQQISSSITLAITAKAKKLKEEGVDVISFGAGEPDFNTPKNIQDVAVDAIRNGL  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            TRYTP +G +E++ AIC KL+EEN + Y P QI+VSNGAKQSI  A++A+C+PGDEV++P
Sbjct  61   TRYTPASGILELKNAICTKLREENSIDYIPSQIVVSNGAKQSIANALMAICNPGDEVIVP  120

Query  734  APFWVSYPE  760
             P+WVSYPE
Sbjct  121  VPYWVSYPE  129



>ref|XP_001421566.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99859.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=452

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 99/133 (74%), Gaps = 1/133 (1%)
 Frame = +2

Query  365  EVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIR  544
            +VD +L+ RV  ++PSKTVA+TD A A+  AG  VI LAAGEPDF TP  + +AG  AI 
Sbjct  39   KVDQTLNERVANLQPSKTVALTDLARAMRDAGEDVIGLAAGEPDFATPRAVGDAGKAAID  98

Query  545  EGHTRYTPNAGTMEIRQAICHKLKEENGLTYT-PDQILVSNGAKQSILQAVLAVCSPGDE  721
             G T+Y+PN G  ++R AI  KL+EENGLTY    +I++SNGAKQS+ Q V+A C PGDE
Sbjct  99   AGKTKYSPNDGDAKLRNAIARKLEEENGLTYDGKTEIVLSNGAKQSVAQCVMATCGPGDE  158

Query  722  VLIPAPFWVSYPE  760
            VL+PAP+WVSYPE
Sbjct  159  VLVPAPYWVSYPE  171



>ref|WP_036944317.1| aspartate aminotransferase [Pseudobacteroides cellulosolvens]
Length=395

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + LS +  ++ PS T+AI  +A  +   G+ VI   AGEPDFDTP  I EA I AI +G 
Sbjct  1    MKLSTKALSISPSSTLAIDAKAKKMKADGIDVIGFGAGEPDFDTPNHIKEAAIKAINDGF  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP +GT+E++QA+C K +++NGL YTP  I++SNGAK S++ A  A+C+ GDEV+IP
Sbjct  61   TKYTPASGTLELKQAVCKKFEKDNGLIYTPSNIVISNGAKHSLVNAFQAICNVGDEVIIP  120

Query  734  APFWVSYPE  760
            AP+WVSYPE
Sbjct  121  APYWVSYPE  129



>ref|XP_003083519.1| putative aspartate aminotransferase (ISS) [Ostreococcus tauri]
 emb|CAL58068.1| Aminotransferases,class-I,pyridoxal-phosphate-binding site [Ostreococcus 
tauri]
Length=448

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD SL+PRV A++PSKTVA+TD A  L   G  VI LAAGEPDF TP   +EAG  AI  
Sbjct  36   VDQSLNPRVEALRPSKTVALTDLARQLRADGKDVIGLAAGEPDFATPRAASEAGKRAIDA  95

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYT-PDQILVSNGAKQSILQAVLAVCSPGDEV  724
            G T+Y+ NAG  E+R+A+  KL+ ENGLTY    +I++SNGAKQS+ Q VLA C PGDEV
Sbjct  96   GKTKYSANAGDAELRKAVREKLRRENGLTYDWASEIVLSNGAKQSVAQCVLATCGPGDEV  155

Query  725  LIPAPFWVSYPE  760
            ++P P+WVSYPE
Sbjct  156  IVPTPYWVSYPE  167



>ref|WP_031217917.1| aspartate aminotransferase [Alicyclobacillus acidoterrestris]
Length=395

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +2

Query  380  LSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTR  559
            LS RV  +KPS T+++  +  +L  +G PVI ++ GEPDFDTP   A AGI AI  G+TR
Sbjct  5    LSTRVRNIKPSATMSVDAKTKSLLASGQPVINMSVGEPDFDTPTAAAFAGIRAITNGNTR  64

Query  560  YTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAP  739
            YTP AGT+ +R+AI  KL  ENGLTY+PDQI++SNGAK ++     A+C  GDEV++PAP
Sbjct  65   YTPAAGTVALRKAIVSKLMTENGLTYSPDQIIISNGAKHTLYNIFTAICDEGDEVILPAP  124

Query  740  FWVSYPE  760
            +WVSYPE
Sbjct  125  YWVSYPE  131



>ref|WP_005402964.1| aspartate aminotransferase, partial [Acinetobacter junii]
 gb|EEY94180.1| aspartate transaminase domain protein, partial [Acinetobacter 
junii SH205]
Length=173

 Score =   150 bits (379),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 93/131 (71%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI +
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINK  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPSLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_029689086.1| aspartate aminotransferase, partial [Thermoanaerobacter sp. A7A]
Length=158

 Score =   149 bits (377),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + LS     + PS T+ IT +A  L   G+ VI    GEPDFDTP  I EA I+AI++G+
Sbjct  1    MDLSQNALQITPSMTLEITAKAKQLKAQGIDVIDFGVGEPDFDTPDYIKEAAIDAIKKGY  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP++G  E+++A+C KL ++NGL Y P+QI++SNGAK SI  A+ A+ +PGDEV+IP
Sbjct  61   TKYTPSSGISELKKAVCDKLLKDNGLKYQPEQIVISNGAKHSIYNALCAILNPGDEVIIP  120

Query  734  APFWVSYPE  760
             P+W+SYPE
Sbjct  121  VPYWLSYPE  129



>ref|WP_010250355.1| aspartate aminotransferase [Acetivibrio cellulolyticus]
Length=395

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + LS +  ++ PS T+AI  +A  +   G+ +I   AGEPDFDTP  I  A I AI +G 
Sbjct  1    MELSKKALSISPSSTLAIDAKAKKMKADGIDIIGFGAGEPDFDTPEHIKAAAIKAINDGF  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP +GT+E++QAIC+K K++NGL Y P  I++SNGAK S++ A  A+ +PGDEV+IP
Sbjct  61   TKYTPASGTLELKQAICNKFKKDNGLDYKPANIVISNGAKHSLVNAFQAILNPGDEVIIP  120

Query  734  APFWVSYPENGKV  772
            APFWVSYPE  K+
Sbjct  121  APFWVSYPEMVKI  133



>gb|EXD71750.1| aminotransferase class I and II family protein [Acinetobacter 
baumannii 662545-1347]
Length=155

 Score =   149 bits (376),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_011025536.1| aspartate aminotransferase [Caldanaerobacter subterraneus]
 gb|AAM24436.1| PLP-dependent aminotransferases [Caldanaerobacter subterraneus 
subsp. tengcongensis MB4]
Length=395

 Score =   155 bits (393),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            ++LS     + PS T+ IT +A  L   GV VI    GEPDFDTP  I EA I AI++G+
Sbjct  1    MNLSQNALQITPSMTLEITAKARQLKAEGVDVIDFGVGEPDFDTPDYIKEAAIEAIKKGY  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP +G +E+++AIC KLK ENGL Y P+QI+VSNGAK SI  A+ A+ +PGDEV+IP
Sbjct  61   TKYTPASGILELKKAICEKLKRENGLFYEPEQIVVSNGAKHSIYNALSAILNPGDEVIIP  120

Query  734  APFWVSYPE  760
             P+W+SYPE
Sbjct  121  VPYWLSYPE  129



>gb|EPZ52609.1| hypothetical protein N007_20245 [Alicyclobacillus acidoterrestris 
ATCC 49025]
Length=430

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +2

Query  380  LSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTR  559
            LS RV  +KPS T+++  +  +L  +G PVI ++ GEPDFDTP   A AGI AI  G+TR
Sbjct  40   LSTRVRNIKPSATMSVDAKTKSLLASGQPVINMSVGEPDFDTPTAAAFAGIRAITNGNTR  99

Query  560  YTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAP  739
            YTP AGT+ +R+AI  KL  ENGLTY+PDQI++SNGAK ++     A+C  GDEV++PAP
Sbjct  100  YTPAAGTVALRKAIVSKLMTENGLTYSPDQIIISNGAKHTLYNIFTAICDEGDEVILPAP  159

Query  740  FWVSYPE  760
            +WVSYPE
Sbjct  160  YWVSYPE  166



>ref|WP_028308020.1| aspartate aminotransferase [Desulfitibacter alkalitolerans]
Length=397

 Score =   155 bits (392),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            +SLS RV  ++PS T+ +   A  L   G  VI   AGEPDF+TP  I  AGI AI +  
Sbjct  1    MSLSQRVKKIEPSPTLGLVAVAKNLKAQGHDVIEFGAGEPDFNTPDNIKAAGIKAIEDNF  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            TRYTPN G  E+R AIC KL++EN L YTPDQ++VS+GAK S+  A++A+C  GDEV+IP
Sbjct  61   TRYTPNLGIKELRDAICEKLEKENNLKYTPDQVIVSSGAKHSLFNAIMALCDVGDEVIIP  120

Query  734  APFWVSYPE  760
            AP+WV+YPE
Sbjct  121  APYWVTYPE  129



>ref|XP_011399542.1| Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Auxenochlorella protothecoides]
 gb|KFM26604.1| Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Auxenochlorella protothecoides]
Length=451

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            VD SL+P V +++PS TV +TD A  L +AGV V+ LAAGEPD  TPA +  AGI AI  
Sbjct  38   VDQSLNPLVASLRPSATVQLTDTAVRLREAGVDVVALAAGEPDAPTPAAVCAAGIEAIAS  97

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G TRYTPN GT  +R AI  KL  EN +   P Q++VSNGAKQ++ QA+LA C PGD+VL
Sbjct  98   GLTRYTPNNGTAPLRAAIAKKLAAENDMIVDPAQVVVSNGAKQAVWQALLATCGPGDQVL  157

Query  728  IPAPFWVSYPENGKV  772
            IPAP+WVSYPE  ++
Sbjct  158  IPAPYWVSYPEMARL  172



>ref|WP_039682453.1| aspartate aminotransferase [Deinococcus swuensis]
 gb|AIZ44462.1| aspartate aminotransferase [Deinococcus swuensis]
Length=393

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            M    +LS R  ++KPS TVA+T +A  L +AGV V+ ++ GEPDFDTPA I  A I AI
Sbjct  1    MSSPFALSARALSLKPSSTVAVTSRALELQKAGVDVVSMSVGEPDFDTPAHIKAAAIRAI  60

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
              G TRYTP +G  E+R AI  K + ENGL YTPD + V++G KQ++  A LA+ +PGDE
Sbjct  61   EAGKTRYTPVSGIPELRAAISAKFRRENGLEYTPDAVTVTSGGKQALFNAFLALLNPGDE  120

Query  722  VLIPAPFWVSYPE  760
            VLIPAP+WVSYPE
Sbjct  121  VLIPAPYWVSYPE  133



>gb|EMS62834.1| Aspartate aminotransferase [Triticum urartu]
Length=428

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +2

Query  515  IAEAGINAIREGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAV  694
            + +AGINAIR+G TRYTPNAGTME+R+AIC+KL+EENGLTY+PDQ+LVSNGAKQ I QAV
Sbjct  69   LRQAGINAIRDGSTRYTPNAGTMELRKAICNKLQEENGLTYSPDQVLVSNGAKQCITQAV  128

Query  695  LAVCSPGDEVLIPAPFWVSYPENGKV  772
            LAVCSPGDEVLIPAPFWVSYPE  ++
Sbjct  129  LAVCSPGDEVLIPAPFWVSYPEMARL  154



>ref|WP_035580186.1| aspartate aminotransferase [Hyphomonas jannaschiana]
 gb|KCZ89076.1| aspartate aminotransferase [Hyphomonas jannaschiana VP2]
Length=403

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            M  D+ LS  ++ VKPS T+A+T +A  L +AG  VI L AGEPDFDTP  I EAGI AI
Sbjct  1    MAADLRLSDALDRVKPSATIAVTTKAAELKRAGHDVIGLGAGEPDFDTPDNIKEAGIRAI  60

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG T+YTP  G  E+++AIC K + ENGLTYTP QI V+ G K  I  A++A  +PGDE
Sbjct  61   REGKTKYTPADGLPELKEAICGKFQRENGLTYTPAQIHVAPGGKPVIYNALVATLNPGDE  120

Query  722  VLIPAPFWVSYPE  760
            V+ PAP+WVSYPE
Sbjct  121  VICPAPYWVSYPE  133



>gb|ETR62168.1| aminotransferase, class I/II domain protein [Acinetobacter baumannii 
UH8907]
Length=179

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_043884136.1| aspartate aminotransferase [Caldanaerobacter subterraneus]
Length=395

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            ++LS     + PS T+ IT +A  L   GV VI    GEPDFDTP+ I EA I+AI+ G+
Sbjct  1    MNLSQNALQITPSMTLEITAKAKQLKAQGVDVIDFGVGEPDFDTPSYIKEAAIDAIKRGY  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP++G  E+++AIC KL ++NGL+YTP+QI+VSNGAK SI  A+ A+ +PGDEV+IP
Sbjct  61   TKYTPSSGIPELKKAICEKLLKDNGLSYTPEQIVVSNGAKHSIYNALSAILNPGDEVIIP  120

Query  734  APFWVSYPE  760
             P+W+SYPE
Sbjct  121  VPYWLSYPE  129



>ref|WP_011025660.1| aspartate aminotransferase [Caldanaerobacter subterraneus]
 gb|AAM24590.1| PLP-dependent aminotransferases [Caldanaerobacter subterraneus 
subsp. tengcongensis MB4]
Length=395

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            ++LS     + PS T+ IT +A  L   GV VI    GEPDFDTP+ I EA I+AI+ G+
Sbjct  1    MNLSQNALQITPSMTLEITAKAKQLKAQGVDVIDFGVGEPDFDTPSYIKEAAIDAIKRGY  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP++G  E+++AIC KL ++NGL+YTP+QI+VSNGAK SI  A+ A+ +PGDEV+IP
Sbjct  61   TKYTPSSGIPELKKAICEKLLKDNGLSYTPEQIVVSNGAKHSIYNALSAILNPGDEVIIP  120

Query  734  APFWVSYPE  760
             P+W+SYPE
Sbjct  121  VPYWLSYPE  129



>ref|WP_009147598.1| aspartate aminotransferase [Thiorhodovibrio sp. 970]
 gb|EIC23515.1| aspartate/tyrosine/aromatic aminotransferase [Thiorhodovibrio 
sp. 970]
Length=400

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            I LS RV AVKPS T+AIT +A AL  AG  VI L AGEPDFDTPA I EA I AIR+G 
Sbjct  3    IKLSARVQAVKPSATLAITARAKALRAAGKDVIGLGAGEPDFDTPAHIKEAAIKAIRDGF  62

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YT   GT E++ A+  K + ENGL +  DQILVS G KQS      AV  PGDEV+IP
Sbjct  63   TKYTAVDGTTELKAAVVAKFERENGLHFAADQILVSCGGKQSFYNLAQAVLDPGDEVIIP  122

Query  734  APFWVSYPE  760
            AP+WVSYP+
Sbjct  123  APYWVSYPD  131



>ref|WP_026963667.1| aspartate aminotransferase [Alicyclobacillus pomorum]
Length=395

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = +2

Query  380  LSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTR  559
            +S RV  + PS T+++  +  AL + G PV+ ++ GEPDFDTP P + AGI AI EG+TR
Sbjct  5    ISSRVRNITPSATMSVDAKTKALLKEGKPVVNMSVGEPDFDTPVPASFAGIQAITEGNTR  64

Query  560  YTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAP  739
            YT  AGT+E+R+AI  KL  ENGL YTP+QI+VS+G K ++    LA+C  GDEV++PAP
Sbjct  65   YTAAAGTLELRKAIASKLMVENGLQYTPEQIVVSSGGKHALFNIFLAICDDGDEVVLPAP  124

Query  740  FWVSYPEN  763
            +WVSYPE 
Sbjct  125  YWVSYPEQ  132



>ref|WP_012693528.1| aspartate aminotransferase [Deinococcus deserti]
 gb|ACO46405.1| putative Aspartate transaminase (Aspartate aminotransferase) 
(Transaminase A) [Deinococcus deserti VCD115]
Length=388

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
             +LS R  ++KPS TVA+T +A  L +AGV VI ++ GEPDFDTP  I  A I+AIR G 
Sbjct  5    FTLSQRALSLKPSATVAVTSRALELRRAGVDVISMSVGEPDFDTPEHIKAAAIHAIRSGQ  64

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP +G  E+R+AI  K + ENGL Y PD + V++G KQ++  A  A+ +PGDEVLIP
Sbjct  65   TKYTPVSGIPELREAISDKFRRENGLDYAPDAVTVTSGGKQALFNAFFALLNPGDEVLIP  124

Query  734  APFWVSYPE  760
            AP+WVSYPE
Sbjct  125  APYWVSYPE  133



>ref|WP_012281785.1| aspartate aminotransferase [Heliobacterium modesticaldum]
 gb|ABZ83250.1| aspartate aminotransferase [Heliobacterium modesticaldum Ice1]
Length=397

 Score =   153 bits (387),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            ++LS +  ++ PS T++I  +A  +   GV VI   AGEPDFDTP  + +A I AI  G 
Sbjct  1    MNLSKKGLSIHPSPTLSIDAKAKKMRSEGVDVIGFGAGEPDFDTPDHVKQAAIAAIEAGF  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP +GT+E++QAIC KLK ENG+ Y P  I+VSNGAK S++ A  A+C+PGDEV+IP
Sbjct  61   TKYTPASGTLELKQAICDKLKAENGVDYAPANIIVSNGAKHSLVNAFEAICNPGDEVIIP  120

Query  734  APFWVSYPENGKV  772
            AP+WVSYPE  K+
Sbjct  121  APYWVSYPEMVKL  133



>ref|WP_003866779.1| aspartate aminotransferase [Thermoanaerobacter ethanolicus]
 gb|EEU63420.1| aminotransferase class I and II [Thermoanaerobacter ethanolicus 
CCSD1]
Length=395

 Score =   153 bits (386),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + LS     + PS T+ IT +A  L   GV VI    GEPDFDTP  I EA I+AI++G+
Sbjct  1    MDLSQNALQITPSMTLEITAKAKQLKAQGVDVIDFGVGEPDFDTPDYIKEAAIDAIKKGY  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP++G  E+++A+C KL ++NGL Y PDQI++SNGAK SI  A+ A+ +PGDEV+IP
Sbjct  61   TKYTPSSGISELKKAVCDKLLKDNGLKYQPDQIVISNGAKHSIYNALCAILNPGDEVIIP  120

Query  734  APFWVSYPE  760
             P+W+SYPE
Sbjct  121  VPYWLSYPE  129



>ref|WP_038290506.1| aspartate aminotransferase [[Clostridium] straminisolvens]
 dbj|GAE89978.1| aspartate aminotransferase [ [[Clostridium] straminisolvens JCM 
21531]
Length=395

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 94/131 (72%), Gaps = 0/131 (0%)
 Frame = +2

Query  380  LSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTR  559
            +S +  ++ PS T+AI  +A  +   G+ +I   AGEPDFDTP  I +A I+AI +G T+
Sbjct  3    VSNKALSISPSSTLAIDAKAKKMRSEGIDIIGFGAGEPDFDTPDHIKKAAIDAINDGFTK  62

Query  560  YTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAP  739
            YTP +GT+E++QAIC K K++NGL Y P  I++SNGAK S++ A  A+C+PGDEV+IP P
Sbjct  63   YTPASGTLELKQAICRKFKKDNGLDYNPSNIVISNGAKHSLVNAFQAICNPGDEVIIPTP  122

Query  740  FWVSYPENGKV  772
             WVSYPE  K+
Sbjct  123  AWVSYPEMVKL  133



>ref|WP_007194976.1| aspartate aminotransferase [Thiocapsa marina]
 gb|EGV16734.1| Aspartate transaminase [Thiocapsa marina 5811]
Length=394

 Score =   152 bits (385),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            I L+ RV AVKPS T+AIT +A AL  AG  VI L AGEPDFDTP  I EA I AIR G 
Sbjct  3    IKLAARVQAVKPSATLAITARAKALRAAGKDVIGLGAGEPDFDTPDHIKEAAIAAIRAGF  62

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YT   GT E++QA+  K K ENGL Y  DQILVS G KQS      A+  PGDEV+IP
Sbjct  63   TKYTAVDGTTELKQAVIDKFKRENGLDYAHDQILVSCGGKQSFFNLAQALLDPGDEVVIP  122

Query  734  APFWVSYPE  760
            AP+WVSYP+
Sbjct  123  APYWVSYPD  131



>ref|WP_015280728.1| aspartate/tyrosine/aromatic aminotransferase [Thioflavicoccus 
mobilis]
 gb|AGA90587.1| aspartate/tyrosine/aromatic aminotransferase [Thioflavicoccus 
mobilis 8321]
Length=394

 Score =   152 bits (385),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 91/131 (69%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            + I LS RV AVKPS T+AIT +A AL  AG  VI L AGEPDFDTPA I EA I AI  
Sbjct  1    MSIKLSARVQAVKPSATLAITARAKALKAAGKDVIGLGAGEPDFDTPAHIKEAAIAAINR  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YTP  GT E++QAI  K + EN L +T DQILVS G KQS      AV  PGDEV+
Sbjct  61   GFTKYTPVDGTPELKQAIIAKFERENQLHFTADQILVSCGGKQSFYNLAQAVLDPGDEVV  120

Query  728  IPAPFWVSYPE  760
            IPAP+WVSYP+
Sbjct  121  IPAPYWVSYPD  131



>ref|WP_003869112.1| aspartate aminotransferase [Thermoanaerobacter ethanolicus]
 gb|EGD52841.1| aminotransferase class I and II [Thermoanaerobacter ethanolicus 
JW 200]
Length=395

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + LS     + PS T+ IT +A  L   G+ VI    GEPDFDTP  I EA I+AI++G+
Sbjct  1    MDLSQNALQITPSMTLEITAKAKQLKAQGIDVIDFGVGEPDFDTPDYIKEAAIDAIKKGY  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP++G  E+++A+C KL ++NGL Y PDQI++SNGAK SI  A+ A+ +PGDEV+IP
Sbjct  61   TKYTPSSGISELKKAVCDKLLKDNGLKYQPDQIVISNGAKHSIYNALCAILNPGDEVIIP  120

Query  734  APFWVSYPE  760
             P+W+SYPE
Sbjct  121  VPYWLSYPE  129



>ref|WP_035617440.1| aspartate aminotransferase [Hyphomonas johnsonii]
 gb|KCZ90724.1| aspartate aminotransferase [Hyphomonas johnsonii MHS-2]
Length=403

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            M  DI LS  +  VKPS T+A+T +A  L +AG  VI L AGEPDFDTP  I EA I AI
Sbjct  1    MAADILLSDALARVKPSATIAVTTKAAELRRAGHDVIGLGAGEPDFDTPDNIKEAAIQAI  60

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            R+G T+YTP  G  E+++AIC K   ENGLTYTP Q+ V+ G K  I  A+LA  +PGDE
Sbjct  61   RDGRTKYTPADGIPELKEAICAKFARENGLTYTPSQVHVAPGGKPVIYNALLATLNPGDE  120

Query  722  VLIPAPFWVSYPE  760
            V++PAP+WVSYPE
Sbjct  121  VIVPAPYWVSYPE  133



>ref|WP_004396233.1| MULTISPECIES: Aspartate/tyrosine/aromatic aminotransferase [Thermoanaerobacter]
 gb|EMT40259.1| Aspartate/tyrosine/aromatic aminotransferase [Thermoanaerobacter 
thermohydrosulfuricus WC1]
Length=395

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + LS     + PS T+ IT +A  L   G+ VI    GEPDFDTP  I EA I+AI++G+
Sbjct  1    MDLSQNALQITPSMTLEITAKAKQLKAQGIDVIDFGVGEPDFDTPDYIKEAAIDAIKKGY  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP++G  E+++A+C KL ++NGL Y PDQI++SNGAK SI  A+ A+ +PGDEV+IP
Sbjct  61   TKYTPSSGISELKKAVCDKLLKDNGLKYQPDQIVISNGAKHSIYNALCAILNPGDEVIIP  120

Query  734  APFWVSYPE  760
             P+W+SYPE
Sbjct  121  VPYWLSYPE  129



>gb|ACJ58006.1| Aspartate aminotransferase A(Transaminase A) (AspAT) [Acinetobacter 
baumannii AB307-0294]
Length=270

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_022587741.1| aspartate aminotransferase [Caldanaerobacter subterraneus]
 gb|ERM92353.1| aspartate aminotransferase [Caldanaerobacter subterraneus subsp. 
yonseiensis KB-1]
Length=395

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            ++LS     + PS T+ IT +A  L   GV VI    GEPDFDTP  I EA I+AI+ G+
Sbjct  1    MNLSQNALQITPSMTLEITAKAKQLKAQGVDVIDFGVGEPDFDTPDYIKEAAIDAIKRGY  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP++G  E+++AIC KL ++NGL YTP+QI+VSNGAK SI  A+ A+ +PGDEV+IP
Sbjct  61   TKYTPSSGIPELKKAICEKLLKDNGLHYTPEQIVVSNGAKHSIYNALSAILNPGDEVIIP  120

Query  734  APFWVSYPE  760
             P+W+SYPE
Sbjct  121  VPYWLSYPE  129



>ref|WP_034769206.1| aspartate aminotransferase [Hyphomonas sp. CY54-11-8]
 gb|KCZ45709.1| aspartate aminotransferase [Hyphomonas sp. CY54-11-8]
Length=403

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            M  D+ LS  ++ VKPS T+A+T +A  L +AG  VI L AGEPDFDTP  I  AGI AI
Sbjct  1    MAADLRLSDALDRVKPSATIAVTTKAAELKRAGHDVIGLGAGEPDFDTPENIKAAGIRAI  60

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            +EG T+YTP  G  E+++AIC K K ENGLTYTP QI V+ G K  I  A++A  +PGDE
Sbjct  61   QEGKTKYTPADGLPELKEAICGKFKRENGLTYTPAQIHVAPGGKPVIYNALVATLNPGDE  120

Query  722  VLIPAPFWVSYPE  760
            V+ PAP+WVSYPE
Sbjct  121  VICPAPYWVSYPE  133



>ref|WP_038169349.1| aspartate aminotransferase [Verrucomicrobium sp. BvORR106]
Length=388

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +2

Query  380  LSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTR  559
            +S  V+ + PS T++IT QA AL + GV V+  +AGEPDF+TPA I EA I A+++G TR
Sbjct  4    ISKNVSELAPSLTLSITSQAKALKKQGVDVLSFSAGEPDFNTPAHITEAAIKALQDGQTR  63

Query  560  YTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAP  739
            YT ++G +E+R+AI  K + ENGL Y P QI V+ GAK S   A+LAVC+PGDEV+IP+P
Sbjct  64   YTESSGLLELREAISAKFEVENGLKYAPSQISVNCGAKHSCYNAILAVCNPGDEVIIPSP  123

Query  740  FWVSYPE  760
            +W SYPE
Sbjct  124  YWTSYPE  130



>ref|WP_009962470.1| aspartate aminotransferase [Verrucomicrobium spinosum]
Length=388

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +2

Query  380  LSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTR  559
            +S  V+ + PS T++IT QA AL + GV V+   AGEPDF+TPA I EA I A+++G TR
Sbjct  4    ISKNVSELAPSLTLSITSQAKALKKQGVDVLSFGAGEPDFNTPAHITEAAIKALQDGQTR  63

Query  560  YTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAP  739
            YT ++G +E+R+AI  K + +NGL Y+P QI V+ GAK S   A+LAVC+PGDEV+IPAP
Sbjct  64   YTESSGLIELREAISAKFEMDNGLKYSPSQISVNCGAKHSCYNAILAVCNPGDEVIIPAP  123

Query  740  FWVSYPE  760
            +W SYPE
Sbjct  124  YWTSYPE  130



>gb|EEG73126.1| aminotransferase, class I/II [ [[Clostridium] hylemonae DSM 15053]
Length=402

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            ++LS +   VKPS T+AIT +A A+   G+ V+   AGEPDF+TP  I EA I AIR G 
Sbjct  7    LTLSEKAARVKPSSTLAITAKAKAMKAEGIDVVGFGAGEPDFNTPDNINEAAIRAIRSGF  66

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP +GT+E+++AI  K +E NGL Y PDQI+VSNG K S+     A+ +PGDEV+IP
Sbjct  67   TKYTPASGTVELKKAISSKFREFNGLDYAPDQIVVSNGGKHSLTNIFQAITNPGDEVIIP  126

Query  734  APFWVSYPE  760
            AP+W++YPE
Sbjct  127  APYWLTYPE  135



>ref|WP_022175526.1| aspartate/tyrosine/aromatic aminotransferase [Firmicutes bacterium 
CAG:552]
 emb|CDB25017.1| aspartate/tyrosine/aromatic aminotransferase [Firmicutes bacterium 
CAG:552]
Length=398

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            +SLS R   V PS T+AI+ +A  +   G+ V+   AGEPDFDTP  I +A   A+ +G 
Sbjct  1    MSLSKRAMGVSPSLTLAISAKAKKMKADGLDVVSFGAGEPDFDTPKYIIDAAKEALDKGM  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            TRYTP +GTME+R+AIC KL+ ENG++Y P QI+VSNGAK S+  A+ A+   GDEV+IP
Sbjct  61   TRYTPASGTMELRKAICDKLQRENGVSYDPSQIVVSNGAKHSLSNAIRALIEEGDEVIIP  120

Query  734  APFWVSYPE  760
            APFW++YPE
Sbjct  121  APFWLTYPE  129



>ref|WP_003516296.1| aspartate aminotransferase [Ruminiclostridium thermocellum]
 gb|ABN51990.1| aminotransferase class I and II [Ruminiclostridium thermocellum 
ATCC 27405]
 gb|EEU02408.1| aminotransferase class I and II [Ruminiclostridium thermocellum 
DSM 2360]
 gb|EFB39136.1| aminotransferase class I and II [Ruminiclostridium thermocellum 
JW20]
 gb|ADU74529.1| aminotransferase class I and II [Ruminiclostridium thermocellum 
DSM 1313]
 gb|EIC05413.1| aminotransferase class I and II [Ruminiclostridium thermocellum 
YS]
 gb|EIC10598.1| aminotransferase class I and II [Ruminiclostridium thermocellum 
AD2]
 emb|CDG35450.1| Aspartate aminotransferase [Ruminiclostridium thermocellum BC1]
Length=395

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 93/131 (71%), Gaps = 0/131 (0%)
 Frame = +2

Query  380  LSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTR  559
            +S +  ++ PS T+AI  +A  +   G+ +I   AGEPDFDTP  I +A I+AI  G T+
Sbjct  3    VSKKALSISPSSTLAIDAKAKKMRSEGIDIIGFGAGEPDFDTPDHIKKAAIDAINAGFTK  62

Query  560  YTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAP  739
            YTP +GT+E++QAIC K K +NGL Y P  I++SNGAK S++ A+ A+C+PGDEV+IP P
Sbjct  63   YTPASGTLELKQAICRKFKRDNGLDYNPSNIVISNGAKHSLVNALQAICNPGDEVIIPTP  122

Query  740  FWVSYPENGKV  772
             WVSYPE  K+
Sbjct  123  AWVSYPEMVKL  133



>ref|WP_040435223.1| aspartate aminotransferase [[Clostridium] hylemonae]
Length=398

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            ++LS +   VKPS T+AIT +A A+   G+ V+   AGEPDF+TP  I EA I AIR G 
Sbjct  3    LTLSEKAARVKPSSTLAITAKAKAMKAEGIDVVGFGAGEPDFNTPDNINEAAIRAIRSGF  62

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP +GT+E+++AI  K +E NGL Y PDQI+VSNG K S+     A+ +PGDEV+IP
Sbjct  63   TKYTPASGTVELKKAISSKFREFNGLDYAPDQIVVSNGGKHSLTNIFQAITNPGDEVIIP  122

Query  734  APFWVSYPE  760
            AP+W++YPE
Sbjct  123  APYWLTYPE  131



>ref|WP_027981308.1| aspartate aminotransferase [gamma proteobacterium L18]
Length=402

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +2

Query  380  LSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTR  559
            ++ RV+ +KPS + A  D+A  L +AG  +I L  GEPDFDTPA I +A  +AI  G TR
Sbjct  6    IAARVHRIKPSPSSAAADRANELRRAGKSIINLVVGEPDFDTPAHIRQAACDAIENGETR  65

Query  560  YTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAP  739
            YT NAGT E+RQAI  KLK ENGL YTP Q++V+NGAK +I  A  A   PGDEVLIPAP
Sbjct  66   YTQNAGTPELRQAIVAKLKRENGLDYTPSQVVVTNGAKSAIYNAFSATLGPGDEVLIPAP  125

Query  740  FWVSYPE  760
            +WVSYP+
Sbjct  126  YWVSYPD  132



>ref|WP_042681840.1| aspartate aminotransferase [Anaerosalibacter sp. ND1]
Length=398

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            ++ +LS +   + PS T+ IT +A A+   GV VI   AGEPDF+TP  I EAGI AI +
Sbjct  1    MNFNLSKKSLEISPSLTLDITAKAKAMKAEGVDVISFGAGEPDFNTPKNIVEAGIEAIEQ  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G TRYTP +G +E+++A+C K K++N L+Y P+ I++S+GAK SI  A++A+ +PGDE++
Sbjct  61   GKTRYTPASGLIELKEAVCKKFKDDNNLSYLPENIIISSGAKHSIYNALMAITNPGDEII  120

Query  728  IPAPFWVSYPE  760
            I  P+WVSYPE
Sbjct  121  ISVPYWVSYPE  131



>ref|WP_038961179.1| aspartate aminotransferase [Atribacteria bacterium JGI 0000079-F20]
Length=396

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 97/134 (72%), Gaps = 0/134 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + +S +VN ++PS T+ I+ +A  + + G+ V+  +AGEPDFDTP  I +A   AI +G 
Sbjct  1    MKISQKVNLIEPSATLTISARAKTMKKNGLNVLSFSAGEPDFDTPQCIKDAAKLAIDQGF  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP +G +E+++AICHKLK+ENGLTY PD+++VS GAK S+  A+L +C   DEVL+P
Sbjct  61   TKYTPTSGILELKEAICHKLKKENGLTYHPDEVIVSCGAKHSLFNAILTLCDTDDEVLLP  120

Query  734  APFWVSYPENGKVG  775
             P+WV+Y E  ++ 
Sbjct  121  VPYWVTYVEQIRLA  134



>ref|WP_022450889.1| aspartate transaminase [Roseburia sp. CAG:303]
 emb|CDE54917.1| aspartate transaminase [Roseburia sp. CAG:303]
Length=399

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            ++LS +  AVKPS T+AIT +A  L   G+ V+   AGEPDF+TP  I  A I AI++G 
Sbjct  3    LTLSRKAQAVKPSSTLAITAKAKELKAQGLDVVGFGAGEPDFNTPDNICNAAIKAIKDGF  62

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP +G +E++QA+C K K+ NGL Y P QI++SNG K S+     A+ +PGDEV+IP
Sbjct  63   TKYTPASGIVELKQAVCDKFKKFNGLDYKPSQIVISNGGKHSLTNVFEAILNPGDEVIIP  122

Query  734  APFWVSYPE  760
            AP+W+SYPE
Sbjct  123  APYWLSYPE  131



>ref|WP_042757927.1| aspartate aminotransferase, partial [Acinetobacter baumannii]
 gb|KCX73345.1| aminotransferase class-V family protein, partial [Acinetobacter 
baumannii 855125]
Length=306

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_014759002.1| MULTISPECIES: aspartate aminotransferase [Thermoanaerobacterium]
 gb|AFK87163.1| aminotransferase class I and II [Thermoanaerobacterium saccharolyticum 
JW/SL-YS485]
 gb|ETO38164.1| class I and II aminotransferase [Thermoanaerobacterium aotearoense 
SCUT27]
Length=396

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 92/128 (72%), Gaps = 2/128 (2%)
 Frame = +2

Query  395  NAVK--PSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTRYTP  568
            NAVK  PS T+ ITD+A  L   G+ VI   AGEPDF TP  I +A + A+ + +T+YT 
Sbjct  6    NAVKITPSATLEITDRANKLKAQGIDVISFGAGEPDFATPQFIKDAAMEALNKNYTKYTA  65

Query  569  NAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAPFWV  748
            ++G  E+R+AIC KL  +NGL YT DQI+VSNGAK SI  A+LA+  PGDEV+IP+P+WV
Sbjct  66   SSGIKELREAICKKLLLDNGLNYTADQIVVSNGAKHSIFNAMLAILDPGDEVIIPSPYWV  125

Query  749  SYPENGKV  772
            SYPE  K+
Sbjct  126  SYPEMVKL  133



>ref|WP_034735961.1| aspartate aminotransferase [Hyphomonas chukchiensis]
 gb|KCZ60917.1| aspartate aminotransferase [Hyphomonas chukchiensis]
Length=403

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            M  DI L+  +  VKPS T+A+T +A  L  AG  VI L AGEPDFDTP  I EA I AI
Sbjct  1    MSADIRLADALERVKPSATIAVTTKAAELKSAGHDVIGLGAGEPDFDTPDNIKEAAIKAI  60

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG T+YTP  G  E++QAIC K   ENGLTY P Q+ V+ G K  I  A++A  +PGDE
Sbjct  61   REGKTKYTPADGLPELKQAICGKFLRENGLTYKPSQVHVAPGGKPVIYNALVATLNPGDE  120

Query  722  VLIPAPFWVSYPE  760
            V++PAP+WVSYPE
Sbjct  121  VIVPAPYWVSYPE  133



>ref|WP_042833036.1| aspartate aminotransferase [Thermoanaerobacter sp. YS13]
 gb|KHO62480.1| aspartate aminotransferase [Thermoanaerobacter sp. YS13]
Length=395

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + LS     + PS T+ IT +A  L   GV VI    GEPDFDTP  I EA I+AI++G+
Sbjct  1    MDLSQNALQITPSMTLEITAKAKQLKAQGVDVIDFGVGEPDFDTPDYIKEAAIDAIKKGY  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP++G  E+++A+C KL ++NGL Y P+QI++SNGAK SI  A+ A+ +PGDEV+IP
Sbjct  61   TKYTPSSGISELKKAVCDKLLKDNGLKYQPEQIVISNGAKHSIYNALCAILNPGDEVIIP  120

Query  734  APFWVSYPE  760
             P+W+SYPE
Sbjct  121  VPYWLSYPE  129



>ref|WP_026476078.1| aspartate aminotransferase [Alkaliphilus transvaalensis]
Length=395

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + LS +   + PS T+AI  +A  +   G+ VI    GEPDF+TP  I +A I A+ +G 
Sbjct  1    MKLSEKNQKIAPSVTLAIDSKAKQMQADGINVISFGVGEPDFNTPDNIKQAAIEAMDKGI  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            TRYT  +G  + R+A+C+KLKE+NGL YTPDQI+VSNGAKQS+  A+ AVC+PGDEV+IP
Sbjct  61   TRYTAASGLPKFREAVCYKLKEDNGLDYTPDQIVVSNGAKQSLFNALQAVCNPGDEVIIP  120

Query  734  APFWVSYPE  760
             P+WVSY E
Sbjct  121  VPYWVSYVE  129



>ref|WP_016846691.1| hypothetical protein, partial [Bradyrhizobium elkanii]
Length=219

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +2

Query  380  LSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTR  559
            LS  ++ VKPS T+A+TD+A AL  AG  VI L AGEPDFDTPA I  A I+AI  G T+
Sbjct  4    LSAALDRVKPSATIAVTDKARALKAAGRNVIGLGAGEPDFDTPANIKLAAIHAIEAGKTK  63

Query  560  YTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAP  739
            YT   G  E+++AI +K   ENGLTY P+Q++V  G KQ +  A++A  +PGDEV+IPAP
Sbjct  64   YTDVGGIPELKEAIINKFARENGLTYKPNQVIVGTGGKQVLYNALMATINPGDEVIIPAP  123

Query  740  FWVSYPE  760
            +WVSYPE
Sbjct  124  YWVSYPE  130



>ref|WP_027099478.1| aspartate aminotransferase [Clostridium paraputrificum]
Length=397

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            ++ S +   + PS T+AIT +A  L  AGV V+   AGEPDF+TP  I EA I ++ EG 
Sbjct  1    MNYSKKAMNITPSITLAITAKAKELKGAGVDVVSFGAGEPDFNTPKNIMEAAIKSMEEGK  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP +G +E+R+AIC KLKE+N L Y  +QI+VS GAKQ +  A +A+ +PGDEV++P
Sbjct  61   TKYTPTSGIIELREAICKKLKEDNNLHYNSNQIIVSTGAKQCLADAFMAILNPGDEVIVP  120

Query  734  APFWVSYPE  760
             P+WVSYPE
Sbjct  121  IPYWVSYPE  129



>ref|WP_026975467.1| aspartate aminotransferase [Alicyclobacillus contaminans]
Length=395

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +2

Query  380  LSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTR  559
            +S RV  + PS T+++  +  AL + G PV+ ++ GEPDF+TP P + AGI AI EG+TR
Sbjct  5    ISSRVRNIAPSATMSVDAKTKALLKEGKPVVNMSVGEPDFNTPLPASFAGIQAITEGNTR  64

Query  560  YTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAP  739
            YT  AGT+E+R+AI  KL  ENGL ++P+QI+VS+GAK S+    L++C  GDEV++PAP
Sbjct  65   YTAAAGTLELRRAIASKLMVENGLQFSPEQIVVSSGAKHSLFNIFLSICDDGDEVILPAP  124

Query  740  FWVSYPE  760
            +WVSYPE
Sbjct  125  YWVSYPE  131



>ref|WP_027417534.1| aspartate aminotransferase [Aneurinibacillus terranovensis]
Length=392

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            ++LS RV  V PSKT+AIT +A  L   G  V+ L AGEPDF+TP  I +A + A+ EG 
Sbjct  1    MNLSQRVEQVTPSKTLAITAKAKELKSQGFDVVGLGAGEPDFNTPQHIIDAAVKAMEEGQ  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YT  +G +E+++AIC KL ++NGL+Y P QILV+NGAK ++     A+ +PGDEV+IP
Sbjct  61   TKYTAASGIIELKKAICEKLADDNGLSYQPSQILVTNGAKHALYNLFQALLNPGDEVIIP  120

Query  734  APFWVSYPE  760
             P+WVSYPE
Sbjct  121  IPYWVSYPE  129



>ref|WP_023414707.1| aspartate aminotransferase [uncultured Thiohalocapsa sp. PB-PSB1]
 gb|ESQ09684.1| aspartate aminotransferase [uncultured Thiohalocapsa sp. PB-PSB1]
Length=395

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            I LS RV +VKPS T+AIT +A  L  AG  VI L AGEPDFDTP  I +A I AI +G 
Sbjct  3    IKLSARVQSVKPSATLAITARAKELRAAGQDVIGLGAGEPDFDTPEHIKQAAIAAIHDGF  62

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YT   GT E+++A+  K + +NGL YTPDQILVS G KQS      AV  PGDEV+IP
Sbjct  63   TKYTAVDGTPELKRAVMDKFRRDNGLDYTPDQILVSCGGKQSFFNMAQAVLEPGDEVVIP  122

Query  734  APFWVSYPE  760
            AP+WVSYP+
Sbjct  123  APYWVSYPD  131



>ref|WP_022224362.1| aspartate transaminase [Clostridium sp. CAG:253]
 emb|CDB88810.1| aspartate transaminase [Clostridium sp. CAG:253]
Length=399

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 91/131 (69%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            + + LS +  AVKPS T+AIT +A  L   G  V+   AGEPDF+TP  I EA I AI++
Sbjct  1    MSLELSKKAAAVKPSSTLAITAKAKELKAQGKDVVGFGAGEPDFNTPENICEAAIKAIKD  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YTP +GT E+++AI  K KE NGL Y  DQI++SNG K S+     A+ +PGDEV+
Sbjct  61   GFTKYTPASGTNELKEAISKKFKEFNGLDYDTDQIVISNGGKHSLTNIFTALLNPGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFW+SYPE
Sbjct  121  IPAPFWLSYPE  131



>ref|WP_006570420.1| aspartate aminotransferase [Thermoanaerobacter siderophilus]
 gb|EIW01173.1| aspartate/tyrosine/aromatic aminotransferase [Thermoanaerobacter 
siderophilus SR4]
Length=395

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + LS     + PS T+ IT +A  L   G+ VI    GEPDFDTP  I EA I+AI++G+
Sbjct  1    MDLSQNALQITPSMTLEITAKAKQLKAQGIDVIDFGVGEPDFDTPDYIKEAAIDAIKKGY  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP++G  E+++A+C KL ++NGL Y P+QI++SNGAK SI  A+ A+ +PGDEV+IP
Sbjct  61   TKYTPSSGISELKKAVCDKLLKDNGLKYQPEQIVISNGAKHSIYNALCAILNPGDEVIIP  120

Query  734  APFWVSYPE  760
             P+W+SYPE
Sbjct  121  VPYWLSYPE  129



>ref|WP_004663094.1| hypothetical protein [Acinetobacter sp. NIPH 236]
 gb|ENU26178.1| hypothetical protein F992_02512 [Acinetobacter sp. NIPH 236]
Length=411

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 93/131 (71%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI +
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINK  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPSLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_044559633.1| aspartate aminotransferase, partial [Azospirillum sp. B4]
Length=221

 Score =   146 bits (368),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +2

Query  380  LSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTR  559
            ++ R+  +KPS+T+A+T +A AL  AG  +I L AGEPDFDTP  I +A I AI+ G T+
Sbjct  4    VAERLARIKPSQTIAVTAKARALKAAGRDIIGLGAGEPDFDTPDNIKQAAIRAIQNGQTK  63

Query  560  YTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAP  739
            YT   GT E+++A+C K K ENGL Y P+Q+ V  G KQ I  A++A  SPGDEV+IPAP
Sbjct  64   YTDVDGTPELKRAVCLKFKRENGLEYKPEQVSVGTGGKQVIFNAMMATLSPGDEVIIPAP  123

Query  740  FWVSYPE  760
            +WVSYP+
Sbjct  124  YWVSYPD  130



>ref|WP_028991905.1| aspartate aminotransferase [Thermoanaerobacter thermocopriae]
Length=395

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            ++LS     + PS T+ IT +A  L   G+ VI    GEPDFDTP  I EA I+AI+ G+
Sbjct  1    MNLSQNALQITPSMTLEITAKAKQLKAKGIDVIDFGVGEPDFDTPDYIKEAAIDAIKNGY  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP++G  E+++A+C KL  +NGL Y P+QI++SNGAK SI  A+ A+ +PGDEV+IP
Sbjct  61   TKYTPSSGISELKKAVCDKLLRDNGLKYQPEQIVISNGAKHSIYNALCAILNPGDEVIIP  120

Query  734  APFWVSYPE  760
             P+W+SYPE
Sbjct  121  VPYWLSYPE  129



>ref|WP_005157664.1| MULTISPECIES: hypothetical protein [Acinetobacter]
 gb|ENW83863.1| hypothetical protein F908_00762 [Acinetobacter sp. NIPH 284]
 gb|ENX00494.1| hypothetical protein F900_02165 [Acinetobacter sp. ANC 3862]
Length=411

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 93/131 (71%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI +
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINK  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPSLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_039046918.1| aspartate aminotransferase [Acinetobacter junii]
Length=410

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 93/131 (71%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI +
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINK  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPSLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_012995221.1| MULTISPECIES: aspartate aminotransferase [Thermoanaerobacter]
 gb|ADD02426.1| aminotransferase class I and II [Thermoanaerobacter italicus 
Ab9]
 gb|ADH60929.1| aminotransferase class I and II [Thermoanaerobacter mathranii 
subsp. mathranii str. A3]
Length=395

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            ++LS     + PS T+ IT +A  L   G+ VI    GEPDFDTP  I EA I+AI+ G+
Sbjct  1    MNLSQNALQITPSMTLEITAKAKQLKAQGIDVIDFGVGEPDFDTPDYIKEAAIDAIKNGY  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP++G  E+++A+C KL  +NGL Y P+QI++SNGAK SI  A+ A+ +PGDEV+IP
Sbjct  61   TKYTPSSGISELKKAVCDKLLRDNGLKYQPEQIVISNGAKHSIYNALCAILNPGDEVIIP  120

Query  734  APFWVSYPE  760
             P+W+SYPE
Sbjct  121  VPYWLSYPE  129



>ref|WP_004953091.1| hypothetical protein [Acinetobacter junii]
 gb|ENV63932.1| hypothetical protein F949_01314 [Acinetobacter junii NIPH 182]
 gb|ENV67975.1| hypothetical protein F948_00551 [Acinetobacter junii CIP 64.5]
Length=410

 Score =   150 bits (380),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 93/131 (71%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI +
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINK  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPSLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_042890603.1| aspartate aminotransferase [Acinetobacter junii]
Length=410

 Score =   150 bits (380),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 93/131 (71%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI +
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINK  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPSLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_028880326.1| aspartate aminotransferase [Terasakiella pusilla]
Length=400

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +2

Query  380  LSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTR  559
            L+ +++ +KPS T+A++ +A  L  AG  VI L AGEPDFDTP  I +A I A+ EG TR
Sbjct  4    LADKLSRIKPSPTIAVSTKAAELKAAGRDVIGLGAGEPDFDTPQHIIDAAIKAMNEGKTR  63

Query  560  YTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAP  739
            YT  AGT E+R+AIC KLK +N LTYTPDQI V  G KQ+I  A++A  + GDEV+IPAP
Sbjct  64   YTAVAGTPELRKAICDKLKRDNDLTYTPDQITVGCGGKQTIYNALMATLNDGDEVIIPAP  123

Query  740  FWVSYPE  760
            +WVSYP+
Sbjct  124  YWVSYPD  130



>ref|WP_004913437.1| hypothetical protein [Acinetobacter junii]
 gb|ENV50110.1| hypothetical protein F953_02499 [Acinetobacter junii CIP 107470]
 gb|EPR86157.1| Aspartate aminotransferase [Acinetobacter junii MTCC 11364]
Length=410

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 93/131 (71%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI +
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINK  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPSLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_045656454.1| aspartate aminotransferase [Hyphomonadaceae bacterium BRH_c29]
 gb|KJS24904.1| aspartate aminotransferase [Hyphomonadaceae bacterium BRH_c29]
Length=403

 Score =   150 bits (379),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            M  D+ LS  ++ VKPS T+A+T +A  L +AG  VI L AGEPDFDTP  I EAGI AI
Sbjct  1    MAADLRLSDALDRVKPSATIAVTTKANELKRAGHDVIGLGAGEPDFDTPENIKEAGIRAI  60

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG T+YTP  G  E+++AI  K K ENGLTYT  QI V+ G K  I  A++A  +PGDE
Sbjct  61   REGKTKYTPADGIPELKEAIVGKFKRENGLTYTTAQIHVAPGGKPVIYNALVATLNPGDE  120

Query  722  VLIPAPFWVSYPE  760
            V+ PAP+WVSYPE
Sbjct  121  VICPAPYWVSYPE  133



>ref|WP_035672188.1| aspartate aminotransferase, partial [Bradyrhizobium liaoningense]
Length=133

 Score =   143 bits (360),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +2

Query  380  LSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTR  559
            L+  ++ VKPS T+A+TD+A AL  AG  VI L AGEPDFDTPA I  A I+AI  G T+
Sbjct  6    LAAALDRVKPSATIAVTDKARALKAAGRNVIGLGAGEPDFDTPANIKLAAIHAIEAGKTK  65

Query  560  YTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAP  739
            YT   G  E+++AI  K + ENG+ Y P+QI+V  G KQ +  A++A  +PGDEV+IPAP
Sbjct  66   YTAVDGIPELKEAIIAKFQRENGVAYKPNQIIVGTGGKQVLYNALMATINPGDEVIIPAP  125

Query  740  FWVSYPE  760
            +WVSYPE
Sbjct  126  YWVSYPE  132



>ref|WP_018703726.1| MULTISPECIES: aspartate aminotransferase [Veillonellaceae]
Length=396

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            ++LS +  ++ PS T+AI  +A  L   G+ V+   AGEPDFDTP  I +A I AI  G 
Sbjct  1    MNLSRKGLSISPSATLAIDSKAKKLKAEGIDVVGFGAGEPDFDTPVHIKQAAIAAIEAGF  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP +GTM +++AIC K K++N L Y P  I++SNGAK S++    A+C+PGDEV+IP
Sbjct  61   TKYTPASGTMTLKEAICAKFKKDNDLDYAPANIVISNGAKHSLVNVFQAICNPGDEVIIP  120

Query  734  APFWVSYPENGKV  772
            APFWVSYPE  K+
Sbjct  121  APFWVSYPEMVKL  133



>ref|WP_014758717.1| MULTISPECIES: aspartate aminotransferase [Thermoanaerobacterium]
 gb|AFK86861.1| aminotransferase class I and II [Thermoanaerobacterium saccharolyticum 
JW/SL-YS485]
 gb|ETO39330.1| class I and II aminotransferase [Thermoanaerobacterium aotearoense 
SCUT27]
Length=395

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 96/131 (73%), Gaps = 0/131 (0%)
 Frame = +2

Query  380  LSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTR  559
            LS +  ++ PS T+ IT +A  + ++G+ VI   AGEPDFDTP  I EA I+AIREG+T+
Sbjct  3    LSDKALSISPSLTLDITAKANRMKKSGINVIGFGAGEPDFDTPDYIKEAAISAIREGYTK  62

Query  560  YTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAP  739
            YTP +G +E+++AI  KLK +N L+Y   QI+VSNGAKQ+I   + A+ + GDEV+IP+P
Sbjct  63   YTPTSGILELKEAIVQKLKRDNNLSYDVSQIVVSNGAKQAIFNTLCAILNQGDEVIIPSP  122

Query  740  FWVSYPENGKV  772
            +W+SYPE  K+
Sbjct  123  YWLSYPEMVKL  133



>ref|WP_014062870.1| aspartate aminotransferase [Thermoanaerobacter wiegelii]
 gb|AEM78746.1| aminotransferase class I and II [Thermoanaerobacter wiegelii 
Rt8.B1]
Length=395

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + LS     + PS T+ IT +A  L   G+ VI    GEPDFDTP  I EA I+AI++G+
Sbjct  1    MDLSQNALQITPSMTLEITAKAKQLKAQGIDVIDFGVGEPDFDTPDYIKEAAIDAIKKGY  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP++G  E+++A+C KL ++N L Y PDQI++SNGAK SI  A+ A+ +PGDEV+IP
Sbjct  61   TKYTPSSGISELKKAVCDKLLKDNDLKYQPDQIVISNGAKHSIYNALCAILNPGDEVIIP  120

Query  734  APFWVSYPE  760
             P+W+SYPE
Sbjct  121  VPYWLSYPE  129



>ref|WP_008516640.1| aspartate aminotransferase [Dethiobacter alkaliphilus]
 gb|EEG77605.1| aminotransferase class I and II [Dethiobacter alkaliphilus AHT 
1]
Length=396

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +2

Query  380  LSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTR  559
            LS +  ++ PS T+AI  +A  +   GV VI   AGEPDFDTP  I +A ++AI +G TR
Sbjct  2    LSKKAQSISPSPTLAIDAKAKKMKADGVDVIGFGAGEPDFDTPEHIKDAAVSAIHDGFTR  61

Query  560  YTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAP  739
            YTP AG ++++QAIC KL+ +NGLTY P++I+VSNGAK S+     A+ +PGDEV+IPAP
Sbjct  62   YTPVAGMLDLQQAICEKLQADNGLTYQPNEIVVSNGAKHSLTNVFAALLNPGDEVIIPAP  121

Query  740  FWVSYPE  760
            +WVSY E
Sbjct  122  YWVSYSE  128



>ref|WP_014254999.1| aspartate aminotransferase [[Clostridium] clariflavum]
 gb|AEV68413.1| aspartate/tyrosine/aromatic aminotransferase [ [[Clostridium] 
clariflavum DSM 19732]
Length=395

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + LS +  ++ PS T+AI  +A  +   G+ +I   AGEPDFDTP  I +A I AI +G 
Sbjct  1    MELSKKAQSISPSSTLAIDAKAKKMKAEGIDIIGFGAGEPDFDTPDHIKDAAIKAINDGF  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP +GT+E+++AIC K   +N L Y P  I++SNGAK S++ A  A+ +PGDEV+IP
Sbjct  61   TKYTPASGTLELKKAICDKFLNDNKLEYKPSNIVISNGAKHSLVNAFQAILNPGDEVIIP  120

Query  734  APFWVSYPENGKV  772
            APFWVSYPE  K+
Sbjct  121  APFWVSYPEMVKL  133



>ref|WP_035696301.1| aspartate aminotransferase, partial [Bradyrhizobium liaoningense]
Length=141

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +2

Query  380  LSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTR  559
            L+  ++ VKPS T+A+TD+A AL  AG  VI L AGEPDFDTPA I  A I+AI  G T+
Sbjct  6    LAAALDRVKPSATIAVTDKARALKAAGRNVIGLGAGEPDFDTPANIKLAAIHAIEAGKTK  65

Query  560  YTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAP  739
            YT   G  E+++AI  K + ENG+ Y P+QI+V  G KQ +  A++A  +PGDEV+IPAP
Sbjct  66   YTAVDGIPELKEAIIAKFQRENGVAYKPNQIIVGTGGKQVLYNALMATINPGDEVIIPAP  125

Query  740  FWVSYPE  760
            +WVSYPE
Sbjct  126  YWVSYPE  132



>ref|WP_014967681.1| aspartate aminotransferase [Gottschalkia acidurici]
 gb|AFS78545.1| aspartate aminotransferase AspB [ [[Clostridium] acidurici 9a]
Length=396

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 89/131 (68%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +  +LS +  ++ PS T+ IT +A  +  +G+ +I   AGEPDFDTP  I EAGI AI+E
Sbjct  1    MKFNLSKKALSISPSLTLEITAKAQEMRNSGIDIIGFGAGEPDFDTPVNIQEAGIKAIKE  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G TRYT  +G  E++  IC KLK EN L Y P  ILVS+G K SI  A+ A+ +PGDEV+
Sbjct  61   GKTRYTATSGIPELKTNICDKLKRENDLDYKPSNILVSSGGKHSIFNALYAILNPGDEVI  120

Query  728  IPAPFWVSYPE  760
            IP P+WVSYPE
Sbjct  121  IPVPYWVSYPE  131



>ref|WP_042050304.1| aspartate aminotransferase [Acinetobacter baumannii]
Length=409

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKHDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_000383204.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|EKP45023.1| aminotransferase, class I/II [Acinetobacter baumannii OIFC111]
 gb|EXB41942.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1461963]
 gb|EXH45517.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1293320]
Length=411

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_000383203.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|EXC71685.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1043794]
 gb|EXD92495.1| aminotransferase class-V family protein [Acinetobacter baumannii 
972082]
 gb|EXE95601.1| aminotransferase class-V family protein [Acinetobacter baumannii 
232184]
 gb|EXF08457.1| aminotransferase class-V family protein [Acinetobacter baumannii 
268680]
 gb|EXH04585.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1064293_45]
 gb|EYT23387.1| aminotransferase class-V family protein [Acinetobacter baumannii 
655378]
Length=411

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_031978052.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|ETQ96270.1| aminotransferase, class I/II [Acinetobacter baumannii UH6507]
Length=409

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_000383198.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|EKK15135.1| aminotransferase, class I/II [Acinetobacter baumannii OIFC0162]
 gb|EKU53988.1| aminotransferase, class I/II [Acinetobacter baumannii WC-348]
 gb|ELW97191.1| aminotransferase, class I/II [Acinetobacter baumannii OIFC047]
Length=409

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_031963257.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|EXA61767.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1035119]
Length=411

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_036548224.1| aspartate aminotransferase [Nitrincola lacisaponensis]
 gb|KDE39290.1| Aspartate aminotransferase [Nitrincola lacisaponensis]
Length=394

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 94/131 (72%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVN++KPS T+A+T++A  L  AG  +I L AGEPDFDTP  I  A I+AI  
Sbjct  1    MDVQLSDRVNSIKPSPTLAVTNRAAELRAAGKNIIGLGAGEPDFDTPDHIKAAAIDAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  K K +NGL+Y P+QILVS+G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKFKRDNGLSYEPNQILVSSGGKQSFFNMALALLNEGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAP+WVSYP+
Sbjct  121  IPAPYWVSYPD  131



>ref|WP_015451593.1| aspartate aminotransferase A [Acinetobacter baumannii]
 gb|AGH36380.1| aspartate aminotransferase A [Acinetobacter baumannii D1279779]
Length=410

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_032029528.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|EXB08912.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1397084]
Length=411

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_004707562.1| MULTISPECIES: hypothetical protein [Acinetobacter calcoaceticus/baumannii 
complex]
 gb|ENU48654.1| hypothetical protein F984_00168 [Acinetobacter nosocomialis NIPH 
2119]
 gb|EXB71517.1| aminotransferase class-V family protein [Acinetobacter baumannii 
21871]
 gb|EXR65615.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1424608]
 gb|EXT41068.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25977_8]
 gb|EXT46534.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25977_7]
 gb|EXT49112.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25977_6]
 gb|EXT53506.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25977_4]
 gb|EXT58149.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25977_3]
 gb|EXT61464.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25977_2]
 gb|EXT64542.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25977_1]
 gb|EXT75732.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25977_10]
 gb|KCY49944.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1571545]
 gb|KCY79284.1| aminotransferase class-V family protein [Acinetobacter baumannii 
796380-1375]
 gb|KCZ35044.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25977_9]
Length=411

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_002069248.1| aminotransferase, class I/II [Acinetobacter baumannii]
 gb|ELW90098.1| aminotransferase, class I/II [Acinetobacter baumannii AA-014]
Length=411

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_000383205.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|ETQ19509.1| aminotransferase, class I/II [Acinetobacter baumannii UH12208]
 gb|ETQ46377.1| aminotransferase, class I/II [Acinetobacter baumannii UH16208]
 gb|ETQ54502.1| aminotransferase, class I/II [Acinetobacter baumannii UH19608]
 gb|ETQ56640.1| aminotransferase, class I/II [Acinetobacter baumannii UH22908]
 gb|ETR08809.1| aminotransferase, class I/II [Acinetobacter baumannii UH6907]
 gb|ETR12455.1| aminotransferase, class I/II [Acinetobacter baumannii UH7607]
 gb|ETR21003.1| aminotransferase, class I/II [Acinetobacter baumannii UH7907]
 gb|AIL78801.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|AIS07400.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW84103.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW88217.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW90283.1| aspartate aminotransferase [Acinetobacter baumannii]
Length=411

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_000383202.1| aspartate aminotransferase [Acinetobacter baumannii]
 emb|CAM85896.1| aspartate aminotransferase A [Acinetobacter baumannii AYE]
 gb|ACJ42294.1| aspartate aminotransferase A [Acinetobacter baumannii AB0057]
 gb|EGJ59678.1| aspartate transaminase [Acinetobacter baumannii 6013150]
 gb|EGJ63841.1| aspartate transaminase [Acinetobacter baumannii 6013113]
 gb|EJG12395.1| aminotransferase, class I/II [Acinetobacter baumannii OIFC137]
 gb|EJG27251.1| aminotransferase, class I/II [Acinetobacter baumannii OIFC109]
 gb|EJO39283.1| aminotransferase, class I/II [Acinetobacter baumannii Canada 
BC-5]
 gb|EJO43231.1| aminotransferase, class I/II [Acinetobacter baumannii IS-123]
 gb|EJP57393.1| aminotransferase, class I/II [Acinetobacter baumannii Naval-81]
 gb|EKA74283.1| aminotransferase, class I/II [Acinetobacter baumannii IS-58]
 gb|EKK08384.1| aminotransferase, class I/II [Acinetobacter baumannii IS-235]
 gb|EKK18053.1| aminotransferase, class I/II [Acinetobacter baumannii IS-251]
 gb|EKL39249.1| aminotransferase, class I/II [Acinetobacter baumannii OIFC074]
 gb|EKL48856.1| aminotransferase, class I/II [Acinetobacter baumannii Naval-83]
 gb|EKL55877.1| aminotransferase, class I/II [Acinetobacter baumannii Naval-13]
 gb|EKP52968.1| aminotransferase, class I/II [Acinetobacter baumannii Naval-82]
 gb|EKP54949.1| aminotransferase, class I/II [Acinetobacter baumannii Naval-21]
 gb|EKP56508.1| aminotransferase, class I/II [Acinetobacter baumannii Canada 
BC1]
 gb|EKP59555.1| aminotransferase, class I/II [Acinetobacter baumannii WC-A-694]
 gb|EMT94403.1| aspartate aminotransferase A [Acinetobacter baumannii ABNIH6]
 gb|EMU00978.1| aspartate aminotransferase A [Acinetobacter baumannii ABNIH11]
 gb|EMU02393.1| aspartate aminotransferase A [Acinetobacter baumannii ABNIH7]
 gb|EMU18366.1| aspartate aminotransferase A [Acinetobacter baumannii ABNIH10]
 gb|EMU33814.1| aspartate aminotransferase A [Acinetobacter baumannii ABNIH19]
 gb|ENU50945.1| hypothetical protein F983_00962 [Acinetobacter baumannii NIPH 
1669]
 gb|ENV26970.1| hypothetical protein F962_00953 [Acinetobacter baumannii NIPH 
190]
 gb|ENW39434.1| hypothetical protein F921_00982 [Acinetobacter baumannii NIPH 
527]
 gb|ENW64117.1| hypothetical protein F914_01034 [Acinetobacter baumannii NIPH 
290]
 gb|ENW68381.1| hypothetical protein F912_02900 [Acinetobacter baumannii ANC 
4097]
 gb|EPS74946.1| aminotransferase, class I/II [Acinetobacter baumannii 1605]
 gb|EXB40706.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1440422]
 gb|EXD27586.1| aminotransferase class-V family protein [Acinetobacter baumannii 
29280]
 gb|EXE19299.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1106579]
 gb|EXE78186.1| aminotransferase class-V family protein [Acinetobacter baumannii 
83444]
 gb|EXG14266.1| aminotransferase class-V family protein [Acinetobacter baumannii 
472237-120]
 gb|EXH10440.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1188188]
 gb|EXH15969.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1271213]
 gb|EXH25263.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1237893]
 gb|EXI06042.1| aminotransferase class-V family protein [Acinetobacter baumannii 
480175]
 gb|EXR37407.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1276470-86]
 gb|EXS59968.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1406589]
 gb|EYT38335.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1121032]
 gb|EZF19214.1| hypothetical protein BA73_02061 [Acinetobacter baumannii R1B]
 gb|EZI42960.1| aminotransferase class-V family protein [Acinetobacter baumannii 
42057_6]
 gb|KCW18457.1| aminotransferase class-V family protein [Acinetobacter baumannii 
42057_4]
 gb|KCX10445.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45075_4]
 gb|KCX81891.1| aminotransferase class-V family protein [Acinetobacter baumannii 
940793]
 gb|KCZ15804.1| aminotransferase class-V family protein [Acinetobacter baumannii 
42057_3]
 gb|KCZ26092.1| aminotransferase class-V family protein [Acinetobacter baumannii 
42057_5]
 gb|KGP65977.1| aminotransferase, class I/II [Acinetobacter baumannii AB5075]
 gb|AJF82662.1| Aspartate aminotransferase A(Transaminase A) (AspAT) [Acinetobacter 
baumannii]
 gb|KIQ74058.1| Aspartate aminotransferase [Acinetobacter baumannii]
 gb|AKA30796.1| aspartate aminotransferase A [Acinetobacter baumannii]
Length=411

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_005131091.1| hypothetical protein [Acinetobacter baumannii]
 gb|ENW51087.1| hypothetical protein F917_00911 [Acinetobacter baumannii NIPH 
67]
Length=411

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_031952052.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|EXT82977.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25307_4]
Length=411

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_000383200.1| aspartate aminotransferase [Acinetobacter baumannii]
 emb|CAP00325.1| aspartate aminotransferase A [Acinetobacter baumannii SDF]
 gb|ACC58098.1| Aspartate/tyrosine/aromatic aminotransferase [Acinetobacter baumannii 
ACICU]
 gb|ADX04474.1| aspC [Acinetobacter baumannii 1656-2]
 gb|ADX93383.1| aspartate aminotransferase A [Acinetobacter baumannii TCDC-AB0715]
 gb|EGJ66842.1| aspartate transaminase [Acinetobacter baumannii 6014059]
 gb|EGK49179.1| aspartate/tyrosine/aromatic aminotransferase [Acinetobacter baumannii 
AB210]
 gb|EGT92939.1| aspartate aminotransferase A [Acinetobacter baumannii ABNIH1]
 gb|EGT93978.1| aspartate aminotransferase A [Acinetobacter baumannii ABNIH2]
 gb|EGT99891.1| aspartate aminotransferase A [Acinetobacter baumannii ABNIH3]
 gb|EGU02969.1| aspartate aminotransferase A [Acinetobacter baumannii ABNIH4]
 gb|AEP07429.1| aspartate aminotransferase A [Acinetobacter baumannii MDR-ZJ06]
 gb|AFI94551.1| aspartate/tyrosine/aromatic aminotransferase [Acinetobacter baumannii 
MDR-TJ]
 gb|EJG19327.1| aminotransferase, class I/II [Acinetobacter baumannii OIFC189]
 gb|EJG21966.1| aminotransferase, class I/II [Acinetobacter baumannii OIFC143]
 gb|EJG31799.1| aminotransferase, class I/II [Acinetobacter baumannii Naval-17]
 gb|EJP50480.1| aminotransferase, class I/II [Acinetobacter baumannii Naval-18]
 gb|EKA62997.1| aminotransferase, class I/II [Acinetobacter baumannii IS-143]
 gb|EKA70941.1| aminotransferase, class I/II [Acinetobacter baumannii WC-692]
 gb|EKB32980.1| hypothetical protein W9G_00150 [Acinetobacter baumannii Ab11111]
 gb|EKB37672.1| hypothetical protein W9K_00156 [Acinetobacter baumannii Ab33333]
 gb|EKB39295.1| hypothetical protein W9M_03322 [Acinetobacter baumannii Ab44444]
 gb|EKE61430.1| aspC [Acinetobacter baumannii ZWS1122]
 gb|EKE61983.1| aspC [Acinetobacter baumannii ZWS1219]
 gb|EKK10327.1| aminotransferase, class I/II [Acinetobacter baumannii Naval-72]
 gb|EKL53462.1| aminotransferase, class I/II [Acinetobacter baumannii OIFC180]
 gb|EKL57646.1| aminotransferase, class I/II [Acinetobacter baumannii OIFC110]
 gb|EKP55376.1| aminotransferase, class I/II [Acinetobacter baumannii Naval-2]
 gb|EKU63017.1| aminotransferase, class I/II [Acinetobacter baumannii Naval-113]
 gb|ELW83878.1| aminotransferase, class I/II [Acinetobacter baumannii WC-A-92]
 gb|ELW94307.1| aminotransferase, class I/II [Acinetobacter baumannii OIFC338]
 gb|ELX00660.1| aminotransferase, class I/II [Acinetobacter baumannii Naval-78]
 gb|EMT82684.1| aspC [Acinetobacter baumannii ABNIH25]
 gb|EMT83816.1| aspC [Acinetobacter baumannii ABNIH5]
 gb|EMT85200.1| aspC [Acinetobacter baumannii ABNIH26]
 gb|EMU13294.1| aspC [Acinetobacter baumannii ABNIH13]
 gb|EMU16251.1| aspC [Acinetobacter baumannii ABNIH14]
 gb|EMU22978.1| aspC [Acinetobacter baumannii ABNIH15]
 gb|EMU24552.1| aspC [Acinetobacter baumannii ABNIH16]
 gb|EMU32200.1| aspC [Acinetobacter baumannii ABNIH18]
 gb|EMU36616.1| aspC [Acinetobacter baumannii ABNIH17]
 gb|EMU43571.1| aspC [Acinetobacter baumannii ABNIH22]
 gb|EMU47433.1| aspC [Acinetobacter baumannii ABNIH23]
 gb|EMU48183.1| aspC [Acinetobacter baumannii ABNIH20]
 gb|EMU48788.1| aspC [Acinetobacter baumannii ABNIH24]
 gb|ENU13651.1| hypothetical protein F996_00901 [Acinetobacter baumannii NIPH 
24]
 gb|ENU56151.1| hypothetical protein F982_00176 [Acinetobacter baumannii NIPH 
1362]
 gb|ENU64564.1| hypothetical protein F979_03298 [Acinetobacter baumannii NIPH 
146]
 gb|ENU72993.1| hypothetical protein F977_02810 [Acinetobacter baumannii NIPH 
2061]
 gb|ENU77613.1| hypothetical protein F976_00945 [Acinetobacter baumannii NIPH 
1734]
 gb|ENW36501.1| hypothetical protein F922_00935 [Acinetobacter baumannii NIPH 
201]
 gb|ENW53639.1| hypothetical protein F918_00917 [Acinetobacter baumannii NIPH 
601]
 gb|ENW57663.1| hypothetical protein F916_02745 [Acinetobacter baumannii NIPH 
528]
 gb|AGQ15243.1| Aspartate/tyrosine/aromatic aminotransferase [Acinetobacter baumannii 
BJAB07104]
 gb|AGQ11304.1| Aspartate/tyrosine/aromatic aminotransferase [Acinetobacter baumannii 
BJAB0868]
 gb|ERH68576.1| aspartate aminotransferase [Acinetobacter baumannii EGD-HP18]
 dbj|BAN86805.1| aspartate aminotransferase A [Acinetobacter baumannii NCGM 237]
 emb|CDG79766.1| aspC [Acinetobacter baumannii 107m]
 gb|AHB90606.1| aspartate aminotransferase A [Acinetobacter baumannii ZW85-1]
 gb|ETP76504.1| aminotransferase, class I/II [Acinetobacter baumannii UH0207]
 gb|ETP85968.1| aminotransferase, class I/II [Acinetobacter baumannii UH0707]
 gb|ETP87659.1| aminotransferase, class I/II [Acinetobacter baumannii UH0807]
 gb|ETP88303.1| aminotransferase, class I/II [Acinetobacter baumannii UH1007]
 gb|ETP94566.1| aminotransferase, class I/II [Acinetobacter baumannii UH10707]
 gb|ETP96294.1| aminotransferase, class I/II [Acinetobacter baumannii UH10107]
 gb|ETP98590.1| aminotransferase, class I/II [Acinetobacter baumannii UH10007]
 gb|ETP99192.1| aminotransferase, class I/II [Acinetobacter baumannii UH11608]
 gb|ETQ06027.1| aminotransferase, class I/II [Acinetobacter baumannii UH12308]
 gb|ETQ10137.1| aminotransferase, class I/II [Acinetobacter baumannii UH12408]
 gb|ETQ17265.1| aminotransferase, class I/II [Acinetobacter baumannii UH13908]
 gb|ETQ20171.1| aminotransferase, class I/II [Acinetobacter baumannii UH12808]
 gb|ETQ23768.1| aminotransferase, class I/II [Acinetobacter baumannii UH15208]
 gb|ETQ25317.1| aminotransferase, class I/II [Acinetobacter baumannii UH14508]
 gb|ETQ35782.1| aminotransferase, class I/II [Acinetobacter baumannii UH16108]
 gb|ETQ36384.1| aminotransferase, class I/II [Acinetobacter baumannii UH16008]
 gb|ETQ42220.1| aminotransferase, class I/II [Acinetobacter baumannii UH18608]
 gb|ETQ49876.1| aminotransferase, class I/II [Acinetobacter baumannii UH19908]
 gb|ETQ57071.1| aminotransferase, class I/II [Acinetobacter baumannii UH20108]
 gb|ETQ65077.1| aminotransferase, class I/II [Acinetobacter baumannii UH2707]
 gb|ETQ67797.1| aminotransferase, class I/II [Acinetobacter baumannii UH2307]
 gb|ETQ71028.1| aminotransferase, class I/II [Acinetobacter baumannii UH2907]
 gb|ETQ71585.1| aminotransferase, class I/II [Acinetobacter baumannii UH5107]
 gb|ETQ86685.1| aminotransferase, class I/II [Acinetobacter baumannii UH5307]
 gb|ETQ91290.1| aminotransferase, class I/II [Acinetobacter baumannii UH5707]
 gb|ETQ93848.1| aminotransferase, class I/II [Acinetobacter baumannii UH6107]
 gb|ETQ99487.1| aminotransferase, class I/II [Acinetobacter baumannii UH6207]
 gb|ETR09925.1| aminotransferase, class I/II [Acinetobacter baumannii UH7007]
 gb|ETR13937.1| aminotransferase, class I/II [Acinetobacter baumannii UH7707]
 gb|ETR15692.1| aminotransferase, class I/II [Acinetobacter baumannii UH7807]
 gb|ETR29795.1| aminotransferase, class I/II [Acinetobacter baumannii UH8107]
 gb|ETR31801.1| aminotransferase, class I/II [Acinetobacter baumannii UH8707]
 gb|ETR33508.1| aminotransferase, class I/II [Acinetobacter baumannii UH8407]
 gb|ETR38484.1| aminotransferase, class I/II [Acinetobacter baumannii UH9007]
 gb|ETR39590.1| aminotransferase, class I/II [Acinetobacter baumannii UH8807]
 gb|ETR43656.1| aminotransferase, class I/II [Acinetobacter baumannii UH9707]
 gb|ETR51556.1| aminotransferase, class I/II [Acinetobacter baumannii UH9907]
 gb|ETR57509.1| aminotransferase, class I/II [Acinetobacter baumannii UH10707]
 gb|ETR62678.1| aminotransferase, class I/II [Acinetobacter baumannii UH9907]
 gb|ETR82129.1| aminotransferase class-V family protein [Acinetobacter baumannii 
CI86]
 gb|ETR84989.1| aminotransferase class-V family protein [Acinetobacter baumannii 
CI79]
 gb|ETR85202.1| aminotransferase class-V family protein [Acinetobacter baumannii 
CI77]
 gb|ETS66710.1| aminotransferase, class I/II [Acinetobacter baumannii UH3807]
 gb|ETS71993.1| aminotransferase, class I/II [Acinetobacter baumannii UH2107]
 gb|ETY68511.1| aspartate aminotransferase [Acinetobacter baumannii MDR_MMC4]
 gb|AHJ94232.1| aspartate aminotransferase [Acinetobacter baumannii PKAB07]
 gb|EXA64739.1| aminotransferase class-V family protein [Acinetobacter baumannii 
984213]
 gb|EXA79171.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1202252]
 gb|EXA81316.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1159076]
 gb|EXA84960.1| aminotransferase class-V family protein [Acinetobacter baumannii 
118362]
 gb|EXA96135.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1267820]
 gb|EXB02872.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1294217]
 gb|EXB21892.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1429530]
 gb|EXB24146.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1406750]
 gb|EXB36159.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1419130]
 gb|EXB65743.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1462234]
 gb|EXB85166.1| aminotransferase class-V family protein [Acinetobacter baumannii 
299505]
 gb|EXC00808.1| aminotransferase class-V family protein [Acinetobacter baumannii 
400834]
 gb|EXC02361.1| aminotransferase class-V family protein [Acinetobacter baumannii 
342950]
 gb|EXC08071.1| aminotransferase class-V family protein [Acinetobacter baumannii 
4749]
 gb|EXC09194.1| aminotransferase class-V family protein [Acinetobacter baumannii 
625974]
 gb|EXC15710.1| aminotransferase class-V family protein [Acinetobacter baumannii 
647609]
 gb|EXC24523.1| aminotransferase class-V family protein [Acinetobacter baumannii 
724909]
 gb|EXC44711.1| aminotransferase class-V family protein [Acinetobacter baumannii 
17534]
 gb|EXC48254.1| aminotransferase class-V family protein [Acinetobacter baumannii 
99063]
 gb|EXC48770.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1031433]
 gb|EXC56280.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1032241]
 gb|EXC63801.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1040094]
 gb|EXC71214.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1036938]
 gb|EXC76642.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1042969-1265]
 gb|EXC78742.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1046051]
 gb|EXC84663.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1043903]
 gb|EXC89559.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1046674]
 gb|EXC92340.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1051176]
 gb|EXC96445.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1051830]
 gb|EXD00931.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1075025]
 gb|EXD03642.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1247182]
 gb|EXD12761.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1289546]
 gb|EXD16138.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1297]
 gb|EXD20123.1| aminotransferase class-V family protein [Acinetobacter baumannii 
136706]
 gb|EXD26166.1| aminotransferase class-V family protein [Acinetobacter baumannii 
34654]
 gb|EXD34837.1| aminotransferase class-V family protein [Acinetobacter baumannii 
472237-1196]
 gb|EXD35816.1| aminotransferase class-V family protein [Acinetobacter baumannii 
34001]
 gb|EXD42503.1| aminotransferase class-V family protein [Acinetobacter baumannii 
562700]
 gb|EXD47340.1| aminotransferase class-V family protein [Acinetobacter baumannii 
532413]
 gb|EXD51443.1| aminotransferase class-V family protein [Acinetobacter baumannii 
564012]
 gb|EXD59151.1| aminotransferase class-V family protein [Acinetobacter baumannii 
653020]
 gb|EXD63944.1| aminotransferase class-V family protein [Acinetobacter baumannii 
796380-2102]
 gb|EXD69544.1| aminotransferase class-V family protein [Acinetobacter baumannii 
58452]
 gb|EXD71102.1| aminotransferase class-V family protein [Acinetobacter baumannii 
929679-2095]
 gb|EXD80636.1| aminotransferase class-V family protein [Acinetobacter baumannii 
942133]
 gb|EXD81119.1| aminotransferase class-V family protein [Acinetobacter baumannii 
947299]
 gb|EXD88712.1| aminotransferase class-V family protein [Acinetobacter baumannii 
993520]
 gb|EXD98386.1| aminotransferase class-V family protein [Acinetobacter baumannii 
942194]
 gb|EXD99193.1| aminotransferase class-V family protein [Acinetobacter baumannii 
959073]
 gb|EXE03505.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1291820]
 gb|EXE10987.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1277411]
 gb|EXE33160.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1440750]
 gb|EXE42633.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1526966]
 gb|EXE44658.1| aminotransferase class-V family protein [Acinetobacter baumannii 
554515]
 gb|EXE52240.1| aminotransferase class-V family protein [Acinetobacter baumannii 
43926]
 gb|EXE65650.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1552865]
 gb|EXE75438.1| aminotransferase class-V family protein [Acinetobacter baumannii 
144107]
 gb|EXE84149.1| aminotransferase class-V family protein [Acinetobacter baumannii 
42887]
 gb|EXE90084.1| aminotransferase class-V family protein [Acinetobacter baumannii 
532279]
 gb|EXF13629.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1575710]
 gb|EXF14474.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1593273]
 gb|EXF21883.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1417041]
 gb|EXF66493.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1552818]
 gb|EXG02509.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1552389]
 gb|EXG04676.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1488685]
 gb|EXG08678.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1426993]
 gb|EXG22563.1| aminotransferase class-V family protein [Acinetobacter baumannii 
470922]
 gb|EXG25971.1| aminotransferase class-V family protein [Acinetobacter baumannii 
458282]
 gb|EXG28403.1| aminotransferase class-V family protein [Acinetobacter baumannii 
323408]
 gb|EXG36429.1| aminotransferase class-V family protein [Acinetobacter baumannii 
121738]
 gb|EXG40897.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24860_8]
 gb|EXG47447.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24860_4]
 gb|EXG50206.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24860_7]
 gb|EXG52698.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24860_2]
 gb|EXG60693.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24812_6]
 gb|EXG62890.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24812_4]
 gb|EXG64434.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24860_10]
 gb|EXG71488.1| aminotransferase class-V family protein [Acinetobacter baumannii 
7893]
 gb|EXG77535.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1296252]
 gb|EXG90896.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1062314]
 gb|EXG97897.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1022959]
 gb|EXH02624.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1095464]
 gb|EXH08750.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1178044]
 gb|EXH24871.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1271651]
 gb|EXH36918.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1207552]
 gb|EXH46236.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1264936]
 gb|EXH50634.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1412924]
 gb|EXH62449.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1471012]
 gb|EXH64212.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1482820]
 gb|EXH69721.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1475764]
 gb|EXH84651.1| aminotransferase class-V family protein [Acinetobacter baumannii 
23671]
 gb|EXH84932.1| aminotransferase class-V family protein [Acinetobacter baumannii 
273929]
 gb|EXH92070.1| aminotransferase class-V family protein [Acinetobacter baumannii 
318814]
 gb|EXH94980.1| aminotransferase class-V family protein [Acinetobacter baumannii 
2887]
 gb|EXI21717.1| aminotransferase class-V family protein [Acinetobacter baumannii 
655555]
 gb|EXI25747.1| aminotransferase class-V family protein [Acinetobacter baumannii 
737393]
 gb|EXI31388.1| aminotransferase class-V family protein [Acinetobacter baumannii 
825610]
 gb|EXI33196.1| aminotransferase class-V family protein [Acinetobacter baumannii 
836190]
 gb|EXI43456.1| aminotransferase class-V family protein [Acinetobacter baumannii 
923118]
 gb|EXI45425.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1045092]
 gb|EXI50552.1| aminotransferase class-V family protein [Acinetobacter baumannii 
73736]
 gb|EXI51403.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1287985]
 gb|EXI53324.1| aminotransferase class-V family protein [Acinetobacter baumannii 
10519]
 gb|EXQ82832.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1058283]
 gb|EXQ95693.1| aminotransferase class-V family protein [Acinetobacter baumannii 
11126]
 gb|EXR02796.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1237202]
 gb|EXR05388.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1262761-97]
 gb|EXR07196.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1117819]
 gb|EXR17193.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1232509]
 gb|EXR31915.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1266220]
 gb|EXR47850.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1294222]
 gb|EXR52372.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1392509]
 gb|EXR55589.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1397513]
 gb|EXR64772.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1406182]
 gb|EXR77999.1| aminotransferase class-V family protein [Acinetobacter baumannii 
339786]
 gb|EXR88469.1| aminotransferase class-V family protein [Acinetobacter baumannii 
466215]
 gb|EXR98206.1| aminotransferase class-V family protein [Acinetobacter baumannii 
145660]
 gb|EXS05261.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1494580]
 gb|EXS15798.1| aminotransferase class-V family protein [Acinetobacter baumannii 
628418]
 gb|EXS20466.1| aminotransferase class-V family protein [Acinetobacter baumannii 
755829]
 gb|EXS32533.1| aminotransferase class-V family protein [Acinetobacter baumannii 
730795]
 gb|EXS45358.1| aminotransferase class-V family protein [Acinetobacter baumannii 
213697]
 gb|EXS52612.1| aminotransferase class-V family protein [Acinetobacter baumannii 
981176]
 gb|EXS56678.1| aminotransferase class-V family protein [Acinetobacter baumannii 
98826]
 gb|EXS63782.1| aminotransferase class-V family protein [Acinetobacter baumannii 
70136]
 gb|EXS67162.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25307_1]
 gb|EXS76553.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45002_7]
 gb|EXS79715.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45002_6]
 gb|EXS84579.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45002_5]
 gb|EXS88425.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45002_4]
 gb|EXS92043.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45002_3]
 gb|EXS98239.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45002_10]
 gb|EXT01947.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44895_9]
 gb|EXT04691.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45002_8]
 gb|EXT10426.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44895_6]
 gb|EXT13006.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44895_8]
 gb|EXT17835.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44895_5]
 gb|EXT21077.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44895_4]
 gb|EXT24394.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44895_3]
 gb|EXT29746.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44895_2]
 gb|EXT32616.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44895_1]
 gb|EXT37106.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44895_10]
 gb|EXT71061.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25307_8]
 gb|EXT75493.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25307_6]
 gb|EXT84118.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25307_5]
 gb|EXT87272.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25307_3]
 gb|EXT92281.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25253_8]
 gb|EXT97303.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25307_2]
 gb|EXU01170.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25253_7]
 gb|EXU03702.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25253_6]
 gb|EXU09032.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25253_5]
 gb|EXU09795.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25253_4]
 gb|EXU15629.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25253_3]
 gb|EXU20718.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25253_1]
 gb|EXU23293.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25253_10]
 gb|EXU31605.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24845_8]
 gb|EXU32352.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24845_7]
 gb|EXU34740.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24845_9]
 gb|EXU41243.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24845_5]
 gb|EXU45178.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24845_6]
 gb|EXU49218.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24845_4]
 gb|EXU52857.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24845_3]
 gb|EXU56909.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24845_1]
 gb|EXU59574.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24845_10]
 gb|EXV13688.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25561_2]
 gb|EXV16234.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25561_1]
 gb|EXV18790.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25561_7]
 gb|EXV24836.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24975_9]
 gb|EXV26163.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24975_7]
 gb|EXV30752.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24975_4]
 gb|EXV36299.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25935_10]
 gb|EXV38341.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24975_1]
 gb|EXV40977.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24975_5]
 gb|EXV41227.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25935_9]
 gb|EXV51056.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25935_8]
 gb|EXV55969.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25935_7]
 gb|EXV58696.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25935_6]
 gb|EXV65487.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25935_2]
 gb|EXV68470.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25935_5]
 gb|EXV72353.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25935_4]
 gb|EXV75557.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25935_1]
 gb|EXV80259.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25691_10]
 gb|EXV86765.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25691_6]
 gb|EXV87438.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25691_9]
 gb|EXV93439.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25691_2]
 gb|EXV96126.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25691_1]
 gb|EXV99890.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25766_10]
 gb|EXW05238.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25766_7]
 gb|EXW07757.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25766_9]
 gb|EXW11517.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25766_6]
 gb|EXW16988.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25766_5]
 gb|EXW20812.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25766_4]
 gb|EXW24940.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25766_3]
 gb|EXW27876.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25766_2]
 gb|EXW32173.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25561_10]
 gb|EXW36019.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25766_1]
 gb|EXW41298.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44327_6]
 gb|EXW47014.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44857_10]
 gb|EXW47620.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44857_9]
 gb|EXW50174.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44467_9]
 gb|EXW59178.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44467_8]
 gb|EXW60969.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44467_7]
 gb|EXW69045.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44467_6]
 gb|EXW69780.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44467_5]
 gb|EXW72695.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44467_4]
 gb|EXW78279.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44467_3]
 gb|EXW81825.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44467_2]
 gb|EXW85592.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44467_1]
 gb|EXW91686.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44467_10]
 gb|EXW94819.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44327_8]
 gb|EXW97319.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44327_7]
 gb|EXX07000.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44327_4]
 gb|EXX09561.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44327_2]
 gb|EXX13816.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44327_1]
 gb|EXX18897.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25750_7]
 gb|EXX21917.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25750_8]
 gb|EXX25181.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25750_6]
 gb|EXX30501.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25681_9]
 gb|EXX33629.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25681_8]
 gb|EXX40608.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25681_5]
 gb|EXX43204.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25681_6]
 gb|EXX45474.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25681_3]
 gb|EXX49814.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25681_2]
 gb|EYC57361.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44437_8]
 gb|EYC58230.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44437_7]
 gb|EYC64638.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44437_9]
 gb|EYC70285.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44437_5]
 gb|EYC74401.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44437_4]
 gb|EYC76244.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44437_3]
 gb|EYC82448.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44362_9]
 gb|EYC85978.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44362_8]
 gb|EYC89373.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44362_7]
 gb|EYC94642.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44362_5]
 gb|EYC99060.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44362_6]
 gb|EYD00805.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44362_4]
 gb|EYD09056.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44362_1]
 gb|EYD09739.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44362_3]
 gb|EYD13107.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44362_2]
 gb|EYD19290.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44362_10]
 gb|EYD22346.1| aminotransferase class-V family protein [Acinetobacter baumannii 
43557_1]
 gb|EYD24905.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25878_3]
 gb|EYD30153.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25493_9]
 gb|EYD33017.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25878_1]
 gb|EYD37430.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25493_8]
 gb|EYD41928.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25493_5]
 gb|EYD42569.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25493_6]
 gb|EYD43181.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25878_2]
 gb|EYD56673.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25493_3]
 gb|EYD58367.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25493_2]
 gb|EYD61644.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25493_1]
 gb|EYD67845.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25493_10]
 gb|EYR86755.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45052_1]
 gb|EYR91564.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25569_5]
 gb|EYR98510.1| aminotransferase class-V family protein [Acinetobacter baumannii 
26016_8]
 gb|EYS00060.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45057_4]
 gb|EYS05582.1| aminotransferase class-V family protein [Acinetobacter baumannii 
26016_5]
 gb|EYS08918.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25569_6]
 gb|EYS14216.1| aminotransferase class-V family protein [Acinetobacter baumannii 
26016_10]
 gb|EYS14476.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25569_7]
 gb|EYS18662.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25569_3]
 gb|EYS26612.1| aminotransferase class-V family protein [Acinetobacter baumannii 
26016_6]
 gb|EYS28716.1| aminotransferase class-V family protein [Acinetobacter baumannii 
26016_1]
 gb|EYS33476.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45052_3]
 gb|EYS34896.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45052_5]
 gb|EYS41932.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25569_4]
 gb|EYS43051.1| aminotransferase class-V family protein [Acinetobacter baumannii 
26016_4]
 gb|EYS46017.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25569_2]
 gb|EYS50912.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25569_1]
 gb|EYS55191.1| aminotransferase class-V family protein [Acinetobacter baumannii 
16553_10]
 gb|EYS58895.1| aminotransferase class-V family protein [Acinetobacter baumannii 
16553_9]
 gb|EYS63753.1| aminotransferase class-V family protein [Acinetobacter baumannii 
16553_8]
 gb|EYS67503.1| aminotransferase class-V family protein [Acinetobacter baumannii 
16553_6]
 gb|EYS71256.1| aminotransferase class-V family protein [Acinetobacter baumannii 
16553_4]
 gb|EYS75123.1| aminotransferase class-V family protein [Acinetobacter baumannii 
16553_3]
 gb|EYS77898.1| aminotransferase class-V family protein [Acinetobacter baumannii 
16553_2]
 gb|EYS84373.1| aminotransferase class-V family protein [Acinetobacter baumannii 
16553_1]
 gb|EYT41585.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1039621]
 gb|EYU53894.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1428368]
 gb|EZI40560.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45052_4]
 gb|EZI50122.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25442_9]
 gb|EZI54132.1| aminotransferase class-V family protein [Acinetobacter baumannii 
42057_2]
 gb|EZI61264.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25569_9]
 gb|EZI67113.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25442_5]
 gb|EZI67886.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25569_8]
 gb|EZI73463.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44298_10]
 gb|EZI77122.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44298_9]
 gb|EZI82559.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44298_7]
 gb|EZI86056.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44298_6]
 gb|EZI88491.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44298_4]
 gb|EZI94353.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44298_2]
 gb|EZI97157.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44298_1]
 gb|EZJ01247.1| aminotransferase class-V family protein [Acinetobacter baumannii 
26016_9]
 gb|EZJ05970.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44839_10]
 gb|EZJ09718.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24975_10]
 gb|EZJ13621.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24860_6]
 gb|EZJ19384.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24860_1]
 gb|AHX27475.1| aspartate aminotransferase [Acinetobacter baumannii AC12]
 gb|AHX63923.1| aspartate aminotransferase [Acinetobacter baumannii AC30]
 gb|KCV90079.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44298_5]
 gb|KCV91169.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44298_3]
 gb|KCV98195.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44298_8]
 gb|KCV99547.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44839_8]
 gb|KCW02314.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45075_1]
 gb|KCW08219.1| aminotransferase class-V family protein [Acinetobacter baumannii 
44839_9]
 gb|KCW09475.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45075_2]
 gb|KCW13038.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45075_3]
 gb|KCW20105.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25442_1]
 gb|KCW27124.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1064293_46]
 gb|KCW31037.1| aminotransferase class-V family protein [Acinetobacter baumannii 
6935]
 gb|KCW34784.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45075_5]
 gb|KCW40275.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45075_6]
 gb|KCW43949.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1032359]
 gb|KCX05605.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45075_8]
 gb|KCX08489.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45075_9]
 gb|KCX21493.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1539026]
 gb|KCX26282.1| aminotransferase class-V family protein [Acinetobacter baumannii 
18689]
 gb|KCX31643.1| aminotransferase class-V family protein [Acinetobacter baumannii 
916567]
 gb|KCX34734.1| aminotransferase class-V family protein [Acinetobacter baumannii 
96512]
 gb|KCX42468.1| aminotransferase class-V family protein [Acinetobacter baumannii 
987421]
 gb|KCX46086.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24812_2]
 gb|KCX48040.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25569_10]
 gb|KCX55490.1| aminotransferase class-V family protein [Acinetobacter baumannii 
135867]
 gb|KCX64755.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1146103]
 gb|KCX70864.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45075_10]
 gb|KCX91277.1| aminotransferase class-V family protein [Acinetobacter baumannii 
15827]
 gb|KCY08080.1| aminotransferase class-V family protein [Acinetobacter baumannii 
23037]
 gb|KCY16866.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1284800]
 gb|KCY33477.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1042969-1197]
 gb|KCY42164.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1276470-132]
 gb|KCY44370.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1505311]
 gb|KCY53561.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24812_8]
 gb|KCY57413.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24860_3]
 gb|KCY58351.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1288284]
 gb|KCY65237.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24860_5]
 gb|KCY70280.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24860_9]
 gb|KCY78724.1| aminotransferase class-V family protein [Acinetobacter baumannii 
756476]
 gb|KCY83989.1| aminotransferase class-V family protein [Acinetobacter baumannii 
24812_7]
 gb|KCY87899.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25691_5]
 gb|KCY93416.1| aminotransferase class-V family protein [Acinetobacter baumannii 
929679-598]
 gb|KCY97368.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25750_1]
 gb|KCY98906.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25691_8]
 gb|KCZ05468.1| aminotransferase class-V family protein [Acinetobacter baumannii 
26016_2]
 gb|KCZ07691.1| aminotransferase class-V family protein [Acinetobacter baumannii 
26016_3]
 gb|KCZ14334.1| aminotransferase class-V family protein [Acinetobacter baumannii 
26016_7]
 gb|KCZ23675.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45052_2]
 gb|KCZ33885.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45057_1]
 gb|KCZ40181.1| aminotransferase class-V family protein [Acinetobacter baumannii 
45002_9]
 gb|KCZ41461.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25691_7]
 gb|KDF05298.1| hypothetical protein AE30_02207 [Acinetobacter baumanii BIDMC 
56]
 gb|AIA51419.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KFB62983.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|AIL76599.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KGB46203.1| Aspartate aminotransferase [Acinetobacter baumannii DU202]
 gb|KGF60790.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHT70149.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHT72222.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHT75604.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHT76234.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHT84436.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHT84701.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHT93799.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHT97630.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV00855.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV04369.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV09034.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV11647.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV15573.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV16545.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV20057.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV29834.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV37282.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV39129.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV42914.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV45643.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV46356.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV55201.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV57769.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV59819.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV65199.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV67486.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV74726.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV74850.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV75917.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV82815.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV84636.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV97932.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHV99161.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW01695.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW03161.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW07239.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW17527.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW20090.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW23069.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW28610.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW30651.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW34371.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW34761.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW37412.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW43107.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW51823.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW54869.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW57019.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW58067.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW62807.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW69380.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW72190.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW75593.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW78680.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW89981.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW90934.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHW97165.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX01541.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX05725.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX06276.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX13165.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX18561.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX19509.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX25102.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX30215.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX34474.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX36484.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX42498.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX43348.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX53383.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX55617.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX57633.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX60430.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX63325.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX64444.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX69097.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX76554.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX77623.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX81748.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX85780.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX88000.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX97616.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX99569.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHX99858.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY07789.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY08482.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY10090.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY11798.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY19617.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY26557.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY30235.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY32946.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY34368.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY44262.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY45256.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY46648.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY55225.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY60799.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY63040.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY63534.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY66919.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY73288.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY79542.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY83729.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY88145.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY92459.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY95481.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHY96803.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ00635.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ05271.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ07295.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ09157.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ12602.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ15635.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ27443.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ28244.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ30774.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ32838.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ39690.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ43011.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ53430.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ54607.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ54876.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ62953.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ64997.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ65639.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ73947.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ74277.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ77023.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ84106.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ86432.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ89226.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KHZ95244.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KIA00140.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KIA03442.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KIA08289.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KIA09073.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KIA20008.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KIA22284.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KIA26744.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KIA30232.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KIA36265.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KIA37557.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KIA41410.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KIA45477.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KIA49056.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KIA56703.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KII24583.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJC66971.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJC67635.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJC71334.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJC71761.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJC81990.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJC86100.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJC86730.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJC88673.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJC99034.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJD01173.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJD02456.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJD08489.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJD09122.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJE58572.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJE60414.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJE64844.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJE70043.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJE71758.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJF01558.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJF06167.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJF09650.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJF13185.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJG72994.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJG79208.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KJG93961.1| Aspartate/tyrosine/aromatic aminotransferase [Acinetobacter baumannii]
 gb|KJX70948.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KKA96302.1| aspartate aminotransferase [Acinetobacter baumannii]
Length=411

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_032002345.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|EXB60411.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1465485]
Length=411

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_031972650.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|EYD51379.1| aminotransferase class-V family protein [Acinetobacter baumannii 
25493_4]
Length=411

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_031954187.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|EXG72534.1| degT/DnrJ/EryC1/StrS aminotransferase family protein [Acinetobacter 
baumannii 24812_10]
Length=411

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_000383197.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|EKA70553.1| aminotransferase, class I/II [Acinetobacter baumannii IS-116]
 gb|EKP39545.1| aminotransferase, class I/II [Acinetobacter baumannii OIFC065]
Length=411

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_000383199.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|EEX03153.1| aspartate transaminase [Acinetobacter baumannii ATCC 19606 = 
CIP 70.34]
 gb|EJP40761.1| aminotransferase, class I/II [Acinetobacter baumannii OIFC032]
 gb|EKL41400.1| aminotransferase, class I/II [Acinetobacter baumannii OIFC098]
 gb|EKP34305.1| aminotransferase, class I/II [Acinetobacter baumannii OIFC099]
 gb|EKP69346.1| aminotransferase, class I/II [Acinetobacter baumannii OIFC035]
 gb|ELX05604.1| aminotransferase, class I/II [Acinetobacter baumannii Naval-57]
 gb|EME53491.1| aspC [Acinetobacter baumannii MSP4-16]
 gb|ENU68451.1| hypothetical protein F978_03186 [Acinetobacter baumannii NIPH 
615]
 gb|ENV31112.1| hypothetical protein F961_00453 [Acinetobacter baumannii NIPH 
60]
 gb|ENW46099.1| hypothetical protein F920_00960 [Acinetobacter baumannii NIPH 
335]
 gb|ENW46367.1| hypothetical protein F919_00913 [Acinetobacter baumannii NIPH 
329]
 gb|ENW63413.1| hypothetical protein F915_00944 [Acinetobacter baumannii NIPH 
70]
 gb|ENW72891.1| hypothetical protein F913_01475 [Acinetobacter baumannii NIPH 
80]
 gb|ENW75854.1| hypothetical protein F911_01135 [Acinetobacter baumannii ATCC 
19606 = CIP 70.34]
 gb|EPG39868.1| aspartate aminotransferase [Acinetobacter baumannii NIPH 410]
 gb|AGQ07559.1| Aspartate/tyrosine/aromatic aminotransferase [Acinetobacter baumannii 
BJAB0715]
 gb|ETQ82213.1| aminotransferase, class I/II [Acinetobacter baumannii UH5207]
 gb|EXA58723.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1297549]
 gb|EXB92754.1| aminotransferase class-V family protein [Acinetobacter baumannii 
466760]
 gb|EXC37211.1| aminotransferase class-V family protein [Acinetobacter baumannii 
951631]
 gb|EXD55263.1| aminotransferase class-V family protein [Acinetobacter baumannii 
781407]
 gb|EXE08186.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1096934]
 gb|EXE23819.1| aminotransferase class-V family protein [Acinetobacter baumannii 
50595]
 gb|EXE32017.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1525283]
 gb|EXE37882.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1546444]
 gb|EXE66971.1| aminotransferase class-V family protein [Acinetobacter baumannii 
397971]
 gb|EXF23079.1| aminotransferase class-V family protein [Acinetobacter baumannii 
831240]
 gb|EXG10085.1| aminotransferase class-V family protein [Acinetobacter baumannii 
722310]
 gb|EXH57948.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1533268]
 gb|EXH96519.1| aminotransferase class-V family protein [Acinetobacter baumannii 
3390]
 gb|EXH98368.1| aminotransferase class-V family protein [Acinetobacter baumannii 
607805]
 gb|EXI05560.1| aminotransferase class-V family protein [Acinetobacter baumannii 
457946]
 gb|EXI40692.1| aminotransferase class-V family protein [Acinetobacter baumannii 
846928]
 gb|EXQ84021.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1007214]
 gb|EXQ91637.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1170863]
 gb|EXR11301.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1413735]
 gb|EXR21522.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1295549]
 gb|EXR49954.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1391434]
 gb|EXR72078.1| aminotransferase class-V family protein [Acinetobacter baumannii 
14216]
 gb|EXR82884.1| aminotransferase class-V family protein [Acinetobacter baumannii 
541915]
 gb|EXR84359.1| aminotransferase class-V family protein [Acinetobacter baumannii 
214216]
 gb|EXR93363.1| aminotransferase class-V family protein [Acinetobacter baumannii 
277047]
 gb|EXS39909.1| aminotransferase class-V family protein [Acinetobacter baumannii 
426863]
 gb|EYT30085.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1195185_11]
 gb|EYT35754.1| aminotransferase class-V family protein [Acinetobacter baumannii 
110912]
 gb|EZF15355.1| hypothetical protein BA71_01495 [Acinetobacter baumannii LAC-4]
 gb|KCX56428.1| aminotransferase class-V family protein [Acinetobacter baumannii 
496487]
 gb|KCX66692.1| aminotransferase class-V family protein [Acinetobacter baumannii 
855125]
 gb|KCX73657.1| aminotransferase class-V family protein [Acinetobacter baumannii 
855125]
 gb|KCX79097.1| aminotransferase class-V family protein [Acinetobacter baumannii 
754286]
 gb|KCY00203.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1499986]
 gb|KCY13361.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1598530]
 gb|KCY17758.1| aminotransferase class-V family protein [Acinetobacter baumannii 
21072]
 gb|KCY27752.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1195185_80]
 gb|KCY37607.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1262761-105]
 gb|KEF45309.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KEF47324.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KFC02900.1| cys/Met metabolism PLP-dependent enzyme family protein [Acinetobacter 
baumannii ATCC 19606 = CIP 70.34]
 gb|KFG11416.1| aspartate aminotransferase A [Acinetobacter baumannii]
 dbj|BAP65730.1| aspartate aminotransferase A [Acinetobacter baumannii]
 gb|AIY36319.1| aspartate/tyrosine/aromatic aminotransferase [Acinetobacter baumannii 
LAC-4]
 gb|KHV89773.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KIA17643.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|AJB66202.1| aspartate aminotransferase [Acinetobacter baumannii]
Length=409

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_038348431.1| aspartate aminotransferase [Acinetobacter baumannii]
Length=409

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_031965185.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|KCY24665.1| degT/DnrJ/EryC1/StrS aminotransferase family protein [Acinetobacter 
baumannii 233846]
Length=411

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>ref|WP_008428412.1| aspartate/tyrosine/aromatic aminotransferase [Clostridium sp. 
Maddingley MBC34-26]
 gb|EKQ51161.1| aspartate/tyrosine/aromatic aminotransferase [Clostridium sp. 
Maddingley MBC34-26]
Length=397

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            ++LS +   + PS T+AIT +A  L   GV VI   AGEPDF+TP  I +A I A+ EG 
Sbjct  1    MNLSKKAGNISPSITLAITAKANELKSQGVDVISFGAGEPDFNTPENIIQAAIKAMNEGK  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP  G +E++Q IC+K K +NGL Y P QI +S GAKQ +    +A  +PGDEVLIP
Sbjct  61   TKYTPAGGLLELKQTICNKFKNDNGLEYKPSQITISTGAKQCLANVFMAALNPGDEVLIP  120

Query  734  APFWVSYPE  760
             P+WVSYPE
Sbjct  121  VPYWVSYPE  129



>ref|WP_031995740.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|EXS09134.1| degT/DnrJ/EryC1/StrS aminotransferase family protein [Acinetobacter 
baumannii 303002]
 gb|EXX02589.1| degT/DnrJ/EryC1/StrS aminotransferase family protein [Acinetobacter 
baumannii 44327_5]
Length=411

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I +A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKDAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



>gb|EEB75560.1| aminotransferase, classes I and II superfamily [Caldanaerobacter 
subterraneus subsp. pacificus DSM 12653]
Length=382

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +2

Query  416  TVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGHTRYTPNAGTMEIRQ  595
            T+ IT +A  L   GV VI    GEPDFDTP+ I EA I+AI+ G+T+YTP++G  E+++
Sbjct  2    TLEITAKAKQLKAQGVDVIDFGVGEPDFDTPSYIKEAAIDAIKRGYTKYTPSSGIPELKK  61

Query  596  AICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIPAPFWVSYPE  760
            AIC KL ++NGL+YTP+QI+VSNGAK SI  A+ A+ +PGDEV+IP P+W+SYPE
Sbjct  62   AICEKLLKDNGLSYTPEQIVVSNGAKHSIYNALSAILNPGDEVIIPVPYWLSYPE  116



>ref|WP_035535287.1| aspartate aminotransferase [Hyphomonas oceanitis]
 gb|KDA03980.1| aspartate aminotransferase [Hyphomonas oceanitis SCH89]
Length=403

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = +2

Query  362  MEVDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAI  541
            M  +I L+  +  VKPS T+A+T +A  L  AG  VI L AGEPDFDTP  I EA I AI
Sbjct  1    MSAEIRLADALERVKPSATIAVTTKAAELKSAGHDVIGLGAGEPDFDTPDNIKEAAIRAI  60

Query  542  REGHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDE  721
            REG T+YTP  G  E++QAIC K   ENGLTY P Q+ V+ G K  I  A++A  +PGDE
Sbjct  61   REGKTKYTPADGLPELKQAICGKFLRENGLTYKPSQVHVAPGGKPVIYNALVATLNPGDE  120

Query  722  VLIPAPFWVSYPE  760
            V++PAP+WVSYPE
Sbjct  121  VIVPAPYWVSYPE  133



>ref|WP_044927429.1| aspartate aminotransferase [Clostridiales bacterium VE202-21]
Length=398

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            + +SLS +  +VKPS T+AIT +A AL   G+ ++   AGEPD++TP  I EA I AI+E
Sbjct  1    MSLSLSRKAASVKPSSTLAITAKAKALKAEGIDIVGFGAGEPDYNTPDNINEAAIRAIKE  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YTP +GT+E+++A+  K +E NGL Y P+QI++SNG K S+      + +PGDEV+
Sbjct  61   GFTKYTPASGTVELKKAVSDKFREFNGLNYEPNQIVISNGGKHSLTNIFEVLLNPGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAP+W++YPE
Sbjct  121  IPAPYWLTYPE  131



>ref|WP_022015081.1| aspartate transaminase [Clostridium sp. CAG:122]
 emb|CCZ42110.1| aspartate transaminase [Clostridium sp. CAG:122]
Length=399

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 90/131 (69%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            + + LS +  AVKPS T+AIT +A  L   G  V+   AGEPDF+TP  I EA I AI++
Sbjct  1    MSLELSKKAAAVKPSSTLAITAKAKELKAQGKDVVGFGAGEPDFNTPENICEAAIKAIKD  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YTP +GT E++ AI  K KE NGL Y  DQI++SNG K S+     A+ +PGDEV+
Sbjct  61   GFTKYTPASGTNELKAAISKKFKEFNGLDYDTDQIVISNGGKHSLTNIFTALINPGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFW+SYPE
Sbjct  121  IPAPFWLSYPE  131



>ref|WP_026291982.1| aspartate aminotransferase [Marinobacterium rhizophilum]
Length=395

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 94/131 (72%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVN++KPS T+A+T++A  L  AG  +I L AGEPDFDTP  I +A I A+ E
Sbjct  1    MDVQLSDRVNSIKPSPTLAVTNRAAELRAAGKNIIGLGAGEPDFDTPDHIKQAAIRALNE  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  K K++NGL Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIISKFKQDNGLEYAPNQILVSCGGKQSFFNLSLALLNAGDEVV  120

Query  728  IPAPFWVSYPE  760
            IPAP+WVSYP+
Sbjct  121  IPAPYWVSYPD  131



>ref|WP_013822400.1| aspartate aminotransferase [Desulfotomaculum kuznetsovii]
 gb|AEG14885.1| Aspartate transaminase [Desulfotomaculum kuznetsovii DSM 6115]
Length=397

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + L+ RV  + PS T+AI  +A  +  AG  VI   AGEPDFDTP  I EA + AIR+G 
Sbjct  1    MKLADRVKNISPSPTLAIDARAKKMIAAGEKVINFGAGEPDFDTPEHIKEAAMAAIRKGM  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP  GTME+++AI  KLK +NGL YTP+QI+VS GAK S+  A++ +  PGDEV++P
Sbjct  61   TKYTPVGGTMELKKAIIQKLKADNGLEYTPEQIVVSVGAKHSLYNAMMVLLQPGDEVILP  120

Query  734  APFWVSYPENGKV  772
            AP+WV+Y E  K+
Sbjct  121  APYWVTYLEQIKL  133



>ref|WP_014778995.1| aspartate aminotransferase [Thiocystis violascens]
 gb|AFL74553.1| aspartate/tyrosine/aromatic aminotransferase [Thiocystis violascens 
DSM 198]
Length=394

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            I L+ RV AVKPS T+AIT +A AL  AG  VI L AGEPDFDTP  I  A I AI+ G 
Sbjct  3    IKLAARVQAVKPSATLAITARAKALRAAGKDVIGLGAGEPDFDTPDHIKTAAIAAIQAGF  62

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YT   GT E++QA+  K K ENGL Y  DQILVS G KQS      A+  PGDEV+IP
Sbjct  63   TKYTAVDGTTELKQAVIDKFKRENGLEYAQDQILVSCGGKQSFFNLAQALLDPGDEVVIP  122

Query  734  APFWVSYPE  760
            AP+WVSYP+
Sbjct  123  APYWVSYPD  131



>ref|WP_022364144.1| aminotransferase class I and II [Clostridium sp. CAG:505]
 emb|CDD62418.1| aminotransferase class I and II [Clostridium sp. CAG:505]
Length=398

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + +S R  ++K S T+AI+ +A  L   G  ++    GEPDFDTPA I EA   AI EG 
Sbjct  1    MEVSRRAQSIKASSTLAISAKAAELKAQGKDMVTFGVGEPDFDTPAHIREAAKKAIDEGK  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            TRYTP AGT  +R+A+C KLK++NGL Y P Q+++SNGAK S++ A +A+ + GDEV+IP
Sbjct  61   TRYTPAAGTPALRKAVCDKLKKDNGLDYEPAQVVISNGAKHSLMNAFMAILNEGDEVIIP  120

Query  734  APFWVSYPENGKV  772
            APFW+SY E  K+
Sbjct  121  APFWLSYAEMVKI  133



>ref|WP_011195162.1| aspartate aminotransferase [Symbiobacterium thermophilum]
 dbj|BAD40015.1| aspartate aminotransferase [Symbiobacterium thermophilum IAM 
14863]
Length=397

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + LS R  A+ PS T+AI   +  +   G+ V+  + GEPDFDTP  I  AGI AI++G 
Sbjct  1    MRLSARARALTPSPTMAIDAMSKQMVAEGIDVVNFSVGEPDFDTPESIKAAGIAAIQQGE  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            T+YTP AGT+E+R+AIC KL+ +NGL Y P++I+VSNG KQS+  A   +  PG+EV+I 
Sbjct  61   TKYTPAAGTLELRKAICEKLERDNGLQYRPEEIVVSNGGKQSLYNAYQVLLDPGEEVIIQ  120

Query  734  APFWVSYPE  760
            AP+WVSYPE
Sbjct  121  APYWVSYPE  129



>ref|WP_034130426.1| aspartate aminotransferase [Peptococcaceae bacterium BICA1-8]
 gb|KJS87623.1| aspartate aminotransferase [Peptococcaceae bacterium BICA1-8]
Length=397

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + L+ RV  ++PSKT+ +  +A AL   G  V+    GEPDF+TP  I + GI AI E  
Sbjct  1    MRLAKRVRIIEPSKTLELMAKAKALKSEGKNVLEFQVGEPDFNTPEHIKKVGIKAIEENF  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            TRYTP+ GTME+R+AI  KL++EN L Y+P +++VSNG K  +   ++A+  PGDEV+IP
Sbjct  61   TRYTPSPGTMELRKAITEKLEKENNLKYSPSEVMVSNGGKHCLFNGIMALVDPGDEVIIP  120

Query  734  APFWVSYPENGKV  772
            AP+WV+YPE  K+
Sbjct  121  APYWVTYPEVVKI  133



>ref|WP_022254028.1| aminotransferase class I and II [Firmicutes bacterium CAG:466]
 emb|CDC28821.1| aminotransferase class I and II [Firmicutes bacterium CAG:466]
Length=398

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = +2

Query  374  ISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIREGH  553
            + +S R  ++K S T+AI+ +A  L   G  ++    GEPDFDTPA I EA   AI EG 
Sbjct  1    MEVSRRAQSIKASSTLAISAKAAELKAQGKDMVTFGVGEPDFDTPAHIREAAKKAIDEGK  60

Query  554  TRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVLIP  733
            TRYTP AGT  +R+A+C KLK++NGL Y P Q+++SNGAK S++ A +A+ + GDEV+IP
Sbjct  61   TRYTPAAGTPALRKAVCDKLKKDNGLDYEPAQVVISNGAKHSLMNAFMAILNEGDEVIIP  120

Query  734  APFWVSYPENGKV  772
            APFW+SY E  K+
Sbjct  121  APFWLSYAEMVKI  133



>ref|WP_032012250.1| aspartate aminotransferase [Acinetobacter baumannii]
 gb|EXR24996.1| aminotransferase class-V family protein [Acinetobacter baumannii 
1179249]
Length=411

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 91/131 (69%), Gaps = 0/131 (0%)
 Frame = +2

Query  368  VDISLSPRVNAVKPSKTVAITDQATALAQAGVPVIRLAAGEPDFDTPAPIAEAGINAIRE  547
            +D+ LS RVNA+KPS T+A+T++A  L  AG  VI L AGEPDFDTP  I  A I AI  
Sbjct  1    MDVRLSDRVNAIKPSPTLAVTNKAAELKAAGKNVIGLGAGEPDFDTPQHIKNAAIEAINN  60

Query  548  GHTRYTPNAGTMEIRQAICHKLKEENGLTYTPDQILVSNGAKQSILQAVLAVCSPGDEVL  727
            G T+YT   GT  +++AI  KLK +N L Y P+QILVS G KQS     LA+ + GDEV+
Sbjct  61   GFTKYTAVDGTPGLKKAIIAKLKRDNNLDYQPNQILVSCGGKQSFFNLALALLNKGDEVI  120

Query  728  IPAPFWVSYPE  760
            IPAPFWVSYP+
Sbjct  121  IPAPFWVSYPD  131



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1566421839775