BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10157

Length=721
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009762378.1|  PREDICTED: probable nucleoredoxin 1                281   1e-87   Nicotiana sylvestris
ref|XP_009626674.1|  PREDICTED: probable nucleoredoxin 1                278   8e-87   Nicotiana tomentosiformis
ref|XP_012085392.1|  PREDICTED: probable nucleoredoxin 1                278   6e-86   Jatropha curcas
emb|CDP00158.1|  unnamed protein product                                273   2e-84   Coffea canephora [robusta coffee]
gb|KJB31217.1|  hypothetical protein B456_005G181700                    269   2e-83   Gossypium raimondii
ref|XP_006365240.1|  PREDICTED: probable nucleoredoxin 1-like           270   8e-83   Solanum tuberosum [potatoes]
ref|XP_002525369.1|  nucleoredoxin, putative                            270   9e-83   
gb|KJB31218.1|  hypothetical protein B456_005G181700                    269   2e-82   Gossypium raimondii
ref|XP_004238662.1|  PREDICTED: probable nucleoredoxin 1                268   4e-82   Solanum lycopersicum
ref|XP_007225633.1|  hypothetical protein PRUPE_ppa003374mg             268   4e-82   Prunus persica
gb|KDO82404.1|  hypothetical protein CISIN_1g008336mg                   260   7e-82   Citrus sinensis [apfelsine]
gb|KHG25736.1|  hypothetical protein F383_04337                         266   2e-81   Gossypium arboreum [tree cotton]
ref|XP_010023550.1|  PREDICTED: probable nucleoredoxin 1 isoform X3     263   6e-81   
ref|XP_006483868.1|  PREDICTED: probable nucleoredoxin 1-like           265   6e-81   Citrus sinensis [apfelsine]
ref|XP_006438373.1|  hypothetical protein CICLE_v10031097mg             265   7e-81   Citrus clementina [clementine]
gb|KCW59853.1|  hypothetical protein EUGRSUZ_H025921                    252   9e-81   Eucalyptus grandis [rose gum]
ref|XP_007044667.1|  DC1 domain-containing protein                      263   2e-80   
ref|XP_008340047.1|  PREDICTED: probable nucleoredoxin 1                261   1e-79   Malus domestica [apple tree]
gb|AGV54528.1|  nucleoredoxin 1-like protein                            261   1e-79   Phaseolus vulgaris [French bean]
ref|XP_007153741.1|  hypothetical protein PHAVU_003G061100g             261   2e-79   Phaseolus vulgaris [French bean]
gb|KFK40790.1|  hypothetical protein AALP_AA2G041400                    261   2e-79   Arabis alpina [alpine rockcress]
ref|XP_007222066.1|  hypothetical protein PRUPE_ppa003234mg             261   2e-79   
ref|XP_010023549.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     259   3e-79   Eucalyptus grandis [rose gum]
ref|XP_004509957.1|  PREDICTED: probable nucleoredoxin 1-like           260   4e-79   
gb|KEH20025.1|  protein disulfide isomerase (PDI)-like protein          258   3e-78   Medicago truncatula
gb|KDO82401.1|  hypothetical protein CISIN_1g008336mg                   258   3e-78   Citrus sinensis [apfelsine]
ref|XP_010023554.1|  PREDICTED: probable nucleoredoxin 1 isoform X6     254   1e-77   Eucalyptus grandis [rose gum]
ref|XP_008221828.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     256   1e-77   Prunus mume [ume]
gb|KHN26883.1|  Putative nucleoredoxin 1                                255   2e-77   Glycine soja [wild soybean]
ref|XP_003532006.1|  PREDICTED: probable nucleoredoxin 1-like iso...    255   2e-77   Glycine max [soybeans]
ref|XP_011071086.1|  PREDICTED: probable nucleoredoxin 1                255   4e-77   Sesamum indicum [beniseed]
gb|ACJ85567.1|  unknown                                                 254   7e-77   Medicago truncatula
ref|XP_008221827.1|  PREDICTED: probable nucleoredoxin 1                253   1e-76   Prunus mume [ume]
ref|XP_010023552.1|  PREDICTED: probable nucleoredoxin 1 isoform X5     251   2e-76   
emb|CBI28535.3|  unnamed protein product                                254   2e-76   Vitis vinifera
ref|XP_008389658.1|  PREDICTED: probable nucleoredoxin 1                253   3e-76   Malus domestica [apple tree]
ref|XP_010023556.1|  PREDICTED: probable nucleoredoxin 1                252   6e-76   Eucalyptus grandis [rose gum]
ref|XP_010023551.1|  PREDICTED: probable nucleoredoxin 1 isoform X4     249   6e-76   
emb|CAN59927.1|  hypothetical protein VITISV_043885                     251   1e-75   Vitis vinifera
ref|XP_006392168.1|  hypothetical protein EUTSA_v10023374mg             250   2e-75   Eutrema salsugineum [saltwater cress]
ref|XP_004297483.1|  PREDICTED: probable nucleoredoxin 1                250   2e-75   Fragaria vesca subsp. vesca
gb|KEH20030.1|  protein disulfide isomerase (PDI)-like protein          248   3e-75   Medicago truncatula
ref|XP_010023548.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     249   4e-75   Eucalyptus grandis [rose gum]
gb|KCW59854.1|  hypothetical protein EUGRSUZ_H02593                     249   8e-75   Eucalyptus grandis [rose gum]
ref|XP_010651773.1|  PREDICTED: probable nucleoredoxin 1                238   2e-74   Vitis vinifera
gb|AAM64945.1|  PDI-like protein                                        247   4e-74   Arabidopsis thaliana [mouse-ear cress]
emb|CCD74518.1|  putative nucleoredoxin 1                               246   1e-73   Arabidopsis halleri subsp. halleri
ref|XP_003631262.2|  PREDICTED: uncharacterized protein LOC100852797    252   3e-73   
ref|XP_002888143.1|  DC1 domain-containing protein                      244   4e-73   Arabidopsis lyrata subsp. lyrata
ref|NP_564756.1|  protein reduce transmission through pollen            244   7e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010553606.1|  PREDICTED: probable nucleoredoxin 1                243   1e-72   Tarenaya hassleriana [spider flower]
ref|XP_008340046.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     243   1e-72   
ref|XP_008340045.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     243   1e-72   
ref|XP_010243058.1|  PREDICTED: probable nucleoredoxin 1                240   2e-72   Nelumbo nucifera [Indian lotus]
ref|XP_008792848.1|  PREDICTED: LOW QUALITY PROTEIN: probable nuc...    242   4e-72   Phoenix dactylifera
ref|XP_008459530.1|  PREDICTED: probable nucleoredoxin 1                241   8e-72   Cucumis melo [Oriental melon]
emb|CBI28541.3|  unnamed protein product                                239   8e-72   Vitis vinifera
ref|XP_010243057.1|  PREDICTED: probable nucleoredoxin 1                241   9e-72   Nelumbo nucifera [Indian lotus]
gb|AAU04766.1|  protein disulfide isomerase (PDI)-like protein 2        239   3e-71   Cucumis melo [Oriental melon]
ref|XP_008459528.1|  PREDICTED: probable nucleoredoxin 1                238   5e-71   Cucumis melo [Oriental melon]
gb|EYU22493.1|  hypothetical protein MIMGU_mgv1a003730mg                238   1e-70   Erythranthe guttata [common monkey flower]
emb|CAN77321.1|  hypothetical protein VITISV_008818                     237   2e-70   Vitis vinifera
ref|XP_010651402.1|  PREDICTED: probable nucleoredoxin 1                237   2e-70   Vitis vinifera
ref|XP_010100450.1|  putative nucleoredoxin 1                           237   2e-70   Morus notabilis
ref|XP_008782777.1|  PREDICTED: probable nucleoredoxin 1-1              236   9e-70   Phoenix dactylifera
ref|XP_010917444.1|  PREDICTED: LOW QUALITY PROTEIN: probable nuc...    236   1e-69   
ref|XP_011656057.1|  PREDICTED: probable nucleoredoxin 1                234   1e-69   Cucumis sativus [cucumbers]
ref|XP_008221826.1|  PREDICTED: probable nucleoredoxin 1                235   1e-69   
ref|XP_010937315.1|  PREDICTED: probable nucleoredoxin 1-2              233   2e-69   
emb|CBI28542.3|  unnamed protein product                                238   2e-69   Vitis vinifera
ref|XP_010937313.1|  PREDICTED: probable nucleoredoxin 1-2              233   3e-69   
ref|XP_009391725.1|  PREDICTED: probable nucleoredoxin 1                234   3e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006302027.1|  hypothetical protein CARUB_v10020010mg             234   6e-69   
ref|XP_010682547.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     227   9e-69   
ref|XP_004141529.1|  PREDICTED: probable nucleoredoxin 1                232   2e-68   Cucumis sativus [cucumbers]
emb|CAC87937.1|  PDI-like protein                                       230   3e-68   Quercus suber [cork oak]
gb|AAS02080.1|  protein disulfide isomerase                             230   3e-68   Quercus suber [cork oak]
ref|XP_010682544.1|  PREDICTED: probable nucleoredoxin 1                228   2e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010937316.1|  PREDICTED: probable nucleoredoxin 1-1              230   2e-67   Elaeis guineensis
emb|CDY60573.1|  BnaC01g43180D                                          228   8e-67   Brassica napus [oilseed rape]
emb|CDP13168.1|  unnamed protein product                                225   1e-66   Coffea canephora [robusta coffee]
ref|XP_010473222.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     227   2e-66   Camelina sativa [gold-of-pleasure]
gb|EYU22494.1|  hypothetical protein MIMGU_mgv1a005241mg                224   3e-66   Erythranthe guttata [common monkey flower]
gb|KDO82402.1|  hypothetical protein CISIN_1g008336mg                   226   3e-66   Citrus sinensis [apfelsine]
ref|XP_009103743.1|  PREDICTED: probable nucleoredoxin 1                226   3e-66   Brassica rapa
emb|CDY24527.1|  BnaA01g22310D                                          226   3e-66   Brassica napus [oilseed rape]
ref|XP_010682546.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     226   4e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010417977.1|  PREDICTED: probable nucleoredoxin 1                226   5e-66   Camelina sativa [gold-of-pleasure]
ref|XP_011014070.1|  PREDICTED: probable nucleoredoxin 1                225   5e-66   Populus euphratica
ref|XP_010510950.1|  PREDICTED: probable nucleoredoxin 1                225   7e-66   Camelina sativa [gold-of-pleasure]
ref|XP_004297482.1|  PREDICTED: probable nucleoredoxin 1                224   2e-65   Fragaria vesca subsp. vesca
emb|CBI28536.3|  unnamed protein product                                223   2e-65   Vitis vinifera
ref|XP_011014064.1|  PREDICTED: probable nucleoredoxin 1                213   2e-65   Populus euphratica
gb|ABK25230.1|  unknown                                                 219   4e-65   Picea sitchensis
ref|XP_008353015.1|  PREDICTED: probable nucleoredoxin 1                218   5e-65   Malus domestica [apple tree]
ref|XP_010937371.1|  PREDICTED: probable nucleoredoxin 1-1              223   6e-65   Elaeis guineensis
gb|EPS71977.1|  hypothetical protein M569_02774                         221   2e-64   Genlisea aurea
ref|XP_011041504.1|  PREDICTED: probable nucleoredoxin 1 isoform X3     218   1e-63   Populus euphratica
ref|XP_010682545.1|  PREDICTED: probable nucleoredoxin 1                218   5e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001105407.1|  nucleoredoxin1                                     217   8e-63   
gb|ERM99464.1|  hypothetical protein AMTR_s00131p00113720               218   8e-63   Amborella trichopoda
ref|XP_011041502.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     217   1e-62   Populus euphratica
ref|XP_008353016.1|  PREDICTED: LOW QUALITY PROTEIN: probable nuc...    217   1e-62   
ref|XP_011041503.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     217   1e-62   Populus euphratica
gb|ABK25413.1|  unknown                                                 217   1e-62   Picea sitchensis
ref|XP_006378294.1|  hypothetical protein POPTR_0010s06990g             216   1e-62   
ref|XP_004984067.1|  PREDICTED: probable nucleoredoxin 1-1-like         216   1e-62   Setaria italica
ref|XP_002314537.2|  hypothetical protein POPTR_0010s06940g             215   3e-62   
ref|XP_006378293.1|  disulfide isomerase family protein                 215   3e-62   
ref|XP_008389657.1|  PREDICTED: probable nucleoredoxin 1                215   3e-62   Malus domestica [apple tree]
ref|XP_004147954.1|  PREDICTED: probable nucleoredoxin 1                215   3e-62   Cucumis sativus [cucumbers]
ref|XP_008459538.1|  PREDICTED: probable nucleoredoxin 1                209   4e-62   Cucumis melo [Oriental melon]
emb|CCP27784.1|  unnamed protein product                                217   5e-62   Arabidopsis halleri subsp. halleri
ref|XP_002314536.2|  hypothetical protein POPTR_0010s06970g             213   5e-62   
tpg|DAA45727.1|  TPA: PDI-like protein                                  215   6e-62   
emb|CBI28543.3|  unnamed protein product                                214   7e-62   Vitis vinifera
gb|ACF82903.1|  unknown                                                 214   7e-62   Zea mays [maize]
ref|XP_002314533.2|  hypothetical protein POPTR_0010s06960g             214   8e-62   Populus trichocarpa [western balsam poplar]
ref|XP_008448920.1|  PREDICTED: probable nucleoredoxin 1                214   9e-62   Cucumis melo [Oriental melon]
ref|XP_002314534.2|  hypothetical protein POPTR_0010s07000g             214   1e-61   Populus trichocarpa [western balsam poplar]
emb|CAN63033.1|  hypothetical protein VITISV_044051                     214   1e-61   Vitis vinifera
ref|XP_010651408.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     214   1e-61   Vitis vinifera
ref|XP_009762379.1|  PREDICTED: probable nucleoredoxin 1                213   1e-61   Nicotiana sylvestris
ref|XP_006378292.1|  hypothetical protein POPTR_0010s06950g             213   2e-61   
ref|XP_011041505.1|  PREDICTED: probable nucleoredoxin 1                213   3e-61   Populus euphratica
ref|XP_006365237.1|  PREDICTED: probable nucleoredoxin 1-like           212   4e-61   Solanum tuberosum [potatoes]
ref|XP_009626672.1|  PREDICTED: probable nucleoredoxin 1                212   5e-61   Nicotiana tomentosiformis
ref|XP_006836611.2|  PREDICTED: uncharacterized protein LOC18427500     218   5e-61   Amborella trichopoda
ref|XP_010651414.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     212   6e-61   
ref|XP_002467709.1|  hypothetical protein SORBIDRAFT_01g032910          212   8e-61   Sorghum bicolor [broomcorn]
ref|XP_002314535.2|  hypothetical protein POPTR_0010s06980g             211   2e-60   
ref|XP_006378291.1|  hypothetical protein POPTR_0010s06930g             211   2e-60   
ref|NP_001050329.1|  Os03g0405500                                       211   2e-60   
ref|XP_011014066.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     210   3e-60   Populus euphratica
ref|XP_011014067.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     210   3e-60   Populus euphratica
ref|XP_011014069.1|  PREDICTED: probable nucleoredoxin 1 isoform X4     210   3e-60   Populus euphratica
ref|XP_011014068.1|  PREDICTED: probable nucleoredoxin 1 isoform X3     210   3e-60   Populus euphratica
ref|XP_003562828.1|  PREDICTED: probable nucleoredoxin 1-2              209   5e-60   Brachypodium distachyon [annual false brome]
ref|XP_003557743.1|  PREDICTED: probable nucleoredoxin 1-2              209   6e-60   Brachypodium distachyon [annual false brome]
gb|EMT12941.1|  Nucleoredoxin                                           209   1e-59   
gb|AHL29285.1|  nucleoredoxin                                           209   1e-59   Triticum aestivum [Canadian hard winter wheat]
gb|ABR16144.1|  unknown                                                 209   1e-59   Picea sitchensis
ref|XP_008221830.1|  PREDICTED: probable nucleoredoxin 1                208   2e-59   
ref|XP_007222607.1|  hypothetical protein PRUPE_ppa003530mg             208   2e-59   Prunus persica
gb|ABK25089.1|  unknown                                                 203   4e-59   Picea sitchensis
ref|XP_012085395.1|  PREDICTED: probable nucleoredoxin 1                197   6e-59   
ref|XP_002965590.1|  hypothetical protein SELMODRAFT_143457             203   3e-58   
ref|XP_002968070.1|  hypothetical protein SELMODRAFT_440252             204   9e-58   Selaginella moellendorffii
ref|XP_004239348.2|  PREDICTED: probable nucleoredoxin 1                203   1e-57   
gb|KGN52628.1|  hypothetical protein Csa_5G647500                       197   2e-57   Cucumis sativus [cucumbers]
ref|XP_008459536.1|  PREDICTED: probable nucleoredoxin 1 isoform X6     197   4e-57   
gb|ERM99461.1|  hypothetical protein AMTR_s00131p00112160               201   5e-57   Amborella trichopoda
ref|XP_008459535.1|  PREDICTED: probable nucleoredoxin 1-1 isofor...    197   8e-57   
ref|XP_002525368.1|  nucleoredoxin, putative                            201   1e-56   
ref|XP_008459534.1|  PREDICTED: probable nucleoredoxin 1-1 isofor...    197   1e-56   
ref|XP_008459533.1|  PREDICTED: probable nucleoredoxin 1 isoform X3     197   1e-56   
ref|XP_008459531.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     197   2e-56   Cucumis melo [Oriental melon]
ref|XP_008459532.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     197   2e-56   
gb|KGN52627.1|  hypothetical protein Csa_5G647490                       197   3e-56   Cucumis sativus [cucumbers]
gb|EAY90397.1|  hypothetical protein OsI_11974                          199   5e-56   Oryza sativa Indica Group [Indian rice]
gb|EEC75442.1|  hypothetical protein OsI_11975                          197   2e-55   Oryza sativa Indica Group [Indian rice]
sp|Q7Y0F2.1|NRX12_ORYSJ  RecName: Full=Probable nucleoredoxin 1-2...    197   2e-55   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ87919.1|  predicted protein                                      197   3e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAU89249.1|  C1-like domain containing protein                       197   1e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_012085394.1|  PREDICTED: probable nucleoredoxin 1                195   1e-54   Jatropha curcas
ref|XP_004141531.2|  PREDICTED: probable nucleoredoxin 1-2              197   2e-54   Cucumis sativus [cucumbers]
gb|AGH33853.1|  PDI4                                                    192   6e-54   Cucumis melo [Oriental melon]
gb|AAU04768.1|  protein disulfide isomerase (PDI)-like protein 4        189   8e-53   Cucumis melo [Oriental melon]
gb|ABR18079.1|  unknown                                                 184   4e-51   Picea sitchensis
ref|XP_010256393.1|  PREDICTED: uncharacterized protein LOC104596799    189   1e-50   Nelumbo nucifera [Indian lotus]
ref|XP_006292691.1|  hypothetical protein CARUB_v10018937mg             175   1e-47   
ref|XP_011627599.1|  PREDICTED: probable nucleoredoxin 2 isoform X2     170   2e-46   Amborella trichopoda
ref|XP_006855862.1|  PREDICTED: probable nucleoredoxin 2 isoform X1     169   4e-46   Amborella trichopoda
ref|XP_011083440.1|  PREDICTED: probable nucleoredoxin 2                169   6e-46   Sesamum indicum [beniseed]
ref|XP_010431903.1|  PREDICTED: probable nucleoredoxin 1                159   8e-45   Camelina sativa [gold-of-pleasure]
ref|NP_001130856.1|  hypothetical protein                               167   3e-44   Zea mays [maize]
ref|XP_010470488.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     159   3e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010470487.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     159   8e-44   Camelina sativa [gold-of-pleasure]
ref|XP_008466458.1|  PREDICTED: probable nucleoredoxin 2 isoform X1     160   1e-42   Cucumis melo [Oriental melon]
emb|CDP07350.1|  unnamed protein product                                160   2e-42   Coffea canephora [robusta coffee]
ref|XP_007221797.1|  hypothetical protein PRUPE_ppa006064mg             159   4e-42   Prunus persica
ref|XP_008221212.1|  PREDICTED: probable nucleoredoxin 2                159   4e-42   Prunus mume [ume]
ref|XP_008377128.1|  PREDICTED: probable nucleoredoxin 2                158   8e-42   Malus domestica [apple tree]
ref|XP_004986914.1|  PREDICTED: LOW QUALITY PROTEIN: probable nuc...    159   1e-41   
ref|XP_007017892.1|  DC1 domain-containing protein isoform 3            157   1e-41   Theobroma cacao [chocolate]
ref|XP_007017890.1|  DC1 domain-containing protein isoform 1            157   2e-41   
ref|XP_010266892.1|  PREDICTED: probable nucleoredoxin 2                157   3e-41   Nelumbo nucifera [Indian lotus]
ref|XP_003603818.1|  Nucleoredoxin                                      156   5e-41   Medicago truncatula
ref|XP_008387909.1|  PREDICTED: probable nucleoredoxin 2                156   5e-41   Malus domestica [apple tree]
ref|XP_009334668.1|  PREDICTED: probable nucleoredoxin 2                155   1e-40   Pyrus x bretschneideri [bai li]
ref|XP_004136369.1|  PREDICTED: probable nucleoredoxin 2                155   1e-40   Cucumis sativus [cucumbers]
ref|XP_002306954.1|  hypothetical protein POPTR_0005s26610g             155   1e-40   Populus trichocarpa [western balsam poplar]
ref|XP_010100128.1|  hypothetical protein L484_014319                   155   2e-40   
gb|KHN45956.1|  Putative nucleoredoxin 2                                154   2e-40   Glycine soja [wild soybean]
ref|NP_001276271.1|  probable nucleoredoxin 2-like                      154   2e-40   
ref|XP_006577959.1|  PREDICTED: probable nucleoredoxin 2-like iso...    154   3e-40   
ref|XP_009620045.1|  PREDICTED: probable nucleoredoxin 2 isoform X1     154   4e-40   Nicotiana tomentosiformis
ref|XP_011003080.1|  PREDICTED: probable nucleoredoxin 2                153   7e-40   Populus euphratica
ref|XP_012073729.1|  PREDICTED: probable nucleoredoxin 2                152   1e-39   Jatropha curcas
ref|XP_007136118.1|  hypothetical protein PHAVU_009G019400g             152   2e-39   Phaseolus vulgaris [French bean]
ref|XP_004238384.1|  PREDICTED: probable nucleoredoxin 2                152   2e-39   Solanum lycopersicum
gb|KHN09060.1|  Putative nucleoredoxin 2                                151   3e-39   Glycine soja [wild soybean]
ref|XP_003527520.1|  PREDICTED: probable nucleoredoxin 2-like iso...    150   4e-39   Glycine max [soybeans]
ref|XP_006342078.1|  PREDICTED: probable nucleoredoxin 2-like           150   5e-39   Solanum tuberosum [potatoes]
ref|XP_007222806.1|  hypothetical protein PRUPE_ppa005061mg             151   6e-39   
ref|XP_003527521.1|  PREDICTED: probable nucleoredoxin 2-like iso...    150   6e-39   Glycine max [soybeans]
gb|KJB14360.1|  hypothetical protein B456_002G121200                    149   9e-39   Gossypium raimondii
gb|KHG29175.1|  hypothetical protein F383_13074                         149   1e-38   Gossypium arboreum [tree cotton]
gb|KJB14359.1|  hypothetical protein B456_002G121200                    149   2e-38   Gossypium raimondii
gb|KJB14358.1|  hypothetical protein B456_002G121200                    149   3e-38   Gossypium raimondii
ref|XP_004500916.1|  PREDICTED: probable nucleoredoxin 2-like iso...    149   3e-38   
ref|XP_002510593.1|  nucleoredoxin, putative                            148   3e-38   Ricinus communis
gb|KJB14361.1|  hypothetical protein B456_002G121200                    149   3e-38   Gossypium raimondii
ref|XP_008221829.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     149   3e-38   Prunus mume [ume]
ref|XP_009417222.1|  PREDICTED: probable nucleoredoxin 2 isoform X1     147   4e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004291331.1|  PREDICTED: probable nucleoredoxin 2                148   4e-38   Fragaria vesca subsp. vesca
ref|XP_009798867.1|  PREDICTED: probable nucleoredoxin 2                148   4e-38   Nicotiana sylvestris
ref|XP_006378295.1|  hypothetical protein POPTR_0010s07010g             148   9e-38   
ref|XP_008806406.1|  PREDICTED: probable nucleoredoxin 2                147   1e-37   Phoenix dactylifera
ref|XP_008653605.1|  PREDICTED: probable nucleoredoxin 3                144   1e-37   Zea mays [maize]
ref|XP_010923905.1|  PREDICTED: probable nucleoredoxin 2                145   2e-37   Elaeis guineensis
ref|XP_010692758.1|  PREDICTED: probable nucleoredoxin 2                145   5e-37   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO82403.1|  hypothetical protein CISIN_1g008336mg                   145   6e-37   Citrus sinensis [apfelsine]
ref|XP_002285895.1|  PREDICTED: probable nucleoredoxin 2 isoform X1     145   7e-37   Vitis vinifera
ref|XP_011034968.1|  PREDICTED: probable nucleoredoxin 2                145   1e-36   Populus euphratica
ref|XP_006438372.1|  hypothetical protein CICLE_v10031097mg             145   1e-36   
ref|XP_008350516.1|  PREDICTED: probable nucleoredoxin 2                144   1e-36   
ref|XP_010266051.1|  PREDICTED: probable nucleoredoxin 2                143   3e-36   Nelumbo nucifera [Indian lotus]
gb|KCW59852.1|  hypothetical protein EUGRSUZ_H025922                    142   4e-36   Eucalyptus grandis [rose gum]
ref|XP_010263377.1|  PREDICTED: probable nucleoredoxin 3                142   4e-36   Nelumbo nucifera [Indian lotus]
ref|XP_006652793.1|  PREDICTED: probable nucleoredoxin 3-like           142   4e-36   
ref|XP_006386162.1|  hypothetical protein POPTR_0002s01870g             143   4e-36   Populus trichocarpa [western balsam poplar]
ref|XP_004976749.1|  PREDICTED: probable nucleoredoxin 3-like           142   5e-36   Setaria italica
ref|XP_006435251.1|  hypothetical protein CICLE_v10001187mg             142   7e-36   
ref|XP_006435250.1|  hypothetical protein CICLE_v10001187mg             142   9e-36   Citrus clementina [clementine]
gb|AFW59396.1|  hypothetical protein ZEAMMB73_974140                    141   2e-35   
ref|XP_008663577.1|  PREDICTED: probable nucleoredoxin 3                141   4e-35   
ref|XP_010913793.1|  PREDICTED: probable nucleoredoxin 3                139   6e-35   Elaeis guineensis
gb|EEC77960.1|  hypothetical protein OsI_17320                          139   8e-35   Oryza sativa Indica Group [Indian rice]
sp|Q7XPE8.2|NRX3_ORYSJ  RecName: Full=Probable nucleoredoxin 3; S...    140   8e-35   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044503.1|  Os01g0794400                                       139   9e-35   
ref|XP_002448495.1|  hypothetical protein SORBIDRAFT_06g027950          138   9e-35   Sorghum bicolor [broomcorn]
gb|EEC71628.1|  hypothetical protein OsI_04055                          138   1e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_010061105.1|  PREDICTED: probable nucleoredoxin 2 isoform X2     139   1e-34   Eucalyptus grandis [rose gum]
ref|XP_010648454.1|  PREDICTED: probable nucleoredoxin 3                138   1e-34   Vitis vinifera
gb|KJB58049.1|  hypothetical protein B456_009G191800                    139   1e-34   Gossypium raimondii
gb|KJB58047.1|  hypothetical protein B456_009G191800                    139   2e-34   Gossypium raimondii
gb|KCW68002.1|  hypothetical protein EUGRSUZ_F01693                     139   2e-34   Eucalyptus grandis [rose gum]
gb|KJB58048.1|  hypothetical protein B456_009G191800                    138   2e-34   Gossypium raimondii
gb|KJB58046.1|  hypothetical protein B456_009G191800                    138   2e-34   Gossypium raimondii
gb|ACG38694.1|  protein disulfide isomerase                             137   3e-34   Zea mays [maize]
ref|NP_001131397.1|  protein disulfide isomerase                        137   3e-34   Zea mays [maize]
ref|XP_008654313.1|  PREDICTED: protein disulfide isomerase isofo...    137   3e-34   Zea mays [maize]
ref|NP_001169000.1|  uncharacterized protein LOC100382831               137   4e-34   
ref|XP_010669505.1|  PREDICTED: probable nucleoredoxin 3                137   4e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006646403.1|  PREDICTED: probable nucleoredoxin 2-like           137   4e-34   Oryza brachyantha
ref|XP_011041579.1|  PREDICTED: probable nucleoredoxin 1                133   2e-33   Populus euphratica
gb|AGT16827.1|  disulfide isomerase                                     135   2e-33   Saccharum hybrid cultivar R570
emb|CDM84533.1|  unnamed protein product                                135   2e-33   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002456473.1|  hypothetical protein SORBIDRAFT_03g036980          134   3e-33   Sorghum bicolor [broomcorn]
emb|CBI20806.3|  unnamed protein product                                138   3e-33   Vitis vinifera
ref|XP_012076288.1|  PREDICTED: probable nucleoredoxin 3 isoform X2     133   6e-33   Jatropha curcas
ref|NP_001053815.2|  Os04g0608600                                       129   6e-33   
gb|KDO67158.1|  hypothetical protein CISIN_1g016384mg                   131   7e-33   Citrus sinensis [apfelsine]
ref|XP_002504076.1|  thioredoxin                                        134   7e-33   Micromonas commoda
ref|XP_008781716.1|  PREDICTED: probable nucleoredoxin 3                133   8e-33   Phoenix dactylifera
ref|XP_012076283.1|  PREDICTED: probable nucleoredoxin 3 isoform X1     133   1e-32   Jatropha curcas
ref|XP_008054249.1|  PREDICTED: nucleoredoxin                           131   1e-32   
tpg|DAA59507.1|  TPA: hypothetical protein ZEAMMB73_323265              132   1e-32   
gb|KHG03676.1|  hypothetical protein F383_28340                         132   1e-32   Gossypium arboreum [tree cotton]
dbj|BAK03911.1|  predicted protein                                      132   2e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO67148.1|  hypothetical protein CISIN_1g016384mg                   131   3e-32   Citrus sinensis [apfelsine]
ref|XP_008654315.1|  PREDICTED: protein disulfide isomerase isofo...    131   3e-32   Zea mays [maize]
emb|CAH67742.1|  H0702G05.1                                             127   3e-32   Oryza sativa [red rice]
ref|XP_008654314.1|  PREDICTED: protein disulfide isomerase isofo...    131   4e-32   Zea mays [maize]
ref|XP_006483643.1|  PREDICTED: probable nucleoredoxin 3-like iso...    131   4e-32   Citrus sinensis [apfelsine]
gb|KDO67152.1|  hypothetical protein CISIN_1g016384mg                   131   4e-32   Citrus sinensis [apfelsine]
ref|XP_004970236.1|  PREDICTED: probable nucleoredoxin 2-like           131   6e-32   Setaria italica
ref|NP_001050331.2|  Os03g0405900                                       131   7e-32   
ref|XP_010112126.1|  putative nucleoredoxin 3                           132   9e-32   
ref|XP_004901065.1|  PREDICTED: nucleoredoxin                           129   1e-31   
gb|KJB18918.1|  hypothetical protein B456_003G074700                    130   1e-31   
ref|XP_005402699.1|  PREDICTED: nucleoredoxin                           129   1e-31   
ref|XP_003564391.1|  PREDICTED: probable nucleoredoxin 2                130   2e-31   
ref|XP_004376324.1|  PREDICTED: nucleoredoxin                           130   2e-31   
ref|XP_010640711.1|  PREDICTED: nucleoredoxin                           129   2e-31   
ref|XP_004594003.1|  PREDICTED: nucleoredoxin                           128   2e-31   
gb|EHB13353.1|  Nucleoredoxin                                           129   2e-31   
ref|XP_004707373.1|  PREDICTED: nucleoredoxin                           129   2e-31   
ref|XP_003469738.1|  PREDICTED: nucleoredoxin isoform 2                 129   2e-31   
ref|XP_004857157.1|  PREDICTED: nucleoredoxin isoform X2                129   3e-31   
ref|XP_004857156.1|  PREDICTED: nucleoredoxin isoform X1                129   3e-31   
ref|XP_005654033.1|  PREDICTED: nucleoredoxin                           127   3e-31   
ref|XP_003469737.1|  PREDICTED: nucleoredoxin isoform 1                 129   4e-31   
gb|AAH73845.1|  NXN protein                                             126   4e-31   
ref|XP_009924330.1|  PREDICTED: nucleoredoxin                           124   5e-31   
ref|XP_006891069.1|  PREDICTED: nucleoredoxin isoform X4                128   5e-31   
gb|KFW03638.1|  Nucleoredoxin                                           125   5e-31   
ref|XP_009574641.1|  PREDICTED: nucleoredoxin                           124   5e-31   
ref|XP_006033187.1|  PREDICTED: nucleoredoxin                           127   5e-31   
ref|XP_006450083.1|  hypothetical protein CICLE_v10010213mg             132   6e-31   
gb|KFP95148.1|  Nucleoredoxin                                           123   6e-31   
gb|KFQ89891.1|  Nucleoredoxin                                           124   6e-31   
ref|XP_004635420.1|  PREDICTED: nucleoredoxin isoform X3                127   6e-31   
ref|XP_008219971.1|  PREDICTED: probable nucleoredoxin 3 isoform X2     128   7e-31   
ref|XP_009814648.1|  PREDICTED: nucleoredoxin                           125   7e-31   
gb|KDO67150.1|  hypothetical protein CISIN_1g016384mg                   127   7e-31   
gb|KFV57197.1|  Nucleoredoxin                                           125   7e-31   
gb|KFZ53194.1|  Nucleoredoxin                                           124   8e-31   
ref|XP_004605049.1|  PREDICTED: nucleoredoxin                           127   8e-31   
ref|XP_006891067.1|  PREDICTED: nucleoredoxin isoform X2                128   8e-31   
ref|XP_006891068.1|  PREDICTED: nucleoredoxin isoform X3                128   8e-31   
gb|KFW07294.1|  Nucleoredoxin                                           125   9e-31   
ref|XP_008827049.1|  PREDICTED: nucleoredoxin                           127   9e-31   
ref|XP_010720373.1|  PREDICTED: nucleoredoxin isoform X3                126   1e-30   
ref|XP_004635419.1|  PREDICTED: nucleoredoxin isoform X2                127   1e-30   
ref|XP_006891066.1|  PREDICTED: nucleoredoxin isoform X1                128   1e-30   
ref|XP_010720371.1|  PREDICTED: nucleoredoxin isoform X1                126   1e-30   
ref|XP_009503264.1|  PREDICTED: nucleoredoxin                           125   1e-30   
ref|XP_004635418.1|  PREDICTED: nucleoredoxin isoform X1                127   1e-30   
gb|KFP31328.1|  Nucleoredoxin                                           125   1e-30   
ref|XP_009484678.1|  PREDICTED: nucleoredoxin                           125   1e-30   
gb|KFO08069.1|  Nucleoredoxin                                           125   1e-30   
ref|XP_009971007.1|  PREDICTED: nucleoredoxin                           124   1e-30   
gb|KFV58459.1|  Nucleoredoxin                                           124   1e-30   
ref|XP_004291281.1|  PREDICTED: probable nucleoredoxin 3                127   1e-30   
ref|XP_005256815.1|  PREDICTED: nucleoredoxin isoform X3                126   1e-30   
gb|EMS60992.1|  putative nucleoredoxin 2                                130   1e-30   
ref|XP_008968177.1|  PREDICTED: nucleoredoxin                           126   2e-30   
ref|XP_010170099.1|  PREDICTED: nucleoredoxin                           124   2e-30   
ref|XP_010720372.1|  PREDICTED: nucleoredoxin isoform X2                126   2e-30   
ref|XP_005256814.1|  PREDICTED: nucleoredoxin isoform X2                126   2e-30   
gb|KFZ62045.1|  Nucleoredoxin                                           124   2e-30   
ref|NP_001192248.1|  nucleoredoxin isoform 2                            126   2e-30   
gb|AAH09327.2|  NXN protein                                             125   2e-30   
gb|KFP38132.1|  Nucleoredoxin                                           124   2e-30   
ref|XP_007223217.1|  hypothetical protein PRUPE_ppa007157mg             127   2e-30   
ref|XP_006277726.1|  PREDICTED: nucleoredoxin                           126   2e-30   
ref|XP_006474525.1|  PREDICTED: probable nucleoredoxin 1-like           127   2e-30   
ref|XP_010447596.1|  PREDICTED: probable nucleoredoxin 3                127   2e-30   
ref|XP_010119022.1|  PREDICTED: nucleoredoxin                           124   2e-30   
ref|XP_008219969.1|  PREDICTED: probable nucleoredoxin 3 isoform X1     126   2e-30   
ref|XP_010664141.1|  PREDICTED: probable nucleoredoxin 2 isoform X2     126   2e-30   
gb|KFQ34957.1|  Nucleoredoxin                                           124   2e-30   
gb|KFV69446.1|  Nucleoredoxin                                           125   2e-30   
ref|XP_006435249.1|  hypothetical protein CICLE_v10001187mg             125   2e-30   
ref|XP_006382207.1|  hypothetical protein POPTR_0006s29370g             126   2e-30   
ref|XP_008944115.1|  PREDICTED: nucleoredoxin                           124   2e-30   
ref|XP_010199267.1|  PREDICTED: nucleoredoxin                           125   2e-30   
emb|CDJ68127.1|  nucleoredoxin, putative                                127   3e-30   
ref|XP_009429794.1|  PREDICTED: nucleoredoxin isoform X1                125   3e-30   
ref|XP_009978109.1|  PREDICTED: LOW QUALITY PROTEIN: nucleoredoxin      125   3e-30   
gb|KDO32836.1|  hypothetical protein SPRG_02529                         127   3e-30   
gb|KDO32827.1|  hypothetical protein SPRG_02520                         127   3e-30   
ref|XP_009901657.1|  PREDICTED: nucleoredoxin                           125   3e-30   
ref|XP_010432885.1|  PREDICTED: probable nucleoredoxin 3                126   3e-30   
gb|EOB06969.1|  Nucleoredoxin                                           125   3e-30   
gb|KFP11930.1|  Nucleoredoxin                                           125   3e-30   
gb|AFK11103.1|  nucleoredoxin-like protein                              124   3e-30   
ref|XP_009276611.1|  PREDICTED: nucleoredoxin                           125   3e-30   
ref|XP_003642481.2|  PREDICTED: nucleoredoxin                           125   3e-30   
ref|XP_009671237.1|  PREDICTED: nucleoredoxin                           125   3e-30   
gb|KFV80184.1|  Nucleoredoxin                                           125   3e-30   
gb|KFM06813.1|  Nucleoredoxin                                           125   4e-30   
gb|KFU86270.1|  Nucleoredoxin                                           125   4e-30   
ref|XP_009093217.1|  PREDICTED: nucleoredoxin                           125   4e-30   
emb|CDJ39906.1|  nucleoredoxin, putative                                126   4e-30   
gb|EMC80597.1|  Nucleoredoxin                                           125   4e-30   
ref|XP_009957883.1|  PREDICTED: nucleoredoxin                           125   4e-30   
ref|XP_010007431.1|  PREDICTED: nucleoredoxin                           125   4e-30   
ref|XP_005011914.1|  PREDICTED: nucleoredoxin                           125   4e-30   
gb|EAW90639.1|  nucleoredoxin, isoform CRA_a                            125   4e-30   
ref|XP_009318514.1|  PREDICTED: nucleoredoxin                           125   4e-30   
ref|XP_005424535.1|  PREDICTED: nucleoredoxin                           124   4e-30   
gb|KFV13409.1|  Nucleoredoxin                                           124   4e-30   
gb|KCW63369.1|  hypothetical protein EUGRSUZ_G01004                     124   4e-30   
ref|XP_010079547.1|  PREDICTED: nucleoredoxin                           124   4e-30   
ref|XP_005512023.1|  PREDICTED: nucleoredoxin                           125   4e-30   
ref|XP_009468450.1|  PREDICTED: nucleoredoxin                           125   5e-30   
ref|XP_006435252.1|  hypothetical protein CICLE_v10001187mg             126   5e-30   
ref|XP_009632193.1|  PREDICTED: nucleoredoxin                           125   5e-30   
ref|XP_007017891.1|  DC1 domain-containing protein isoform 2            125   5e-30   
ref|NP_071908.2|  nucleoredoxin isoform 1                               125   5e-30   
ref|XP_010400666.1|  PREDICTED: nucleoredoxin isoform X3                124   6e-30   
ref|XP_007137135.1|  hypothetical protein PHAVU_009G102600g             125   6e-30   
ref|XP_005493616.1|  PREDICTED: nucleoredoxin                           124   6e-30   
ref|XP_010400664.1|  PREDICTED: nucleoredoxin isoform X1                124   6e-30   
ref|XP_009127152.1|  PREDICTED: probable nucleoredoxin 3                125   6e-30   
gb|KDO84955.1|  hypothetical protein CISIN_1g013684mg                   125   6e-30   
ref|XP_010400665.1|  PREDICTED: nucleoredoxin isoform X2                124   6e-30   
gb|KFW86506.1|  Nucleoredoxin                                           124   6e-30   
gb|KFP89121.1|  Nucleoredoxin                                           124   6e-30   
ref|XP_008629409.1|  PREDICTED: nucleoredoxin                           124   6e-30   
ref|XP_009868051.1|  PREDICTED: nucleoredoxin                           124   6e-30   
gb|KFO57186.1|  Nucleoredoxin                                           124   7e-30   
ref|XP_002191661.1|  PREDICTED: nucleoredoxin-like                      122   7e-30   
ref|XP_008928855.1|  PREDICTED: nucleoredoxin                           124   8e-30   
ref|XP_005233760.1|  PREDICTED: nucleoredoxin                           124   8e-30   
gb|KGL77160.1|  Nucleoredoxin                                           124   8e-30   
ref|XP_005056720.1|  PREDICTED: nucleoredoxin                           124   9e-30   
ref|XP_009074337.1|  PREDICTED: nucleoredoxin                           122   9e-30   
ref|XP_011580131.1|  PREDICTED: nucleoredoxin                           125   9e-30   
ref|NP_567869.1|  putative nucleoredoxin 3                              125   1e-29   
ref|XP_005298217.1|  PREDICTED: nucleoredoxin                           125   1e-29   
gb|KGL91395.1|  Nucleoredoxin                                           124   1e-29   
ref|XP_010572043.1|  PREDICTED: nucleoredoxin                           125   1e-29   
ref|NP_001135672.1|  nucleoredoxin                                      125   1e-29   
gb|KFP81403.1|  Nucleoredoxin                                           122   1e-29   
ref|XP_010438062.1|  PREDICTED: probable nucleoredoxin 3                124   1e-29   
ref|XP_007898874.1|  PREDICTED: nucleoredoxin                           123   1e-29   
ref|XP_011006661.1|  PREDICTED: probable nucleoredoxin 3                124   1e-29   
ref|XP_010188235.1|  PREDICTED: nucleoredoxin                           123   1e-29   
ref|XP_005439924.1|  PREDICTED: nucleoredoxin                           124   1e-29   
emb|CDX68729.1|  BnaC01g07240D                                          124   2e-29   
gb|KFQ39372.1|  Nucleoredoxin                                           123   2e-29   
ref|NP_001086161.1|  nucleoredoxin                                      124   2e-29   
ref|XP_007440160.1|  PREDICTED: nucleoredoxin                           123   2e-29   
ref|XP_003800168.1|  PREDICTED: nucleoredoxin                           124   2e-29   
ref|XP_009187555.1|  PREDICTED: nucleoredoxin isoform X3                123   2e-29   
ref|XP_010212818.1|  PREDICTED: nucleoredoxin                           124   2e-29   
ref|XP_005582477.1|  PREDICTED: nucleoredoxin isoform X3                122   3e-29   
ref|XP_006452948.1|  hypothetical protein CICLE_v10010235mg             123   3e-29   
ref|XP_007011460.1|  Kinase C-like zinc finger protein                  123   3e-29   
ref|XP_005582476.1|  PREDICTED: nucleoredoxin isoform X2                122   3e-29   
ref|XP_005525777.1|  PREDICTED: nucleoredoxin                           123   4e-29   
ref|XP_003417015.1|  PREDICTED: nucleoredoxin                           122   4e-29   
ref|XP_009353319.1|  PREDICTED: probable nucleoredoxin 3                123   4e-29   
gb|EMT04086.1|  hypothetical protein F775_43323                         123   4e-29   
ref|XP_009881039.1|  PREDICTED: nucleoredoxin                           123   4e-29   
ref|XP_006977476.1|  PREDICTED: nucleoredoxin                           122   4e-29   
ref|XP_004685199.1|  PREDICTED: nucleoredoxin                           122   5e-29   
gb|EMP37752.1|  Nucleoredoxin                                           122   5e-29   
ref|XP_008824756.1|  PREDICTED: nucleoredoxin                           120   5e-29   
ref|XP_005328005.1|  PREDICTED: nucleoredoxin                           122   5e-29   
ref|XP_009697403.1|  PREDICTED: nucleoredoxin                           120   5e-29   
ref|XP_003912092.1|  PREDICTED: nucleoredoxin isoform X1                123   6e-29   
ref|XP_002867308.1|  predicted protein                                  122   6e-29   
ref|XP_010371830.1|  PREDICTED: nucleoredoxin                           122   6e-29   
ref|XP_006863275.1|  PREDICTED: nucleoredoxin isoform X2                122   6e-29   
ref|XP_008357428.1|  PREDICTED: probable nucleoredoxin 3                122   6e-29   
gb|EHH57553.1|  Nucleoredoxin                                           121   7e-29   
ref|XP_001701995.1|  nucleoredoxin 2                                    123   7e-29   
ref|XP_007123660.1|  PREDICTED: nucleoredoxin                           121   7e-29   
gb|KFP64510.1|  Nucleoredoxin                                           120   7e-29   
ref|XP_004483855.1|  PREDICTED: nucleoredoxin isoform 2                 122   7e-29   
ref|XP_005349576.1|  PREDICTED: nucleoredoxin isoform X2                122   7e-29   
ref|NP_001101755.1|  nucleoredoxin                                      122   7e-29   
ref|XP_005582475.1|  PREDICTED: nucleoredoxin isoform X1                122   7e-29   
ref|XP_004318054.1|  PREDICTED: nucleoredoxin                           121   8e-29   
gb|AAH04688.1|  Nxn protein                                             122   8e-29   
dbj|BAD88798.1|  nucleoredoxin                                          122   8e-29   
ref|XP_011912507.1|  PREDICTED: nucleoredoxin                           122   8e-29   
ref|XP_008007939.1|  PREDICTED: nucleoredoxin                           122   8e-29   
tpg|DAA59757.1|  TPA: hypothetical protein ZEAMMB73_767325              121   8e-29   
gb|ELV11126.1|  Nucleoredoxin                                           121   8e-29   
ref|XP_007623197.1|  PREDICTED: nucleoredoxin isoform X2                120   8e-29   
ref|XP_009556788.1|  PREDICTED: nucleoredoxin                           122   8e-29   
ref|XP_009417224.1|  PREDICTED: probable nucleoredoxin 2 isoform X3     121   9e-29   
ref|XP_010956525.1|  PREDICTED: nucleoredoxin                           121   9e-29   
ref|XP_010016215.1|  PREDICTED: nucleoredoxin                           121   9e-29   
ref|XP_002718941.1|  PREDICTED: nucleoredoxin                           122   9e-29   
gb|KFQ52683.1|  Nucleoredoxin                                           121   9e-29   
ref|XP_007567435.1|  PREDICTED: nucleoredoxin                           122   9e-29   
gb|KFR05500.1|  Nucleoredoxin                                           121   9e-29   
ref|XP_006246969.1|  PREDICTED: nucleoredoxin isoform X1                122   1e-28   
ref|XP_006002386.1|  PREDICTED: nucleoredoxin                           122   1e-28   
ref|XP_006285266.1|  hypothetical protein CARUB_v10006638mg             125   1e-28   
ref|XP_006863274.1|  PREDICTED: nucleoredoxin isoform X1                122   1e-28   
ref|XP_005349575.1|  PREDICTED: nucleoredoxin isoform X1                122   1e-28   
ref|XP_004483854.1|  PREDICTED: nucleoredoxin isoform 1                 122   1e-28   
ref|XP_009417223.1|  PREDICTED: probable nucleoredoxin 2 isoform X2     121   1e-28   
emb|CBI18925.3|  unnamed protein product                                119   1e-28   
ref|NP_032776.1|  nucleoredoxin                                         122   1e-28   
ref|XP_003506776.1|  PREDICTED: nucleoredoxin isoform X1                121   1e-28   
ref|XP_008591306.1|  PREDICTED: nucleoredoxin                           121   1e-28   
ref|XP_011998002.1|  PREDICTED: nucleoredoxin isoform X3                121   1e-28   
gb|EDL12859.1|  nucleoredoxin                                           122   1e-28   
ref|XP_012040823.1|  PREDICTED: nucleoredoxin isoform X1                121   1e-28   
ref|XP_004807669.1|  PREDICTED: nucleoredoxin                           120   1e-28   
ref|XP_006940095.1|  PREDICTED: nucleoredoxin                           120   1e-28   
ref|XP_005067434.1|  PREDICTED: nucleoredoxin isoform X2                121   1e-28   
ref|XP_008423154.1|  PREDICTED: nucleoredoxin                           121   2e-28   
ref|XP_005804144.1|  PREDICTED: nucleoredoxin-like                      121   2e-28   
gb|EPQ02770.1|  Nucleoredoxin                                           120   2e-28   
ref|XP_010863626.1|  PREDICTED: nucleoredoxin                           121   2e-28   
gb|ELK26967.1|  Nucleoredoxin                                           120   2e-28   
ref|XP_004747434.1|  PREDICTED: nucleoredoxin                           120   2e-28   
ref|XP_004267131.1|  PREDICTED: nucleoredoxin isoform 1                 121   2e-28   
ref|XP_005858409.1|  PREDICTED: nucleoredoxin                           120   2e-28   
ref|XP_008122185.1|  PREDICTED: nucleoredoxin                           120   2e-28   
ref|XP_006099271.1|  PREDICTED: nucleoredoxin                           120   2e-28   
ref|XP_003526462.1|  PREDICTED: probable nucleoredoxin 3-like iso...    121   2e-28   
ref|XP_004433510.1|  PREDICTED: nucleoredoxin                           121   2e-28   
emb|CDQ77743.1|  unnamed protein product                                121   2e-28   
ref|XP_005143023.1|  PREDICTED: nucleoredoxin                           120   2e-28   
ref|XP_004267132.1|  PREDICTED: nucleoredoxin isoform 2                 121   2e-28   
ref|XP_006167578.1|  PREDICTED: nucleoredoxin isoform X1                121   2e-28   
ref|XP_006768187.1|  PREDICTED: nucleoredoxin                           120   2e-28   
ref|XP_005067433.1|  PREDICTED: nucleoredoxin isoform X1                121   2e-28   
ref|XP_005837333.1|  hypothetical protein GUITHDRAFT_151288             116   2e-28   



>ref|XP_009762378.1| PREDICTED: probable nucleoredoxin 1 [Nicotiana sylvestris]
Length=520

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            D+HDL  +L SSDRDFLIRN+G QVK+D LK KK+G+YFSASWCGPC  FTPNL   YNE
Sbjct  5    DSHDLMKLLGSSDRDFLIRNNGDQVKLDALKEKKVGLYFSASWCGPCQHFTPNLVEAYNE  64

Query  362  LLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
            LLPKG+FEVVF++ADED++SFKEYF KMPW AVPFSDS TR+RLD LF V+GIPHLVILD
Sbjct  65   LLPKGDFEVVFLTADEDDKSFKEYFSKMPWLAVPFSDSETRKRLDELFAVKGIPHLVILD  124

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            +SGKV T++GV+I+LEHGVE YPFT ER+ E+K+ EE   REQSLK++L S SR+YV+AA
Sbjct  125  DSGKVVTDNGVEIILEHGVEGYPFTQERLNELKEQEETAKREQSLKSILESQSRNYVVAA  184


 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L SIL + D DF+I   G ++ V DL GK I +YFSA WC PC  FTP L   Y  
Sbjct  327  EAQTLESILVTGDHDFVIGKDGEKILVSDLVGKNILLYFSAHWCPPCRAFTPKLKEAYEN  386

Query  362  LLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K G  EV+F+S+D+D+ SF +YF  MPW A+PF D   +  L  LF V+GIP LV +
Sbjct  387  IKAKSGPLEVIFISSDQDQASFDDYFATMPWLALPFGDE-RKASLSRLFKVQGIPTLVAI  445

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSL  676
              SGK  T     +++ HG EA+PFT ER+KEI +AE A  +E +L
Sbjct  446  GPSGKTITTGARSMIMRHGAEAFPFTKERMKEI-EAEIAEKKENNL  490


 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 114/197 (58%), Gaps = 7/197 (4%)
 Frame = +2

Query  146  ERKASSMAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  316
            + + + + EQ   A     L+SIL S  R++++   G +V V +L+GK +G+YFS S   
Sbjct  150  QERLNELKEQEETAKREQSLKSILESQSRNYVVAADGRKVPVAELEGKIVGLYFSISSFE  209

Query  317  PCHRFTPNLATVYNELLPKG-NFEVVFVSAD--EDEESFKEYFGKMPWTAVPFSDSVTRE  487
             C  FT  L  +Y++L  +G NFEVV +  D  + +ESFK+ F  MPW ++P  D  T E
Sbjct  210  ECESFTRMLIDMYDKLKAQGENFEVVMIPLDGEDGDESFKKEFASMPWYSLPLKDR-TCE  268

Query  488  RLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*RE  667
            +L   F +  +P LVI+   GK    +  + + EHG+ AYPFT E+  E++  E+A    
Sbjct  269  KLARYFELSTLPTLVIIGTDGKTLHSNVAEAIEEHGILAYPFTPEKFSELEQIEKAKREA  328

Query  668  QSLKTVLVSTSRDYVIA  718
            Q+L+++LV+   D+VI 
Sbjct  329  QTLESILVTGDHDFVIG  345



>ref|XP_009626674.1| PREDICTED: probable nucleoredoxin 1 [Nicotiana tomentosiformis]
Length=520

 Score =   278 bits (712),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            D+HDL  +L SSDRDFLIRN+G QVK+D LK KK+G+YFSASWCGPC  FTPNL   YNE
Sbjct  5    DSHDLMKLLGSSDRDFLIRNNGDQVKLDALKEKKVGLYFSASWCGPCQHFTPNLVEAYNE  64

Query  362  LLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
            LLPKG+FEVVF++ADED+ESFKEYF KMPW AVPFSDS TR+RL+ LF V+GIPHLVILD
Sbjct  65   LLPKGDFEVVFLTADEDDESFKEYFSKMPWLAVPFSDSETRKRLNELFAVKGIPHLVILD  124

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            + GKV T++GV+I+LEHGVE YPFT ER+ E+K+ EEA  REQSLK++L S SR+YV+A
Sbjct  125  DCGKVVTDNGVEIILEHGVEGYPFTQERLNELKEQEEAAKREQSLKSILESQSRNYVVA  183


 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L SIL + D DF+I   G ++ V DL GK I +YFSA WC PC  FTP L   Y +
Sbjct  327  EAQTLESILVTGDHDFVIGKDGEKILVSDLVGKNILLYFSAHWCPPCRAFTPKLKDAYEK  386

Query  362  LLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K G  EV+F+S+D+D+ SF +YF  MPW A+PF D   +  L  LF V+GIP LV +
Sbjct  387  IKTKNGPLEVIFISSDQDQASFDDYFATMPWLALPFGDE-RKASLSRLFKVQGIPTLVAI  445

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSL  676
               GK  T    ++++ HG EA+PFT ER+KEI +A+ A  +E +L
Sbjct  446  GPLGKTITTGARNMIMRHGAEAFPFTEERMKEI-EADIAEKKENNL  490


 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 73/203 (36%), Positives = 117/203 (58%), Gaps = 6/203 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F++ +  E K    A +      L+SIL S  R++++   G +V V +L+GK +G+YF
Sbjct  146  YPFTQERLNELKEQEEAAKR--EQSLKSILESQSRNYVVAVDGRKVPVAELEGKIVGLYF  203

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSAD--EDEESFKEYFGKMPWTAVPFS  469
            S +    C  FT  L  +Y++L  +G NFEVV +  D  +D+ESFK+ F  MPW ++P  
Sbjct  204  SMTSFEECESFTRMLIDMYDKLKAQGENFEVVMIPLDGEDDDESFKKEFASMPWYSLPLK  263

Query  470  DSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAE  649
            D  T E+L   F +  +P LVI+   GK    +  + + EHG+ AYPFT E+  E++  E
Sbjct  264  DR-TCEKLARYFELSTLPTLVIIGTDGKTLHSNVAEAIEEHGILAYPFTPEKFAELEQIE  322

Query  650  EAT*REQSLKTVLVSTSRDYVIA  718
            +A    Q+L+++LV+   D+VI 
Sbjct  323  KAKREAQTLESILVTGDHDFVIG  345



>ref|XP_012085392.1| PREDICTED: probable nucleoredoxin 1 [Jatropha curcas]
 gb|KDP26595.1| hypothetical protein JCGZ_17753 [Jatropha curcas]
Length=572

 Score =   278 bits (710),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 159/187 (85%), Gaps = 1/187 (1%)
 Frame = +2

Query  164  MAEQ-NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPN  340
            MAE  NGD+HD RS+L SSD D+LIRN+G QVK+D LKGKKIG+YFSASWCGPC RFTP 
Sbjct  1    MAEMANGDSHDFRSLLSSSDCDYLIRNNGDQVKIDSLKGKKIGLYFSASWCGPCQRFTPV  60

Query  341  LATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
            L   YNEL PKGNFE+VF+SADED+ESFK+YF KMPW A+PFS+S TR+RLD LF ++GI
Sbjct  61   LVEAYNELAPKGNFEIVFISADEDDESFKKYFSKMPWLAIPFSESETRDRLDQLFKIQGI  120

Query  521  PHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTS  700
            PHLVI+DE+GKV++E GV+I+ E+GVEAYPFT E++K++K+ EE   R QSL+++LV  S
Sbjct  121  PHLVIIDENGKVSSESGVEIIREYGVEAYPFTPEKIKQLKEQEEEARRNQSLRSILVVHS  180

Query  701  RDYVIAA  721
            RDYVI++
Sbjct  181  RDYVISS  187


 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/193 (41%), Positives = 116/193 (60%), Gaps = 5/193 (3%)
 Frame = +2

Query  152  KASSMAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPC  322
            K   + EQ  +A     LRSIL    RD++I + G +  + +L+GK +G++FS +    C
Sbjct  155  KIKQLKEQEEEARRNQSLRSILVVHSRDYVISSDGKKFPISELEGKTVGLFFSLASYKSC  214

Query  323  HRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDA  499
              FT  L  VY +L  KG NFEVVF+S D+DEE+F++  G MPW ++PF D    E+L  
Sbjct  215  VDFTQKLVEVYGKLKEKGENFEVVFISLDDDEETFQQSLGGMPWLSLPFKDKCC-EKLVR  273

Query  500  LFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLK  679
             F +  +P LV++   GK    +  + + EHGV+AYPFT ER  E+ + E+A    Q+L+
Sbjct  274  YFELSTVPTLVVIGPDGKTLHSNVAEAIEEHGVQAYPFTPERFAELAEIEKAREASQTLE  333

Query  680  TVLVSTSRDYVIA  718
            +VLVS  RD+VI 
Sbjct  334  SVLVSGDRDFVIG  346


 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 96/153 (63%), Gaps = 2/153 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +  L S+L S DRDF+I   G +V V DL GK I +YFSA WC PC  F P L   Y+E+
Sbjct  329  SQTLESVLVSGDRDFVIGKDGAKVLVSDLIGKNILLYFSAHWCPPCRAFLPKLIEAYHEI  388

Query  365  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K N FEV+F+S+D D+ S+ ++F  MPW A+PF D   +  L   F V+GIP LV L 
Sbjct  389  KAKDNAFEVIFISSDSDQASYDDFFSTMPWLALPFGDE-RKASLSRKFKVQGIPMLVALG  447

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
             +G+  T++   ++  HG +AYPFT E +KEI+
Sbjct  448  PTGRTITKEARSLITIHGADAYPFTDEHLKEIE  480



>emb|CDP00158.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 154/187 (82%), Gaps = 1/187 (1%)
 Frame = +2

Query  164  MAE-QNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPN  340
            MAE  NG  HDL ++L SSDRDFLIRN+G QVKV+ LKGKK+G+YFSASWCGPC RFTP 
Sbjct  1    MAEGANGRVHDLNTMLSSSDRDFLIRNNGQQVKVESLKGKKVGLYFSASWCGPCRRFTPK  60

Query  341  LATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
            L  VYNELLPK +FE+VFVSADED+ESF  YF KMPW A+PFSDS TR+RLD LF+VRGI
Sbjct  61   LVEVYNELLPKDDFEIVFVSADEDDESFAAYFSKMPWLAIPFSDSETRDRLDELFSVRGI  120

Query  521  PHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTS  700
            PHLVI+ E+GKV+T+DGV++V   G E YPF+ E +KEIK+ EE   R Q+LKT+LVS S
Sbjct  121  PHLVIIGENGKVSTDDGVEVVQGCGAEGYPFSPEWIKEIKEQEEVARRNQTLKTILVSRS  180

Query  701  RDYVIAA  721
            RDYV+A+
Sbjct  181  RDYVVAS  187


 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 90/146 (62%), Gaps = 2/146 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L SIL S D +F+I   G +V V DL GK I +YFSA WC PC  F P L   Y+ 
Sbjct  328  EAQTLESILVSGDHNFVIGKDGVKVPVSDLVGKTILLYFSAHWCPPCRAFLPKLIEAYHG  387

Query  362  LLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K G FEVVF+S+D D+ SF E+F KMPW A+PF D   +E L  +F V GIP LV +
Sbjct  388  IKAKNGAFEVVFISSDRDQNSFDEFFSKMPWLALPFGDG-RKESLSRVFKVLGIPMLVAI  446

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFT  616
              +GK  T +  D++  HG  AYPFT
Sbjct  447  GPTGKTVTTEARDLITYHGANAYPFT  472


 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 109/176 (62%), Gaps = 2/176 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            L++IL S  RD+++ + G +V V +L+GK +G+YF  S  G  + FT  L  +Y +L  K
Sbjct  172  LKTILVSRSRDYVVASDGKKVSVAELEGKTVGLYFFLSTFGGRNAFTSKLLELYEKLKAK  231

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            G NFE+V +  D+DEES+K +F  MPW ++P  D    E+L   F +  +P +VI+   G
Sbjct  232  GENFEIVMIPLDDDEESYKLWFKNMPWLSLPVKDKGC-EKLVRYFELFTLPTVVIIGPDG  290

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  + + EHGV+AYPFT E+  E+++ E+A    Q+L+++LVS   ++VI 
Sbjct  291  KTLHSNVAEAIEEHGVQAYPFTPEKFAELEEIEKAKREAQTLESILVSGDHNFVIG  346



>gb|KJB31217.1| hypothetical protein B456_005G181700 [Gossypium raimondii]
Length=490

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = +2

Query  176  NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
            N D HD +S+L SSDRDFL+RN+G QVK+D LKGKK+G+YFSASWCGPC RFTPNL  VY
Sbjct  13   NRDCHDFKSLLSSSDRDFLVRNNGDQVKIDSLKGKKLGLYFSASWCGPCRRFTPNLIEVY  72

Query  356  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
             EL  KG+FEV+FVSADEDEESF  YF KMPW A+PFSDS  R+RLD  F+V+GIPHLV+
Sbjct  73   TELSTKGDFEVIFVSADEDEESFNGYFSKMPWLAIPFSDSEARKRLDEPFSVKGIPHLVL  132

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            LDE+GKV TE+GV+I+ E+G E YPFT E+++E+KD EE   +EQS+KT+LVS SRD+V+
Sbjct  133  LDENGKVLTEEGVEIIREYGEEGYPFTPEKIQELKDLEEKAKKEQSIKTILVSRSRDFVV  192

Query  716  AA  721
             +
Sbjct  193  TS  194


 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 122/201 (61%), Gaps = 5/201 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K +E K   + E+      +++IL S  RDF++ + G +V V +L+GK +GIYF
Sbjct  156  YPFTPEKIQELK--DLEEKAKKEQSIKTILVSRSRDFVVTSDGSKVPVSELEGKTVGIYF  213

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SAS   P   FT  LA VY++L   G  FEVV +S D+D+ESFK+ FG  PW A+P  D 
Sbjct  214  SASSFKPSADFTQKLAEVYSKLKENGEKFEVVMISLDDDDESFKQSFG-APWLALPSKDK  272

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
             + E+L   F +  +P +VI+   GK    +  D + EHG+ AYPFT E+  E+K+ E+A
Sbjct  273  -SCEKLARYFELSTLPTVVIIGPDGKTLHPNAADAIDEHGIVAYPFTPEKFAELKEIEKA  331

Query  656  T*REQSLKTVLVSTSRDYVIA  718
            +   Q+L++VLVS   D+V+ 
Sbjct  332  SEATQTLESVLVSGGLDFVLG  352


 Score =   120 bits (300),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 90/151 (60%), Gaps = 4/151 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K  E K    A +      L S+L S   DF++   G +VKV DL GK I +YF
Sbjct  315  YPFTPEKFAELKEIEKASEA--TQTLESVLVSGGLDFVLGKDGAKVKVADLVGKTILLYF  372

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  FTP+L  VY ++  K + FEV+F+S+D D+ SF +Y+  MPW A+PF+D+
Sbjct  373  SAHWCPPCRAFTPSLVEVYKKIKEKDDAFEVIFISSDRDQSSFDDYYSGMPWLALPFNDA  432

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTED  568
              +  L   F V+GIP L+ L  +GK  T++
Sbjct  433  -RKSSLSRKFKVQGIPMLIALGPTGKTITKE  462



>ref|XP_006365240.1| PREDICTED: probable nucleoredoxin 1-like [Solanum tuberosum]
Length=607

 Score =   270 bits (691),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 164/216 (76%), Gaps = 3/216 (1%)
 Frame = +2

Query  74   SIAQFLSTFLLR*SIFQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQ  253
            S+   L  F L+  +    + K ++R   SMA +N   HD+  +L SSDRDFLIRN+G +
Sbjct  2    SVCPSLYFFSLQNFVITIHQNK-KKRLNRSMAGEN--CHDVIKLLGSSDRDFLIRNNGDK  58

Query  254  VKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEY  433
            VK+D LK KKIG+YFSASWCGPC  FTPNL   YN LLP G+FEVVF++AD+D+ESFKEY
Sbjct  59   VKLDTLKEKKIGLYFSASWCGPCKHFTPNLVEAYNGLLPNGDFEVVFLTADKDDESFKEY  118

Query  434  FGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  613
            F KMPW AVPFSDS TR+RL+ LF VRGIPHLVILD SGKV T  GV+I++EHGVE YPF
Sbjct  119  FSKMPWLAVPFSDSETRKRLNELFAVRGIPHLVILDASGKVVTNSGVEIIVEHGVEGYPF  178

Query  614  TLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            T ER+ E+K+ EE   REQSLK++L S SR+YVIAA
Sbjct  179  TQERLSELKEQEETAKREQSLKSILESQSRNYVIAA  214


 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 99/159 (62%), Gaps = 3/159 (2%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L SIL + D DF+I   G ++ V DL GK I +YFSA WC PC  FTP L   Y  
Sbjct  357  EAQTLESILVTGDHDFVIGKDGEKILVSDLVGKNILLYFSAHWCPPCRAFTPQLKEAYET  416

Query  362  LLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K G  EV+F+S+D D+ SF +YF  MPW A+PF D   +  L  LF VRGIP LV +
Sbjct  417  IKAKNGPLEVIFISSDRDQASFDDYFASMPWLALPFGDE-RKTYLSRLFKVRGIPTLVAV  475

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
              SGK  T    ++++ HG +A+PFT ER+KEI +AE A
Sbjct  476  GPSGKTVTTGARNLIMSHGAKAFPFTEERMKEI-EAETA  513


 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 116/197 (59%), Gaps = 7/197 (4%)
 Frame = +2

Query  146  ERKASSMAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  316
            + + S + EQ   A     L+SIL S  R+++I   G +V V DL+GK IG+YFS +   
Sbjct  180  QERLSELKEQEETAKREQSLKSILESQSRNYVIAADGRKVPVADLEGKIIGLYFSMTSFK  239

Query  317  PCHRFTPNLATVYNELLPK-GNFEVVFVSAD-EDE-ESFKEYFGKMPWTAVPFSDSVTRE  487
             C  FT  L  +Y++L  + GNFE+V +  D EDE ESFK+ F +MPW ++P  D  T E
Sbjct  240  GCESFTRKLIEMYDKLKAQEGNFEIVMIPLDDEDEDESFKKEFSRMPWFSLPLKDK-TCE  298

Query  488  RLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*RE  667
            +L   F +  +P LVI+   GK    +  + V EHG+ AYPFT E+  E++  ++A    
Sbjct  299  KLARYFELSTLPTLVIIGTDGKTLHSNVAEAVEEHGILAYPFTPEKYAELEQIQKAKLEA  358

Query  668  QSLKTVLVSTSRDYVIA  718
            Q+L+++LV+   D+VI 
Sbjct  359  QTLESILVTGDHDFVIG  375



>ref|XP_002525369.1| nucleoredoxin, putative [Ricinus communis]
 gb|EEF37007.1| nucleoredoxin, putative [Ricinus communis]
Length=575

 Score =   270 bits (689),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 154/187 (82%), Gaps = 1/187 (1%)
 Frame = +2

Query  164  MAEQ-NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPN  340
            MAE  NGD HD  S+L SSDRD+LIRN+G QV++D LKGKK+G+YFSASWCGPC RFTP 
Sbjct  1    MAEMVNGDYHDFVSLLSSSDRDYLIRNNGDQVEIDSLKGKKLGLYFSASWCGPCQRFTPT  60

Query  341  LATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
            L  VYNEL PKG+FE+VF++ADED+ESF+EYF KMPW A+PFSDS  R+RLD +F V+GI
Sbjct  61   LVEVYNELAPKGDFEIVFITADEDDESFEEYFSKMPWLAIPFSDSDKRDRLDEIFKVQGI  120

Query  521  PHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTS  700
            PH VILDE+GKV++E GV+I+ E+GV+ YPFT ER+K +K  EE   R QSL+++LV  S
Sbjct  121  PHFVILDENGKVSSESGVEIIQEYGVQCYPFTAERIKVLKGQEEEARRNQSLRSILVFGS  180

Query  701  RDYVIAA  721
            RDYVIA+
Sbjct  181  RDYVIAS  187


 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 117/195 (60%), Gaps = 9/195 (5%)
 Frame = +2

Query  137  KGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  316
            KG+E +A            LRSIL    RD++I + G +V V +L+GK +G+YFS S   
Sbjct  160  KGQEEEARR-------NQSLRSILVFGSRDYVIASDGKKVSVSELEGKTVGLYFSLSSYT  212

Query  317  PCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERL  493
             C  FT  LA VY +L  KG NFE+VF+S D++EE+F++    MPW A PF+D    E+L
Sbjct  213  SCVDFTSTLAEVYEKLKAKGENFEIVFISLDDEEETFQQSLANMPWLAFPFNDKGC-EKL  271

Query  494  DALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQS  673
               F +  +P LV++   GK    +  + + EHGV+AYPFT E+  E+ + E+A    Q+
Sbjct  272  VRYFELSTVPTLVVIGPDGKTLHSNVAEAIEEHGVQAYPFTPEKFAELAEMEKAREAAQT  331

Query  674  LKTVLVSTSRDYVIA  718
            L++VLVS  +++VI 
Sbjct  332  LESVLVSGDQNFVIG  346


 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 99/162 (61%), Gaps = 2/162 (1%)
 Frame = +2

Query  158  SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            + M +    A  L S+L S D++F+I   G ++ V DL GK I +YFSA WC PC  F P
Sbjct  320  AEMEKAREAAQTLESVLVSGDQNFVIGRDGAKIPVTDLVGKNILLYFSAHWCPPCRAFLP  379

Query  338  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  514
             L   Y+E+  K + FEV+F+S+D D+ SF E+F  MPW A+PF D V +  L   F V+
Sbjct  380  KLVEAYHEIKTKDDAFEVIFISSDRDQASFDEFFSGMPWLALPFGD-VRKASLSRKFKVQ  438

Query  515  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
            GIP L+ L  +G+  T++   +V  HG +AY FT E +KEI+
Sbjct  439  GIPMLIALGPTGRTITKEARSLVTLHGADAYLFTEEHLKEIE  480



>gb|KJB31218.1| hypothetical protein B456_005G181700 [Gossypium raimondii]
Length=570

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = +2

Query  176  NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
            N D HD +S+L SSDRDFL+RN+G QVK+D LKGKK+G+YFSASWCGPC RFTPNL  VY
Sbjct  13   NRDCHDFKSLLSSSDRDFLVRNNGDQVKIDSLKGKKLGLYFSASWCGPCRRFTPNLIEVY  72

Query  356  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
             EL  KG+FEV+FVSADEDEESF  YF KMPW A+PFSDS  R+RLD  F+V+GIPHLV+
Sbjct  73   TELSTKGDFEVIFVSADEDEESFNGYFSKMPWLAIPFSDSEARKRLDEPFSVKGIPHLVL  132

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            LDE+GKV TE+GV+I+ E+G E YPFT E+++E+KD EE   +EQS+KT+LVS SRD+V+
Sbjct  133  LDENGKVLTEEGVEIIREYGEEGYPFTPEKIQELKDLEEKAKKEQSIKTILVSRSRDFVV  192

Query  716  AA  721
             +
Sbjct  193  TS  194


 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 108/175 (62%), Gaps = 4/175 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K  E K    A +      L S+L S   DF++   G +VKV DL GK I +YF
Sbjct  315  YPFTPEKFAELKEIEKASEA--TQTLESVLVSGGLDFVLGKDGAKVKVADLVGKTILLYF  372

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  FTP+L  VY ++  K + FEV+F+S+D D+ SF +Y+  MPW A+PF+D+
Sbjct  373  SAHWCPPCRAFTPSLVEVYKKIKEKDDAFEVIFISSDRDQSSFDDYYSGMPWLALPFNDA  432

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +  L   F V+GIP L+ L  +GK  T++   +V+ HG +AYPFT ER+KEI+
Sbjct  433  -RKSSLSRKFKVQGIPMLIALGPTGKTITKEARSLVMAHGADAYPFTEERLKEIE  486


 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 122/201 (61%), Gaps = 5/201 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K +E K   + E+      +++IL S  RDF++ + G +V V +L+GK +GIYF
Sbjct  156  YPFTPEKIQELK--DLEEKAKKEQSIKTILVSRSRDFVVTSDGSKVPVSELEGKTVGIYF  213

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SAS   P   FT  LA VY++L   G  FEVV +S D+D+ESFK+ FG  PW A+P  D 
Sbjct  214  SASSFKPSADFTQKLAEVYSKLKENGEKFEVVMISLDDDDESFKQSFG-APWLALPSKDK  272

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
             + E+L   F +  +P +VI+   GK    +  D + EHG+ AYPFT E+  E+K+ E+A
Sbjct  273  -SCEKLARYFELSTLPTVVIIGPDGKTLHPNAADAIDEHGIVAYPFTPEKFAELKEIEKA  331

Query  656  T*REQSLKTVLVSTSRDYVIA  718
            +   Q+L++VLVS   D+V+ 
Sbjct  332  SEATQTLESVLVSGGLDFVLG  352



>ref|XP_004238662.1| PREDICTED: probable nucleoredoxin 1 [Solanum lycopersicum]
Length=601

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 151/186 (81%), Gaps = 2/186 (1%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            MA +N   HD+ ++L SSDRDFLIRN+G +VK+D LK KKIG YFSASWCGPC  FTPNL
Sbjct  1    MAGEN--CHDVINLLGSSDRDFLIRNNGDKVKLDTLKEKKIGFYFSASWCGPCKHFTPNL  58

Query  344  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
               YN LLPKG+FEVVF++AD D+ESFKEYF KMPW AVPFSDS TR+RL+ LF VRGIP
Sbjct  59   VEAYNALLPKGDFEVVFLTADMDDESFKEYFSKMPWLAVPFSDSETRKRLNELFAVRGIP  118

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
            HLVILD SGKV T  GV+I++EHGVE YPFT ER+ E+K+ EE   REQSLK++L S SR
Sbjct  119  HLVILDASGKVVTNSGVEIIVEHGVEGYPFTQERLNELKEQEETAKREQSLKSILESQSR  178

Query  704  DYVIAA  721
            +YVIAA
Sbjct  179  NYVIAA  184


 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 91/146 (62%), Gaps = 2/146 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L SIL + DRDF+I   G ++ V DL GK I +YFSA WC PC  FTP L   Y  
Sbjct  327  EAQTLESILVTRDRDFVIGKDGEKILVSDLVGKTILLYFSAHWCPPCRAFTPQLKEAYET  386

Query  362  LLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K G  EV+F+S+D+D+ SF EYF  MPW A+PF D   +  L  LF VRGIP LV +
Sbjct  387  IKSKNGPLEVIFLSSDQDQASFDEYFATMPWLALPFGDE-RKTYLSRLFKVRGIPTLVAV  445

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFT  616
              SGK  T D   +++ HG +A+PFT
Sbjct  446  GPSGKTVTTDARSLIMCHGAKAFPFT  471


 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 115/197 (58%), Gaps = 7/197 (4%)
 Frame = +2

Query  146  ERKASSMAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  316
            + + + + EQ   A     L+SIL S  R+++I   G +V V +L+GK IG+Y S +   
Sbjct  150  QERLNELKEQEETAKREQSLKSILESQSRNYVIAADGRKVPVAELEGKIIGLYMSMASFE  209

Query  317  PCHRFTPNLATVYNELLPKG-NFEVVFVSADE--DEESFKEYFGKMPWTAVPFSDSVTRE  487
             C  FT  L  +Y++L  +G NFE+V +  D+  D+ESFK+ F +MPW ++P  D   + 
Sbjct  210  ECESFTGKLIEMYDKLKSQGENFEIVMIPLDDEDDDESFKKEFSRMPWFSLPLKDKTCK-  268

Query  488  RLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*RE  667
            +L   F +  +P LVI+   GK    +  + V EHG+ AYPF+ E+  E++  ++A    
Sbjct  269  KLARYFELSTLPTLVIIGTDGKTLHSNVAEAVEEHGILAYPFSHEKFAELEQIQKAKLEA  328

Query  668  QSLKTVLVSTSRDYVIA  718
            Q+L+++LV+  RD+VI 
Sbjct  329  QTLESILVTRDRDFVIG  345



>ref|XP_007225633.1| hypothetical protein PRUPE_ppa003374mg [Prunus persica]
 gb|EMJ26832.1| hypothetical protein PRUPE_ppa003374mg [Prunus persica]
Length=580

 Score =   268 bits (685),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +2

Query  176  NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
            N + HD RS+L SS+RDFL+ N+G Q+KV+ LKGKK+G+YFSASWCGPC RFTP+L  VY
Sbjct  13   NSEPHDFRSLLSSSERDFLVGNNGDQIKVESLKGKKLGLYFSASWCGPCRRFTPSLVEVY  72

Query  356  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
            NEL PKG+FEVVF+SADED+ESF  YF KMPW A+PFSDS  R+R+D LF VRGIPHLVI
Sbjct  73   NELSPKGDFEVVFISADEDDESFNGYFSKMPWLAIPFSDSEARDRVDKLFKVRGIPHLVI  132

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            LDE GKV ++ GV+I+ EHGV+ YPFT E++KE+ D EEA  R+QSLKT+LVS  RD+VI
Sbjct  133  LDEDGKVLSDSGVEIIQEHGVDGYPFTPEKIKELNDQEEAARRDQSLKTILVSRLRDFVI  192

Query  716  A  718
            +
Sbjct  193  S  193


 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 109/175 (62%), Gaps = 4/175 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K EE      A++   A  L SIL S DR+F+I   G ++ V DL GK I +YF
Sbjct  316  YPFTPEKFEELIEIEKAKEK--AQTLESILISGDRNFVIGKGGTEIPVSDLVGKNILLYF  373

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+++  K + FEV+F+S+D D+++F E+F  MPW A+PF DS
Sbjct  374  SAHWCPPCRAFLPKLLEAYHKIKAKDDAFEVIFISSDRDQDAFDEFFSGMPWLALPFGDS  433

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +  L   F V+GIP L+ +  +G+  T++   +V++HG  AYPFT ER+KEI+
Sbjct  434  -RKACLSRRFKVQGIPMLIAIGPTGQTVTKEARHLVMQHGANAYPFTEERLKEIE  487


 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 111/178 (62%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L++IL S  RDF+I N G  V V +L+GK +G+YFS S   PC  FTP L  VY +L 
Sbjct  177  QSLKTILVSRLRDFVISNDGKNVPVSELEGKIVGLYFSLSAYSPCVDFTPKLLEVYEKLK  236

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              G +FEVV +  D+DEESFK+ F  MPW ++P  D     +L   F +  +P LVI+  
Sbjct  237  ANGESFEVVVIPLDDDEESFKQDFKNMPWFSLPIGDKNVG-KLARYFELSTLPTLVIIGA  295

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK  +++  + + EHGV AYPFT E+ +E+ + E+A  + Q+L+++L+S  R++VI 
Sbjct  296  DGKTVSKNVAEAIEEHGVLAYPFTPEKFEELIEIEKAKEKAQTLESILISGDRNFVIG  353



>gb|KDO82404.1| hypothetical protein CISIN_1g008336mg [Citrus sinensis]
Length=350

 Score =   260 bits (665),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            M     ++HD++S+L SS RDFLIR++G QVK+D LKGK IG+YFSASWCGPC RFTP L
Sbjct  1    MNMNGANSHDIQSLLSSSARDFLIRSNGDQVKLDSLKGK-IGLYFSASWCGPCQRFTPIL  59

Query  344  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
            A VYNEL  +G+FEV+FVS DED+E+FK YF KMPW AVPFSDS TR++LD LF V GIP
Sbjct  60   AEVYNELSRQGDFEVIFVSGDEDDEAFKGYFSKMPWLAVPFSDSETRDKLDELFKVMGIP  119

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
            HLVILDE+GKV ++ GV+I+ E+GVE YPFT+ER+KE+K+ EE   REQSL++VL S SR
Sbjct  120  HLVILDENGKVLSDGGVEIIREYGVEGYPFTVERIKEMKEQEERAKREQSLRSVLTSHSR  179

Query  704  DYVIAA  721
            D+VI++
Sbjct  180  DFVISS  185


 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 113/189 (60%), Gaps = 5/189 (3%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            M EQ   A     LRS+L S  RDF+I + G ++ V DL+GK IG+YFS S       FT
Sbjct  157  MKEQEERAKREQSLRSVLTSHSRDFVISSDGRKISVSDLEGKTIGLYFSMSSYKASAEFT  216

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  VY +L  KG +FE+V +S D++EESFK   G MPW A+PF D  +RE+L   F +
Sbjct  217  PRLVEVYEKLKGKGESFEIVLISLDDEEESFKRDLGSMPWLALPFKDK-SREKLARYFEL  275

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
              +P LVI+   GK    +  + + EHGV A+PFT E+  E+ + + A    Q+L++VLV
Sbjct  276  STLPTLVIIGPDGKTLHSNVAEAIEEHGVGAFPFTPEKFAELAEIQRAKEESQTLESVLV  335

Query  692  STSRDYVIA  718
            S   D+V+ 
Sbjct  336  SGDLDFVVG  344



>gb|KHG25736.1| hypothetical protein F383_04337 [Gossypium arboreum]
Length=570

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  176  NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
            NGD HD +S+L S DRDFL+RN+G QVK+D LKGKK+G+Y SASWCGPC RFTPNL  VY
Sbjct  13   NGDCHDFKSLLSSLDRDFLVRNNGDQVKIDSLKGKKLGLYISASWCGPCRRFTPNLIEVY  72

Query  356  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
             EL  KG+FEV+FVSADEDEESF  YF KMPW A+PFSDS  R+RLD  F+V GIPHLV+
Sbjct  73   TELSTKGDFEVIFVSADEDEESFNGYFSKMPWLAIPFSDSEARKRLDEPFSVMGIPHLVL  132

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            LDE+GKV TE+GV+I+ E+G E YPFT E+++E+KD EE   +EQS+KT+LVS SRD+V+
Sbjct  133  LDENGKVLTEEGVEIIREYGEEGYPFTPEKIQELKDLEEKAKKEQSIKTILVSRSRDFVV  192

Query  716  AA  721
             +
Sbjct  193  TS  194


 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 108/175 (62%), Gaps = 4/175 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K  E K    A +   A  L S+L S   DF++   G +VKV DL GK I +YF
Sbjct  315  YPFTPEKFAELKEIEKASEA--AQTLESVLVSGGLDFVLGKDGAKVKVADLVGKTILLYF  372

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  FTP+L  VY ++  K + FEV+F+S+D D  SF EY+  MPW A+PF+D+
Sbjct  373  SAHWCPPCRAFTPSLVEVYKKIKEKDDAFEVIFISSDRDRASFDEYYSGMPWLALPFNDA  432

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +  L   F V+GIP L+ L  +GK  T++   +V+ HG +AYPFT ER+KEI+
Sbjct  433  -RKSSLSRKFKVQGIPMLIALGPTGKTITKEARSLVMAHGADAYPFTEERLKEIE  486


 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 122/201 (61%), Gaps = 5/201 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K +E K   + E+      +++IL S  RDF++ + G +V V +L+GK +GIYF
Sbjct  156  YPFTPEKIQELK--DLEEKAKKEQSIKTILVSRSRDFVVTSDGSKVPVSELEGKTVGIYF  213

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SAS   P   FT  LA VY++L   G  FEVV +S D+DEESF++ FG  PW A+P  D 
Sbjct  214  SASSFKPSADFTQKLAEVYSKLKENGEKFEVVMISLDDDEESFRQSFG-APWLALPLKDK  272

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
             + E+L   F +  +P +VI+   GK    +  D + EHG+ AYPFT E+  E+K+ E+A
Sbjct  273  -SCEKLARYFELSTLPTVVIIGPDGKTLHPNAADAIDEHGIVAYPFTPEKFAELKEIEKA  331

Query  656  T*REQSLKTVLVSTSRDYVIA  718
            +   Q+L++VLVS   D+V+ 
Sbjct  332  SEAAQTLESVLVSGGLDFVLG  352



>ref|XP_010023550.1| PREDICTED: probable nucleoredoxin 1 isoform X3 [Eucalyptus grandis]
Length=525

 Score =   263 bits (673),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 149/188 (79%), Gaps = 0/188 (0%)
 Frame = +2

Query  158  SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            + + E    +HD++S+L S DRDFLIRN+G QVKVD LKGKKIG+YFSASWCGPC RFTP
Sbjct  2    ADVVEGGASSHDVQSLLSSPDRDFLIRNNGDQVKVDSLKGKKIGLYFSASWCGPCQRFTP  61

Query  338  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  517
             LA VYNEL PKG+ E++F+SADEDEESF  YF KMPW A+PFSDS  R+ LD LF VRG
Sbjct  62   TLAEVYNELSPKGDLEIIFISADEDEESFSGYFSKMPWLAIPFSDSEKRDSLDELFEVRG  121

Query  518  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVST  697
            IPHLV LD +G V T+ GV+IV E+GVE +PFT ER+KE+KD EEA  R QS+ ++LV  
Sbjct  122  IPHLVFLDGTGTVLTDSGVEIVREYGVEGHPFTAERIKELKDQEEAAKRNQSVTSILVDG  181

Query  698  SRDYVIAA  721
            SRD+V+++
Sbjct  182  SRDFVVSS  189


 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 101/156 (65%), Gaps = 2/156 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            ++  L SIL S DRDF+I   G ++ V DL GK + +YFSA WC PC  F P L   Y +
Sbjct  330  ESQTLESILVSGDRDFVIGKEGTKIPVLDLVGKTVLLYFSAHWCPPCRDFLPVLTEAYEK  389

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K N FE++F+S+D+D+ +F  Y+ +MPW A+PF D   ++ L+  F V GIP L+ +
Sbjct  390  IKAKNNAFELIFISSDKDQAAFDNYYAQMPWLALPFGDE-RKKSLNRKFKVDGIPTLIAI  448

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDA  646
              +G+  T++  +++ EHG +AYPFT E +K+++ +
Sbjct  449  GPTGRTLTKEARNLISEHGADAYPFTTEHLKKLEKS  484


 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 114/198 (58%), Gaps = 5/198 (3%)
 Frame = +2

Query  128  SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  307
            ++R  E +     A++N     + SIL    RDF++ + G +V V +L+GK +G+YFS S
Sbjct  155  AERIKELKDQEEAAKRN---QSVTSILVDGSRDFVVSSDGKKVPVAELEGKTVGLYFSLS  211

Query  308  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTR  484
                C  FTP L  V+ +L  KG  FE+V +  D+DEESF + FG MPW ++P  D    
Sbjct  212  IYKSCIDFTPILLDVHEKLKAKGERFEIVQIPLDDDEESFNQAFGSMPWLSLPLKDKKC-  270

Query  485  ERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*R  664
            E+L   F +  +P LVI+   GK    +  + V EHGVEAYPFT E+  E+ + +     
Sbjct  271  EKLVRYFELSTLPTLVIIGPDGKTLHSNVAETVEEHGVEAYPFTPEKFAELAEIQRKKEE  330

Query  665  EQSLKTVLVSTSRDYVIA  718
             Q+L+++LVS  RD+VI 
Sbjct  331  SQTLESILVSGDRDFVIG  348



>ref|XP_006483868.1| PREDICTED: probable nucleoredoxin 1-like [Citrus sinensis]
Length=570

 Score =   265 bits (676),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            M     ++HD++S+L SS RDFLIR++G QVK+D LKGKKIG+YFSASWCGPC RFTP L
Sbjct  1    MNMNGANSHDIQSLLSSSARDFLIRSNGDQVKIDSLKGKKIGLYFSASWCGPCQRFTPIL  60

Query  344  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
            A VYNEL  +G+FEV+FVS DED+E+FK YF KMPW AVPFSDS TR++LD LF V GIP
Sbjct  61   AEVYNELSRQGDFEVIFVSGDEDDEAFKGYFSKMPWLAVPFSDSETRDKLDELFKVMGIP  120

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
            HLVILDE+GKV ++ GV+I+ E+GVE YPFT+ER+KE+K+ EE   REQSL++VL S SR
Sbjct  121  HLVILDENGKVLSDGGVEIIREYGVEGYPFTVERIKEMKEQEERAKREQSLRSVLTSHSR  180

Query  704  DYVIAA  721
            D+VI++
Sbjct  181  DFVISS  186


 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 112/189 (59%), Gaps = 5/189 (3%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            M EQ   A     LRS+L S  RDF+I + G ++ V DL+GK IG+YFS S       FT
Sbjct  158  MKEQEERAKREQSLRSVLTSHSRDFVISSDGRKISVSDLEGKTIGLYFSMSSYKASAEFT  217

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  VY +L  KG +FE+V +S D++EESFK   G MPW A+PF D  +RE+L   F +
Sbjct  218  PRLVEVYEKLKGKGESFEIVLISLDDEEESFKRDLGSMPWLALPFKDK-SREKLARYFEL  276

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
              +P LVI+   GK    +  + + EHGV A+PFT E+  E+ + + A    Q+L+ VLV
Sbjct  277  STLPTLVIIGPDGKTLHSNVAEAIEEHGVGAFPFTPEKFAELAEIQRAKEESQTLELVLV  336

Query  692  STSRDYVIA  718
            S   D+V+ 
Sbjct  337  SGDLDFVVG  345


 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 103/174 (59%), Gaps = 4/174 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            F F+  K  E      A++  ++  L  +L S D DF++  +G +V V DL GK I +YF
Sbjct  308  FPFTPEKFAELAEIQRAKE--ESQTLELVLVSGDLDFVVGKNGGKVPVSDLVGKTILLYF  365

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y ++  +  + EVVF+S+D D+ SF E+F  MPW A+PF D+
Sbjct  366  SAHWCPPCRAFLPKLIEAYKKIKERNESLEVVFISSDRDQTSFDEFFKGMPWLALPFGDA  425

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEI  637
              +  L   F V GIP LV +  SG+  T++  D++  HG EAYPFT ER+KEI
Sbjct  426  -RKASLSRKFKVSGIPMLVAIGPSGRTITKEARDMIAVHGAEAYPFTEERMKEI  478



>ref|XP_006438373.1| hypothetical protein CICLE_v10031097mg [Citrus clementina]
 gb|ESR51613.1| hypothetical protein CICLE_v10031097mg [Citrus clementina]
Length=570

 Score =   265 bits (676),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            M     ++HD++S+L SS RDFLIR++G QVK+D LKGKKIG+YFSASWCGPC RFTP L
Sbjct  1    MNMNGANSHDIQSLLSSSARDFLIRSNGDQVKIDSLKGKKIGLYFSASWCGPCQRFTPIL  60

Query  344  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
            A VYNEL  +G+FEV+FVS DED+E+FK YF KMPW AVPFSDS TR++LD LF V GIP
Sbjct  61   AEVYNELSCQGDFEVIFVSGDEDDEAFKGYFSKMPWLAVPFSDSETRDKLDELFKVMGIP  120

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
            HLVILDE+GKV ++ GV+I+ E+GVE YPFT+ER+KE+K+ EE   REQSL++VL S SR
Sbjct  121  HLVILDENGKVLSDGGVEIIREYGVEGYPFTVERIKEMKEQEERAKREQSLRSVLTSHSR  180

Query  704  DYVIAA  721
            D+VI++
Sbjct  181  DFVISS  186


 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 112/189 (59%), Gaps = 5/189 (3%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            M EQ   A     LRS+L S  RDF+I + G ++ V DL+GK IG+YFS S       FT
Sbjct  158  MKEQEERAKREQSLRSVLTSHSRDFVISSDGRKISVSDLEGKTIGLYFSMSSYKASAEFT  217

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  VY +L  KG +FE+V +S D++EESFK   G MPW A+PF D  +RE+L   F +
Sbjct  218  PRLVEVYEKLKGKGESFEIVLISLDDEEESFKRDLGSMPWLALPFKDK-SREKLARYFEL  276

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
              +P LVI+   GK    +  + + EHGV A+PFT E+  E+ + + A    Q+L+ VLV
Sbjct  277  STLPTLVIIGPDGKTLHSNVAEAIEEHGVGAFPFTPEKFAELAEIQRAKEESQTLELVLV  336

Query  692  STSRDYVIA  718
            S   D+V+ 
Sbjct  337  SGDLDFVVG  345


 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 103/174 (59%), Gaps = 4/174 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            F F+  K  E      A++  ++  L  +L S D DF++  +G +V V DL GK I +YF
Sbjct  308  FPFTPEKFAELAEIQRAKE--ESQTLELVLVSGDLDFVVGKNGGKVPVSDLVGKTILLYF  365

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y ++  +  + EVVF+S+D D+ SF E+F  MPW A+PF D+
Sbjct  366  SAHWCPPCRAFLPKLIEAYKKIKERNESLEVVFISSDRDQTSFDEFFKGMPWLALPFGDA  425

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEI  637
              +  L   F V GIP LV +  SG+  T++  D++  HG EAYPFT ER+KEI
Sbjct  426  -RKASLSRKFKVSGIPMLVAIGPSGRTITKEAKDMIAVHGAEAYPFTEERMKEI  478



>gb|KCW59853.1| hypothetical protein EUGRSUZ_H025921, partial [Eucalyptus grandis]
Length=192

 Score =   252 bits (644),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 147/188 (78%), Gaps = 0/188 (0%)
 Frame = +2

Query  158  SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            + + E    +HD++S+L S DRDFLIRN+G QVKVD LKGKKIG+YFSASWCGPCHRFTP
Sbjct  2    ADVVEGGASSHDVQSLLSSPDRDFLIRNNGDQVKVDSLKGKKIGLYFSASWCGPCHRFTP  61

Query  338  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  517
             LA VY+EL PKG+ E++F+SAD+DE SF  YF KMPW A+PFSD   R  LD LF VRG
Sbjct  62   ILAEVYDELSPKGDLEIIFISADKDEGSFSGYFSKMPWLAIPFSDLDKRNSLDELFKVRG  121

Query  518  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVST  697
            IPHLVILD +G V T+ GV IV E+GVE +PFT ER+KE+KD EEAT   QS+ ++LV  
Sbjct  122  IPHLVILDGTGTVLTDSGVAIVREYGVEGHPFTPERIKELKDQEEATRINQSVTSLLVHG  181

Query  698  SRDYVIAA  721
            SR++V+++
Sbjct  182  SRNFVVSS  189



>ref|XP_007044667.1| DC1 domain-containing protein [Theobroma cacao]
 gb|EOY00499.1| DC1 domain-containing protein [Theobroma cacao]
Length=577

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = +2

Query  176  NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
            NGD HD +S+L SS+RDFL+RN+G +VK+D L G K+G+YFSASWCGPC RFTPNL  VY
Sbjct  13   NGDCHDFQSLLSSSNRDFLVRNNGDRVKIDSLNGTKLGLYFSASWCGPCRRFTPNLMEVY  72

Query  356  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
            +EL PKG+FE++FVS D+DEESF  YF KMPW A+PFSDS TR RLD LF V GIPHLV+
Sbjct  73   SELSPKGDFEIIFVSGDQDEESFNGYFSKMPWLAIPFSDSETRSRLDELFKVMGIPHLVL  132

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            L E+GKV T+DGV I+ E+GVE YPF  E+++E++D EE    EQS+KT+LVS SRD+V+
Sbjct  133  LGENGKVLTDDGVGIIQEYGVEGYPFNPEKIQELRDLEEKARTEQSIKTILVSRSRDFVV  192

Query  716  AA  721
             +
Sbjct  193  TS  194


 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 101/153 (66%), Gaps = 2/153 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A  L SIL S D DF+I   G +V+V +L GK + +YFSA WC PC  FTP L   Y ++
Sbjct  336  AQTLESILISGDLDFVIGKDGAKVQVTELVGKTVLLYFSAHWCPPCRGFTPKLVEAYKKI  395

Query  365  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K   FEVVFVS+D D+ SF+EY+ +MPW A+PF D+  +  L   F VRGIP LV + 
Sbjct  396  KAKNEAFEVVFVSSDRDQASFEEYYSEMPWLALPFGDA-RKPLLSRKFKVRGIPMLVAIG  454

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
             +GK  T++  ++++ HG +AYPFT ER+KEI+
Sbjct  455  PTGKTVTKETRNLIMAHGADAYPFTEERLKEIE  487


 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/201 (35%), Positives = 116/201 (58%), Gaps = 4/201 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K +E +   + E+      +++IL S  RDF++ + G++V V +L+GK +G+YF
Sbjct  156  YPFNPEKIQELR--DLEEKARTEQSIKTILVSRSRDFVVTSDGNKVPVSELEGKTVGLYF  213

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            S S       FTP LA VY +L  KG NFE+V +S D++EE   +     PW A+PF D 
Sbjct  214  SVSSYKASADFTPKLAEVYKKLKEKGENFEIVVISLDDEEEESFKESFVAPWLALPFKDK  273

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
              + +L   F +  +P +VI+   GK    +  + +  HG++AYPF+ ER  E+ + E+A
Sbjct  274  SCK-KLARYFELSTLPTVVIIGPDGKTLHSNVAEAIEGHGIQAYPFSPERFAELAEIEKA  332

Query  656  T*REQSLKTVLVSTSRDYVIA  718
                Q+L+++L+S   D+VI 
Sbjct  333  KEAAQTLESILISGDLDFVIG  353



>ref|XP_008340047.1| PREDICTED: probable nucleoredoxin 1 [Malus domestica]
Length=579

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = +2

Query  176  NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
              + HD  S+L SS+RDFL+RN+G Q+KV+ LKGKK+G+YFSASWCGPC RFTP L   Y
Sbjct  13   GAEPHDFVSLLSSSERDFLVRNNGDQIKVESLKGKKLGLYFSASWCGPCKRFTPALVEAY  72

Query  356  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
            NEL PKG+FE+VF+SADED+ESF+ YF KMPW A PFSDS  R+R+D LF VRGIPHLVI
Sbjct  73   NELSPKGDFEIVFISADEDDESFEGYFAKMPWLAFPFSDSEARDRVDELFKVRGIPHLVI  132

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            L E GKV ++ GV+I+ E+G +AYPFTLE++KE+KD EEA  R+QSLKT+LV+ SRD+VI
Sbjct  133  LGEDGKVLSDSGVEIIQEYGADAYPFTLEKLKELKDEEEAARRDQSLKTILVTRSRDFVI  192

Query  716  A  718
            +
Sbjct  193  S  193


 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L++IL +  RDF+I N G +V V +L+GK +G+YFS S  GPC  FTP L   +++L 
Sbjct  177  QSLKTILVTRSRDFVISNDGEKVPVSELEGKIVGLYFSLSLYGPCVEFTPKLVEAHDKLK  236

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              G NFE+V V  D+DEESFK+YF KMPW ++P  D  + ++L   F +  +P +VI+  
Sbjct  237  ANGENFEIVLVPLDDDEESFKQYFEKMPWFSLPIGDK-SVQKLARYFELSTLPTVVIIGA  295

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK   E+  D + EHG  AYPFT E+  E+ + E+A  + Q+L+++L+S  R++VI 
Sbjct  296  DGKTLGENVADAIDEHGSLAYPFTPEKFAELVEIEKAKEKAQTLESILISGDRNFVIG  353


 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 98/153 (64%), Gaps = 2/153 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A  L SIL S DR+F+I   G Q+ V DL GK I +YFSA WC PC  F P L   Y+ +
Sbjct  336  AQTLESILISGDRNFVIGKDGTQIPVTDLVGKNILLYFSAHWCPPCRAFLPKLVEAYHGI  395

Query  365  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K + FEV+F+S+D D+ SF E+F  MPW A+PF DS  +  L   F V+GIP L+ + 
Sbjct  396  KAKDDAFEVIFISSDRDQGSFDEFFATMPWLALPFGDS-RKAFLSRKFKVQGIPMLIAIG  454

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
             +G+  T++  ++++ HG  AYPFT ERVKEI+
Sbjct  455  PTGQTVTKEARNLIMRHGANAYPFTEERVKEIE  487



>gb|AGV54528.1| nucleoredoxin 1-like protein [Phaseolus vulgaris]
Length=571

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            MA    + HD+ S+L S  RDFL+RN+G QVK++ LKGKK+G+YFSASWCGPC +FTP L
Sbjct  1    MAASEDNTHDVVSLLSSPQRDFLLRNNGDQVKIESLKGKKLGVYFSASWCGPCRKFTPTL  60

Query  344  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
               YNE++ KG+FEVVF SADEDEESFK YF KMPW A+PFSDS TR RLD LF VRGIP
Sbjct  61   VEAYNEVVSKGDFEVVFASADEDEESFKGYFSKMPWLAIPFSDSETRSRLDELFHVRGIP  120

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
            HLVIL+E+GKV TEDGVDIV E+GV+AYPFT  R++E++  EE   R QS++++L+S SR
Sbjct  121  HLVILEETGKVVTEDGVDIVREYGVDAYPFTSARIQELRAQEEEARRNQSVRSLLISPSR  180

Query  704  DYVIAA  721
            D+VI++
Sbjct  181  DFVISS  186


 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 104/159 (65%), Gaps = 2/159 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A  L S+L S DR F+I   G Q+ V +LKGK + +YFSA WC PC  F P L   Y E+
Sbjct  328  AQTLESVLVSEDRGFVIGKDGVQIPVSELKGKVVLLYFSAHWCPPCRAFLPKLVDAYQEI  387

Query  365  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              KGN  EVVF+S+D+D+ SF E+FG MPW A+PF DS  ++ L   F V GIP LV + 
Sbjct  388  KAKGNALEVVFISSDKDQASFDEFFGGMPWLALPFGDS-RKKFLSRKFKVTGIPKLVAIG  446

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT  658
             SG+ +T +  D+VL++G  AYPFT E++++I+  EE T
Sbjct  447  SSGQTSTTEARDLVLQYGARAYPFTEEKIQDIEAEEEET  485


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 49/91 (54%), Gaps = 4/91 (4%)
 Frame = +2

Query  128  SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  307
            S R  E R     A +N     +RS+L S  RDF+I + G+ + V +L+GK +G+ FS +
Sbjct  152  SARIQELRAQEEEARRN---QSVRSLLISPSRDFVISSDGNNILVSELEGKTVGLEFSRN  208

Query  308  WCGPCHRFTPNLATVYNELLPKG-NFEVVFV  397
                   FTP    VY +L  +G NFEVV +
Sbjct  209  SFHRNSEFTPRPGEVYEKLKAQGENFEVVLI  239



>ref|XP_007153741.1| hypothetical protein PHAVU_003G061100g [Phaseolus vulgaris]
 gb|ESW25735.1| hypothetical protein PHAVU_003G061100g [Phaseolus vulgaris]
Length=571

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            MA    + HD+ S+L S  RDFL+RN+G QVK++ LKGKK+G+YFSASWCGPC +FTP L
Sbjct  1    MAASADNTHDVVSLLSSPQRDFLLRNNGDQVKIESLKGKKLGVYFSASWCGPCRKFTPTL  60

Query  344  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
               YNE++ KG+FEVVF SADEDEESFK YF +MPW A+PFSDS TR RLD LF VRGIP
Sbjct  61   VEAYNEVVSKGDFEVVFASADEDEESFKGYFSEMPWLAIPFSDSETRSRLDELFHVRGIP  120

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
            HLVIL+E+GKV TEDGVDIV E+GVEAYPFT  R++E++  EE   R QS++++L+S SR
Sbjct  121  HLVILEETGKVVTEDGVDIVREYGVEAYPFTSARIQELRAQEEEARRNQSVRSLLISPSR  180

Query  704  DYVIAA  721
            D+VI++
Sbjct  181  DFVISS  186


 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 104/159 (65%), Gaps = 2/159 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A  L S+L S DR F+I   G Q+ V +LKGK + +YFSA WC PC  F P L   Y E+
Sbjct  328  AQTLESVLVSEDRGFVIGKDGVQIPVSELKGKVVLLYFSAHWCPPCRAFLPKLVDAYQEI  387

Query  365  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              KGN  EVVF+S+D+D+ SF E+FG MPW A+PF DS  ++ L   F V GIP LV + 
Sbjct  388  KEKGNALEVVFISSDKDQASFDEFFGGMPWLALPFGDS-RKKFLSRKFKVTGIPKLVAIG  446

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT  658
             SG+ +T +  D+VL++G  AYPFT E++++I+  EE T
Sbjct  447  SSGQTSTTEARDLVLQYGARAYPFTEEKIQDIEAEEEET  485


 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 115/198 (58%), Gaps = 5/198 (3%)
 Frame = +2

Query  128  SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  307
            S R  E R     A +N     +RS+L S  RDF+I + G+++ V +L+GK +G+YFS +
Sbjct  152  SARIQELRAQEEEARRN---QSVRSLLISPSRDFVISSDGNKILVSELEGKTVGLYFSLN  208

Query  308  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTR  484
                   FTP L  VY +L  KG NFEVV +  DEDEESFK+  G +PW ++PF D    
Sbjct  209  SFQRSSEFTPKLVDVYEKLKAKGENFEVVLIPLDEDEESFKKVLGSVPWLSLPFKDKFCG  268

Query  485  ERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*R  664
             +L   F +  +P LVI+   GK    +  + + +HGV+AYPFT E+  E+ +  +A   
Sbjct  269  -KLAQYFELSTLPTLVIIGPDGKTLNPNVAEAIEDHGVDAYPFTPEKFVELDEILKAREA  327

Query  665  EQSLKTVLVSTSRDYVIA  718
             Q+L++VLVS  R +VI 
Sbjct  328  AQTLESVLVSEDRGFVIG  345



>gb|KFK40790.1| hypothetical protein AALP_AA2G041400 [Arabis alpina]
Length=572

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 146/185 (79%), Gaps = 1/185 (1%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            MAE  GDA DL S+L S  RDFL+RN G QVK+D LKGKKIG+YFSASWCGPC RFTP L
Sbjct  1    MAE-GGDARDLHSLLSSPSRDFLLRNDGQQVKIDSLKGKKIGLYFSASWCGPCQRFTPQL  59

Query  344  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
              VYNEL PK  FEVVFVS DEDEESF +YF KMPW AVPF+DS TR+RLD +F VRGIP
Sbjct  60   VQVYNELAPKAGFEVVFVSGDEDEESFTDYFSKMPWLAVPFTDSETRDRLDEVFKVRGIP  119

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
            +LVI+D+ GK+  E+GV  +  +G EAYPFT ER+KEIK+ E+   REQ+L +VLVS SR
Sbjct  120  NLVIIDDQGKLENENGVGNIRSYGAEAYPFTPERMKEIKEGEDRARREQTLTSVLVSPSR  179

Query  704  DYVIA  718
            D+VI+
Sbjct  180  DFVIS  184


 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 108/175 (62%), Gaps = 4/175 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K EE KA   A+   +A  L S+L S D ++++   G +V V +L GK I +YF
Sbjct  307  YPFTPEKFEELKAIEKAK--AEAQTLESLLVSGDLNYVLGKDGAKVLVSELVGKNILMYF  364

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  FTP L  VY ++  +   FE++F+S+D D E+F EY+ +MPW A+P+ D 
Sbjct  365  SAHWCPPCRAFTPKLVEVYKQIKERDEAFELIFISSDRDPEAFSEYYSQMPWLALPYGDP  424

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +  L   F V GIP L  L  +G+  T++  D+VL HG +AYPFT ER+KEI+
Sbjct  425  -RKSTLSQTFKVGGIPMLAALGPTGRTVTKEARDLVLAHGADAYPFTEERLKEIE  478


 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 108/176 (61%), Gaps = 2/176 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            L S+L S  RDF+I   G++V V +L+GK IG+ FS      C  F+P L  VYN+L   
Sbjct  170  LTSVLVSPSRDFVISRDGNKVPVSELEGKTIGLLFSVGTYKKCTEFSPKLVEVYNKLKEN  229

Query  374  -GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
             G+FE+V +S ++DEESFK+ F   PW A+PF+D  +  +L   F +  +P LVIL   G
Sbjct  230  GGDFEIVLISLEDDEESFKQDFETKPWLALPFNDK-SSSKLARHFMLSTLPTLVILGPDG  288

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  + + EHG+ AYPFT E+ +E+K  E+A    Q+L+++LVS   +YV+ 
Sbjct  289  KTRHSNVAEAIEEHGIVAYPFTPEKFEELKAIEKAKAEAQTLESLLVSGDLNYVLG  344



>ref|XP_007222066.1| hypothetical protein PRUPE_ppa003234mg [Prunus persica]
 gb|EMJ23265.1| hypothetical protein PRUPE_ppa003234mg [Prunus persica]
Length=590

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = +2

Query  176  NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
            N + HD  S+L SS+RDFL+RN+G Q+KV+ LKGKK+G+YFSASWCGPC RFTP+L   Y
Sbjct  13   NSEPHDFCSLLSSSERDFLVRNNGDQIKVESLKGKKLGLYFSASWCGPCQRFTPSLVEAY  72

Query  356  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
            NEL PKG+FEVVF+SADED+ESF  YF KMPW A+PFSD   R+R+D LF VRGIPHLVI
Sbjct  73   NELSPKGDFEVVFISADEDDESFNGYFSKMPWLAIPFSDKEARDRVDKLFKVRGIPHLVI  132

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            L E GKV ++ GV+I+ EHGV+ YPFT E++KE+ D E A  R+QSLKT+LVS  RD+VI
Sbjct  133  LGEDGKVLSDSGVEIIKEHGVDGYPFTPEKIKELNDQEAAARRDQSLKTILVSRLRDFVI  192

Query  716  A  718
            +
Sbjct  193  S  193


 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 99/153 (65%), Gaps = 2/153 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A  L SIL S DR+F+I   G ++ V DL GK I +YFSA WC PC  F P L   Y+++
Sbjct  336  AQTLESILVSGDRNFVIGKGGTEIPVSDLVGKNILLYFSAHWCPPCRAFLPKLVEAYHKI  395

Query  365  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K + FEV+F+S+D D+  F E+F  MPW A+PF D + +  L   F V+GIP LV + 
Sbjct  396  KAKDDAFEVIFISSDRDQGDFDEFFSGMPWLALPFGD-LRKASLSRKFKVKGIPMLVAIG  454

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
             +G+  T++  ++V++HG  AYPFT ER+KEI+
Sbjct  455  PTGQTVTKEARNLVMQHGANAYPFTEERLKEIE  487


 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 110/178 (62%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L++IL S  RDF+I N G  V V +L+GK +G+YFS S   PC  FTP L  VY +L 
Sbjct  177  QSLKTILVSRLRDFVISNDGKNVPVSELEGKIVGLYFSLSVYSPCVDFTPKLLEVYEKLK  236

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              G +FEVV +  D+DEESFK+ F  MPW ++P  D     +L   F +  +P LVI+  
Sbjct  237  ANGESFEVVVIPLDDDEESFKQDFKNMPWFSLPIGDK-NIGKLARYFELSTLPTLVIIGA  295

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK  +++  + + EHGV AYPFT E+  E+ + E+A  + Q+L+++LVS  R++VI 
Sbjct  296  DGKTVSKNVAEAIEEHGVLAYPFTPEKFAELIEIEKAKEKAQTLESILVSGDRNFVIG  353



>ref|XP_010023549.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Eucalyptus grandis]
 gb|KCW59849.1| hypothetical protein EUGRSUZ_H02589 [Eucalyptus grandis]
Length=526

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +HD++S+L S DRDFL+RN+G +VKVD LKGKKIG+YFSASWCGPC RFTP LA VYNEL
Sbjct  12   SHDVQSLLSSPDRDFLVRNNGDRVKVDSLKGKKIGLYFSASWCGPCQRFTPTLAEVYNEL  71

Query  365  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             PKG+ E++F+SADEDEESF  YF KMPW A+PFSDS  R+ LD LF VRGIPHLV LD 
Sbjct  72   SPKGDLEIIFISADEDEESFSGYFSKMPWLAIPFSDSEKRDSLDELFEVRGIPHLVFLDG  131

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            +G V T+ GV+IV E+GVE +PFT ER+KE+KD EEA  R QS+ ++LV  SRD+V+++
Sbjct  132  TGTVLTDSGVEIVREYGVEGHPFTAERIKELKDQEEAAKRNQSVTSILVDGSRDFVVSS  190


 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 104/164 (63%), Gaps = 2/164 (1%)
 Frame = +2

Query  158  SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            + +  +  ++  L SIL S DRDF+I   G ++ V DL GK + +YFSA WC PC  F P
Sbjct  323  AEIQRKKEESQTLESILVSGDRDFVIGKEGTKIPVLDLVGKTVLLYFSAHWCPPCRDFLP  382

Query  338  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  514
             L   Y ++  K N FE++F+S+D+D+ +F  Y+ +MPW A+PF D   ++ L+  F V 
Sbjct  383  VLTEAYEKIKAKNNAFELIFISSDKDQAAFDNYYAQMPWLALPFGDE-RKKSLNRKFKVD  441

Query  515  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDA  646
            GIP L+ +  +G+  T++  +++ EHG +AYPFT E +K+++ +
Sbjct  442  GIPTLIAIGPTGRTLTKEARNLISEHGADAYPFTTEHLKKLEKS  485


 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 114/198 (58%), Gaps = 5/198 (3%)
 Frame = +2

Query  128  SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  307
            ++R  E +     A++N     + SIL    RDF++ + G +V V +L+GK +G+YFS S
Sbjct  156  AERIKELKDQEEAAKRN---QSVTSILVDGSRDFVVSSDGKKVPVAELEGKTVGLYFSLS  212

Query  308  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTR  484
                C  FTP L  V+ +L  KG  FE+V +  D+DEESF + FG MPW ++P  D    
Sbjct  213  IYKSCIDFTPILLDVHEKLKAKGERFEIVQIPLDDDEESFNQAFGSMPWLSLPLKDKKC-  271

Query  485  ERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*R  664
            E+L   F +  +P LVI+   GK    +  + V EHGVEAYPFT E+  E+ + +     
Sbjct  272  EKLVRYFELSTLPTLVIIGPDGKTLHSNVAETVEEHGVEAYPFTPEKFAELAEIQRKKEE  331

Query  665  EQSLKTVLVSTSRDYVIA  718
             Q+L+++LVS  RD+VI 
Sbjct  332  SQTLESILVSGDRDFVIG  349



>ref|XP_004509957.1| PREDICTED: probable nucleoredoxin 1-like [Cicer arietinum]
Length=569

 Score =   260 bits (664),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 146/186 (78%), Gaps = 0/186 (0%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            MA+     HDL S+L S DRDFL+RN+G QVK+D LKGKK+G+YFSASWCGPC  FTP L
Sbjct  1    MADSVDVTHDLHSLLSSPDRDFLLRNNGDQVKIDSLKGKKLGLYFSASWCGPCRGFTPTL  60

Query  344  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
               YNEL P G FEVVF++ADED+E+FK YF KMPW A+PFSDS TR RLD LF V GIP
Sbjct  61   VEAYNELSPNGEFEVVFITADEDDEAFKSYFSKMPWLAIPFSDSDTRNRLDELFHVNGIP  120

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
            HL +LDE+GKV  EDGVDI+ E+G EA+PFT ER++E+KD EE   R QSL+++L S SR
Sbjct  121  HLALLDETGKVVAEDGVDIIREYGPEAFPFTSERIQELKDQEEEAKRNQSLRSILGSRSR  180

Query  704  DYVIAA  721
            D+VI++
Sbjct  181  DFVISS  186


 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 94/149 (63%), Gaps = 3/149 (2%)
 Frame = +2

Query  200  SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGN  379
            S+L S DRDF+I   G ++ V  L+GK + +YFSA WC PC  F P L   Y+++  + N
Sbjct  333  SVLVSGDRDFVIEKDGEKIPVSKLEGKTVLLYFSAHWCPPCRAFLPKLIDAYHKIKAQDN  392

Query  380  --FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGK  553
               EV+F+S   D+ SF E+F  MPW A+PF DS  +E L   F V GIP LV +  +G+
Sbjct  393  DALEVIFISRYRDQASFDEFFAXMPWLALPFGDS-RKEFLSRKFKVSGIPKLVAIGSNGR  451

Query  554  VTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              T++  D+V  +G +AYPFT ER+KEI+
Sbjct  452  TVTKEARDLVALYGADAYPFTEERIKEIE  480


 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/200 (37%), Positives = 116/200 (58%), Gaps = 4/200 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            F F+  + +E K     E+      LRSIL S  RDF+I + G  + + +L+GK +G+YF
Sbjct  148  FPFTSERIQELK--DQEEEAKRNQSLRSILGSRSRDFVISSDGKNIPISELEGKTVGLYF  205

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
             A+    C  FT  L  VY +L  +G NFEVV +  D++EES ++    + W ++P  D 
Sbjct  206  CANSYRSCTTFTSQLKDVYKKLKAEGENFEVVVIPLDDEEESLEKELESVHWLSLPIKDK  265

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
             T  +L   F +  +P LVI+  +GK    +  +I+ +HG+ AYPFT E++ E+++ E+A
Sbjct  266  -TCAKLVQYFELSALPTLVIIGPNGKTLHPNAAEIIEDHGITAYPFTPEKLAELEEIEKA  324

Query  656  T*REQSLKTVLVSTSRDYVI  715
                Q++ +VLVS  RD+VI
Sbjct  325  KEATQTIGSVLVSGDRDFVI  344



>gb|KEH20025.1| protein disulfide isomerase (PDI)-like protein [Medicago truncatula]
Length=570

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 148/187 (79%), Gaps = 1/187 (1%)
 Frame = +2

Query  164  MAEQNGD-AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPN  340
            MA+   D  H++ SIL SSDRDFL+RN+G QVK+D LKGKK+G YFSASWCGPC  FTP 
Sbjct  1    MADSVADVTHNVHSILSSSDRDFLLRNTGDQVKIDSLKGKKLGFYFSASWCGPCRGFTPK  60

Query  341  LATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
            L  VY+EL P G FEVVFVSAD+D+E+FK YF KMPW A+PFSDS TR RLD LF V GI
Sbjct  61   LVEVYDELSPNGEFEVVFVSADKDDEAFKSYFSKMPWLAIPFSDSETRGRLDELFHVNGI  120

Query  521  PHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTS  700
            PHL +LDE+GKV TEDGVDI+  +G EAYPFT +RV+E+KD EE   R QSL+++L S S
Sbjct  121  PHLALLDEAGKVITEDGVDIIRVYGAEAYPFTSKRVQELKDIEEEAKRNQSLRSILASRS  180

Query  701  RDYVIAA  721
            RD++I++
Sbjct  181  RDFLISS  187


 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 101/161 (63%), Gaps = 3/161 (2%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            +A+    +  L S+L S D+DF+I   G ++ V +L GK + +YFSA WC PC  F P L
Sbjct  322  IAKAKEASQTLESVLVSGDQDFVIDKDGKKIPVSELVGKTVLLYFSAHWCPPCRAFLPKL  381

Query  344  ATVYNELLPKGN--FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  517
               Y+++  + N   EVVF+S+D D+ESF E+F  MPW A+PF D+  +E L   F V G
Sbjct  382  IEAYHKIKAQNNDALEVVFISSDRDQESFNEFFAGMPWLALPFGDT-RKEFLSRKFKVSG  440

Query  518  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
            IP LV +  SG+  T++   +V  +G +AYPFT +R+KEI+
Sbjct  441  IPKLVAIGPSGQTVTKEARGLVGLYGADAYPFTEKRIKEIE  481


 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 116/197 (59%), Gaps = 5/197 (3%)
 Frame = +2

Query  128  SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  307
            SKR  E +     A++N     LRSIL S  RDFLI + G+++ + +L+GK +G++F A+
Sbjct  153  SKRVQELKDIEEEAKRN---QSLRSILASRSRDFLISSDGNEIPISELEGKTVGLHFCAT  209

Query  308  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTR  484
                C  FT  L  VY +L   G NFEVVF+  D++E++FK+     PW ++P  D  T 
Sbjct  210  SYRACTLFTQKLKEVYKKLKENGENFEVVFIPLDDEEDAFKKELESAPWLSLPLKDK-TC  268

Query  485  ERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*R  664
             +L   F +  +P LVI+   GK    +  + + +HGV+AYPFT E+  E+ +  +A   
Sbjct  269  AKLIQYFELSELPTLVIIGPDGKTLHPNAAEAIEDHGVDAYPFTPEKFSELDEIAKAKEA  328

Query  665  EQSLKTVLVSTSRDYVI  715
             Q+L++VLVS  +D+VI
Sbjct  329  SQTLESVLVSGDQDFVI  345



>gb|KDO82401.1| hypothetical protein CISIN_1g008336mg [Citrus sinensis]
Length=569

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            M     ++HD++S+L SS RDFLIR++G QVK+D LKGK IG+YFSASWCGPC RFTP L
Sbjct  1    MNMNGANSHDIQSLLSSSARDFLIRSNGDQVKLDSLKGK-IGLYFSASWCGPCQRFTPIL  59

Query  344  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
            A VYNEL  +G+FEV+FVS DED+E+FK YF KMPW AVPFSDS TR++LD LF V GIP
Sbjct  60   AEVYNELSRQGDFEVIFVSGDEDDEAFKGYFSKMPWLAVPFSDSETRDKLDELFKVMGIP  119

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
            HLVILDE+GKV ++ GV+I+ E+GVE YPFT+ER+KE+K+ EE   REQSL++VL S SR
Sbjct  120  HLVILDENGKVLSDGGVEIIREYGVEGYPFTVERIKEMKEQEERAKREQSLRSVLTSHSR  179

Query  704  DYVIAA  721
            D+VI++
Sbjct  180  DFVISS  185


 Score =   146 bits (368),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 113/189 (60%), Gaps = 5/189 (3%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            M EQ   A     LRS+L S  RDF+I + G ++ V DL+GK IG+YFS S       FT
Sbjct  157  MKEQEERAKREQSLRSVLTSHSRDFVISSDGRKISVSDLEGKTIGLYFSMSSYKASAEFT  216

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  VY +L  KG +FE+V +S D++EESFK   G MPW A+PF D  +RE+L   F +
Sbjct  217  PRLVEVYEKLKGKGESFEIVLISLDDEEESFKRDLGSMPWLALPFKDK-SREKLARYFEL  275

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
              +P LVI+   GK    +  + + EHGV A+PFT E+  E+ + + A    Q+L++VLV
Sbjct  276  STLPTLVIIGPDGKTLHSNVAEAIEEHGVGAFPFTPEKFAELAEIQRAKEESQTLESVLV  335

Query  692  STSRDYVIA  718
            S   D+V+ 
Sbjct  336  SGDLDFVVG  344


 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 104/174 (60%), Gaps = 4/174 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            F F+  K  E      A++  ++  L S+L S D DF++  +G +V V DL GK I +YF
Sbjct  307  FPFTPEKFAELAEIQRAKE--ESQTLESVLVSGDLDFVVGKNGGKVPVSDLAGKTILLYF  364

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y ++  +  + EVVF+S+D D+ SF E+F  MPW A+PF D+
Sbjct  365  SAHWCPPCRAFLPKLIDAYKKIKERNESLEVVFISSDRDQTSFDEFFKGMPWLALPFGDA  424

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEI  637
              +  L   F V GIP LV +  SG+  T++  D++  HG EAYPFT ER+KEI
Sbjct  425  -RKASLSRKFKVSGIPMLVAIGPSGRTITKEARDMIAVHGAEAYPFTEERMKEI  477



>ref|XP_010023554.1| PREDICTED: probable nucleoredoxin 1 isoform X6 [Eucalyptus grandis]
 gb|KCW59848.1| hypothetical protein EUGRSUZ_H02588 [Eucalyptus grandis]
Length=485

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 147/188 (78%), Gaps = 0/188 (0%)
 Frame = +2

Query  158  SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            + + E    +HD++S+L S DRDFLIRN+G QVKVD LKGKKIG+YFSASWCGPCHRFT 
Sbjct  2    ADVVEGGASSHDVQSLLSSPDRDFLIRNNGDQVKVDSLKGKKIGLYFSASWCGPCHRFTL  61

Query  338  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  517
             LA VYNEL PKG+ E++F+SAD+DE SF  YF KMPW A+PFSDS  R  LD LF VRG
Sbjct  62   ILAEVYNELSPKGDLEIIFISADKDEGSFSGYFSKMPWLAIPFSDSDKRNGLDELFKVRG  121

Query  518  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVST  697
            IPHLVILD +G V T++G  IV E+GVE YPFT ER+KE+KD +EA  + QSL ++LV  
Sbjct  122  IPHLVILDGNGTVLTDEGDKIVREYGVEGYPFTPERIKELKDQDEAARKNQSLTSLLVHG  181

Query  698  SRDYVIAA  721
            SRD+V+++
Sbjct  182  SRDFVVSS  189


 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            ++  L S+L S D DF+I   G ++ V DL GK + +YFSA WC PC  F P L   Y +
Sbjct  330  ESQTLESLLVSGDLDFVIGKEGAKIPVSDLVGKTVLLYFSAHWCPPCRAFLPVLIESYEK  389

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K N FEV+F+S+D+D+ +F  YF +MPW A+PF D   ++ L   F VRGIP L+ +
Sbjct  390  IKAKDNAFEVIFLSSDKDQTAFDNYFAEMPWLALPFGDE-RKKSLSRKFKVRGIPTLIAI  448

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAE  649
              +G+  T    ++++EHG +A+PFT E +K  ++++
Sbjct  449  GPTGRTLTNKARNLIMEHGADAHPFTAEHLKTFEESK  485


 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 113/201 (56%), Gaps = 4/201 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  + +E K    A +   +  L S+L    RDF++ ++G++V V +L+GK +G+YF
Sbjct  151  YPFTPERIKELKDQDEAARKNQS--LTSLLVHGSRDFVVSSAGNKVPVAELEGKTVGLYF  208

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            S S    C  F P L  VY +L  KG +FE+V +   +DE SF + F  +PW ++P  D 
Sbjct  209  SLSKNKSCVDFMPKLLEVYEKLKAKGESFEIVQIPLGDDEASFNQTFESLPWLSLPLKDK  268

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
               E+L   F +  +P LVI+   GK    +  + V EHGV AYPFT E+  E+ + E+ 
Sbjct  269  KC-EKLVTYFELLTVPTLVIIGPDGKTMHSNVAETVEEHGVAAYPFTPEKFAELAEIEKK  327

Query  656  T*REQSLKTVLVSTSRDYVIA  718
                Q+L+++LVS   D+VI 
Sbjct  328  REESQTLESLLVSGDLDFVIG  348



>ref|XP_008221828.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Prunus mume]
Length=580

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = +2

Query  176  NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
            N + HD RS+L SS+RDFL+RN+G Q+KV+ LKGKK+G+YFSASWCGPC +FTP+L   Y
Sbjct  13   NSEPHDFRSLLSSSERDFLVRNNGDQIKVESLKGKKLGLYFSASWCGPCQQFTPSLVEAY  72

Query  356  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
            NEL PKG+FEVVF+SADED+ESF  YF KMPW A+PF D   R+R+D LF V GIP LVI
Sbjct  73   NELSPKGDFEVVFISADEDDESFNGYFSKMPWLAIPFFDKKARDRVDKLFKVIGIPCLVI  132

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            L E GKV ++ GV+I+ E+GV+ YPFT E+VKE+KD EEA  R QSLKT+LVS SRD+VI
Sbjct  133  LGEDGKVLSDSGVEIIKEYGVDGYPFTPEKVKELKDQEEAARRNQSLKTILVSRSRDFVI  192

Query  716  A  718
            +
Sbjct  193  S  193


 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 100/153 (65%), Gaps = 2/153 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A  L SIL S DR+F+I   G ++ V DL GK I +YFSA WC PC  F P L   Y+++
Sbjct  336  AQTLESILVSGDRNFVIGKGGTEIPVSDLVGKNILLYFSAHWCPPCRAFLPKLVEAYHKI  395

Query  365  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K + FEV+F+S+D+D+  F E+F  MPW A+PF D + +  L   F VRGIP LV + 
Sbjct  396  KAKDDAFEVIFISSDKDQGDFDEFFSGMPWFALPFGD-LRKASLSRRFKVRGIPMLVAIG  454

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
             +G+  T++  D+V++HG  AYPFT ER+KEI+
Sbjct  455  PTGQTVTKEARDLVMQHGANAYPFTEERLKEIE  487


 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 120/201 (60%), Gaps = 4/201 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K +E K    A +   +  L++IL S  RDF+I N G  V V +L+GK +G+YF
Sbjct  156  YPFTPEKVKELKDQEEAARRNQS--LKTILVSRSRDFVISNDGKNVPVSELEGKIVGLYF  213

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            S S    C  FTP L  VY +L   G +F+VV +  D+DEESFK+ F  MPW ++P  D 
Sbjct  214  SLSVYNRCVDFTPKLLEVYEKLKANGESFQVVVIPLDDDEESFKQDFKSMPWFSLPIGDK  273

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
               E+L   F +  +P LVI+   GK  +++  + + EHGV AYPFT E+  E+ + E+A
Sbjct  274  -NVEKLARYFELSTLPTLVIIGADGKTISKNVAEAIEEHGVLAYPFTPEKFAELIEIEKA  332

Query  656  T*REQSLKTVLVSTSRDYVIA  718
              + Q+L+++LVS  R++VI 
Sbjct  333  KEKAQTLESILVSGDRNFVIG  353



>gb|KHN26883.1| Putative nucleoredoxin 1 [Glycine soja]
Length=570

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            MA+     HD+ S+L S  RDFL+RN+G QVK+D LKGKK+G+YFSASWCGPC  FTP L
Sbjct  1    MADSADVTHDVVSLLSSPQRDFLLRNNGDQVKIDSLKGKKLGLYFSASWCGPCQTFTPTL  60

Query  344  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
              VYNE+  KG+F++VF++ADED+ESF  YF KMPW A+PFSDS TR RLD LF VRGIP
Sbjct  61   VDVYNEVAKKGDFQIVFITADEDDESFNGYFSKMPWLAIPFSDSDTRSRLDELFHVRGIP  120

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
            HL +LDE+G V TEDGVD++ E+GVE YPFT  R++E++D EE   R QS++++LVS SR
Sbjct  121  HLALLDEAGNVVTEDGVDVIREYGVEGYPFTSARIQELRDQEEEARRNQSVRSLLVSPSR  180

Query  704  DYVIAA  721
            D+VI++
Sbjct  181  DFVISS  186


 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 101/159 (64%), Gaps = 2/159 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A  L SIL S D+DF+I   G ++ V +LKGK + +YFSA WC PC  F P L   YN++
Sbjct  328  AQTLESILVSDDQDFVIGKDGVKIPVSELKGKVVLLYFSAHWCPPCRAFLPKLIDAYNKI  387

Query  365  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              KGN  EVVF+S+D D+ SF E+F  MPW A+PF DS  ++ L   F V GIP LV + 
Sbjct  388  KEKGNALEVVFISSDRDQTSFDEFFAGMPWLALPFGDS-RKKFLSRKFKVSGIPMLVAIA  446

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT  658
             SG+  T    D+V  +G +AYPFT ER+KEI+  +E T
Sbjct  447  SSGQTLTTKARDLVSLYGADAYPFTEERIKEIETEQEET  485


 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +2

Query  128  SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  307
            S R  E R     A +N     +RS+L S  RDF+I + G +  V +L+GK +G+YF   
Sbjct  152  SARIQELRDQEEEARRN---QSVRSLLVSPSRDFVISSDGKKTLVSELEGKTVGLYFCVK  208

Query  308  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTR  484
              G C  FTP L  VY +L  +G NFEVV +  D+DEESFKE    +PW ++PF D +  
Sbjct  209  SFGSCSDFTPKLVEVYEKLKAQGENFEVVLIPLDDDEESFKELLESVPWLSLPFKDKICG  268

Query  485  ERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*R  664
             +L   F +  +P LVI+   GK    +  + + +HGV AYPFT E+  E+ +  +A   
Sbjct  269  -KLARYFELSTLPTLVIIGPDGKTLHSNVAEAIEDHGVAAYPFTPEKFAELDEILKAKEA  327

Query  665  EQSLKTVLVSTSRDYVIA  718
             Q+L+++LVS  +D+VI 
Sbjct  328  AQTLESILVSDDQDFVIG  345



>ref|XP_003532006.1| PREDICTED: probable nucleoredoxin 1-like isoform X1 [Glycine 
max]
Length=570

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            MA+     HD+ S+L S  RDFL+RN+G QVK+D LKGKK+G+YFSASWCGPC  FTP L
Sbjct  1    MADSADVTHDVVSLLSSPQRDFLLRNNGDQVKIDSLKGKKLGLYFSASWCGPCQTFTPTL  60

Query  344  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
              VYNE+  KG+F++VF++ADED+ESF  YF KMPW A+PFSDS TR RLD LF VRGIP
Sbjct  61   VDVYNEVAKKGDFQIVFITADEDDESFNGYFSKMPWLAIPFSDSDTRSRLDELFHVRGIP  120

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
            HL +LDE+G V TEDGVD++ E+GVE YPFT  R++E++D EE   R QS++++LVS SR
Sbjct  121  HLALLDEAGNVVTEDGVDVIREYGVEGYPFTSARIQELRDQEEEARRNQSVRSLLVSPSR  180

Query  704  DYVIAA  721
            D+VI++
Sbjct  181  DFVISS  186


 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 101/159 (64%), Gaps = 2/159 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A  L SIL S D+DF+I   G ++ V +LKGK + +YFSA WC PC  F P L   YN++
Sbjct  328  AQTLESILVSDDQDFVIGKDGVKIPVSELKGKVVLLYFSAHWCPPCRAFLPKLIDAYNKI  387

Query  365  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              KGN  EVVF+S+D D+ SF E+F  MPW A+PF DS  ++ L   F V GIP LV + 
Sbjct  388  KEKGNALEVVFISSDRDQTSFDEFFAGMPWLALPFGDS-RKKFLSRKFRVSGIPMLVAIA  446

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT  658
             SG+  T    D+V  +G +AYPFT ER+KEI+  +E T
Sbjct  447  SSGQTLTTKARDLVSLYGADAYPFTEERIKEIETEQEET  485


 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +2

Query  128  SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  307
            S R  E R     A +N     +RS+L S  RDF+I + G +  V +L+GK +G+YF   
Sbjct  152  SARIQELRDQEEEARRN---QSVRSLLVSPSRDFVISSDGKKTLVSELEGKTVGLYFCVK  208

Query  308  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTR  484
              G C  FTP L  VY +L  +G NFEVV +  D+DEESFKE    +PW ++PF D +  
Sbjct  209  SFGSCSDFTPKLVEVYEKLKAQGENFEVVLIPLDDDEESFKELLESVPWLSLPFKDKICG  268

Query  485  ERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*R  664
             +L   F +  +P LVI+   GK    +  + + +HGV AYPFT E+  E+ +  +A   
Sbjct  269  -KLARYFELSTLPTLVIIGPDGKTLHSNVAEAIEDHGVAAYPFTPEKFAELDEILKAKEA  327

Query  665  EQSLKTVLVSTSRDYVIA  718
             Q+L+++LVS  +D+VI 
Sbjct  328  AQTLESILVSDDQDFVIG  345



>ref|XP_011071086.1| PREDICTED: probable nucleoredoxin 1 [Sesamum indicum]
Length=585

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            +DL SILC  +RDFL+RN+G QV+VD L+GK +G+YFSASWCGPC RFTPNL  VYNELL
Sbjct  18   YDLASILCVPNRDFLVRNNGDQVRVDSLRGKIVGLYFSASWCGPCQRFTPNLVEVYNELL  77

Query  368  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  547
               NFE+VFVS+DED+ESF  YF KMPW A+PFSDS TR +LD LF V GIPHL ILDE+
Sbjct  78   QVNNFEIVFVSSDEDDESFNAYFSKMPWLAIPFSDSETRGQLDELFAVSGIPHLEILDEN  137

Query  548  GKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            GKV T DGV+I+ EHGVE YPFT E ++++ + EE   R QSLKT+LV+ SRDYVI A
Sbjct  138  GKVLTSDGVEIIQEHGVEGYPFTSEHIEKLVEQEEEAKRNQSLKTLLVTKSRDYVITA  195


 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 101/158 (64%), Gaps = 2/158 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L SIL + D DF+I   G ++ V DL GK I +YFSA WC PC  F P L   Y E
Sbjct  336  EAQTLESILVAKDCDFVIGKDGIKIPVSDLVGKNILLYFSAHWCPPCRAFLPALIKAYEE  395

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +   GN  EVVF+S+D DE SF E+F KMPW A+PF D   +E L  LF VRGIP ++ +
Sbjct  396  INKNGNVLEVVFISSDRDETSFDEFFSKMPWLALPFGDE-RKEFLGRLFKVRGIPMVIAI  454

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
              +G+  + +  ++++ HG EA+PFT ER++EI+ A E
Sbjct  455  GPNGRTVSTEVRELIMYHGAEAFPFTTERLEEIEAAHE  492


 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 111/190 (58%), Gaps = 7/190 (4%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIY-FSASWCGPCHRF  331
            + EQ  +A     L+++L +  RD++I   G +V V +L+GK +G+Y F A++ G C  F
Sbjct  167  LVEQEEEAKRNQSLKTLLVTKSRDYVITADGKKVPVSELEGKTVGLYIFLATYNG-CLAF  225

Query  332  TPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFT  508
               L  VY  L  +G NFE+V +  D+DE+SFKE F  +PW ++P  D     +L   F 
Sbjct  226  NAKLVEVYKSLKEQGENFEIVMIPLDDDEQSFKEAFEHLPWFSLPVKDKCCA-KLLRYFE  284

Query  509  VRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVL  688
            +  +P +V++   GK    +  D V EHG +AYPFT E+  E+++ E+A    Q+L+++L
Sbjct  285  LESLPTVVVIGPDGKTLHSNVADAVDEHGTKAYPFTPEKFAELEELEKAKREAQTLESIL  344

Query  689  VSTSRDYVIA  718
            V+   D+VI 
Sbjct  345  VAKDCDFVIG  354



>gb|ACJ85567.1| unknown [Medicago truncatula]
 gb|AFK46193.1| unknown [Medicago truncatula]
Length=570

 Score =   254 bits (648),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 147/187 (79%), Gaps = 1/187 (1%)
 Frame = +2

Query  164  MAEQNGD-AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPN  340
            MA+   D  H++ SIL SSDRDFL+RN+G QVK+D LKGKK+G YFSASWCGPC  FTP 
Sbjct  1    MADSVADVTHNVHSILSSSDRDFLLRNTGDQVKIDSLKGKKLGFYFSASWCGPCRGFTPK  60

Query  341  LATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
            L  V +EL P G FEVVFVSAD+D+E+FK YF KMPW A+PFSDS TR RLD LF V GI
Sbjct  61   LVEVCDELSPNGGFEVVFVSADKDDEAFKSYFSKMPWLAIPFSDSETRGRLDELFHVNGI  120

Query  521  PHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTS  700
            PHL +LDE+GKV TEDGVDI+  +G EAYPFT +RV+E+KD EE   R QSL+++L S S
Sbjct  121  PHLALLDEAGKVITEDGVDIIRVYGAEAYPFTSKRVQELKDIEEEAKRNQSLRSILASRS  180

Query  701  RDYVIAA  721
            RD++I++
Sbjct  181  RDFLISS  187


 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 101/161 (63%), Gaps = 3/161 (2%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            +A+    +  L S+L S D+DF+I   G ++ V +L GK + +YFSA WC PC  F P L
Sbjct  322  IAKAKEASQTLESVLVSGDQDFVIDKDGKKIPVSELVGKTVLLYFSAHWCPPCRAFLPKL  381

Query  344  ATVYNELLPKGN--FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  517
               Y+++  + N   EVVF+S+D D+ESF E+F  MPW A+PF D+  +E L   F V G
Sbjct  382  IEAYHKIKARNNDALEVVFISSDRDQESFNEFFAGMPWLALPFGDT-RKEFLSRKFKVSG  440

Query  518  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
            IP LV +  SG+  T++   +V  +G +AYPFT +R+KEI+
Sbjct  441  IPELVAIGPSGQTVTKEARGLVGLYGADAYPFTEKRIKEIE  481


 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 116/197 (59%), Gaps = 5/197 (3%)
 Frame = +2

Query  128  SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  307
            SKR  E +     A++N     LRSIL S  RDFLI + G+++ + +L+GK +G++F A+
Sbjct  153  SKRVQELKDIEEEAKRN---QSLRSILASRSRDFLISSDGNEIPIPELEGKTVGLHFCAT  209

Query  308  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTR  484
                C  FT  L  VY +L   G NFEVVF+  D++E++FK+     PW ++P  D  T 
Sbjct  210  SYRACTLFTQKLKEVYKKLKENGENFEVVFIPLDDEEDAFKKELESAPWLSLPLKDK-TC  268

Query  485  ERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*R  664
             +L   F +  +P LVI+   GK    +  + + +HGV+AYPFT E+  E+ +  +A   
Sbjct  269  AKLIQYFELSELPTLVIIGPDGKTLHPNAAEAIEDHGVDAYPFTPEKFSELDEIAKAKEA  328

Query  665  EQSLKTVLVSTSRDYVI  715
             Q+L++VLVS  +D+VI
Sbjct  329  SQTLESVLVSGDQDFVI  345



>ref|XP_008221827.1| PREDICTED: probable nucleoredoxin 1 [Prunus mume]
Length=580

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = +2

Query  176  NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
            N + HD RS+L SS RDF++RN+G Q KV+ L+GKK+G+YFSASWCGPC RFTP     Y
Sbjct  13   NSEPHDFRSLLSSSQRDFVVRNNGDQTKVESLEGKKLGLYFSASWCGPCQRFTPAFVEAY  72

Query  356  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
            NEL  KG+FEVVF+SADED+ESF  YF KMPW A+PFSDS  R+R+D LF VRGIPHLVI
Sbjct  73   NELSSKGDFEVVFISADEDDESFNGYFSKMPWLAIPFSDSEARDRMDELFKVRGIPHLVI  132

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            L E GKV +E GV+I+ E+GV+ YPFT E++KE+ D EEA  R+QSL T+LVS  R++VI
Sbjct  133  LGEDGKVLSESGVEIIQEYGVDGYPFTPEKIKELNDQEEAARRDQSLNTILVSGLRNFVI  192

Query  716  A  718
            +
Sbjct  193  S  193


 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 99/153 (65%), Gaps = 2/153 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A  L SIL S DR+F+I   G ++ V D+ GK I +YFSA WC PC  F P L   Y+++
Sbjct  336  AQTLESILVSGDRNFVIGKGGTEIPVSDMVGKNILLYFSAHWCPPCRAFLPKLVEAYHKI  395

Query  365  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K + FEV+F+S+D+D+  F E+F  MPW A+PF D + +  L   F V GIP LV + 
Sbjct  396  KAKDDAFEVIFISSDKDQGDFDEFFSGMPWLALPFGD-LRKASLSRRFKVNGIPMLVAIG  454

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
             +G+  T++  D+V++HG  AYPFT ER+KEI+
Sbjct  455  PTGQTITKEARDLVMQHGANAYPFTEERLKEIE  487


 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 110/178 (62%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L +IL S  R+F+I N G  V V +LKGK +G+YFS S   PC  FTP L  VY +L 
Sbjct  177  QSLNTILVSGLRNFVISNDGKNVPVSELKGKIVGLYFSLSAYSPCVDFTPKLLEVYEKLK  236

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              G +FEVV +  D+DEESFK+ F  MPW ++P  D   R +L   F +  +P LVI+  
Sbjct  237  ASGESFEVVVIPLDDDEESFKQDFKSMPWFSLPIGDKNVR-KLARYFELSTLPTLVIIGA  295

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK  +++  + + E+GV AYPFT E+  E+ + E+A  + Q+L+++LVS  R++VI 
Sbjct  296  DGKTISKNVAEAIEENGVLAYPFTPEKFAELIEIEKAKEKAQTLESILVSGDRNFVIG  353



>ref|XP_010023552.1| PREDICTED: probable nucleoredoxin 1 isoform X5 [Eucalyptus grandis]
Length=485

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 146/188 (78%), Gaps = 0/188 (0%)
 Frame = +2

Query  158  SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            + + E    +HD++S+L S DRDFLIRN+G QVKVD LKGKK+G+YFSASWCGPCHRFTP
Sbjct  2    ADVVEGGASSHDVQSLLSSPDRDFLIRNNGDQVKVDSLKGKKLGLYFSASWCGPCHRFTP  61

Query  338  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  517
             LA VY+EL PKG+ E++F+SAD+DE SF  YF KMPW A+PFSD   R  LD LF VRG
Sbjct  62   ILAEVYDELSPKGDLEIIFISADKDEGSFSGYFSKMPWLAIPFSDLDKRNSLDELFKVRG  121

Query  518  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVST  697
            IPHLVILD +G V T+ GV IV E+GVE +PFT ER+KE+KD EEA    QSL ++LV  
Sbjct  122  IPHLVILDGTGTVLTDSGVAIVREYGVEGHPFTPERIKELKDQEEAARINQSLTSLLVHG  181

Query  698  SRDYVIAA  721
            SR++V+++
Sbjct  182  SRNFVVSS  189


 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 103/165 (62%), Gaps = 2/165 (1%)
 Frame = +2

Query  158  SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            + + ++  ++  L SIL S D DF+I   G ++ V DL GK + +YFSA WC PC  F P
Sbjct  322  AEIEKKREESQTLESILVSGDLDFVIGKDGTKIPVSDLVGKTVLLYFSAHWCPPCRAFLP  381

Query  338  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  514
             L   Y ++  K N FEV+F+S+D+D+ +F  YF +MPW A+PF D   ++ L   F VR
Sbjct  382  VLIESYEKIKAKDNAFEVIFLSSDKDQTAFDNYFAEMPWLALPFGDE-RKKSLSRKFKVR  440

Query  515  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAE  649
            GIP L+ +  +G+  T    ++++EHG +A+PFT E +K  ++++
Sbjct  441  GIPTLIAIGPTGRTLTNKARNLIMEHGADAHPFTAEHLKTFEESK  485


 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 107/178 (60%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L S+L    R+F++ ++ +QV V +L+GK +G+YFS S    C  FTP L  VY +L 
Sbjct  172  QSLTSLLVHGSRNFVVSSNRNQVPVTELEGKTVGLYFSLSVHRACVDFTPKLLEVYEKLK  231

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             +G +FE+V +  D+DE SF + FG MPW ++PF D    E+L   F +  +P LVI+ +
Sbjct  232  ARGESFEIVQIPLDDDEASFNQSFGSMPWLSLPFKDKKC-EKLVRYFKLSTLPTLVIIGQ  290

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK    +  + V EHG+ AYPFT E+  E+ + E+     Q+L+++LVS   D+VI 
Sbjct  291  DGKTVHANVAETVEEHGITAYPFTPEKFAELAEIEKKREESQTLESILVSGDLDFVIG  348



>emb|CBI28535.3| unnamed protein product [Vitis vinifera]
Length=617

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 152/188 (81%), Gaps = 1/188 (1%)
 Frame = +2

Query  161  SMAEQNGDA-HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            +M  ++G A HD+ S+L S +RD+LIRN+G+QVK+  L+GKKIG+YFSASWCGPC RFTP
Sbjct  78   NMDCEDGSAVHDVVSVLSSPNRDYLIRNNGNQVKITSLRGKKIGLYFSASWCGPCRRFTP  137

Query  338  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  517
             L  VYN L  KG+FE+ FVSADED+E FKEYF +MPW A+PFSDS TR+ LD LF V G
Sbjct  138  ELVEVYNGLSLKGDFEITFVSADEDDEMFKEYFSEMPWLAIPFSDSDTRDHLDELFRVSG  197

Query  518  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVST  697
            IPHLVI+ E+GKV T+ GV+I+ E+GVE +PFT ER+KE+K+ EE   REQSL+++LVS 
Sbjct  198  IPHLVIIGENGKVLTDSGVEIIREYGVEGFPFTSERIKELKEQEEVAKREQSLRSILVSD  257

Query  698  SRDYVIAA  721
            SRD+VI+A
Sbjct  258  SRDFVISA  265


 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 117/197 (59%), Gaps = 10/197 (5%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K  E +    A+Q  +A  L SIL S +RD+LI   G +V V DL GK I +YF
Sbjct  387  YPFTPAKFAELEEIEKAKQ--EAQTLESILVSGNRDYLIGKHGVKVPVSDLVGKNILLYF  444

Query  299  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+++  K   FEV+F+S+D D+ SF ++F +MPW A+PF D 
Sbjct  445  SAHWCSPCRAFLPKLTDAYHKIKAKDSGFEVIFISSDRDQTSFDDFFSEMPWLALPFGDE  504

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
              +E L  +F V+GIP +V +  +G+  T    D+V +HG +AYPFT ER++EI+   E 
Sbjct  505  -RKESLSKMFKVQGIPKVVAIGPTGRTITTQARDLVADHGADAYPFTDERLQEIEAQYEM  563

Query  656  T*REQSLKTVLVSTSRD  706
                   K VL  T+++
Sbjct  564  A------KGVLWKTAKE  574


 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 110/178 (62%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              LRSIL S  RDF+I  +G +V +  L+G+ +G+YFS S    C  FT  L  VY ++ 
Sbjct  248  QSLRSILVSDSRDFVISANGMKVPISKLEGRLVGLYFSLSSYKLCVDFTSKLVDVYAKVK  307

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              G +FE+V +S D+DEESF E FG MP  A+PF D   R +L   F +  +P LV++  
Sbjct  308  AMGESFEIVLISFDDDEESFNEGFGSMPCFALPFKDESCR-KLARYFELSTVPTLVMIGP  366

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK    + V+ + E+G++AYPFT  +  E+++ E+A    Q+L+++LVS +RDY+I 
Sbjct  367  DGKTLHSNVVEAIEEYGIQAYPFTPAKFAELEEIEKAKQEAQTLESILVSGNRDYLIG  424



>ref|XP_008389658.1| PREDICTED: probable nucleoredoxin 1 [Malus domestica]
Length=579

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            + HD+ S+L S++RD+L+RN+G Q+KV+ LKGKK+G+YFSASWC PC +FTP L   YNE
Sbjct  15   EPHDVVSLLSSAERDYLVRNNGDQIKVESLKGKKLGLYFSASWCSPCQQFTPALVEAYNE  74

Query  362  LLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
            + P G+FE++F+SADED+ESF  YF KMPW A+PFSDS  R+ +D LF VRGIPHLVIL 
Sbjct  75   ISPNGDFEIIFISADEDDESFNGYFSKMPWLAIPFSDSDARDSVDGLFKVRGIPHLVILG  134

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            E GKV ++DGV+I+ E+GV++YPFT E++KE+KD EEA  REQSLK +LVS SRD+VI+
Sbjct  135  EDGKVLSDDGVEILQEYGVDSYPFTQEKIKELKDQEEAARREQSLKKILVSRSRDFVIS  193


 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 123/201 (61%), Gaps = 4/201 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F++ K +E K    A +      L+ IL S  RDF+I N+G +V + +L+GK +G+YF
Sbjct  156  YPFTQEKIKELKDQEEAARR--EQSLKKILVSRSRDFVISNNGEKVPISELEGKIVGLYF  213

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            S S   PC  +TP L  VY +L   G NFE+V +  D+DE+SFK++F KMPW ++P  D 
Sbjct  214  SLSSYSPCAEYTPKLVDVYEKLKGNGENFEIVLLPLDDDEKSFKKHFEKMPWFSLPNGDK  273

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
               E+L   F +  +P LVI+   GK  +++  D + EHG  AYPFT E+  E+ + E+A
Sbjct  274  -NVEKLARYFELSTLPTLVIIGADGKTLSKNVTDAIDEHGSLAYPFTPEKFAELDEIEKA  332

Query  656  T*REQSLKTVLVSTSRDYVIA  718
              + Q+L+++L+S  R++VI 
Sbjct  333  KEKAQTLESLLISGDRNFVIG  353


 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 96/153 (63%), Gaps = 2/153 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A  L S+L S DR+F+I     +V V DL GK I +YFSA WC PC  F P L   Y+E+
Sbjct  336  AQTLESLLISGDRNFVIGKDETEVPVTDLVGKNILLYFSAHWCPPCRAFLPKLVEAYHEI  395

Query  365  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K + FE +F+S+D D+ SF ++F KMPW A+PF D   +  L   F V+GIP LV L 
Sbjct  396  KAKDDAFETIFISSDRDQTSFDDFFAKMPWLALPFGDE-RKVPLSRRFRVQGIPMLVALG  454

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
             +GK  T++  ++V  HG  AYPFT ER+KE++
Sbjct  455  PTGKTVTKEARNLVTLHGANAYPFTEERLKEME  487



>ref|XP_010023556.1| PREDICTED: probable nucleoredoxin 1 [Eucalyptus grandis]
Length=599

 Score =   252 bits (644),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 151/198 (76%), Gaps = 3/198 (2%)
 Frame = +2

Query  137  KGEERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  307
            K    KA+ MA   E    +HD++S+L S DRDFLIRN+G QVKV+ LKGK IG+YFSAS
Sbjct  7    KNTPAKATRMADDVEGGASSHDVQSLLSSPDRDFLIRNNGDQVKVNSLKGKNIGLYFSAS  66

Query  308  WCGPCHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRE  487
            WCGPC +FTP L  VYNEL P+G+ E++F+S+DEDEESF  YF KMPW A+PFSDS  R+
Sbjct  67   WCGPCQQFTPILLEVYNELAPRGDLEIIFISSDEDEESFSGYFSKMPWLAIPFSDSEKRD  126

Query  488  RLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*RE  667
             LD LF VRGIPHLV+LD +G V T+ GV+IV E+G E +PFT ER+KE+KD EEA  R 
Sbjct  127  SLDELFNVRGIPHLVLLDGTGTVLTDSGVEIVREYGEEGHPFTPERIKELKDQEEAARRN  186

Query  668  QSLKTVLVSTSRDYVIAA  721
            QSL ++LV  +RD+V+++
Sbjct  187  QSLTSLLVIKTRDFVVSS  204


 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 97/155 (63%), Gaps = 2/155 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            ++  L SIL S D DF+I   G ++ V DL GK + +YFSA WC PC  F P L   Y +
Sbjct  345  ESQTLESILVSGDLDFIIGKEGTKIPVSDLIGKTVLLYFSAHWCRPCRAFLPVLMEAYEK  404

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +   GN  EV+F+S+D ++ +F +YF +MPW A+PF D   ++ L   F VRGIP LV +
Sbjct  405  IKAAGNALEVIFISSDRNQTAFDDYFAQMPWLALPFGDE-RKKSLSGKFKVRGIPMLVAI  463

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKD  643
              +G+  T    D++++HG +AYPFT E +K+ ++
Sbjct  464  GPTGRTVTNKARDLIMDHGADAYPFTAEHLKKFEE  498


 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 103/178 (58%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L S+L    RDF++ + G +V V +L+GK +G+YFS S    C  FTP L  VY  L 
Sbjct  187  QSLTSLLVIKTRDFVVSSDGKKVSVSELEGKTVGLYFSLSMSKSCVDFTPKLLEVYKTLK  246

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             K  +FE+V +  D+DE SF + FG MPW ++PF D    E+L   F +  +P LVI+ +
Sbjct  247  AKEESFEIVQIPLDDDEASFNQSFGSMPWLSLPFKDK-KWEKLVRYFELSTLPTLVIIGQ  305

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK    +    V +HGV AYPFT E+  E+ + E+     Q+L+++LVS   D++I 
Sbjct  306  DGKTVHPNVAGTVEKHGVAAYPFTPEKFAELAEIEKKKEESQTLESILVSGDLDFIIG  363



>ref|XP_010023551.1| PREDICTED: probable nucleoredoxin 1 isoform X4 [Eucalyptus grandis]
Length=486

 Score =   249 bits (636),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +HD++S+L S DRDFL+RN+G +VKVD LKGKKIG+YFSASWCGPCHRFT  LA VYNEL
Sbjct  12   SHDVQSLLSSPDRDFLVRNNGDRVKVDSLKGKKIGLYFSASWCGPCHRFTLILAEVYNEL  71

Query  365  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             PKG+ E++F+SAD+DE SF  YF KMPW A+PFSDS  R  LD LF VRGIPHLVILD 
Sbjct  72   SPKGDLEIIFISADKDEGSFSGYFSKMPWLAIPFSDSDKRNGLDELFKVRGIPHLVILDG  131

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            +G V T++G  IV E+GVE YPFT ER+KE+KD +EA  + QSL ++LV  SRD+V+++
Sbjct  132  NGTVLTDEGDKIVREYGVEGYPFTPERIKELKDQDEAARKNQSLTSLLVHGSRDFVVSS  190


 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 103/165 (62%), Gaps = 2/165 (1%)
 Frame = +2

Query  158  SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            + + ++  ++  L S+L S D DF+I   G ++ V DL GK + +YFSA WC PC  F P
Sbjct  323  AEIEKKREESQTLESLLVSGDLDFVIGKEGAKIPVSDLVGKTVLLYFSAHWCPPCRAFLP  382

Query  338  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  514
             L   Y ++  K N FEV+F+S+D+D+ +F  YF +MPW A+PF D   ++ L   F VR
Sbjct  383  VLIESYEKIKAKDNAFEVIFLSSDKDQTAFDNYFAEMPWLALPFGDE-RKKSLSRKFKVR  441

Query  515  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAE  649
            GIP L+ +  +G+  T    ++++EHG +A+PFT E +K  ++++
Sbjct  442  GIPTLIAIGPTGRTLTNKARNLIMEHGADAHPFTAEHLKTFEESK  486


 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 113/201 (56%), Gaps = 4/201 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  + +E K    A +   +  L S+L    RDF++ ++G++V V +L+GK +G+YF
Sbjct  152  YPFTPERIKELKDQDEAARKNQS--LTSLLVHGSRDFVVSSAGNKVPVAELEGKTVGLYF  209

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            S S    C  F P L  VY +L  KG +FE+V +   +DE SF + F  +PW ++P  D 
Sbjct  210  SLSKNKSCVDFMPKLLEVYEKLKAKGESFEIVQIPLGDDEASFNQTFESLPWLSLPLKDK  269

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
               E+L   F +  +P LVI+   GK    +  + V EHGV AYPFT E+  E+ + E+ 
Sbjct  270  KC-EKLVTYFELLTVPTLVIIGPDGKTMHSNVAETVEEHGVAAYPFTPEKFAELAEIEKK  328

Query  656  T*REQSLKTVLVSTSRDYVIA  718
                Q+L+++LVS   D+VI 
Sbjct  329  REESQTLESLLVSGDLDFVIG  349



>emb|CAN59927.1| hypothetical protein VITISV_043885 [Vitis vinifera]
Length=570

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 147/185 (79%), Gaps = 0/185 (0%)
 Frame = +2

Query  167  AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  346
             E     HD+ S+L S +RD+LIRN+G+QVK+  L+GKKIG+YFSASWCGPC RFTP L 
Sbjct  3    CEDGSAVHDVVSVLSSPNRDYLIRNNGNQVKITSLRGKKIGLYFSASWCGPCRRFTPELV  62

Query  347  TVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  526
             VYN L  KG+FE+ FVSADED+E FKEYF +MPW A+PFSDS TR+ LD LF V GIPH
Sbjct  63   EVYNGLSLKGDFEITFVSADEDDEMFKEYFSEMPWLAIPFSDSDTRDHLDELFRVSGIPH  122

Query  527  LVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRD  706
            +VI+ E+GKV T+ GV+I+ E+GVE +PFT ER+KE+K+ EE   REQSL+++LVS SRD
Sbjct  123  IVIIGENGKVLTDSGVEIIREYGVEGFPFTSERIKELKEQEEVAKREQSLRSILVSDSRD  182

Query  707  YVIAA  721
            +VI+A
Sbjct  183  FVISA  187


 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 109/175 (62%), Gaps = 4/175 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K  E +    A+Q  +A  L SIL S +RD+LI   G +V V DL GK I +YF
Sbjct  309  YPFTPAKFAELEEIEKAKQ--EAQTLESILVSGNRDYLIGKHGVKVPVSDLVGKNILLYF  366

Query  299  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+++  K   FEV+F+S+D D+ SF ++F +MPW A+PF D 
Sbjct  367  SAXWCSPCRAFLPKLTDAYHKIKAKDSGFEVIFISSDRDQTSFDDFFSEMPWLALPFGDE  426

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +E L  +F V+GIP +V +  +G+  T    D+V +HG +AYPFT ER++EI+
Sbjct  427  -RKESLSKMFKVQGIPKVVAIGPTGRTITTQARDLVADHGADAYPFTDERLQEIE  480


 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 120/198 (61%), Gaps = 5/198 (3%)
 Frame = +2

Query  128  SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  307
            S+R  E ++   +A++      LRSIL S  RDF+I  +G +V +  L+G+ +G+YFS S
Sbjct  153  SERIKELKEQEEVAKRE---QSLRSILVSDSRDFVISANGMKVPISKLEGRLVGLYFSLS  209

Query  308  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTR  484
                C  FT  L  VY ++   G +FE+V +S D+DEESF E  G MPW A+PF D   R
Sbjct  210  SYKLCVDFTSKLVDVYAKVKAMGESFEIVLISFDDDEESFNEGXGSMPWFALPFKDESCR  269

Query  485  ERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*R  664
             +L   F +  +P LV++   GK    + V+ + E+G++AYPFT  +  E+++ E+A   
Sbjct  270  -KLARYFELSTVPTLVMIGPDGKTLHSNVVEAIEEYGIQAYPFTPAKFAELEEIEKAKQE  328

Query  665  EQSLKTVLVSTSRDYVIA  718
             Q+L+++LVS +RDY+I 
Sbjct  329  AQTLESILVSGNRDYLIG  346



>ref|XP_006392168.1| hypothetical protein EUTSA_v10023374mg [Eutrema salsugineum]
 gb|ESQ29454.1| hypothetical protein EUTSA_v10023374mg [Eutrema salsugineum]
Length=579

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 147/184 (80%), Gaps = 1/184 (1%)
 Frame = +2

Query  170  EQNG-DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  346
            E NG DA +L S+L S  RDFL+RN G QVK+D LKGKKIG+YFSA+WCGPC RFTP L 
Sbjct  7    EVNGSDAQNLHSLLSSPARDFLVRNDGEQVKIDSLKGKKIGLYFSAAWCGPCQRFTPQLM  66

Query  347  TVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  526
             VYNEL PK  FEV+FVS DEDEESF++YF KMPW AVPF+DS TR+RLD LF V+GIP+
Sbjct  67   EVYNELSPKVGFEVIFVSGDEDEESFRDYFTKMPWLAVPFTDSETRDRLDQLFKVKGIPY  126

Query  527  LVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRD  706
            LV++D+ G +  E+G+ ++  +G +AYPFT ER+KEIK+ E+   REQ+LK+VLV+ SRD
Sbjct  127  LVMVDDHGNLLNENGIGVIRSYGADAYPFTPERMKEIKEEEDRARREQTLKSVLVTPSRD  186

Query  707  YVIA  718
            +VI+
Sbjct  187  FVIS  190


 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 108/175 (62%), Gaps = 4/175 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K EE KA   A+   DA  L S+L S D ++++   G +V V DL GK I +YF
Sbjct  313  YPFAPEKFEELKAIEKAKT--DAQTLESLLVSGDLNYVLGKDGAKVLVSDLVGKNILLYF  370

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  FTP L  VY ++  +   FE++F+S+D D+ESF EY+ +MPW A+PF D 
Sbjct  371  SAHWCPPCRAFTPKLVEVYKQIKERDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP  430

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +  L   F V GIP L  +  SGK  T++  D+V  HG +AYPFT ER+KEI+
Sbjct  431  -RKTSLARTFKVGGIPMLAAVGPSGKTVTKEARDLVGAHGADAYPFTEERLKEIE  484


 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 110/176 (63%), Gaps = 2/176 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            L+S+L +  RDF+I   G++V V +L+GK IG+ FS +    C  FTP L  VYN+L   
Sbjct  176  LKSVLVTPSRDFVISRDGNKVPVSELEGKTIGLLFSVATYRRCMEFTPKLIEVYNKLKEN  235

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            G +FE+V +S ++DEESFK+ F   PW A+PF+D  +  +L   F +  +P LVIL   G
Sbjct  236  GEDFEIVLISLEDDEESFKQDFETKPWLALPFNDK-SSSKLARHFMLSTLPTLVILGPDG  294

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K+   +  + + ++GV AYPF  E+ +E+K  E+A    Q+L+++LVS   +YV+ 
Sbjct  295  KIRHSNVAEAIDDYGVLAYPFAPEKFEELKAIEKAKTDAQTLESLLVSGDLNYVLG  350



>ref|XP_004297483.1| PREDICTED: probable nucleoredoxin 1 [Fragaria vesca subsp. vesca]
Length=583

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  DLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP  370
            D +S+L S  RD+L+RN+G QVKV+ LKGKK+G+YFSASWCGPC RFTP+L   YN L  
Sbjct  22   DFQSLLSSPARDYLVRNNGDQVKVETLKGKKLGLYFSASWCGPCQRFTPDLVETYNALAS  81

Query  371  KGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            KG+FEV+FVSADEDEESF  YF KMPW A+PFSDS  RE LD  F VRGIPHLV L E G
Sbjct  82   KGDFEVIFVSADEDEESFNGYFSKMPWLAIPFSDSEARESLDEQFKVRGIPHLVFLCEEG  141

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            +V    GV+IV E+GV+ YPFT+ER+KE++D E A  REQSLKTVLVS SRD+VIA+
Sbjct  142  RVRNASGVEIVREYGVDGYPFTIERLKELQDQEAAAKREQSLKTVLVSRSRDFVIAS  198


 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 95/148 (64%), Gaps = 2/148 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A  L SIL S D++F+I   G ++ V DL GK I +YFSA WC PC  F P L   Y+++
Sbjct  341  AQTLESILISGDQNFVIGKDGIKIPVSDLVGKNILLYFSAHWCPPCRAFLPRLMEAYHKI  400

Query  365  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K + FEV+F+S+D D+ SF ++F  MPW A+PF DS  +  L   F V+GIP LV + 
Sbjct  401  KAKDDAFEVIFISSDRDQASFDDFFSGMPWLALPFGDS-RKASLSRRFKVQGIPMLVAIG  459

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLER  625
             +G+  T++  D+++ HG +AYPFT ER
Sbjct  460  RAGQTVTKEARDLIMVHGADAYPFTEER  487


 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 125/193 (65%), Gaps = 6/193 (3%)
 Frame = +2

Query  143  EERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPC  322
            ++++A++  EQ+     L+++L S  RDF+I + G +V V +L+GK +G+YFS S   PC
Sbjct  171  QDQEAAAKREQS-----LKTVLVSRSRDFVIASGGKKVPVSELEGKMVGLYFSLSTYSPC  225

Query  323  HRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDA  499
              FTP L  VY +L  +G +FE+VF+S D++EE+F+E    MPW A+P  D+ T E+L  
Sbjct  226  IEFTPKLVEVYEKLKAQGESFEIVFISLDDEEEAFEEDLTNMPWFALPQKDTKTSEKLAR  285

Query  500  LFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLK  679
             F +  +P LVIL   GK    + V+ + EHG+ AYPFT E+  E+ + E+A  + Q+L+
Sbjct  286  YFELSTLPTLVILGADGKTVHNNVVEAIEEHGLLAYPFTPEKFAELAEIEKAREKAQTLE  345

Query  680  TVLVSTSRDYVIA  718
            ++L+S  +++VI 
Sbjct  346  SILISGDQNFVIG  358



>gb|KEH20030.1| protein disulfide isomerase (PDI)-like protein [Medicago truncatula]
Length=506

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
             HD+ S+L S DRDFL+RN+G QVK+D LKGKK+G YFSASWCGPC  FTP L  VYNEL
Sbjct  9    THDVHSLLSSPDRDFLLRNTGDQVKIDSLKGKKLGFYFSASWCGPCRSFTPTLVEVYNEL  68

Query  365  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             PKG+FEVV+VS D+D+E+F  YF KMPW A+PFSDS  R RL  LF V+GIPHL +LD+
Sbjct  69   SPKGDFEVVYVSRDKDDETFNNYFSKMPWLAIPFSDSEIRIRLKELFHVKGIPHLALLDD  128

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            +GKV TEDGV I+ E+G E YPFT ++V+E+KD EE   R QSL++ LVS+ RD+VI++
Sbjct  129  TGKVVTEDGVHIIREYGTEGYPFTSKKVQELKDIEEEAMRNQSLRSTLVSSYRDFVISS  187


 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 110/174 (63%), Gaps = 4/174 (2%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            +A+    +  L S+L S D+DF+I   G ++ V +LKGK + +YFSA WC PC  F P L
Sbjct  322  IAKAKEASQTLESVLVSGDQDFVIEKDGKKIPVSELKGKTVLLYFSAHWCPPCREFLPKL  381

Query  344  ATVYNELLPKGN--FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  517
               Y ++  + N   EVVF+S+D D++SF E+F +MPW A+PF DS  +E L   F V G
Sbjct  382  IDAYLKIKTEDNDALEVVFISSDRDQDSFDEFFAEMPWVALPFGDS-RKEFLSRKFKVAG  440

Query  518  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLK  679
            IP LV +  SG+  T++  D+V  +G +AYPFT ER+KEI +A++A   E+  K
Sbjct  441  IPKLVAIGPSGQTVTKEARDLVGIYGADAYPFTEERIKEI-EAQKAAKEEEKPK  493


 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 116/200 (58%), Gaps = 4/200 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+ +K +E K   + E+      LRS L SS RDF+I +  +++ + +++GK +G++F
Sbjct  149  YPFTSKKVQELK--DIEEEAMRNQSLRSTLVSSYRDFVISSDRNEIPISEIEGKTVGLHF  206

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
              +   PC  F   L  VYN L   G NFEVVF+  D++EESFK+    +PW ++P  D 
Sbjct  207  FTTSYKPCVLFNQKLKEVYNNLKENGENFEVVFIPLDDEEESFKKELESVPWLSLPLKDK  266

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
             T  +L   F +  +P  V++   GK    +  D + +HG++AYPFT E+  E+ +  +A
Sbjct  267  -TCLKLVKYFELSTLPSFVVIGPDGKTLHPNAADAIEDHGIDAYPFTPEKFSELDEIAKA  325

Query  656  T*REQSLKTVLVSTSRDYVI  715
                Q+L++VLVS  +D+VI
Sbjct  326  KEASQTLESVLVSGDQDFVI  345



>ref|XP_010023548.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Eucalyptus grandis]
 gb|KCW59850.1| hypothetical protein EUGRSUZ_H02590 [Eucalyptus grandis]
Length=573

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 146/188 (78%), Gaps = 0/188 (0%)
 Frame = +2

Query  158  SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            + + E    +HD++S+L S DRDFLIRN+G QVKVD LKGKK+G+YFSASWCGPCHRFTP
Sbjct  2    ADVVEGGASSHDVQSLLSSPDRDFLIRNNGDQVKVDSLKGKKLGLYFSASWCGPCHRFTP  61

Query  338  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  517
             LA VY+EL PKG+ E++F+SAD+DE SF  YF KMPW A+PFSD   R  LD LF VRG
Sbjct  62   ILAEVYDELSPKGDLEIIFISADKDEGSFSGYFSKMPWLAIPFSDLDKRNSLDELFKVRG  121

Query  518  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVST  697
            IPHLVILD +G V T+ GV IV E+GVE +PFT ER+KE+KD EEA    QSL ++LV  
Sbjct  122  IPHLVILDGTGTVLTDSGVAIVREYGVEGHPFTPERIKELKDQEEAARINQSLTSLLVHG  181

Query  698  SRDYVIAA  721
            SR++V+++
Sbjct  182  SRNFVVSS  189


 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 104/163 (64%), Gaps = 2/163 (1%)
 Frame = +2

Query  158  SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            + + ++  ++  L SIL S D DF+I   G ++ V DL GK I +YFSA WC PC  F P
Sbjct  322  AEIEKKREESQTLESILVSGDLDFVIGKDGTKIPVSDLVGKTILLYFSAHWCPPCRAFLP  381

Query  338  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  514
             L+  Y ++    + FEV+F+S+D+D+ +F +YF +MPW A+PF D   ++ L   F V+
Sbjct  382  VLSEAYEKIKATDDAFEVIFISSDKDQTAFDDYFAQMPWLALPFGDE-RKKFLSRRFKVK  440

Query  515  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKD  643
            GIP LV +  +G+  ++   D++++HG +AYPFT E +K+ ++
Sbjct  441  GIPMLVAIGPTGRTVSKKARDLIMDHGADAYPFTAEHLKKFEE  483


 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 107/178 (60%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L S+L    R+F++ ++ +QV V +L+GK +G+YFS S    C  FTP L  VY +L 
Sbjct  172  QSLTSLLVHGSRNFVVSSNRNQVPVTELEGKTVGLYFSLSVHRACVDFTPKLLEVYEKLK  231

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             +G +FE+V +  D+DE SF + FG MPW ++PF D    E+L   F +  +P LVI+ +
Sbjct  232  ARGESFEIVQIPLDDDEASFNQSFGSMPWLSLPFKDKKC-EKLVRYFKLSTLPTLVIIGQ  290

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK    +  + V EHG+ AYPFT E+  E+ + E+     Q+L+++LVS   D+VI 
Sbjct  291  DGKTVHANVAETVEEHGITAYPFTPEKFAELAEIEKKREESQTLESILVSGDLDFVIG  348



>gb|KCW59854.1| hypothetical protein EUGRSUZ_H02593 [Eucalyptus grandis]
Length=584

 Score =   249 bits (636),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = +2

Query  170  EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  349
            E    +HD++S+L S DRDFLIRN+G QVKV+ LKGK IG+YFSASWCGPC +FTP L  
Sbjct  6    EGGASSHDVQSLLSSPDRDFLIRNNGDQVKVNSLKGKNIGLYFSASWCGPCQQFTPILLE  65

Query  350  VYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  529
            VYNEL P+G+ E++F+S+DEDEESF  YF KMPW A+PFSDS  R+ LD LF VRGIPHL
Sbjct  66   VYNELAPRGDLEIIFISSDEDEESFSGYFSKMPWLAIPFSDSEKRDSLDELFNVRGIPHL  125

Query  530  VILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDY  709
            V+LD +G V T+ GV+IV E+G E +PFT ER+KE+KD EEA  R QSL ++LV  +RD+
Sbjct  126  VLLDGTGTVLTDSGVEIVREYGEEGHPFTPERIKELKDQEEAARRNQSLTSLLVIKTRDF  185

Query  710  VIAA  721
            V+++
Sbjct  186  VVSS  189


 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 101/163 (62%), Gaps = 2/163 (1%)
 Frame = +2

Query  158  SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            + + ++  ++  L SIL S D DF+I   G ++ V DL GK + +YFSA WC PC  F P
Sbjct  322  AEIEKKKEESQTLESILVSGDLDFIIGKEGTKIPVSDLIGKTVLLYFSAHWCRPCRAFLP  381

Query  338  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  514
             L   Y ++   GN  EV+F+S+D ++ +F +YF +MPW A+PF D   ++ L   F VR
Sbjct  382  VLMEAYEKIKAAGNALEVIFISSDRNQTAFDDYFAQMPWLALPFGDE-RKKSLSGKFKVR  440

Query  515  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKD  643
            GIP LV +  +G+  T    D++++HG +AYPFT E +K+ ++
Sbjct  441  GIPMLVAIGPTGRTVTNKARDLIMDHGADAYPFTAEHLKKFEE  483


 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 103/178 (58%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L S+L    RDF++ + G +V V +L+GK +G+YFS S    C  FTP L  VY  L 
Sbjct  172  QSLTSLLVIKTRDFVVSSDGKKVSVSELEGKTVGLYFSLSMSKSCVDFTPKLLEVYKTLK  231

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             K  +FE+V +  D+DE SF + FG MPW ++PF D    E+L   F +  +P LVI+ +
Sbjct  232  AKEESFEIVQIPLDDDEASFNQSFGSMPWLSLPFKDK-KWEKLVRYFELSTLPTLVIIGQ  290

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK    +    V +HGV AYPFT E+  E+ + E+     Q+L+++LVS   D++I 
Sbjct  291  DGKTVHPNVAGTVEKHGVAAYPFTPEKFAELAEIEKKKEESQTLESILVSGDLDFIIG  348



>ref|XP_010651773.1| PREDICTED: probable nucleoredoxin 1 [Vitis vinifera]
Length=258

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = +2

Query  176  NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
            +G AHDL S+L   DRDFL+RN+GHQVKV+ LKGKKI +YFSASWCGPC RFTP L   Y
Sbjct  7    DGVAHDLVSLLTREDRDFLVRNNGHQVKVESLKGKKIWLYFSASWCGPCRRFTPKLVEAY  66

Query  356  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
            NEL    +FE++FVS D D+ESF  YF KMPW A+PFSDS  R++L+ LF V GIP+LV+
Sbjct  67   NELSSNDDFEIIFVSGDNDDESFHGYFSKMPWLAIPFSDSDARDQLNELFKVMGIPNLVM  126

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            LDESGKV +EDGVDI+ E+GVEAYPFT E++KE+K+ EE   +EQSL+++LVS SRDYVI
Sbjct  127  LDESGKVLSEDGVDIIQEYGVEAYPFTPEKIKEMKEKEETARKEQSLRSILVSQSRDYVI  186

Query  716  AA  721
            + 
Sbjct  187  ST  188


 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              LRSIL S  RD++I   G +V V +L+GK +G++FS S    C  FTP L  VY +L 
Sbjct  171  QSLRSILVSQSRDYVISTDGKKVPVSELEGKFVGLFFSLSSYKACLEFTPTLVDVYEKLR  230

Query  368  PKG-NFEVVFVSADEDE  415
             KG +FE+V +S D++E
Sbjct  231  AKGESFEIVMISLDDEE  247



>gb|AAM64945.1| PDI-like protein [Arabidopsis thaliana]
Length=578

 Score =   247 bits (630),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 147/189 (78%), Gaps = 1/189 (1%)
 Frame = +2

Query  155  ASSMAEQNGD-AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRF  331
            A +  + NGD A DL S+L S  RDFL+RN G QVKVD L GKKIG+YFSA+WCGPC RF
Sbjct  2    AETSKQVNGDDAQDLHSLLSSPARDFLVRNDGEQVKVDSLLGKKIGLYFSAAWCGPCQRF  61

Query  332  TPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            TP L  VYNEL  K  FE+VFVS DEDEESF +YF KMPW AVPF+DS TR+RLD LF V
Sbjct  62   TPQLVEVYNELSSKVGFEIVFVSGDEDEESFGDYFSKMPWLAVPFTDSETRDRLDELFKV  121

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            RGIP+LV++D+ GK+  E+GV ++  +G +AYPFT E++KEIK+ E+   REQ+L++VLV
Sbjct  122  RGIPNLVMVDDHGKLVNENGVGVIRSYGADAYPFTPEKMKEIKEDEDRARREQTLRSVLV  181

Query  692  STSRDYVIA  718
            + SRD+VI+
Sbjct  182  TPSRDFVIS  190


 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 108/175 (62%), Gaps = 4/175 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K +E K   + +   +A  L S+L S D ++++   G +V V DL GK I +YF
Sbjct  313  YPFTPEKFQELK--ELEKAKVEAQTLESLLVSGDLNYVLGKDGAKVLVSDLVGKTILMYF  370

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  FTP L  VY ++  +   FE++F+S+D D+ESF EY+ +MPW A+PF D 
Sbjct  371  SAHWCPPCRAFTPKLVEVYKQIKERNEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP  430

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +  L   F V GIP L  L  +G+  T++  D+V+ HG +AYPFT ER+KEI+
Sbjct  431  -RKASLAKTFKVGGIPMLAALGPTGQTVTKEARDLVVAHGADAYPFTEERLKEIE  484


 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 108/176 (61%), Gaps = 2/176 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP-  370
            LRS+L +  RDF+I   G++V V +L+GK IG+ FS +    C   TP L   Y +L   
Sbjct  176  LRSVLVTPSRDFVISPDGNKVPVSELEGKTIGLLFSVASYRKCTELTPKLVEFYTKLKEN  235

Query  371  KGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            K +FE+V +S ++DEESF + F   PW A+PF+D  +  +L   F +  +P LVIL   G
Sbjct  236  KEDFEIVLISLEDDEESFNQDFKTKPWLALPFNDK-SGSKLARHFMLSTLPTLVILGPDG  294

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K+   +  + + ++GV AYPFT E+ +E+K+ E+A    Q+L+++LVS   +YV+ 
Sbjct  295  KIRHSNVAEAIDDYGVLAYPFTPEKFQELKELEKAKVEAQTLESLLVSGDLNYVLG  350



>emb|CCD74518.1| putative nucleoredoxin 1 [Arabidopsis halleri subsp. halleri]
Length=578

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +2

Query  158  SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            +S     GD+ DL S+L S  RDFL+RN G QVK+D L GKKIG+YFSA+WCGPC RFTP
Sbjct  4    TSKVVNGGDSQDLHSLLSSPARDFLVRNDGEQVKIDSLIGKKIGLYFSAAWCGPCQRFTP  63

Query  338  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  517
             L  VYNEL  K  FE+VFVS DEDEESF +YF KMPW AVPF+DS +R+RLD LF VRG
Sbjct  64   QLVEVYNELSSKVGFEIVFVSGDEDEESFGDYFSKMPWLAVPFTDSESRDRLDELFKVRG  123

Query  518  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVST  697
            IP+LV++D+ GK+  E+GV ++  +G +AYPFT E++KEIK+ E+   REQ+L++VLV+ 
Sbjct  124  IPNLVMVDDHGKLVNENGVGVIRSYGADAYPFTPEKMKEIKEDEDRARREQTLRSVLVTP  183

Query  698  SRDYVIA  718
            SRD+VI+
Sbjct  184  SRDFVIS  190


 Score =   152 bits (384),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 108/175 (62%), Gaps = 4/175 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K EE K    A+   +A  L S+L S D ++++   G +V + DL GK I IYF
Sbjct  313  YPFTPEKFEELKEIEKAKV--EAQTLESLLVSGDLNYVLGKDGAKVLISDLVGKNILIYF  370

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  FTP L  VY ++  +   FE++F+S D D+ESF EY+ +MPW A+PF DS
Sbjct  371  SAHWCPPCRTFTPKLVEVYKQIKERDEAFELIFISNDRDQESFDEYYSQMPWLALPFGDS  430

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +  L   F V GIP L  L  +GK  T++  D+V+ HG EAYPFT ER+KEI+
Sbjct  431  -RKTSLARTFKVGGIPMLAALGPTGKTVTKEARDLVVAHGAEAYPFTEERLKEIE  484


 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 107/176 (61%), Gaps = 2/176 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP-  370
            LRS+L +  RDF+I   G++V V +L+GK IG+ FS +    C  FTP L   Y +L   
Sbjct  176  LRSVLVTPSRDFVISPDGNKVPVSELEGKTIGLLFSVASYRKCTEFTPKLVEFYTKLKEN  235

Query  371  KGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            K +FE+V +S D+DEESF + F   PW ++ F+D  +  +L   F +  +P LVIL   G
Sbjct  236  KEDFEIVLISLDDDEESFNQEFKTKPWLSLLFNDK-SASKLARHFMLATVPTLVILGPDG  294

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  + + ++GV AYPFT E+ +E+K+ E+A    Q+L+++LVS   +YV+ 
Sbjct  295  KTRHSNVAEAIDDYGVLAYPFTPEKFEELKEIEKAKVEAQTLESLLVSGDLNYVLG  350



>ref|XP_003631262.2| PREDICTED: uncharacterized protein LOC100852797 [Vitis vinifera]
Length=1163

 Score =   252 bits (643),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 147/185 (79%), Gaps = 0/185 (0%)
 Frame = +2

Query  167  AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  346
             E     HD+ S+L S +RD+LIRN+G+QVK+  L+GKKIG+YFSASWCGPC RFTP L 
Sbjct  3    CEDGSAVHDVVSVLSSPNRDYLIRNNGNQVKITSLRGKKIGLYFSASWCGPCRRFTPELV  62

Query  347  TVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  526
             VYN L  KG+FE+ FVSADED+E FKEYF +MPW A+PFSDS TR+ LD LF V GIPH
Sbjct  63   EVYNGLSLKGDFEITFVSADEDDEMFKEYFSEMPWLAIPFSDSDTRDHLDELFRVSGIPH  122

Query  527  LVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRD  706
            LVI+ E+GKV T+ GV+I+ E+GVE +PFT ER+KE+K+ EE   REQSL+++LVS SRD
Sbjct  123  LVIIGENGKVLTDSGVEIIREYGVEGFPFTSERIKELKEQEEVAKREQSLRSILVSDSRD  182

Query  707  YVIAA  721
            +VI+A
Sbjct  183  FVISA  187


 Score =   223 bits (568),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 152/202 (75%), Gaps = 5/202 (2%)
 Frame = +2

Query  131  KRKGEERKASSMAEQ-----NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIY  295
            KRKG   +   + +      +G +HDL  +L S DRDFL+RN+GHQVKV+ LKGKKI +Y
Sbjct  577  KRKGAGSRPVRIEDMATDKIDGVSHDLVLLLTSEDRDFLVRNNGHQVKVESLKGKKIWLY  636

Query  296  FSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            FSASWCGPC +FTP L  VY+E   KG+FE++FVS D+ ++ F EYF KMPW A+PFSDS
Sbjct  637  FSASWCGPCRQFTPKLVEVYDEFSSKGDFEIIFVSLDKGDQLFNEYFSKMPWLAIPFSDS  696

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
             TR+ L  LF +RGIP L +LDESGKV + +GV+I+ ++GVE YPFT E++KE+K+ EE 
Sbjct  697  DTRDHLKKLFKMRGIPSLAMLDESGKVLSSEGVEIIKDYGVEGYPFTAEKIKELKEKEET  756

Query  656  T*REQSLKTVLVSTSRDYVIAA  721
              +EQSL+++LVS SRDYVI+A
Sbjct  757  AKKEQSLRSILVSQSRDYVISA  778


 Score =   150 bits (378),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 109/175 (62%), Gaps = 4/175 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K  E +    A+Q  +A  L SIL S +RD+LI   G +V V DL GK I +YF
Sbjct  309  YPFTPAKFAELEEIEKAKQ--EAQTLESILVSGNRDYLIGKHGVKVPVSDLVGKNILLYF  366

Query  299  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+++  K   FEV+F+S+D D+ SF ++F +MPW A+PF D 
Sbjct  367  SAHWCSPCRAFLPKLTDAYHKIKAKDSGFEVIFISSDRDQTSFDDFFSEMPWLALPFGDE  426

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +E L  +F V+GIP +V +  +G+  T    D+V +HG +AYPFT ER++EI+
Sbjct  427  -RKESLSKMFKVQGIPKVVAIGPTGRTITTQARDLVADHGADAYPFTDERLQEIE  480


 Score =   149 bits (377),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              LRSIL S  RD++I   G +V V +L+GK +G+YFS S    C  FT  LA VY EL 
Sbjct  761  QSLRSILVSQSRDYVISADGRKVSVSELEGKLVGLYFSLSSYNACQEFTTTLAEVYEELR  820

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             KG +FE+V +S D++E+SFK+YF  MPW A+PF+D  +  +L   F +R +P LV++ +
Sbjct  821  AKGESFEIVMISLDDEEQSFKKYFESMPWFALPFNDK-SCGKLARYFKLRVLPTLVVIGQ  879

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK    +  + + +HG++AYPFT E+  E+++ E+A    Q+L+++LVS   D+VI 
Sbjct  880  DGKTLHSNVAEAIEQHGIQAYPFTPEKFVELEEIEKAKREAQTLESILVSGDTDFVIG  937


 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 93/154 (60%), Gaps = 2/154 (1%)
 Frame = +2

Query  182   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
             +A  L SIL S D DF+I   G ++ V  L GK I +YFSA WC PC  F P L   Y  
Sbjct  919   EAQTLESILVSGDTDFVIGKDGVKIPVSHLAGKNILLYFSAHWCPPCRAFLPKLIEAYQN  978

Query  362   LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
             +  K   FEV+F+S+D D+ SF E+F  MPW A+PF D   +  L   F VR IP L+ +
Sbjct  979   IKAKDEAFEVIFISSDRDQASFDEFFSGMPWLALPFGDK-RKASLGRTFKVRSIPKLIAV  1037

Query  539   DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
             + +G+  T +  ++V+ HG +AYPFT E +KEI+
Sbjct  1038  EPTGRTVTTEARNLVMIHGADAYPFTDEHIKEIE  1071


 Score =   135 bits (341),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 120/198 (61%), Gaps = 5/198 (3%)
 Frame = +2

Query  128  SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  307
            S+R  E ++   +A++      LRSIL S  RDF+I  +G +V +  L+G+ +G+YFS S
Sbjct  153  SERIKELKEQEEVAKRE---QSLRSILVSDSRDFVISANGMKVPISKLEGRLVGLYFSLS  209

Query  308  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTR  484
                C  FT  L  VY ++   G +FE+V +S D+DEESF E FG MP  A+PF D   R
Sbjct  210  SYKLCVDFTSKLVDVYAKVKAMGESFEIVLISFDDDEESFNEGFGSMPCFALPFKDESCR  269

Query  485  ERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*R  664
             +L   F +  +P LV++   GK    + V+ + E+G++AYPFT  +  E+++ E+A   
Sbjct  270  -KLARYFELSTVPTLVMIGPDGKTLHSNVVEAIEEYGIQAYPFTPAKFAELEEIEKAKQE  328

Query  665  EQSLKTVLVSTSRDYVIA  718
             Q+L+++LVS +RDY+I 
Sbjct  329  AQTLESILVSGNRDYLIG  346



>ref|XP_002888143.1| DC1 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64402.1| DC1 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=578

 Score =   244 bits (623),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 144/182 (79%), Gaps = 1/182 (1%)
 Frame = +2

Query  176  NG-DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATV  352
            NG DA DL S+L S  RDFL+RN G QVK+D L GKKIG+YFSA+WCGPC RFTP L  V
Sbjct  9    NGSDALDLHSLLSSPARDFLVRNDGEQVKIDSLIGKKIGLYFSAAWCGPCQRFTPQLVEV  68

Query  353  YNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLV  532
            YNEL  K  FE+VFVS DEDEESF +YF KMPW AVPF+DS TR+RLD LF VRGIP+LV
Sbjct  69   YNELSSKVGFEIVFVSGDEDEESFGDYFSKMPWLAVPFTDSETRDRLDELFKVRGIPNLV  128

Query  533  ILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYV  712
            ++D+ GK+  E+GV ++  +G +AYPFT E++KEIK+ E+   REQ+L++VLV+ SRD+V
Sbjct  129  MVDDHGKLVNENGVGVIRSYGADAYPFTPEKMKEIKEDEDRARREQTLRSVLVTPSRDFV  188

Query  713  IA  718
            I+
Sbjct  189  IS  190


 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 108/175 (62%), Gaps = 4/175 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K EE K    A+   +A  L S+L S D ++++   G +V + DL GK I IYF
Sbjct  313  YPFTPEKFEELKEIEKAKV--EAQTLESLLVSGDLNYVLGKDGAKVLISDLVGKNILIYF  370

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  FTP L  VY ++  +   FE++F+S+D D+ESF EY+ +MPW A+PF D 
Sbjct  371  SAHWCPPCRAFTPKLVEVYKQIKERDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP  430

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +  L   F V GIP L  L  +GK  T++  D+V+ HG EAYPFT ER+KEI+
Sbjct  431  -RKTSLARTFKVGGIPMLAALGPTGKTVTKEARDLVVAHGAEAYPFTEERLKEIE  484


 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 108/176 (61%), Gaps = 2/176 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP-  370
            LRS+L +  RDF+I   G++V V +L+GK IG+ FS +    C  FTP L   Y +L   
Sbjct  176  LRSVLVTPSRDFVISPDGNKVPVSELEGKTIGLLFSVASYRKCTEFTPKLVEFYTKLKEN  235

Query  371  KGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            K +FE+V +S ++DEESF + F   PW ++PF+D  +  +L   F +  +P LVIL   G
Sbjct  236  KEDFEIVLISLEDDEESFNQEFKTKPWLSLPFNDK-SASKLARHFMLATLPTLVILGPDG  294

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  + + ++GV AYPFT E+ +E+K+ E+A    Q+L+++LVS   +YV+ 
Sbjct  295  KTRHSNVAEAIDDYGVLAYPFTPEKFEELKEIEKAKVEAQTLESLLVSGDLNYVLG  350



>ref|NP_564756.1| protein reduce transmission through pollen [Arabidopsis thaliana]
 sp|O80763.1|NRX1_ARATH RecName: Full=Probable nucleoredoxin 1; Short=AtNrx1 [Arabidopsis 
thaliana]
 gb|AAC24068.1| Similar to red-1 (related to thioredoxin) gene gb|X92750 from 
Mus musculus. ESTs gb|AA712687 and gb|Z37223 come from this 
gene [Arabidopsis thaliana]
 gb|AAL38874.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51306.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33684.1| protein reduce transmission through pollen [Arabidopsis thaliana]
Length=578

 Score =   244 bits (622),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 146/189 (77%), Gaps = 1/189 (1%)
 Frame = +2

Query  155  ASSMAEQNGD-AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRF  331
            A +  + NGD A DL S+L S  RDFL+RN G QVKVD L GKKIG+YFSA+WCGPC RF
Sbjct  2    AETSKQVNGDDAQDLHSLLSSPARDFLVRNDGEQVKVDSLLGKKIGLYFSAAWCGPCQRF  61

Query  332  TPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            TP L  VYNEL  K  FE+VFVS DEDEESF +YF KMPW AVPF+DS TR+RLD LF V
Sbjct  62   TPQLVEVYNELSSKVGFEIVFVSGDEDEESFGDYFRKMPWLAVPFTDSETRDRLDELFKV  121

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            RGIP+LV++D+ GK+  E+GV ++  +G +AYPFT E++KEIK+ E+   R Q+L++VLV
Sbjct  122  RGIPNLVMVDDHGKLVNENGVGVIRSYGADAYPFTPEKMKEIKEDEDRARRGQTLRSVLV  181

Query  692  STSRDYVIA  718
            + SRD+VI+
Sbjct  182  TPSRDFVIS  190


 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 108/175 (62%), Gaps = 4/175 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K +E K   + +   +A  L S+L S D ++++   G +V V DL GK I +YF
Sbjct  313  YPFTPEKFQELK--ELEKAKVEAQTLESLLVSGDLNYVLGKDGAKVLVSDLVGKTILMYF  370

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  FTP L  VY ++  +   FE++F+S+D D+ESF EY+ +MPW A+PF D 
Sbjct  371  SAHWCPPCRAFTPKLVEVYKQIKERNEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP  430

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +  L   F V GIP L  L  +G+  T++  D+V+ HG +AYPFT ER+KEI+
Sbjct  431  -RKASLAKTFKVGGIPMLAALGPTGQTVTKEARDLVVAHGADAYPFTEERLKEIE  484


 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 116/201 (58%), Gaps = 4/201 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K +E K      + G    LRS+L +  RDF+I   G++V V +L+GK IG+ F
Sbjct  153  YPFTPEKMKEIKEDEDRARRGQT--LRSVLVTPSRDFVISPDGNKVPVSELEGKTIGLLF  210

Query  299  SASWCGPCHRFTPNLATVYNELLP-KGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            S +    C   TP L   Y +L   K +FE+V +S ++DEESF + F   PW A+PF+D 
Sbjct  211  SVASYRKCTELTPKLVEFYTKLKENKEDFEIVLISLEDDEESFNQDFKTKPWLALPFNDK  270

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
             +  +L   F +  +P LVIL   GK    +  + + ++GV AYPFT E+ +E+K+ E+A
Sbjct  271  -SGSKLARHFMLSTLPTLVILGPDGKTRHSNVAEAIDDYGVLAYPFTPEKFQELKELEKA  329

Query  656  T*REQSLKTVLVSTSRDYVIA  718
                Q+L+++LVS   +YV+ 
Sbjct  330  KVEAQTLESLLVSGDLNYVLG  350



>ref|XP_010553606.1| PREDICTED: probable nucleoredoxin 1 [Tarenaya hassleriana]
Length=580

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 155/189 (82%), Gaps = 1/189 (1%)
 Frame = +2

Query  155  ASSMAEQN-GDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRF  331
            A+S +E N GD+HDLR++L S  RDFL+RN G QVK+D LKGKK+G+YFSA+WCGPC  F
Sbjct  2    ANSPSEVNAGDSHDLRTLLSSPARDFLLRNDGEQVKLDSLKGKKLGLYFSAAWCGPCQHF  61

Query  332  TPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            TP L  VYNEL PKG+FE+VFVS DEDEESFKEYF KMPW A+PF+DS TR+RLD LF V
Sbjct  62   TPQLTEVYNELSPKGDFEIVFVSGDEDEESFKEYFSKMPWLAIPFTDSETRDRLDELFKV  121

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            RGIP+LVILDE+ KV   +GV +V  +GVEAYPFT ER+KEIK+ EE   REQ+LK+VLV
Sbjct  122  RGIPNLVILDENVKVVNTNGVGMVRGYGVEAYPFTPERMKEIKEEEERARREQTLKSVLV  181

Query  692  STSRDYVIA  718
            + SRD+VI+
Sbjct  182  TGSRDFVIS  190


 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 108/175 (62%), Gaps = 4/175 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K EE +A  +A    +A  L S+L   D D+++   G +V+V DL GK I +YF
Sbjct  313  YPFTPEKFEELEA--IARAKAEAQTLESLLVWDDLDYVLGKDGLKVRVSDLVGKHILLYF  370

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  FTP L  VY ++  +   FE++F+S+D D+ SF EY+ +MPW A+PF D 
Sbjct  371  SAHWCPPCRGFTPKLVEVYKQIKARDEAFELIFISSDRDQASFDEYYSEMPWLALPFGDP  430

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              ++ L   F V GIP LV L  +G+  T +  D+V  HG +AYPFT ER+KE++
Sbjct  431  -RKQSLARTFKVSGIPMLVALGPTGRTITTEARDLVGAHGADAYPFTQERLKEVE  484


 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 110/176 (63%), Gaps = 2/176 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            L+S+L +  RDF+I   G+ V V +L+GK IG+YFS +   PC  FT  L  VYN+L   
Sbjct  176  LKSVLVTGSRDFVISRDGNTVPVSELEGKIIGLYFSVASYKPCTEFTGKLVEVYNKLKEM  235

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            G NFEVV +S ++DEESFK+ F  MPW ++PF+D  +  +L   F + G+P LVIL   G
Sbjct  236  GENFEVVMISLEDDEESFKQDFETMPWLSLPFNDK-SSSKLARHFMLSGLPMLVILGPDG  294

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    + V+ V E+GV AYPFT E+ +E++    A    Q+L+++LV    DYV+ 
Sbjct  295  KTRHPNVVEAVEEYGVVAYPFTPEKFEELEAIARAKAEAQTLESLLVWDDLDYVLG  350



>ref|XP_008340046.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Malus domestica]
Length=578

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 149/191 (78%), Gaps = 2/191 (1%)
 Frame = +2

Query  146  ERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCH  325
            E KA+ +     + HD+ S+L +S+R+FL+RN+G Q+KV+ LKGKK+G+YFSASWC  C 
Sbjct  5    EVKAAKLV--GSEPHDVVSLLSASERNFLVRNNGDQIKVESLKGKKLGLYFSASWCSTCE  62

Query  326  RFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  505
            RFT  L   YNEL PKG+FE+VF+SADED+ESFK YF +MPW A+PFSDS  R R+D LF
Sbjct  63   RFTQALVEAYNELSPKGDFEIVFISADEDDESFKGYFAEMPWLAIPFSDSKARSRVDELF  122

Query  506  TVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTV  685
             VR IPHLV L E GKV ++ GV I+ ++G +AYPFTLE++KE+KD EEA  R+QSLKT+
Sbjct  123  KVREIPHLVTLGEDGKVLSDSGVWIIRKYGADAYPFTLEKLKELKDEEEAARRDQSLKTI  182

Query  686  LVSTSRDYVIA  718
            LV+ SRD+VI+
Sbjct  183  LVTRSRDFVIS  193


 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 110/178 (62%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L++IL +  RDF+I N G +V V +L+GK +G+YFS    G C  FTP L   + +L 
Sbjct  177  QSLKTILVTRSRDFVISNDGEKVPVSELEGKIVGLYFSLFSRGACVEFTPKLVEAHEKLK  236

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              G NFE+V V  D+DEESFK+YF KMPW ++P  D   + +L   F    +P +VI+  
Sbjct  237  ANGENFEIVLVPLDDDEESFKQYFEKMPWFSLPIGDKSVK-KLARYFEHSTLPTVVIIGA  295

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK  +E+  D + EHG  AYPFT E+  E+ + E+A  + Q+L+++L+S  R++VI 
Sbjct  296  DGKTLSENVADAIDEHGSLAYPFTPEKFAELVEIEKAKEKAQTLESILISGDRNFVIG  353


 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 102/170 (60%), Gaps = 3/170 (2%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A  L SIL S DR+F+I   G Q+ V DL GK I +YFSA     C  F P L   Y+E+
Sbjct  336  AQTLESILISGDRNFVIGKDGTQIPVTDLVGKNILLYFSAHRSRACRAFLPKLVEAYHEI  395

Query  365  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K + FEV+F+S+D+ + +F + F  MPW A+PF DS  +  L + F V  IP L+ + 
Sbjct  396  KAKDDAFEVIFISSDKGQNAFDKVFATMPWLALPFGDS-RKAFLISKFKVLFIPKLIAIG  454

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK-DAEEAT*REQSLKTVL  688
             +G+  T++  +++ +HG  AYPFT ER+KEIK + E A    + LK+ L
Sbjct  455  PTGQTVTKEARNLIKDHGANAYPFTEERMKEIKAEFEMARGWPEKLKSAL  504



>ref|XP_008340045.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Malus domestica]
Length=583

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 149/191 (78%), Gaps = 2/191 (1%)
 Frame = +2

Query  146  ERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCH  325
            E KA+ +     + HD+ S+L +S+R+FL+RN+G Q+KV+ LKGKK+G+YFSASWC  C 
Sbjct  5    EVKAAKLV--GSEPHDVVSLLSASERNFLVRNNGDQIKVESLKGKKLGLYFSASWCSTCE  62

Query  326  RFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  505
            RFT  L   YNEL PKG+FE+VF+SADED+ESFK YF +MPW A+PFSDS  R R+D LF
Sbjct  63   RFTQALVEAYNELSPKGDFEIVFISADEDDESFKGYFAEMPWLAIPFSDSKARSRVDELF  122

Query  506  TVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTV  685
             VR IPHLV L E GKV ++ GV I+ ++G +AYPFTLE++KE+KD EEA  R+QSLKT+
Sbjct  123  KVREIPHLVTLGEDGKVLSDSGVWIIRKYGADAYPFTLEKLKELKDEEEAARRDQSLKTI  182

Query  686  LVSTSRDYVIA  718
            LV+ SRD+VI+
Sbjct  183  LVTRSRDFVIS  193


 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 110/178 (62%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L++IL +  RDF+I N G +V V +L+GK +G+YFS    G C  FTP L   + +L 
Sbjct  177  QSLKTILVTRSRDFVISNDGEKVPVSELEGKIVGLYFSLFSRGACVEFTPKLVEAHEKLK  236

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              G NFE+V V  D+DEESFK+YF KMPW ++P  D   + +L   F    +P +VI+  
Sbjct  237  ANGENFEIVLVPLDDDEESFKQYFEKMPWFSLPIGDKSVK-KLARYFEHSTLPTVVIIGA  295

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK  +E+  D + EHG  AYPFT E+  E+ + E+A  + Q+L+++L+S  R++VI 
Sbjct  296  DGKTLSENVADAIDEHGSLAYPFTPEKFAELVEIEKAKEKAQTLESILISGDRNFVIG  353


 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 102/170 (60%), Gaps = 3/170 (2%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A  L SIL S DR+F+I   G Q+ V DL GK I +YFSA     C  F P L   Y+E+
Sbjct  336  AQTLESILISGDRNFVIGKDGTQIPVTDLVGKNILLYFSAHRSRACRAFLPKLVEAYHEI  395

Query  365  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K + FEV+F+S+D+ + +F + F  MPW A+PF DS  +  L + F V  IP L+ + 
Sbjct  396  KAKDDAFEVIFISSDKGQNAFDKVFATMPWLALPFGDS-RKAFLISKFKVLFIPKLIAIG  454

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK-DAEEAT*REQSLKTVL  688
             +G+  T++  +++ +HG  AYPFT ER+KEIK + E A    + LK+ L
Sbjct  455  PTGQTVTKEARNLIKDHGANAYPFTEERMKEIKAEFEMARGWPEKLKSAL  504



>ref|XP_010243058.1| PREDICTED: probable nucleoredoxin 1 [Nelumbo nucifera]
Length=498

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = +2

Query  176  NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
             GD+HDL S+L + +RDFL+ N+GHQ+K+D L GK +G+YFS SWCGPC RFTP LA VY
Sbjct  3    KGDSHDLSSLLSTGERDFLVHNNGHQIKIDSLTGKTVGLYFSGSWCGPCRRFTPILAEVY  62

Query  356  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
             EL  KG+FEVVFVS+D D++SF +YF +MPW A+PF+DS  R+RL  LF VRGIP+LV+
Sbjct  63   QELSSKGDFEVVFVSSDRDDDSFGKYFSEMPWLAIPFADSGARQRLKELFQVRGIPNLVV  122

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            LD +GKV +E  V IV ++G EAYPFT ER+K +K+ EEA  + Q+L+++L S+SRD+VI
Sbjct  123  LDGTGKVLSERAVQIVRDYGAEAYPFTPERIKLLKEEEEAAKQNQTLRSILASSSRDFVI  182

Query  716  A  718
            +
Sbjct  183  S  183


 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 114/185 (62%), Gaps = 5/185 (3%)
 Frame = +2

Query  167  AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  346
            A+QN     LRSIL SS RDF+I N G++  + +L+GK +G+YFS      C  FT  L 
Sbjct  163  AKQN---QTLRSILASSSRDFVISNDGNKTPISELEGKMVGLYFSVGSHPACLEFTAKLV  219

Query  347  TVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
             +Y EL   G  FEVV +S   +EESF++ F  MPW A+PF D +  E+L   F +R +P
Sbjct  220  QIYRELKENGEAFEVVLISLGYEEESFRQDFESMPWFALPFKDKLC-EKLIRYFELRALP  278

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
             LVI+   GK    +  ++V +HG+ AYPF+ E+++E+ + E A    Q+L+++LVS  R
Sbjct  279  TLVIVGPDGKTINSNVAELVEDHGILAYPFSPEKLEELAEIERAKREAQTLESILVSGDR  338

Query  704  DYVIA  718
            D+VI 
Sbjct  339  DFVIG  343


 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 108/181 (60%), Gaps = 4/181 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + FS  K EE      A++  +A  L SIL S DRDF+I     +V+V  L GK I +YF
Sbjct  306  YPFSPEKLEELAEIERAKR--EAQTLESILVSGDRDFVIGKGDAKVQVSQLVGKNILLYF  363

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+E+  K + FEV+F+S+D D++SF +++  MPW A+P+ D 
Sbjct  364  SAHWCPPCRAFLPKLIEAYHEIKAKDDAFEVIFISSDRDQKSFDDFYSGMPWLALPYGDE  423

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
              ++ L   F + GIP ++ +  SG+  T D   +++ HG  AYPFT E VK+I++  EA
Sbjct  424  -RKQSLSRWFKIEGIPTVIAIGPSGRTVTMDARALLMTHGAAAYPFTDEHVKQIEERLEA  482

Query  656  T  658
             
Sbjct  483  A  483



>ref|XP_008792848.1| PREDICTED: LOW QUALITY PROTEIN: probable nucleoredoxin 1 [Phoenix 
dactylifera]
Length=589

 Score =   242 bits (618),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 145/185 (78%), Gaps = 1/185 (1%)
 Frame = +2

Query  167  AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  346
            A   G+AHDL+S+L +  RDFL+RN+G QVK+ +L GK  G+YFSASWCGPCHRFTP L 
Sbjct  7    AANGGNAHDLKSLLSAEGRDFLVRNNGDQVKISNLDGKVTGLYFSASWCGPCHRFTPKLV  66

Query  347  TVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
              YNE+  + G+FEV+F+S DEDEESF  YF +MPW A+PFSDS TR+RL+ LF V GIP
Sbjct  67   EAYNEISSRVGDFEVIFISGDEDEESFNNYFSEMPWLAIPFSDSETRDRLNELFDVSGIP  126

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
            HLV+LD+SGKV T++ V  V ++G E YPFT ER+ ++K+ EEA  + Q+L++VLVS+SR
Sbjct  127  HLVVLDKSGKVLTDEAVRAVRDYGSEGYPFTPERIAKMKEEEEAAKKNQTLRSVLVSSSR  186

Query  704  DYVIA  718
            D+VI+
Sbjct  187  DFVIS  191


 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 119/176 (68%), Gaps = 2/176 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            LRS+L SS RDF+I NSG++V V +L+GK +G+YF+ S   PC  FT  L+ +Y +L  K
Sbjct  177  LRSVLVSSSRDFVISNSGNKVPVAELEGKIVGLYFALSSFAPCIEFTRVLSDMYGKLKEK  236

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            G +FEVV VS D+++ SF++ F  MPW A+P +D  + E+L   F +  IP LV++   G
Sbjct  237  GESFEVVLVSLDDEDSSFEQSFASMPWLAIPINDK-SSEKLARYFELETIPTLVVIGSDG  295

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  ++V ++GVEAYPF+ E+++E+ + E+A    Q+L+++LVS  RDYVI 
Sbjct  296  KTLNANAAELVEDYGVEAYPFSPEKLQELAEKEKAKMEAQTLESLLVSGERDYVIG  351


 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 109/179 (61%), Gaps = 4/179 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + FS  K +E      A+   +A  L S+L S +RD++I     +V + +L GK I +YF
Sbjct  314  YPFSPEKLQELAEKEKAKM--EAQTLESLLVSGERDYVIGKGNVKVPISELVGKNILLYF  371

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+++  K + FEV+FVS+D+D+ SF ++F  MPW A+PF D 
Sbjct  372  SAHWCPPCRAFLPKLIDAYHKIKEKDSAFEVIFVSSDQDQSSFDDFFSSMPWLALPFGDE  431

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
              ++ L   F + GIP LV +  +GK  T++  ++V+ HG +AYPFT ER+K+++   E
Sbjct  432  -RKKXLSRTFKIYGIPSLVAIGPTGKTITKEARELVMVHGADAYPFTEERLKQLEAESE  489



>ref|XP_008459530.1| PREDICTED: probable nucleoredoxin 1 [Cucumis melo]
 gb|AAU04767.1| protein disulfide isomerase (PDI)-like protein 3 [Cucumis melo]
Length=561

 Score =   241 bits (614),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            HD+ S+  S  RDFLIRN+G QVK+  L GK +G+YFSASWC PCHRFTP  A VY EL+
Sbjct  7    HDINSLFSSDGRDFLIRNNGDQVKISSLIGKIVGLYFSASWCPPCHRFTPIFAGVYEELV  66

Query  368  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  547
             KG+FEVVFVS+D DEESFK+YF KMPW ++PFSDS T +RL+ LF VRGIPHLV+LD +
Sbjct  67   SKGDFEVVFVSSDNDEESFKDYFSKMPWLSIPFSDSETNQRLNELFKVRGIPHLVVLDAN  126

Query  548  GKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            GKV T DGV +V E+GV AYPFT E++K +K+ EE   R Q++ ++LVS SR+YVI+
Sbjct  127  GKVLTNDGVRLVSEYGVNAYPFTSEQIKLLKEKEEEAKRNQTISSILVSNSRNYVIS  183


 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 98/151 (65%), Gaps = 2/151 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            ++  L S+L S ++D++I  +G ++ V +L GK I +YFSA WC PC  F P L   YNE
Sbjct  325  ESQTLESLLVSGNQDYVIGKNGKKIPVSELVGKNILLYFSAHWCPPCRAFLPKLIEAYNE  384

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K   FEV+F+S+D D++SF+E+F  MPW A+PF D   ++ L+  F + GIP LV L
Sbjct  385  IKQKDKEFEVIFISSDSDQDSFEEFFSGMPWLALPFGDE-RKKFLNRRFKIEGIPTLVAL  443

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVK  631
            + SG+  + D   ++  HG +AYPFT ER+K
Sbjct  444  NRSGRTVSTDARKLITSHGADAYPFTEERLK  474


 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 110/176 (63%), Gaps = 2/176 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            + SIL S+ R+++I N G Q+ V +L+GK IG+YFS     PC  FT  L   Y +L  K
Sbjct  169  ISSILVSNSRNYVISNDGTQIPVSELEGKVIGLYFSVYGHEPCDDFTSILVDAYKKLKEK  228

Query  374  GN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            GN FE+V +S D++ + F E    MP  A+PF D   + +L   F +  IP L+I+ + G
Sbjct  229  GNNFEIVLISLDDEADDFNEALKAMPCLALPFQDEKCK-KLIRYFELSDIPTLIIIGQDG  287

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    + V+++ EHG +AYPFT E+++++ + ++A    Q+L+++LVS ++DYVI 
Sbjct  288  KTLHPNAVELIEEHGSDAYPFTPEKIEKLVEIQKAKLESQTLESLLVSGNQDYVIG  343



>emb|CBI28541.3| unnamed protein product [Vitis vinifera]
Length=490

 Score =   239 bits (609),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = +2

Query  176  NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
            +G AHDL S+L   DRDFL+RN+GHQVKV+ LKGKKI +YFSASWCGPC RFTP L   Y
Sbjct  7    DGVAHDLVSLLTREDRDFLVRNNGHQVKVESLKGKKIWLYFSASWCGPCRRFTPKLVEAY  66

Query  356  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
            NEL    +FE++FVS D D+ESF  YF KMPW A+PFSDS  R++L+ LF V GIP+LV+
Sbjct  67   NELSSNDDFEIIFVSGDNDDESFNGYFSKMPWLAIPFSDSDARDQLNELFKVMGIPNLVM  126

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            LDESGKV +EDGVDI+ E+GVEAYPFT E++KE+K+ EE   +EQSL+++LVS SRDYVI
Sbjct  127  LDESGKVLSEDGVDIIQEYGVEAYPFTPEKIKEMKEKEETARKEQSLRSILVSQSRDYVI  186

Query  716  A  718
            +
Sbjct  187  S  187


 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              LRSIL S  RD++I   G +V V +L+GK +G++FS S    C  FTP L  VY +L 
Sbjct  171  QSLRSILVSQSRDYVISTDGKKVPVSELEGKFVGLFFSLSSYKACLEFTPTLVDVYEKLR  230

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             KG +FE+V +S D++EESFK+YFG MPW A+PF D  + E+L   F +  +P LV++  
Sbjct  231  AKGESFEIVMISLDDEEESFKKYFGSMPWLALPFRDK-SCEKLARYFELSALPTLVVIGP  289

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK    +  + + EHG++AYPFT E+  E+++ E+A    Q+L+++LVS  RD+VI 
Sbjct  290  DGKTLHSNVAEAIQEHGIQAYPFTPEKFAELEEIEKAKREAQTLESILVSGDRDFVIG  347


 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 96/154 (62%), Gaps = 2/154 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L SIL S DRDF+I   G ++ V DL GK I +YFSA WC PC  F P L   Y +
Sbjct  329  EAQTLESILVSGDRDFVIGKDGVKIPVSDLVGKNILLYFSAHWCPPCRAFLPKLIEAYQK  388

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K   FEV+F+S+D+D+ SF E+F  MPW A+PF D   +  L   F V GIP L+ +
Sbjct  389  IKTKDEAFEVIFISSDKDQTSFDEFFSGMPWLALPFGDK-RKASLSRTFKVHGIPSLIAI  447

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +G+  T +  ++V+ HG +AYPFT E ++EI+
Sbjct  448  GPTGRTVTTEARNLVMIHGADAYPFTEEHIREIE  481



>ref|XP_010243057.1| PREDICTED: probable nucleoredoxin 1 [Nelumbo nucifera]
Length=570

 Score =   241 bits (614),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = +2

Query  176  NGDA-HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATV  352
            +GD+ HDL+ IL S +RDFL+RN+G QVK+ DL GK  G+YFSASWCGPC RFTP L  V
Sbjct  3    DGDSQHDLKFILSSGERDFLVRNNGDQVKISDLSGKTTGLYFSASWCGPCRRFTPELIDV  62

Query  353  YNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLV  532
            YN+L  KG FE+VFVSAD+DEE F  YF KMPW A+PFSDS TR+RLD +F V GIPHLV
Sbjct  63   YNDLSAKGGFEIVFVSADQDEEEFNGYFSKMPWLAIPFSDSDTRDRLDGIFQVNGIPHLV  122

Query  533  ILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYV  712
            ILD +GKV+TE+GV+I+ E+GVEAYPFT E + ++K+ EEA  +EQSL+++LVS+SRD++
Sbjct  123  ILDANGKVSTEEGVEIIGEYGVEAYPFTSEIINQLKEEEEAAKKEQSLRSILVSSSRDFL  182

Query  713  IA  718
            I+
Sbjct  183  IS  184


 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              LRSIL SS RDFLI N G++V V +L+GK +G+YF +S+ G C  FT     +YNEL 
Sbjct  168  QSLRSILVSSSRDFLISNDGNKVPVSELEGKVVGLYFCSSFYGSCVEFTKEFVGIYNELK  227

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             K  +FEVV +S D+DEES+K+ F  +PW A+PF D  +  +L   F +  +P LVI+  
Sbjct  228  EKAESFEVVLISLDDDEESYKKSFEIVPWLALPFKDK-SISKLVRYFELSTVPTLVIIGT  286

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK    + V I+ EHG++ YPFT E++ E+ + E+A    Q+L+++LVS  RD+VI 
Sbjct  287  DGKTLHSNAVKIIEEHGIQGYPFTAEKLAELAEIEKARLEAQTLESILVSGDRDFVIG  344


 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 99/158 (63%), Gaps = 2/158 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L SIL S DRDF+I   G ++ V  L GK I +YFSA WC PC  F P L   Y+E
Sbjct  326  EAQTLESILVSGDRDFVIGKDGAKIPVSKLLGKNILLYFSAEWCPPCRAFLPKLIKAYHE  385

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K + FEV+F+S+D ++ SF E++  MPW A+PF D   ++ L+  F V GIP  V +
Sbjct  386  IKAKDDGFEVIFISSDSNQSSFDEFYSGMPWLALPFGDE-RKKSLNRRFKVTGIPTAVAI  444

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
              SG+  T D  ++++ HG +AYPFT ERVKEI+   E
Sbjct  445  GSSGRTVTTDARNLLMAHGADAYPFTDERVKEIESQLE  482



>gb|AAU04766.1| protein disulfide isomerase (PDI)-like protein 2 [Cucumis melo]
Length=563

 Score =   239 bits (610),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            HDL S++ S  RDFLIR++G QVK+  L GK +G+YFSASWC PC RFTP  A VY EL+
Sbjct  7    HDLNSLVSSEGRDFLIRSNGDQVKISSLIGKNVGLYFSASWCPPCRRFTPVFAGVYEELV  66

Query  368  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  547
            PKG FEV+F+S+D DE+SFK+YF KMPW ++PFSDS   +RL  LF VRGIPHLV+LD S
Sbjct  67   PKGEFEVIFISSDRDEDSFKDYFSKMPWLSIPFSDSEIVKRLKELFKVRGIPHLVVLDPS  126

Query  548  GKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            GKV+T+ GV +V EHG+ AYPFT E+++ +KD EE   R Q++ ++LVS SRDYVI+
Sbjct  127  GKVSTDQGVRLVSEHGINAYPFTAEQIQHLKDKEEEARRNQTISSLLVSNSRDYVIS  183


 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 108/176 (61%), Gaps = 2/176 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            + S+L S+ RD++I N G+Q+ V +L+GK IG+YFS      C  FTP L   Y +L  K
Sbjct  169  ISSLLVSNSRDYVISNGGNQIPVSELEGKVIGLYFSVYGYALCDEFTPILVDTYKKLKEK  228

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            G NFE+V +S D+  E F E    +PW A+PF D   R +L   F +  IP LVI+ + G
Sbjct  229  GQNFEIVSISLDDANEDFSEALKTVPWLALPFQDEKCR-KLTRYFELSTIPTLVIIGQDG  287

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  ++V EHGV+AYPFT E+++E+ + E++    Q+L+++LV   RD+ I 
Sbjct  288  KTLISNAAELVEEHGVDAYPFTQEKLEELAEIEKSKLESQTLESILVHGERDFGIG  343


 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 102/174 (59%), Gaps = 7/174 (4%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F++ K EE   + + +   ++  L SIL   +RDF I  +G +V V +L GK I +YF
Sbjct  306  YPFTQEKLEE--LAEIEKSKLESQTLESILVHGERDFGIGKNGAKVSVSELGGKNILLYF  363

Query  299  SASWCG--PCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFS  469
             ++     PC      L   YNE+  K   FEV+F+S+D D+ SF+E+F  MPW A+PF 
Sbjct  364  LSTLVPSVPCI-LCLKLIESYNEIKQKYKEFEVIFISSDRDDNSFQEFFSGMPWLALPFG  422

Query  470  DSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVK  631
            D   +  ++  F ++GIP +V ++ESG+  + +   ++ E+G  AYPFT ER+K
Sbjct  423  DE-RKNFINRRFKIQGIPAVVAINESGRTVSTEARKLITEYGANAYPFTEERLK  475



>ref|XP_008459528.1| PREDICTED: probable nucleoredoxin 1 [Cucumis melo]
Length=562

 Score =   238 bits (608),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            HDL S++ S  RDFLIR++G QVK+  L GK +G+YFSASWC PC RFTP  A VY EL+
Sbjct  7    HDLNSLVSSEGRDFLIRSNGDQVKISSLIGKNVGLYFSASWCPPCRRFTPVFAGVYEELV  66

Query  368  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  547
            PKG FEV+F+S+D DE+SFK+YF KMPW ++PFSDS   +RL  LF VRGIPHLV+LD S
Sbjct  67   PKGEFEVIFISSDRDEDSFKDYFSKMPWLSIPFSDSEIVKRLKELFKVRGIPHLVVLDPS  126

Query  548  GKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            GKV+T+ GV +V EHG+ AYPFT E+++ +KD EE   R Q++ ++LVS SRDYVI+
Sbjct  127  GKVSTDQGVRLVSEHGINAYPFTAEQIQHLKDKEEEARRNQTISSLLVSNSRDYVIS  183


 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 109/176 (62%), Gaps = 2/176 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            + S+L S+ RD++I N G+Q+ V +L+GK IG+YFS      C  FTP L   Y +L  K
Sbjct  169  ISSLLVSNSRDYVISNGGNQIPVSELEGKVIGLYFSVYGYALCDEFTPILVDTYKKLKEK  228

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            G NFE+V +S D+  E F E    +PW A+PF D   R +L   F +  IP LVI+ + G
Sbjct  229  GQNFEIVSISLDDANEDFSEALKTVPWLALPFQDEKCR-KLTRYFELSTIPTLVIIGQDG  287

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  ++V EHGV+AYPFT E+++E+ + E++    Q+L+++LV   RD+VI 
Sbjct  288  KTLISNAAELVEEHGVDAYPFTQEKLEELAEIEKSKLESQTLESILVHGERDFVIG  343


 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 106/172 (62%), Gaps = 4/172 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F++ K EE   + + +   ++  L SIL   +RDF+I   G +V V +L GK I +YF
Sbjct  306  YPFTQEKLEE--LAEIEKSKLESQTLESILVHGERDFVIGKDGAKVSVSELVGKNILLYF  363

Query  299  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   YNE+  K   FEV+F+S+D D+ SF+E+F  MPW A+PF D 
Sbjct  364  SAHWCPPCRAFLPKLIESYNEIKQKYKEFEVIFISSDRDDNSFQEFFSGMPWLALPFGDE  423

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVK  631
              +  ++  F ++GIP +V ++ESG+  + +   ++ E+G  AYPFT ER+K
Sbjct  424  -RKNFINRRFKIQGIPAVVAINESGRTVSTEARKLITEYGANAYPFTEERLK  474



>gb|EYU22493.1| hypothetical protein MIMGU_mgv1a003730mg [Erythranthe guttata]
Length=567

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = +2

Query  158  SSMAEQNGDA-HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            S +   NGDA +DL SIL S +RD+L+RN+G QVK D  KGK  G+YFSASWCGPC RFT
Sbjct  3    SELEIANGDATYDLSSILSSPNRDYLVRNNGDQVKFDSFKGKVTGLYFSASWCGPCQRFT  62

Query  335  PNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  514
            P L   YNEL    NFE+VF+S DED+ESF  YF KMPW A+PFSDS TRE+L+ LF V 
Sbjct  63   PKLVEAYNELAQSNNFEIVFISGDEDDESFDAYFSKMPWLAIPFSDSDTREKLNELFGVS  122

Query  515  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVS  694
            GIPHLVIL+E GK+ T +GV +++E+G + YPFT E++++++  EE     QSLK++LV+
Sbjct  123  GIPHLVILNEDGKILTSEGVQVIVENGSDGYPFTSEQIEKLRKQEEEAKMNQSLKSLLVT  182

Query  695  TSRDYVIAA  721
             SRDYVI +
Sbjct  183  ESRDYVITS  191


 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 102/159 (64%), Gaps = 4/159 (3%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L S+L + D D++I  +G +V V DL GK I +YFSA WC PC  F P L   Y E
Sbjct  332  EAQTLESLLVNQDSDYVIGEAGVKVPVSDLNGKDILLYFSAHWCRPCRAFLPTLTKAYEE  391

Query  362  LLPKGN--FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
             + K N   EV+F+S+D D+++F++YF +MPW A+PF D   +E L + F V GIP LV 
Sbjct  392  -INKNNKRLEVIFISSDRDQKAFEDYFSEMPWLALPFGDK-RKESLSSWFKVDGIPTLVA  449

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
            L  +GK  + D   +++ HG EAYPFT ER++EI+ A E
Sbjct  450  LGPTGKTVSTDARGLIMAHGAEAYPFTRERIEEIEKAFE  488


 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 116/192 (60%), Gaps = 7/192 (4%)
 Frame = +2

Query  149  RKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFS-ASWCGPCH  325
            RK    A+ N     L+S+L +  RD++I + G +V V +L+GK +G+YF  AS+ G C 
Sbjct  164  RKQEEEAKMN---QSLKSLLVTESRDYVITSDGKKVPVAELEGKTVGLYFVLASYYG-CL  219

Query  326  RFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDAL  502
             F   L  VYN L   G +FE+V V  DEDEESF E F K+PW ++P +D     +L   
Sbjct  220  DFNSKLIEVYNSLREGGESFEIVMVPLDEDEESFGEEFEKLPWLSLPINDKCCL-KLVRY  278

Query  503  FTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKT  682
            F +  +P +VI+  +GK    + V+ + EHG++AYPFT E+  E+++ E+A    Q+L++
Sbjct  279  FELGALPTVVIIGPNGKTLQSNVVEAIEEHGMKAYPFTPEKFIELEEIEKAKREAQTLES  338

Query  683  VLVSTSRDYVIA  718
            +LV+   DYVI 
Sbjct  339  LLVNQDSDYVIG  350



>emb|CAN77321.1| hypothetical protein VITISV_008818 [Vitis vinifera]
Length=572

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = +2

Query  176  NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
            +G AHDL S+L   DRDFL+RN+GHQVKV+ LKGKKI +YFSASWCGPC RFTP L   Y
Sbjct  7    DGVAHDLVSLLTREDRDFLVRNNGHQVKVESLKGKKIWLYFSASWCGPCRRFTPKLVEAY  66

Query  356  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
            NEL    +FE++FVS D D+ESF  YF KMPW A+PFSDS  R++L+ LF V GIP+LV+
Sbjct  67   NELSSNDDFEIIFVSGDNDDESFNGYFSKMPWLAIPFSDSDARDQLNELFKVMGIPNLVM  126

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            LDESGKV +EDGVDI+ E+GVEAYPFT E++KE+K+ EE   +EQSL+++LVS SRDYVI
Sbjct  127  LDESGKVLSEDGVDIIQEYGVEAYPFTPEKIKEMKEKEETARKEQSLRSILVSQSRDYVI  186

Query  716  A  718
            +
Sbjct  187  S  187


 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              LRSIL S  RD++I   G +V V +L+GK +G++FS S    C  FTP L  VY +L 
Sbjct  171  QSLRSILVSQSRDYVISTDGKKVPVSELEGKFVGLFFSLSSYKACLEFTPTLVDVYEKLR  230

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             KG +FE+V +S D++EESFK+YFG MPW A+PF D  + E+L   F +  +P LV++  
Sbjct  231  AKGESFEIVMISLDDEEESFKKYFGSMPWLALPFRDK-SCEKLARYFELSALPTLVVIGP  289

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK    +  + + EHG++AYPFT E+  E+++ E+A    Q+L+++LVS  RD+VI 
Sbjct  290  DGKTLHSNVAEAIQEHGIQAYPFTPEKFAELEEIEKAKREAQTLESILVSGDRDFVIG  347


 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 96/154 (62%), Gaps = 2/154 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L SIL S DRDF+I   G ++ V DL GK I +YFSA WC PC  F P L   Y +
Sbjct  329  EAQTLESILVSGDRDFVIGKDGVKIPVSDLVGKNILLYFSAHWCPPCRAFLPKLIEAYQK  388

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K   FEV+F+S+D+D+ SF E+F  MPW A+PF D   +  L   F V GIP L+ +
Sbjct  389  IKTKDEAFEVIFISSDKDQTSFDEFFSGMPWLALPFGDK-RKASLSRTFKVHGIPSLIAI  447

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +G+  T +  ++V+ HG +AYPFT E +KEI+
Sbjct  448  GPTGRTVTTEARNLVMIHGADAYPFTEEHIKEIE  481



>ref|XP_010651402.1| PREDICTED: probable nucleoredoxin 1 [Vitis vinifera]
Length=572

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = +2

Query  176  NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
            +G AHDL S+L   DRDFL+RN+GHQVKV+ LKGKKI +YFSASWCGPC RFTP L   Y
Sbjct  7    DGVAHDLVSLLTREDRDFLVRNNGHQVKVESLKGKKIWLYFSASWCGPCRRFTPKLVEAY  66

Query  356  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
            NEL    +FE++FVS D D+ESF  YF KMPW A+PFSDS  R++L+ LF V GIP+LV+
Sbjct  67   NELSSNDDFEIIFVSGDNDDESFNGYFSKMPWLAIPFSDSDARDQLNELFKVMGIPNLVM  126

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            LDESGKV +EDGVDI+ E+GVEAYPFT E++KE+K+ EE   +EQSL+++LVS SRDYVI
Sbjct  127  LDESGKVLSEDGVDIIQEYGVEAYPFTPEKIKEMKEKEETARKEQSLRSILVSQSRDYVI  186

Query  716  A  718
            +
Sbjct  187  S  187


 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              LRSIL S  RD++I   G +V V +L+GK +G++FS S    C  FTP L  VY +L 
Sbjct  171  QSLRSILVSQSRDYVISTDGKKVPVSELEGKFVGLFFSLSSYKACLEFTPTLVDVYEKLR  230

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             KG +FE+V +S D++EESFK+YFG MPW A+PF D  + E+L   F +  +P LV++  
Sbjct  231  AKGESFEIVMISLDDEEESFKKYFGSMPWLALPFRDK-SCEKLARYFELSALPTLVVIGP  289

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK    +  + + EHG++AYPFT E+  E+++ E+A    Q+L+++LVS  RD+VI 
Sbjct  290  DGKTLHSNVAEAIQEHGIQAYPFTPEKFAELEEIEKAKREAQTLESILVSGDRDFVIG  347


 Score =   143 bits (361),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 96/154 (62%), Gaps = 2/154 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L SIL S DRDF+I   G ++ V DL GK I +YFSA WC PC  F P L   Y +
Sbjct  329  EAQTLESILVSGDRDFVIGKDGVKIPVSDLVGKNILLYFSAHWCPPCRAFLPKLIEAYQK  388

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K   FEV+F+S+D+D+ SF E+F  MPW A+PF D   +  L   F V GIP L+ +
Sbjct  389  IKTKDEAFEVIFISSDKDQTSFDEFFSGMPWLALPFGDK-RKASLSRTFKVHGIPSLIAI  447

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +G+  T +  ++V+ HG +AYPFT E ++EI+
Sbjct  448  GPTGRTVTTEARNLVMIHGADAYPFTEEHIREIE  481



>ref|XP_010100450.1| putative nucleoredoxin 1 [Morus notabilis]
 gb|EXB82584.1| putative nucleoredoxin 1 [Morus notabilis]
Length=568

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 140/181 (77%), Gaps = 0/181 (0%)
 Frame = +2

Query  176  NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
            NG +HDL ++  S  RDFL+RN+G +V +  L GK + IYFS SWCGPC RFTP L  VY
Sbjct  7    NGVSHDLSALFSSDPRDFLVRNNGDKVTISSLSGKVVAIYFSGSWCGPCRRFTPKLVEVY  66

Query  356  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
             E+ PKG+FEVVFVS+D DEESF +YF +MPW A+PFSDS TR+ L  LF VRGIP+LVI
Sbjct  67   QEVAPKGDFEVVFVSSDRDEESFNDYFSEMPWLAIPFSDSDTRKHLKELFKVRGIPNLVI  126

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            +D +G+VTTE+G  +V+E+GV+ YPFT ER+  +K+ EEAT R QSL ++LVS SR+Y++
Sbjct  127  IDSNGEVTTENGTMVVMEYGVDGYPFTCERINFLKEVEEATKRNQSLSSILVSRSRNYLV  186

Query  716  A  718
            +
Sbjct  187  S  187


 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 111/178 (62%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L SIL S  R++L+ N+G+QV V  L+GK +G+YFS S   PC  FT  L  VYN+L 
Sbjct  171  QSLSSILVSRSRNYLVSNNGNQVPVSALEGKMVGLYFSMSSHEPCVEFTSTLVDVYNKLK  230

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             KG NFEVV +  D +EE  K+ F  MPW A+PF D  + E+L   F +  IP LVI+  
Sbjct  231  EKGENFEVVLIPLDYEEEEHKQGFEAMPWLALPFKDK-SCEKLVRYFELETIPTLVIIGP  289

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK    +  + + EHG++AYPFT E++ E+ + E+A    Q+L+++LVS  +D+VI 
Sbjct  290  DGKTLDPNVAERIEEHGIDAYPFTPEKLAELAEFEKAKEASQTLESLLVSGDKDFVIG  347


 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 104/171 (61%), Gaps = 4/171 (2%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +  L S+L S D+DF+I  +  +V V +L GK + +YFSA WC PC  FTP L  +Y+E+
Sbjct  330  SQTLESLLVSGDKDFVIGKNDSKVPVSELVGKNVLLYFSAHWCPPCRGFTPKLNKIYHEI  389

Query  365  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K N FEV+F+S+D D+ SF EYF  MPW A+P+ D   ++ LD  F +  IP  + + 
Sbjct  390  KEKDNQFEVIFISSDSDQSSFDEYFSSMPWLALPYGDE-RKKLLDRKFKIEAIPAAIAIG  448

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDA--EEAT*REQSLKTVL  688
             SG+  T++  D++  HG  AYPFT E +K +++   E+A    Q LK  L
Sbjct  449  SSGRTVTKEARDLIGVHGANAYPFTEEHLKHLEEQAEEQAKGWPQKLKHEL  499



>ref|XP_008782777.1| PREDICTED: probable nucleoredoxin 1-1 [Phoenix dactylifera]
Length=583

 Score =   236 bits (601),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 145/190 (76%), Gaps = 3/190 (2%)
 Frame = +2

Query  155  ASSMAEQNGDA--HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHR  328
            A    + NG A  HDL+S+L + +RDFL+RN+G QVK+ +L+GK IG+YFSASWC PC R
Sbjct  2    AGVGGDDNGAACRHDLKSLLAADERDFLVRNNGDQVKIANLEGKTIGLYFSASWCPPCRR  61

Query  329  FTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  505
            FTP L   Y +L  +G +FEVVFVSAD DE+SF  YF KMPW A+PFSD+  R+RLD +F
Sbjct  62   FTPKLIETYGKLSSEGKDFEVVFVSADRDEDSFNGYFAKMPWLAIPFSDTKARDRLDEVF  121

Query  506  TVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTV  685
             VRGIPHLVILD SG+V  E+GV  V ++G E YPFTLE++ ++K+ EEA  REQ+L+TV
Sbjct  122  KVRGIPHLVILDASGEVLNEEGVQAVGDYGSEGYPFTLEKINKLKEDEEAAKREQTLQTV  181

Query  686  LVSTSRDYVI  715
            LVS SRDY+I
Sbjct  182  LVSPSRDYLI  191


 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 102/156 (65%), Gaps = 2/156 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L S+L S + D++I   G Q+ V +L GK I +YFSA WCGPC  F P L   Y ++ 
Sbjct  339  QSLESLLVSGEIDYVIGKDGVQIPVSELMGKNILLYFSAQWCGPCRAFLPKLIEEYRKIK  398

Query  368  PKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             K + FEVVF+S+D D++SF+++   MPW A+PF D   ++ L+ +F +RGIP LV +  
Sbjct  399  DKDSAFEVVFISSDRDQKSFEDFLSGMPWLALPFGDE-RKKSLNRVFKIRGIPSLVAIGP  457

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
            +G+  T+D   +++ HG +AYPFT ER+KE++D  E
Sbjct  458  TGRTVTKDAKLLLMIHGADAYPFTEERIKELEDQLE  493


 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 111/179 (62%), Gaps = 5/179 (3%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            L+++L S  RD+LI N+G+QV V +L+GK + +YFS S   PC  FT  LA +Y  L  K
Sbjct  178  LQTVLVSPSRDYLILNNGNQVPVSELEGKIVCLYFSVSGFQPCDEFTLVLAKIYRTLKEK  237

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            G +FEVV VS D++E SFKE F  MPW A+PF D   + +L   F +R IP LV+L   G
Sbjct  238  GESFEVVMVSLDDEESSFKEGFAGMPWLAIPFGDESCK-KLVRYFELRTIPTLVVLGSDG  296

Query  551  KVTTEDGVDIVLEHGVEA---YPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  ++V EHG EA   +PF+ +++  + +  +A    QSL+++LVS   DYVI 
Sbjct  297  KTLHSNIAELVEEHGEEAWEGFPFSQDKMDLLAEKAKAKLAAQSLESLLVSGEIDYVIG  355



>ref|XP_010917444.1| PREDICTED: LOW QUALITY PROTEIN: probable nucleoredoxin 1 [Elaeis 
guineensis]
Length=592

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 142/183 (78%), Gaps = 1/183 (1%)
 Frame = +2

Query  173  QNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATV  352
              GDAHDL+S+L    RDFL+RN+G QVK+ +L GK  G+YFSASWCGPCHRFTP L   
Sbjct  9    NGGDAHDLKSLLSGEGRDFLVRNNGDQVKISNLDGKVTGLYFSASWCGPCHRFTPKLVEA  68

Query  353  YNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  529
            YNE+  +  +FEV+F+S+DEDEESF  YF +MPW A+PFSDS TR+ L+ LF V GIPHL
Sbjct  69   YNEISSRVEDFEVIFISSDEDEESFNNYFSEMPWLAIPFSDSETRDHLNELFDVSGIPHL  128

Query  530  VILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDY  709
            VILD+SGKV T++ V +V ++G E YPFT ER+ ++K+ E+A    Q+L++VLVS+SRD+
Sbjct  129  VILDKSGKVLTDEAVQVVRDYGSEGYPFTPERIAKMKEEEKAAKDNQTLRSVLVSSSRDF  188

Query  710  VIA  718
            VI+
Sbjct  189  VIS  191


 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 129/205 (63%), Gaps = 14/205 (7%)
 Frame = +2

Query  122  QFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQ-----VKVDDLKGKKI  286
            + +K K EE+ A        D   LRS+L SS RDF+I NSG +     V V +L+GK +
Sbjct  160  RIAKMKEEEKAAK-------DNQTLRSVLVSSSRDFVISNSGIRXMLFFVPVTELEGKIV  212

Query  287  GIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVP  463
            G+YFS S  GPC+ F+  LA +Y +L  KG +FEVV VS D+DE SF++ F  MPW A+P
Sbjct  213  GLYFSLSSFGPCNGFSRVLADMYGKLKEKGESFEVVLVSLDDDESSFEQSFASMPWLAIP  272

Query  464  FSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKD  643
              D  + E+L   F +  IP LV++   GK+   +  ++V E+GVEAYPF+ E+++E+ +
Sbjct  273  VKDK-SSEKLARYFELETIPTLVVIGSDGKILNANAAELVEEYGVEAYPFSPEKLEELAE  331

Query  644  AEEAT*REQSLKTVLVSTSRDYVIA  718
             E+A    Q+L+++LVS  RDYVI 
Sbjct  332  MEKAKMEAQTLESLLVSGERDYVIG  356


 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 110/179 (61%), Gaps = 4/179 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + FS  K EE   + M +   +A  L S+L S +RD++I     +V + +L GK I +YF
Sbjct  319  YPFSPEKLEE--LAEMEKAKMEAQTLESLLVSGERDYVIGKGNVKVPISELVGKNILLYF  376

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+++  K + FEV+FVS+D+D+ SF ++F  MPW A+PF D 
Sbjct  377  SAQWCPPCRAFLPKLIEAYHKIKEKDSAFEVIFVSSDQDQSSFDDFFSGMPWLALPFGDE  436

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
              +  L   F + GIP LV +  +GK  T++  ++V++HG +AYPFT ER+KE+K   E
Sbjct  437  -RKNSLSRTFKIYGIPSLVAIGPTGKTITKEARELVMDHGADAYPFTEERIKELKAESE  494



>ref|XP_011656057.1| PREDICTED: probable nucleoredoxin 1 [Cucumis sativus]
 gb|KGN52626.1| hypothetical protein Csa_5G647480 [Cucumis sativus]
Length=561

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            HD+ S+  S   DFLIRN+G QVK+  L GK +G+YFSASWC PCHRFTP  A VY EL 
Sbjct  7    HDINSLFSSDGTDFLIRNNGDQVKISSLIGKIVGLYFSASWCPPCHRFTPIFAGVYEELA  66

Query  368  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  547
             KG+FEVVFVS+D DEESFK+YF KMPW A+PFSDS T +RL+ LF VRGIPHLV+LD +
Sbjct  67   SKGDFEVVFVSSDNDEESFKDYFSKMPWLAIPFSDSDTNQRLNELFKVRGIPHLVVLDAN  126

Query  548  GKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            GKV T DGV +V E+GV AYPFT E++K +K+ E    R Q++ ++LVS SR+YVI+
Sbjct  127  GKVLTNDGVRLVSEYGVNAYPFTSEQIKLLKEKELEAKRNQTISSILVSNSRNYVIS  183


 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 101/154 (66%), Gaps = 2/154 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            ++  L S+L S ++D++I  +G ++ V +L GK I +YFSA WC PC  F P L   Y+E
Sbjct  325  ESQTLESLLISGNKDYVIGKNGKKIPVSELVGKNILLYFSAHWCPPCRAFLPKLIQAYDE  384

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K   FEV+F+S+D D++SF+E+F  MPW A+PF D   ++ L+  F ++GIP LV L
Sbjct  385  IKQKDKEFEVIFISSDSDQDSFEEFFSGMPWLALPFGDE-RKKFLNRRFKIQGIPTLVAL  443

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
            + SG   + D   ++  HG +AYPFT ER+K+++
Sbjct  444  NRSGCTVSTDARKLIQSHGADAYPFTEERLKQLE  477


 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 110/176 (63%), Gaps = 2/176 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            + SIL S+ R+++I N G Q+ V +L+GK +G+YFS     PC  FT  L   Y +L  K
Sbjct  169  ISSILVSNSRNYVISNDGTQIPVSELEGKVVGLYFSVYGHEPCDDFTSILVDAYKKLKEK  228

Query  374  GN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            GN FE+V +S D++ + F E    +P  A+PF D   + +L   F +  IP L+I+ + G
Sbjct  229  GNNFEIVLLSLDDEADDFNEALETLPCLALPFQDEKCK-KLIRYFELSDIPTLIIIGQDG  287

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    + V+++ EHG +AYPFT E+++++ + ++A    Q+L+++L+S ++DYVI 
Sbjct  288  KTLHPNAVELIEEHGPDAYPFTPEKIEKLVEIQKAKLESQTLESLLISGNKDYVIG  343



>ref|XP_008221826.1| PREDICTED: probable nucleoredoxin 1 [Prunus mume]
Length=579

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +2

Query  176  NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
            N   H+ RS+L SS RDF++RN+G +VKV+ L+GK +G+YFSASWC PC RFT  L   Y
Sbjct  13   NSKPHNFRSLLSSSQRDFVVRNNGDKVKVESLEGKNLGLYFSASWCSPCQRFTSALVEAY  72

Query  356  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
            NEL PKG+FEVVF+SADED+ESF  YF KMPW A+PFSDS  R+ ++ LF V GIPHLVI
Sbjct  73   NELSPKGDFEVVFISADEDDESFNGYFSKMPWLAIPFSDSEARDCMNELFKVIGIPHLVI  132

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            L E GKV  + GV+I+ E+GV+ YPFT E++KE+ D EE    +QSLKT+LVS  RD+VI
Sbjct  133  LGEDGKVLCDSGVEIIQEYGVDGYPFTPEKIKELNDQEEVHRMDQSLKTILVSHLRDFVI  192

Query  716  A  718
            +
Sbjct  193  S  193


 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 100/153 (65%), Gaps = 2/153 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A  L SIL S DR+F+I   G ++ V DL GK I +YFSA WC PC  F P L   Y+++
Sbjct  336  AQTLESILVSGDRNFVIGKGGTEILVSDLVGKNILLYFSAHWCHPCRAFLPKLVEAYHKI  395

Query  365  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K + FEV+F+S+D+D+  F E+F  MPW A+PF D + +  L   F VRGIP LV + 
Sbjct  396  KAKDDAFEVIFISSDKDQGDFDEFFSGMPWLALPFGD-LRKASLSHRFKVRGIPMLVAIG  454

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
             +G+  T++  D+V++HG  AYPFT ER+KEI+
Sbjct  455  HTGQTVTKEARDLVMQHGANAYPFTEERLKEIE  487


 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 111/178 (62%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L++IL S  RDF+I N G  V V +L+GK +G+YFS S   PC  FTP L  VY +L 
Sbjct  177  QSLKTILVSHLRDFVISNDGKNVPVSELEGKIVGLYFSLSVYSPCVDFTPKLLEVYEKLK  236

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              G +FEVV +  D+DEESFK+ F  MPW ++P  D    E+L   F +  +P LVI+  
Sbjct  237  ANGESFEVVVIPLDDDEESFKQDFKSMPWFSLPIGDK-NVEKLAGYFELSTLPTLVIIGA  295

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK  +++  + + EHGV AYPFT E+  E+ + E+A  + Q+L+++LVS  R++VI 
Sbjct  296  DGKTISKNVAEAIEEHGVLAYPFTPEKFAELIEIEKAKEKAQTLESILVSGDRNFVIG  353



>ref|XP_010937315.1| PREDICTED: probable nucleoredoxin 1-2 [Elaeis guineensis]
Length=519

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 140/185 (76%), Gaps = 1/185 (1%)
 Frame = +2

Query  167  AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  346
            A   G+ HDL+S+L   +RDFL+RN+G QV++ +L+GK IG+YFSASWC PC RFTP L 
Sbjct  11   AVNGGECHDLKSLLAGDERDFLVRNNGDQVRIANLEGKTIGLYFSASWCPPCRRFTPQLI  70

Query  347  TVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
              Y EL  +G   EVVFVS D DE+SF  YF KMPW A+PFSDS  R++L+ LF VRGIP
Sbjct  71   ETYGELSSEGKGLEVVFVSGDRDEDSFNGYFSKMPWLAIPFSDSKARDQLNKLFKVRGIP  130

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
            HLVILD  G+V  E+GV+ V ++G  AYPFTLE++ ++K+ EEA  REQ+L+TVLVS SR
Sbjct  131  HLVILDARGEVVNEEGVEAVRDYGSGAYPFTLEKINKLKEDEEAAKREQTLQTVLVSPSR  190

Query  704  DYVIA  718
            DY+I+
Sbjct  191  DYLIS  195


 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 108/169 (64%), Gaps = 2/169 (1%)
 Frame = +2

Query  167  AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  346
            A+   +A  L S+L S + D++I   G QV V +L GK I +YFSA WCGPC  F P L 
Sbjct  335  AKAKLEAQTLESLLVSGEIDYVIGKDGVQVPVSELNGKTILLYFSARWCGPCRAFLPKLI  394

Query  347  TVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
              Y ++  K + FEVVF+S DED+ SF+++F  MPW A+PF D V ++ L  LF +RGIP
Sbjct  395  EEYKKIKDKDSAFEVVFISDDEDQNSFEDFFSGMPWLALPFGD-VRKKSLSRLFKIRGIP  453

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQ  670
             LV +  +GK  T D   ++L HG +AYPFT ER+KE+ + +E T  EQ
Sbjct  454  SLVAIGPTGKTVTTDAKLLLLIHGADAYPFTEERIKELVENKEKTGEEQ  502


 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 111/179 (62%), Gaps = 5/179 (3%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            L+++L S  RD+LI N+G++V V +L+GK + +YF+ +   PC  FT  LA +Y  L  +
Sbjct  181  LQTVLVSPSRDYLISNNGNKVSVSELEGKIVCLYFTVNGFDPCDEFTVVLAKIYKTLKER  240

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            G +FEVV VS D++E SFKE F  MPW A+PF D  +RERL   F +   P LV+L   G
Sbjct  241  GESFEVVLVSLDDEESSFKEGFASMPWLAIPFEDK-SRERLVRYFELETAPTLVVLGPDG  299

Query  551  KVTTEDGVDIVLEHGVEA---YPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  ++V EHG EA   +PF+ +++  + +  +A    Q+L+++LVS   DYVI 
Sbjct  300  KTLHTNIAELVEEHGEEAWEGFPFSQDKLDLLAEKAKAKLEAQTLESLLVSGEIDYVIG  358



>emb|CBI28542.3| unnamed protein product [Vitis vinifera]
Length=807

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = +2

Query  176  NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
            +G AHDL S+L   DRDFL+RN+GHQVKV+ LKGKKI +YFSASWCGPC RFTP L   Y
Sbjct  7    DGVAHDLVSLLTREDRDFLVRNNGHQVKVESLKGKKIWLYFSASWCGPCRRFTPKLVEAY  66

Query  356  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
            NEL    +FE++FVS D D+ESF  YF KMPW A+PFSDS  R++L+ LF V GIP+LV+
Sbjct  67   NELSSNDDFEIIFVSGDNDDESFHGYFSKMPWLAIPFSDSDARDQLNELFKVMGIPNLVM  126

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            LDESGKV +EDGVDI+ E+GVEAYPFT E++KE+K+ EE   +EQSL+++LVS SRDYVI
Sbjct  127  LDESGKVLSEDGVDIIQEYGVEAYPFTPEKIKEMKEKEETARKEQSLRSILVSQSRDYVI  186

Query  716  AA  721
            + 
Sbjct  187  ST  188


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              LRSIL S  RD++I   G +V V +L+GK +G++FS S    C  FTP L  VY +L 
Sbjct  171  QSLRSILVSQSRDYVISTDGKKVPVSELEGKFVGLFFSLSSYKACLEFTPTLVDVYEKLR  230

Query  368  PKG-NFEVVFVSADED  412
             KG +FE+V +S D++
Sbjct  231  AKGESFEIVMISLDDE  246



>ref|XP_010937313.1| PREDICTED: probable nucleoredoxin 1-2 [Elaeis guineensis]
Length=519

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 140/185 (76%), Gaps = 1/185 (1%)
 Frame = +2

Query  167  AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  346
            A   G+ HDL+S+L   +RDFL+RN+G QV++ +L+GK IG+YFSASWC PC RFTP L 
Sbjct  11   AVNGGECHDLKSLLAGDERDFLVRNNGDQVRIANLEGKTIGLYFSASWCPPCRRFTPQLI  70

Query  347  TVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
              Y EL  +G   EVVFVS D DE+SF  YF KMPW A+PFSDS  R++L+ LF VRGIP
Sbjct  71   ETYGELSSEGKGLEVVFVSGDRDEDSFNGYFSKMPWLAIPFSDSKARDQLNKLFKVRGIP  130

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
            HLVILD  G+V  E+GV+ V ++G  AYPFTLE++ ++K+ EEA  REQ+L+TVLVS SR
Sbjct  131  HLVILDARGEVVNEEGVEAVRDYGSGAYPFTLEKINKLKEDEEAAKREQTLQTVLVSPSR  190

Query  704  DYVIA  718
            DY+I+
Sbjct  191  DYLIS  195


 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 109/169 (64%), Gaps = 2/169 (1%)
 Frame = +2

Query  167  AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  346
            A+   +A  L S+L S + DF+I   G +V V +L GK I +YFSA WCGPC  F P L 
Sbjct  335  AKAKLEAQTLESLLVSGEIDFVIGKDGVKVPVSELNGKTILLYFSARWCGPCRAFLPKLI  394

Query  347  TVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
              Y ++  K + FEVVF+S DED+ SF+++F  MPW A+PF D V ++ L+ LF +RGIP
Sbjct  395  EEYKKIKDKDSAFEVVFISDDEDQNSFEDFFSGMPWLALPFGD-VRKKSLNRLFKIRGIP  453

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQ  670
             LV +  +GK  T D   ++L HG +AYPFT ER+KE+ + +E T  EQ
Sbjct  454  SLVAIGPTGKTVTTDAKLLLLIHGADAYPFTEERIKELVENKEKTGEEQ  502


 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 110/179 (61%), Gaps = 5/179 (3%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            L+++L S  RD+LI N+G++V V +L+GK + +YF+ +   PC  FT  LA +Y  L  +
Sbjct  181  LQTVLVSPSRDYLISNNGNKVSVSELEGKIVCLYFTVNGFDPCDEFTVVLAKIYKTLKER  240

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            G +FEVV VS D++E SFKE F  MPW A+PF D  +RERL   F     P LV+L   G
Sbjct  241  GESFEVVLVSLDDEESSFKEGFASMPWLAIPFEDK-SRERLVHYFEFETPPTLVVLGPDG  299

Query  551  KVTTEDGVDIVLEHGVEA---YPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  ++V EHG EA   +PF+ +++  + +  +A    Q+L+++LVS   D+VI 
Sbjct  300  KTLHTNIAELVEEHGEEAWEGFPFSQDKLDLLAEKAKAKLEAQTLESLLVSGEIDFVIG  358



>ref|XP_009391725.1| PREDICTED: probable nucleoredoxin 1 [Musa acuminata subsp. malaccensis]
Length=591

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 147/195 (75%), Gaps = 4/195 (2%)
 Frame = +2

Query  146  ERKASSMAEQNGD---AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  316
            E  A S  E NG     HDL+S+L S  RDFL+RN+G QVK+ +L GK +G+YFSASWCG
Sbjct  3    EHDAESNGELNGHEETTHDLQSLLASVGRDFLVRNTGDQVKISNLDGKIVGLYFSASWCG  62

Query  317  PCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERL  493
            PC RFTP L   YNEL  + GNFE+VFVSADEDE+SF +YF KMPW A+PFSDS  R+RL
Sbjct  63   PCKRFTPKLVETYNELSSENGNFEIVFVSADEDEKSFTDYFSKMPWFAIPFSDSDIRDRL  122

Query  494  DALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQS  673
            + LF V GIP+LVI D +GKV T  GV +V ++G  AYPFT ER++++K+ EEA  + Q+
Sbjct  123  NDLFDVGGIPYLVIFDVNGKVLTSVGVQVVRDYGSNAYPFTDERIQKLKEEEEAAKQNQT  182

Query  674  LKTVLVSTSRDYVIA  718
            L+++LVS+SRD+VI+
Sbjct  183  LRSLLVSSSRDFVIS  197


 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 117/185 (63%), Gaps = 5/185 (3%)
 Frame = +2

Query  167  AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  346
            A+QN     LRS+L SS RDF+I   G++V V +L+GK +GI+FS S    C  F  +L 
Sbjct  177  AKQN---QTLRSLLVSSSRDFVISKDGNKVPVSELQGKIVGIFFSISSFNSCSEFAKSLK  233

Query  347  TVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
             +Y +L   G NFEVV VS D++E S+++ F  MPW A+PF D +  ++L   F +  IP
Sbjct  234  EMYLKLKENGENFEVVLVSLDDEESSYEQGFADMPWLAIPFKDKIC-DKLVRYFELDSIP  292

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
             LV++   GK    +  +++ EHG+EAYPF+ E+++EI + E+A    Q+L+++L S  +
Sbjct  293  TLVVIGSDGKTLNSNVAELIEEHGIEAYPFSPEKLEEIAEKEKARIEAQTLESLLASGEQ  352

Query  704  DYVIA  718
            DYVI 
Sbjct  353  DYVIG  357


 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 99/167 (59%), Gaps = 4/167 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + FS  K EE      A    +A  L S+L S ++D++I N G +V V +L GK I +YF
Sbjct  320  YPFSPEKLEEIAEKEKARI--EAQTLESLLASGEQDYVIGNGGIRVPVSELVGKNILLYF  377

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+++  K + FE++FVS D DE SF ++F +MPW A+PF D 
Sbjct  378  SAQWCPPCRMFLPKLIEAYHKIKEKDDAFEIIFVSNDRDESSFHDFFSEMPWLALPFGDE  437

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFT  616
              ++ L   F + GIP LV +  +GK  T +  ++V+ HG  AYPFT
Sbjct  438  -RKKFLARTFKIYGIPSLVAIGPTGKTVTTEARELVMTHGAAAYPFT  483



>ref|XP_006302027.1| hypothetical protein CARUB_v10020010mg, partial [Capsella rubella]
 gb|EOA34925.1| hypothetical protein CARUB_v10020010mg, partial [Capsella rubella]
Length=602

 Score =   234 bits (596),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 147/191 (77%), Gaps = 5/191 (3%)
 Frame = +2

Query  161  SMAE-----QNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCH  325
            SMAE       GDA DL+S+L S  RDFL+RN G QVK+D L GKKIG+YFSA+WCGPC 
Sbjct  24   SMAEIAKEVNGGDAQDLQSLLSSPARDFLVRNDGEQVKIDSLIGKKIGLYFSAAWCGPCQ  83

Query  326  RFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  505
            RFTP L  VYNEL  K  FE+VFVS DEDEESF +YF KMPW AVPF+DSVTR+RLD  F
Sbjct  84   RFTPQLVEVYNELASKVGFEIVFVSGDEDEESFSDYFSKMPWLAVPFADSVTRDRLDGFF  143

Query  506  TVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTV  685
             VRGIP+LV++D+ GK+  E+GV ++  +G +AYPFT E++KEIK+ E+   REQ+L ++
Sbjct  144  KVRGIPNLVMVDDHGKLLNENGVGVIRSYGADAYPFTPEKMKEIKEEEDRARREQTLSSL  203

Query  686  LVSTSRDYVIA  718
            LV+ SRD+VI+
Sbjct  204  LVTPSRDFVIS  214


 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 110/175 (63%), Gaps = 4/175 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K EE K    A+   +A  L SIL S D ++++   G +V V DL GK I +YF
Sbjct  337  YPFTPEKFEELKEIEKAKI--EAQTLESILVSGDLNYVLGKDGAKVLVSDLVGKNILMYF  394

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  FTP L  VY ++  +   FE++F+S+D D+ESF EY+ +MPW A+PF D 
Sbjct  395  SAHWCPPCRAFTPKLVEVYKQIKERDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP  454

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +E L   F V GIP L  L ++GK  T++  D+V+ HG +AYPFT ER+KEI+
Sbjct  455  -RKESLARTFKVGGIPMLAALGQTGKTVTKEARDLVVAHGADAYPFTEERLKEIE  508


 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 107/176 (61%), Gaps = 2/176 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            L S+L +  RDF+I   G++V V +L+G+ IG+ FS +    C  FTP L  VY +L  +
Sbjct  200  LSSLLVTPSRDFVISPDGNKVPVSELEGRTIGLLFSVASYSKCREFTPKLVEVYTKLKER  259

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
              +FE+V +S ++DEESF + F   PW A+PF+D  +  +L   F +  +P LVIL   G
Sbjct  260  TEDFEIVLISLEDDEESFNQDFKTKPWLALPFNDK-SSSKLARHFMLSTLPTLVILGPDG  318

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  + + ++G+  YPFT E+ +E+K+ E+A    Q+L+++LVS   +YV+ 
Sbjct  319  KTRHMNVAEAIDDYGILPYPFTPEKFEELKEIEKAKIEAQTLESILVSGDLNYVLG  374



>ref|XP_010682547.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=356

 Score =   227 bits (578),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 140/179 (78%), Gaps = 4/179 (2%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            HDL SILCSS+R+FL RN+GHQV VD LKGK + +YFSASWCG C RFTP L  VYNEL 
Sbjct  6    HDLGSILCSSNRNFLCRNNGHQVSVDTLKGKIVALYFSASWCGLCCRFTPILIEVYNELT  65

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             +G +FEVVF++AD+D+ESF  YF KMPW A+PFSDS TR++LD +F V G+PH VILDE
Sbjct  66   SQGKDFEVVFITADDDDESFDNYFSKMPWLAIPFSDSETRDKLDDMFKVDGLPHFVILDE  125

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            +GKV T+DGV I+ ++  + YPFT ER++ +K  EE T   ++LK++L S SR++V++A
Sbjct  126  TGKVLTDDGVAIIQDYEAQGYPFTPERIQILKKQEETT---RTLKSILASDSRNFVLSA  181


 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 111/185 (60%), Gaps = 2/185 (1%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            + +Q      L+SIL S  R+F++  +G +V V +L+G+ IG+YFS S    C +F P L
Sbjct  156  LKKQEETTRTLKSILASDSRNFVLSANGKKVLVSELEGRTIGLYFSLSTYRSCMQFNPVL  215

Query  344  ATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
               Y EL  KG NFE+V +  DEDEE FK+ F  MPW ++P  D  +  +L   F +  +
Sbjct  216  IDFYEELKAKGENFEIVLIPLDEDEELFKQGFASMPWYSLPVKDK-SCVKLARYFDLSTL  274

Query  521  PHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTS  700
            P LVI+   G+    +G + + +HGVEAYPFT ER KE+   E+A    Q+L+++LVS  
Sbjct  275  PTLVIVGPDGRTLHYNGREAIEDHGVEAYPFTPERFKELAQIEKARQEAQTLESILVSGK  334

Query  701  RDYVI  715
             D+VI
Sbjct  335  LDFVI  339



>ref|XP_004141529.1| PREDICTED: probable nucleoredoxin 1 [Cucumis sativus]
 gb|KGN52625.1| hypothetical protein Csa_5G647470 [Cucumis sativus]
Length=562

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 135/177 (76%), Gaps = 0/177 (0%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            HDL S++ S  RDFLIRN+G QVK+  L GK +G+YFSASWC PC RFTP  A VY E+ 
Sbjct  7    HDLSSLVSSEGRDFLIRNNGDQVKISSLIGKNVGLYFSASWCPPCRRFTPVFAGVYEEVA  66

Query  368  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  547
            PKG FEV+F+S+D DE+SFK+YF KMPW + PFSDS   +RL  LF VRGIP LV+LD S
Sbjct  67   PKGEFEVIFISSDRDEDSFKDYFSKMPWLSFPFSDSEIVKRLKELFEVRGIPRLVVLDPS  126

Query  548  GKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            GKV+T+ GV +V EHG+ AYPFT E+++ +K+ EE   R Q++ ++LVS SRDYVI+
Sbjct  127  GKVSTDQGVRLVTEHGISAYPFTAEQIQHLKEEEEEARRNQTISSLLVSNSRDYVIS  183


 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 105/170 (62%), Gaps = 4/170 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F++ K +E   + + +   ++  L SIL   ++DF+I   G +V V +L GKKI +YF
Sbjct  306  YPFTQEKLDE--LAEIEKSKLESQTLESILVHGEKDFVIGKDGAKVPVSELVGKKILLYF  363

Query  299  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   YNE+  K   FEV+F+S+D D+ SF+E+F  MPW A+PF D 
Sbjct  364  SAHWCPPCRSFLPKLIESYNEIKQKYKEFEVIFISSDRDDNSFQEFFSGMPWLALPFGDE  423

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLER  625
              +  L+  F ++GIP +V ++ESG+  + +   ++ EHG  AYPFT ER
Sbjct  424  -RKNFLNRRFKIQGIPAVVAINESGRTVSTEARKLITEHGANAYPFTEER  472


 Score =   140 bits (353),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 108/176 (61%), Gaps = 2/176 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            + S+L S+ RD++I N G+Q+ V +L+GK IG+YFS      C  FTP L   Y +L  K
Sbjct  169  ISSLLVSNSRDYVISNDGNQIPVSELEGKVIGLYFSVYGYADCDEFTPILVDTYKKLKEK  228

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            G NFE+V +S D+  + F E    +PW A+PF D   R +L   F +  IP LVI+ + G
Sbjct  229  GQNFEIVLISLDDANKDFSEALKTVPWLALPFQDEKCR-KLTRYFDLSTIPTLVIIGQDG  287

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  ++V EHGV+AYPFT E++ E+ + E++    Q+L+++LV   +D+VI 
Sbjct  288  KTLISNAAELVEEHGVDAYPFTQEKLDELAEIEKSKLESQTLESILVHGEKDFVIG  343



>emb|CAC87937.1| PDI-like protein [Quercus suber]
Length=506

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = +2

Query  176  NGD----AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            NGD    +HDL S+L S +RD+L+RN+G QVK+ +L GK +G+YFS SWCGPC  FTPNL
Sbjct  3    NGDVDNVSHDLISLLSSEERDYLVRNNGDQVKISNLIGKTVGLYFSGSWCGPCCHFTPNL  62

Query  344  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
              VY ELLPKG+FEVVF+S+D ++ESF  Y  KMPW A+PFSDS TR+RL  LF VRGIP
Sbjct  63   VEVYEELLPKGDFEVVFISSDRNDESFNGYLAKMPWLAIPFSDSETRKRLKELFKVRGIP  122

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
            +L+ LD +GKV T  GV I+ E+GV+ YPFT ER+  +K+ EE   + QSL T+LV  SR
Sbjct  123  NLIFLDATGKVVTNQGVRIIGEYGVDGYPFTTERINFLKEEEENAKKNQSLSTILVHGSR  182

Query  704  DYVIA  718
             ++++
Sbjct  183  SHLVS  187


 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 99/168 (59%), Gaps = 2/168 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L +IL S + DF+I  SG +V V +L GK I +YFSA WC PC  F P L   YNE
Sbjct  327  EAQTLETILVSEESDFVIDKSGSKVLVSELVGKNILLYFSAHWCPPCRAFLPKLVKAYNE  386

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K N FE++F+S+D D+ SF E+F  MPW A+PF D   +  L   F ++GIP  V +
Sbjct  387  IKEKDNAFEIIFISSDRDQSSFDEFFAGMPWLALPFGDK-RKSFLARKFKIQGIPAAVAI  445

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKT  682
              SG+  T++   ++  HG +AYPFT + +K + +  E   +E   K 
Sbjct  446  GPSGRTVTKEARQLITAHGADAYPFTEDHLKRLVEKAEEVAKEDEKKA  493


 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 106/177 (60%), Gaps = 4/177 (2%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L +IL    R  L+ N G+ V + +L+GK +G+YFS      C  FTP L  VY +L 
Sbjct  171  QSLSTILVHGSRSHLVSNDGNGVPIPELEGKTVGLYFSIKRL--CLDFTPKLVEVYKKLK  228

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             +G +FE+V +S D++E  FKE F  MPW AVPF D    E+L   F +  +P +V++  
Sbjct  229  ERGESFEIVLISLDDEENDFKEGFNTMPWLAVPFKDKCC-EKLARYFDLETLPTVVVIGP  287

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
             GK    +  +++ EHG+EAYPFT E++ E+ + E+A    Q+L+T+LVS   D+VI
Sbjct  288  DGKTLNPNVAELIEEHGIEAYPFTPEKLAELAEIEKARLEAQTLETILVSEESDFVI  344



>gb|AAS02080.1| protein disulfide isomerase [Quercus suber]
Length=506

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = +2

Query  176  NGD----AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            NGD    +HDL S+L S +RD+L+RN+G QVK+ +L GK +G+YFS SWCGPC  FTPNL
Sbjct  3    NGDVDNVSHDLISLLSSEERDYLVRNNGDQVKISNLIGKTVGLYFSGSWCGPCCHFTPNL  62

Query  344  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
              VY ELLPKG+FEVVF+S+D ++ESF  Y  KMPW A+PFSDS TR+RL  LF VRGIP
Sbjct  63   VEVYEELLPKGDFEVVFISSDRNDESFNGYLAKMPWLAIPFSDSETRKRLKELFKVRGIP  122

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
            +L+ LD +GKV T  GV I+ E+GV+ YPFT ER+  +K+ EE   + QSL T+LV  SR
Sbjct  123  NLIFLDATGKVVTNQGVRIIGEYGVDGYPFTTERINFLKEEEENAKKNQSLSTILVHGSR  182

Query  704  DYVIA  718
             ++++
Sbjct  183  SHLVS  187


 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 99/168 (59%), Gaps = 2/168 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L +IL S + DF+I  SG +V V +L GK I +YFSA WC PC  F P L   YNE
Sbjct  327  EAQTLETILVSEESDFVIDKSGSKVLVSELVGKNILLYFSAHWCPPCRAFLPKLVKAYNE  386

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K N FE++F+S+D D+ SF E+F  MPW A+PF D   +  L   F ++GIP  V +
Sbjct  387  IKEKDNAFEIIFISSDRDQSSFDEFFAGMPWLALPFGDK-RKSFLARKFKIQGIPAAVAI  445

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKT  682
              SG+  T++   ++  HG +AYPFT + +K + +  E   +E   K 
Sbjct  446  GPSGRTVTKEARQLITAHGADAYPFTEDHLKRLVEKAEEVAKEDEKKA  493


 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 107/177 (60%), Gaps = 4/177 (2%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L +IL    R  L+ N G++V + +L+GK +G+YFS      C  FTP L  VY +L 
Sbjct  171  QSLSTILVHGSRSHLVSNDGNEVPIPELEGKTVGLYFSIKRL--CLDFTPKLVEVYKKLK  228

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             +G +FE+V +S D++E  FKE F  MPW AVPF D    E+L   F +  +P +V++  
Sbjct  229  ERGESFEIVLISLDDEENDFKEGFNTMPWLAVPFKDKCC-EKLARYFDLETLPTVVVIGP  287

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
             GK    +  +++ EHG+EAYPFT E++ E+ + E+A    Q+L+T+LVS   D+VI
Sbjct  288  DGKTLNPNVAELIEEHGIEAYPFTPEKLAELAEIEKARLEAQTLETILVSEESDFVI  344



>ref|XP_010682544.1| PREDICTED: probable nucleoredoxin 1 [Beta vulgaris subsp. vulgaris]
Length=514

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 142/190 (75%), Gaps = 4/190 (2%)
 Frame = +2

Query  164  MAEQN----GDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRF  331
            MAE+N     + +DL S+  S +RDFLIRN+G +V + DL GK +G+YFSASWC PC  F
Sbjct  1    MAEENSINNNECYDLSSLFSSEERDFLIRNNGDKVNIKDLSGKILGLYFSASWCPPCRGF  60

Query  332  TPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            TP+L  VY EL  KG+FE+VF+S+D DEESF+ YF KMPW A+P SD+ T + L   F+V
Sbjct  61   TPSLIEVYKELSSKGDFEIVFISSDRDEESFQGYFSKMPWLAIPLSDNATIKSLKEKFSV  120

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
             GIPHLV LD+ GK++T++GV++V+EH  EAYPFT ER+ ++K+ EEA  R Q+L+ +LV
Sbjct  121  MGIPHLVFLDKDGKISTDEGVEVVMEHEAEAYPFTSERIDQLKEEEEAAKRNQNLRNLLV  180

Query  692  STSRDYVIAA  721
              SRDYVI++
Sbjct  181  YGSRDYVISS  190


 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 116/198 (59%), Gaps = 6/198 (3%)
 Frame = +2

Query  128  SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  307
            S+R  + ++    A++N    +LR++L    RD++I +   +V V +L+GK +G+YF   
Sbjct  156  SERIDQLKEEEEAAKRN---QNLRNLLVYGSRDYVISSDETKVSVTELEGKMVGLYFCVG  212

Query  308  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEES-FKEYFGKMPWTAVPFSDSVT  481
               PC  FT  L  VY +L  +G NFE+V +  DED+E  FKE    MPW ++PF D   
Sbjct  213  PYEPCTVFTQKLVEVYKKLREEGENFEIVLIYLDEDDEGGFKENLADMPWLSLPFKDKKI  272

Query  482  RERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*  661
             E+L   F +R IP LVI+   GK    D  +++ EHG  AYPF+ E++ E+ + E+A  
Sbjct  273  -EKLVRYFELRSIPRLVIIGPDGKTLNPDVAELIQEHGAAAYPFSSEKLAELAEIEKAKL  331

Query  662  REQSLKTVLVSTSRDYVI  715
              Q+L+++LV   +DYVI
Sbjct  332  ESQTLESILVHGEKDYVI  349


 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 93/153 (61%), Gaps = 2/153 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            ++  L SIL   ++D++I  SG +V V  L GK + IYFSA WC PC  FTP L   Y+E
Sbjct  332  ESQTLESILVHGEKDYVIDKSGSKVPVSQLVGKHVLIYFSAHWCPPCRAFTPKLIETYHE  391

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K + FE++FVS+D D+ SF EY+  MPW A+PF D   +  L   F V+GIP LV +
Sbjct  392  IKAKESAFEIIFVSSDRDQPSFDEYYSDMPWLALPFGDE-RKAYLSRKFKVKGIPCLVAI  450

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEI  637
               GK  T +   ++  HG +A+PFT   +K++
Sbjct  451  GPEGKTITTETRQLIGAHGADAFPFTENHMKKL  483



>ref|XP_010937316.1| PREDICTED: probable nucleoredoxin 1-1 [Elaeis guineensis]
Length=614

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 136/185 (74%), Gaps = 1/185 (1%)
 Frame = +2

Query  167  AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  346
            A   G+ HDL+SIL   +RDFLI N+G QVK+ +L+GK +G+YFSASWC PC  FTP L 
Sbjct  40   ASDGGECHDLKSILAGDERDFLIHNNGDQVKIANLEGKTVGLYFSASWCPPCRGFTPKLI  99

Query  347  TVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
              Y EL  +G +FEVVFVS D DE+SF  YF KMPW A+PFSDS  R+RLD LF VRGIP
Sbjct  100  ETYGELSSEGKDFEVVFVSGDRDEDSFNGYFSKMPWLAIPFSDSKARDRLDELFKVRGIP  159

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
            HLVIL   G+V  E GV  V E+G E YPFT E++ ++K+ EEA  REQ+L+TVLVS SR
Sbjct  160  HLVILGARGEVLNEKGVPAVREYGSEGYPFTPEKINKLKEDEEAAKREQTLQTVLVSPSR  219

Query  704  DYVIA  718
            DY+I+
Sbjct  220  DYLIS  224


 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 111/176 (63%), Gaps = 4/176 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            F FS+ K +    +  A+   +A  L S+L S + D++I   G +V V +L GK I +YF
Sbjct  350  FPFSQDKMD--MLAEKAKAKLEAQTLESLLVSGELDYVIGKDGVKVPVSELIGKNILLYF  407

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WCGPC  F P L   YN++  K + FE+VFVS+D D+ SF+++F  MPW A+PF D 
Sbjct  408  SAKWCGPCRAFLPKLVEEYNKIKEKDSAFELVFVSSDRDQNSFEDFFSGMPWLALPFGDE  467

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKD  643
              ++ L  LF +RGIP LV +  +GK  T D   +++ HG +AYPFT ER+KE++D
Sbjct  468  -RKKTLSRLFKIRGIPSLVAIGPTGKTVTTDARHLLMIHGADAYPFTEERIKELED  522


 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 108/179 (60%), Gaps = 5/179 (3%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            L+++L S  RD+LI N G++V V +L+GK + +YF+ +   PC  FT  L  +Y +L  +
Sbjct  210  LQTVLVSPSRDYLISNDGNKVSVSELEGKIVCLYFTINGMKPCDEFTLVLGKIYRKLKER  269

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            G +FEVV VS D++E SFK  F  MPW A+PF D     +L   F +R +P LV+L   G
Sbjct  270  GESFEVVMVSLDDEESSFKGGFATMPWLAIPFQDKSCG-KLVRYFELRTVPTLVVLGADG  328

Query  551  KVTTEDGVDIVLEHGVEA---YPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  ++V EHG EA   +PF+ +++  + +  +A    Q+L+++LVS   DYVI 
Sbjct  329  KTLHSNIAEVVEEHGEEAWEGFPFSQDKMDMLAEKAKAKLEAQTLESLLVSGELDYVIG  387



>emb|CDY60573.1| BnaC01g43180D [Brassica napus]
Length=578

 Score =   228 bits (580),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 144/181 (80%), Gaps = 0/181 (0%)
 Frame = +2

Query  173  QNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATV  352
              GDA DL S+L S  RDFLIR +G QVK+D LKGKKIG+YFSA+WCGPC RFTP L  +
Sbjct  9    NGGDARDLHSLLFSPARDFLIRKNGEQVKIDSLKGKKIGLYFSAAWCGPCQRFTPQLVEI  68

Query  353  YNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLV  532
            YNEL  K  FEVVFVS DEDE+SFK+YF KMPW AVPF+DS TR+RLD +F VRGIP+LV
Sbjct  69   YNELSSKVGFEVVFVSGDEDEDSFKDYFSKMPWLAVPFTDSETRDRLDEVFKVRGIPNLV  128

Query  533  ILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYV  712
            ++D+ GK+  E+GV ++  +G +AYPFT E++KEIK+ EE   REQ+LK+VLV+ SRD+V
Sbjct  129  MIDDEGKLVNENGVGVIRSYGADAYPFTPEKMKEIKEEEERARREQTLKSVLVTPSRDFV  188

Query  713  I  715
            I
Sbjct  189  I  189


 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 108/175 (62%), Gaps = 4/175 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K EE KA   A+   +A  L S+L S D ++++   G +V V +L GK I +YF
Sbjct  313  YPFTPEKFEELKAIEKAKL--EAQTLESLLVSGDLNYVLGKDGAKVLVSELVGKNILLYF  370

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  FTP L  VY ++  K   FE++F+S+D D+ESF EY+ +MPW A+PF D 
Sbjct  371  SAHWCPPCRAFTPKLVEVYKQIKEKDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP  430

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +  L   F V GIP L  L  +GK  T++  D+V  HG +AYPFT ERVKEI+
Sbjct  431  -RKTSLARTFKVGGIPMLAALGPTGKTVTKEARDLVGAHGADAYPFTEERVKEIE  484


 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 107/176 (61%), Gaps = 2/176 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            L+S+L +  RDF+I   G++V V +L+GK IG+ FS +    C  FT  L  VY +L   
Sbjct  176  LKSVLVTPSRDFVITRDGNKVPVSELEGKTIGLLFSVASYRQCKEFTSKLEEVYKKLKEN  235

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
              +FE+V +S ++DE++FK+ F   PW A+PF+D  +  +L   F +  +P LVIL   G
Sbjct  236  NEDFEIVLISLEDDEDAFKQDFDTNPWLALPFNDK-SSSKLTRHFMLSTLPTLVILGPDG  294

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  + + ++GV AYPFT E+ +E+K  E+A    Q+L+++LVS   +YV+ 
Sbjct  295  KTRHSNVAEAIDDYGVVAYPFTPEKFEELKAIEKAKLEAQTLESLLVSGDLNYVLG  350



>emb|CDP13168.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +HD+ S+L S +RDFL+RN+G QVK++ L GK +G+YFS SWCGPC RFTPNL  VYNEL
Sbjct  11   SHDITSLLSSPERDFLVRNNGDQVKIESLIGKAVGLYFSGSWCGPCLRFTPNLVQVYNEL  70

Query  365  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
                +FEVVFVS+D DEESF  YF KMPW A PF++S TR+ L  LF VRGIPHLVILD 
Sbjct  71   SSNADFEVVFVSSDRDEESFNAYFKKMPWLAFPFAESETRQSLKELFKVRGIPHLVILDG  130

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            SG+V+TE+GV I+ +HG + YP+T E++ ++K+ EE   REQSL ++L   SRDY+I+
Sbjct  131  SGRVSTEEGVRIIYDHGADGYPYTPEKINDLKEEEERARREQSLMSILTHDSRDYLIS  188


 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 101/165 (61%), Gaps = 2/165 (1%)
 Frame = +2

Query  152  KASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRF  331
            K + + +   +A  L SIL S+D+DF+I   G +V V +L GK + +YFSA WC PC  F
Sbjct  320  KLAEIEKAKLEAQTLESILISADKDFVISKDGSKVPVSELVGKNVLLYFSAHWCPPCRHF  379

Query  332  TPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFT  508
             P    VY E+  K + FEV+F+S+D ++ SF ++F  MPW A+PF D   +  L   F 
Sbjct  380  LPRFIAVYEEIKAKDDAFEVIFISSDHNQSSFDDFFSGMPWLALPFGDE-RKALLQRRFK  438

Query  509  VRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKD  643
            ++GIP +V +  +G+  +     ++  HG +AYPFT ERVK++++
Sbjct  439  IKGIPAVVAIGPNGRTVSTQARQLIQAHGADAYPFTEERVKQLEE  483


 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 108/178 (61%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L SIL    RD+LI N G+++ V +L+GK +G+YFS S    C  FT  L  VY +L 
Sbjct  172  QSLMSILTHDSRDYLISNDGNKIPVSELEGKTVGLYFSVSSHRGCLHFTDRLLEVYKKLR  231

Query  368  PKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             KG  FE+V VS D+DE+ FK  +  M W A+PF D  T ++L   F +  +P LV++  
Sbjct  232  EKGEAFELVLVSLDDDEQEFKNCYEPMTWLALPFKDK-TCDKLVRHFELGTLPTLVVIGP  290

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK    + V+ + EHG EAYPFT E+  ++ + E+A    Q+L+++L+S  +D+VI+
Sbjct  291  DGKTLHSNVVESIEEHGDEAYPFTPEKFAKLAEIEKAKLEAQTLESILISADKDFVIS  348



>ref|XP_010473222.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Camelina sativa]
 ref|XP_010473223.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Camelina sativa]
Length=578

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 140/182 (77%), Gaps = 0/182 (0%)
 Frame = +2

Query  173  QNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATV  352
              GDA DL S+L S  RDFL+RN G QVK+D L GKKIG+YFSA+WCGPC RFTP L  V
Sbjct  9    NGGDAQDLLSLLSSPARDFLVRNDGEQVKIDSLIGKKIGLYFSAAWCGPCQRFTPQLVEV  68

Query  353  YNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLV  532
            YNEL PK  FEVVFVS DED+ESF +YF KMPW AVPF+DS TR+RLD LF V GIP+LV
Sbjct  69   YNELAPKVGFEVVFVSGDEDQESFADYFSKMPWLAVPFADSETRDRLDGLFKVTGIPNLV  128

Query  533  ILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYV  712
            ++D+ GK+   +GV ++  +G  AYPFT E++KEIK+ E+   REQ+L +VLV+ SRD+V
Sbjct  129  MVDDHGKLVNGNGVGVIRSYGAGAYPFTPEKMKEIKEEEDRARREQTLSSVLVTPSRDFV  188

Query  713  IA  718
            ++
Sbjct  189  VS  190


 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 98/154 (64%), Gaps = 2/154 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A    S+L S D ++++   G +V V DL GK I +YFSA WC PC  FTP L  +Y +
Sbjct  332  EAQTTESLLVSGDLNYVLGKDGAKVLVSDLVGKNILMYFSAHWCPPCRAFTPELVEIYKQ  391

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  +   FE++F+S+D D+ESF EY+ +MPW A+PF D   +E L   F V GIP L  L
Sbjct  392  IKERDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP-RKESLARTFKVGGIPMLAAL  450

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +GK  T++  D+V  HG +AYPFT ER+KEI+
Sbjct  451  GPTGKTVTKEARDLVAIHGADAYPFTEERLKEIE  484


 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 106/176 (60%), Gaps = 2/176 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP-  370
            L S+L +  RDF++   G++V V +L+GK IG+ FS +    C  FTP L   Y +L   
Sbjct  176  LSSVLVTPSRDFVVSPDGNKVPVSELEGKTIGLLFSVASYSKCSEFTPTLVEFYTKLKEN  235

Query  371  KGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            K +FE+V +S ++DEESF + F   PW A+PF+D  +  +L   F +  +P LVIL   G
Sbjct  236  KEDFEIVLISLEDDEESFNQDFKSKPWLALPFNDK-SSSKLARHFMLSTLPTLVILGPDG  294

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  + + ++G+ AYPFT E+ KE+++ E+A    Q+ +++LVS   +YV+ 
Sbjct  295  KTRHLNVAEAIDDYGLLAYPFTPEKFKELEEIEKAKIEAQTTESLLVSGDLNYVLG  350



>gb|EYU22494.1| hypothetical protein MIMGU_mgv1a005241mg [Erythranthe guttata]
Length=492

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 136/189 (72%), Gaps = 1/189 (1%)
 Frame = +2

Query  158  SSMAEQNGDA-HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            S +   NGDA +DL SIL S +RD+L+RN+G QVK D  KGK IG+YFS SWCGPC  FT
Sbjct  3    SELEIANGDATYDLSSILSSPNRDYLVRNNGDQVKFDSFKGKIIGVYFSGSWCGPCQWFT  62

Query  335  PNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  514
            P L  VYNE     NFE+VFVS D D+ESF  YF KMPW A+PFSDS TRE+L+ LF V 
Sbjct  63   PKLVEVYNERAQSNNFEIVFVSRDADDESFDAYFSKMPWLAIPFSDSDTREKLNELFGVS  122

Query  515  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVS  694
             IPHLVIL E GK+ T +GV +++E+G + YPFT E++++++   E     QSLK++LV+
Sbjct  123  EIPHLVILYEDGKILTSEGVRVIVENGSDGYPFTSEQIEKLRKQREEAKMNQSLKSLLVT  182

Query  695  TSRDYVIAA  721
             SRDYVI +
Sbjct  183  ESRDYVITS  191


 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 100/155 (65%), Gaps = 4/155 (3%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L S+L + D D++I   G ++ V DL GK I +YFSA WC PC  F+P L   Y E
Sbjct  332  EAQTLESLLVNQDSDYVIGEDGVKIPVSDLIGKDILLYFSAHWCPPCRAFSPTLTKAYEE  391

Query  362  LLPKGN--FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
             + K N   EV+F+S+D D+++F++YF +MPW A+PF D   +E L + F V GIP LV 
Sbjct  392  -INKNNKRLEVIFISSDIDQKAFEDYFSEMPWLALPFGDK-RKESLSSWFKVEGIPTLVA  449

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
            L  +GK  + D   +++ HG EAYPFT ER++EI+
Sbjct  450  LGPTGKTVSTDARGLIMAHGAEAYPFTRERIEEIE  484


 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 114/191 (60%), Gaps = 5/191 (3%)
 Frame = +2

Query  149  RKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHR  328
            RK    A+ N     L+S+L +  RD++I + G +V V +L+GK +G+YF  +    C  
Sbjct  164  RKQREEAKMN---QSLKSLLVTESRDYVITSDGKKVPVAELEGKTVGLYFVFATVYECLH  220

Query  329  FTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  505
            F P L  VYN L   G +FE+V V  DEDE+SF E F K+PW ++P +D     +L   F
Sbjct  221  FNPKLIKVYNSLREGGESFEIVMVPLDEDEDSFSEEFEKLPWLSLPINDKCCL-KLARYF  279

Query  506  TVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTV  685
             +  IP +VI+  +GK    + V+ + EHGV+AYPFT E+  E+++ E+A    Q+L+++
Sbjct  280  ELGAIPTVVIISPNGKTLQSNVVEAIEEHGVKAYPFTPEKFAELEEIEKAKREAQTLESL  339

Query  686  LVSTSRDYVIA  718
            LV+   DYVI 
Sbjct  340  LVNQDSDYVIG  350



>gb|KDO82402.1| hypothetical protein CISIN_1g008336mg [Citrus sinensis]
Length=551

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +2

Query  251  QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKE  430
            +VK+D LKGK IG+YFSASWCGPC RFTP LA VYNEL  +G+FEV+FVS DED+E+FK 
Sbjct  12   RVKLDSLKGK-IGLYFSASWCGPCQRFTPILAEVYNELSRQGDFEVIFVSGDEDDEAFKG  70

Query  431  YFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYP  610
            YF KMPW AVPFSDS TR++LD LF V GIPHLVILDE+GKV ++ GV+I+ E+GVE YP
Sbjct  71   YFSKMPWLAVPFSDSETRDKLDELFKVMGIPHLVILDENGKVLSDGGVEIIREYGVEGYP  130

Query  611  FTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            FT+ER+KE+K+ EE   REQSL++VL S SRD+VI++
Sbjct  131  FTVERIKEMKEQEERAKREQSLRSVLTSHSRDFVISS  167


 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 113/189 (60%), Gaps = 5/189 (3%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            M EQ   A     LRS+L S  RDF+I + G ++ V DL+GK IG+YFS S       FT
Sbjct  139  MKEQEERAKREQSLRSVLTSHSRDFVISSDGRKISVSDLEGKTIGLYFSMSSYKASAEFT  198

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  VY +L  KG +FE+V +S D++EESFK   G MPW A+PF D  +RE+L   F +
Sbjct  199  PRLVEVYEKLKGKGESFEIVLISLDDEEESFKRDLGSMPWLALPFKDK-SREKLARYFEL  257

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
              +P LVI+   GK    +  + + EHGV A+PFT E+  E+ + + A    Q+L++VLV
Sbjct  258  STLPTLVIIGPDGKTLHSNVAEAIEEHGVGAFPFTPEKFAELAEIQRAKEESQTLESVLV  317

Query  692  STSRDYVIA  718
            S   D+V+ 
Sbjct  318  SGDLDFVVG  326


 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 104/174 (60%), Gaps = 4/174 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            F F+  K  E      A++  ++  L S+L S D DF++  +G +V V DL GK I +YF
Sbjct  289  FPFTPEKFAELAEIQRAKE--ESQTLESVLVSGDLDFVVGKNGGKVPVSDLAGKTILLYF  346

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y ++  +  + EVVF+S+D D+ SF E+F  MPW A+PF D+
Sbjct  347  SAHWCPPCRAFLPKLIDAYKKIKERNESLEVVFISSDRDQTSFDEFFKGMPWLALPFGDA  406

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEI  637
              +  L   F V GIP LV +  SG+  T++  D++  HG EAYPFT ER+KEI
Sbjct  407  -RKASLSRKFKVSGIPMLVAIGPSGRTITKEARDMIAVHGAEAYPFTEERMKEI  459



>ref|XP_009103743.1| PREDICTED: probable nucleoredoxin 1 [Brassica rapa]
Length=578

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 144/181 (80%), Gaps = 0/181 (0%)
 Frame = +2

Query  173  QNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATV  352
              GDA DL S+L S  RDFLIRN+G QVK++ LKGKKIG+YFSA+WCGPC RFTP L  +
Sbjct  9    NGGDARDLHSLLSSPARDFLIRNNGEQVKIESLKGKKIGLYFSAAWCGPCQRFTPQLVDI  68

Query  353  YNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLV  532
            YNEL     FEVVFVS DEDE+SFK+YF KMPW AVPF+DS TR+RLD +F VRGIP+LV
Sbjct  69   YNELSSNVGFEVVFVSGDEDEDSFKDYFSKMPWLAVPFTDSETRDRLDEVFKVRGIPNLV  128

Query  533  ILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYV  712
            ++D+ GK+  E+GV ++  +G +AYPFT E++KEIK+ EE   REQ+L++VLV+ SRD+V
Sbjct  129  MIDDEGKLVNENGVGVIRSYGADAYPFTPEKMKEIKEEEERARREQTLRSVLVTPSRDFV  188

Query  713  I  715
            I
Sbjct  189  I  189


 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 108/175 (62%), Gaps = 4/175 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K EE KA   A+   +A  L S+L S D ++++   G +V V +L GK I +YF
Sbjct  313  YPFTPEKFEELKAIEKAKL--EAQTLESLLVSGDLNYVLGKDGAKVLVSELVGKNILLYF  370

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  FTP L  VY ++  K   FE++F+S+D D+ESF EY+ +MPW A+PF D 
Sbjct  371  SAHWCPPCRGFTPKLVEVYKQIKEKDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP  430

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +  L   F V GIP L  L  +GK  T++  D+V  HG +AYPFT ERVKEI+
Sbjct  431  -RKTSLARTFKVGGIPMLAALGPTGKTVTKEARDLVGAHGADAYPFTEERVKEIE  484


 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 106/176 (60%), Gaps = 2/176 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            LRS+L +  RDF+I   G++V V  L+GK IG+ FS +    C  FT  L  VY +L   
Sbjct  176  LRSVLVTPSRDFVITRDGNKVPVSQLEGKTIGLLFSVASYRQCKEFTSKLEEVYKKLKEN  235

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
              +FE+V +S ++DEE+FK+ F   PW A+PF+D  +  +L   F +  +P LVIL   G
Sbjct  236  NEDFEIVLISLEDDEEAFKQDFETNPWLALPFNDK-SSSKLTRHFMLSTLPTLVILGPDG  294

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  + + ++GV AYPFT E+ +E+K  E+A    Q+L+++LVS   +YV+ 
Sbjct  295  KTRHSNVAEAIDDYGVVAYPFTPEKFEELKAIEKAKLEAQTLESLLVSGDLNYVLG  350



>emb|CDY24527.1| BnaA01g22310D [Brassica napus]
Length=578

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 144/181 (80%), Gaps = 0/181 (0%)
 Frame = +2

Query  173  QNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATV  352
              GDA DL S+L S  RDFLIRN+G QVK++ LKGKKIG+YFSA+WCGPC RFTP L  +
Sbjct  9    NGGDARDLHSLLSSPARDFLIRNNGEQVKIESLKGKKIGLYFSAAWCGPCQRFTPQLVDI  68

Query  353  YNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLV  532
            YNEL     FEVVFVS DEDE+SFK+YF KMPW AVPF+DS TR+RLD +F VRGIP+LV
Sbjct  69   YNELSSNVGFEVVFVSGDEDEDSFKDYFSKMPWLAVPFTDSETRDRLDEVFKVRGIPNLV  128

Query  533  ILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYV  712
            ++D+ GK+  E+GV ++  +G +AYPFT E++KEIK+ EE   REQ+L++VLV+ SRD+V
Sbjct  129  MIDDEGKLVNENGVGVIRSYGADAYPFTPEKMKEIKEEEERARREQTLRSVLVTPSRDFV  188

Query  713  I  715
            I
Sbjct  189  I  189


 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 108/175 (62%), Gaps = 4/175 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K EE KA  + +   +A  L S+L S D ++++   G +V V +L GK I +YF
Sbjct  313  YPFTPEKFEELKA--IEKGKLEAQTLESLLVSGDLNYVLGKDGAKVLVSELVGKNILLYF  370

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  FTP L  VY ++  K   FE++F+S+D D+ESF EY+ +MPW A+PF D 
Sbjct  371  SAHWCPPCRGFTPKLVEVYKQIKEKDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP  430

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +  L   F V GIP L  L  +GK  T++  D+V  HG +AYPFT ERVKEI+
Sbjct  431  -RKTSLARTFKVGGIPMLAALGPTGKTVTKEARDLVGAHGADAYPFTEERVKEIE  484


 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 105/176 (60%), Gaps = 2/176 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            LRS+L +  RDF+I   G++V V  L+GK IG+ FS +    C  FT  L  VY +L   
Sbjct  176  LRSVLVTPSRDFVITRDGNKVPVSQLEGKTIGLLFSVASYRQCKEFTSKLEEVYQKLKEN  235

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
              +FE+V +S ++DEE+FK+ F   PW A+PF+D  +  +L   F +  +P LVIL   G
Sbjct  236  NEDFEIVLISLEDDEEAFKQDFETNPWLALPFNDK-SSSKLTRHFMLSTLPTLVILGPDG  294

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  + + ++GV AYPFT E+ +E+K  E+     Q+L+++LVS   +YV+ 
Sbjct  295  KTRHSNVAEAIDDYGVVAYPFTPEKFEELKAIEKGKLEAQTLESLLVSGDLNYVLG  350



>ref|XP_010682546.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=566

 Score =   226 bits (575),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 140/179 (78%), Gaps = 4/179 (2%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            HDL SILCSS+R+FL RN+GHQV VD LKGK + +YFSASWCG C RFTP L  VYNEL 
Sbjct  6    HDLGSILCSSNRNFLCRNNGHQVSVDTLKGKIVALYFSASWCGLCCRFTPILIEVYNELT  65

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             +G +FEVVF++AD+D+ESF  YF KMPW A+PFSDS TR++LD +F V G+PH VILDE
Sbjct  66   SQGKDFEVVFITADDDDESFDNYFSKMPWLAIPFSDSETRDKLDDMFKVDGLPHFVILDE  125

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            +GKV T+DGV I+ ++  + YPFT ER++ +K  EE T   ++LK++L S SR++V++A
Sbjct  126  TGKVLTDDGVAIIQDYEAQGYPFTPERIQILKKQEETT---RTLKSILASDSRNFVLSA  181


 Score =   140 bits (353),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 111/185 (60%), Gaps = 2/185 (1%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            + +Q      L+SIL S  R+F++  +G +V V +L+G+ IG+YFS S    C +F P L
Sbjct  156  LKKQEETTRTLKSILASDSRNFVLSANGKKVLVSELEGRTIGLYFSLSTYRSCMQFNPVL  215

Query  344  ATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
               Y EL  KG NFE+V +  DEDEE FK+ F  MPW ++P  D  +  +L   F +  +
Sbjct  216  IDFYEELKAKGENFEIVLIPLDEDEELFKQGFASMPWYSLPVKDK-SCVKLARYFDLSTL  274

Query  521  PHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTS  700
            P LVI+   G+    +G + + +HGVEAYPFT ER KE+   E+A    Q+L+++LVS  
Sbjct  275  PTLVIVGPDGRTLHYNGREAIEDHGVEAYPFTPERFKELAQIEKARQEAQTLESILVSGK  334

Query  701  RDYVI  715
             D+VI
Sbjct  335  LDFVI  339


 Score =   134 bits (338),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 105/182 (58%), Gaps = 5/182 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  + +E      A Q  +A  L SIL S   DF+I  SG +V +  L GK I +YF
Sbjct  303  YPFTPERFKELAQIEKARQ--EAQTLESILVSGKLDFVIDKSGTKVPISHLVGKNILLYF  360

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F   L   Y ++  K + FEV+F+S D+D+ SF E+F  MPW A+P+ D 
Sbjct  361  SAHWCPPCRAFLSKLIEAYQQIKAKDDAFEVIFISGDKDQISFDEFFSAMPWLAIPYDDQ  420

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK-DAEE  652
             T   L  LF V GIP LV +  SGK  + +   +++ HG ++YPFT ER+K ++ + EE
Sbjct  421  RT-AYLSRLFKVFGIPKLVAIGPSGKTISTEARKLIMVHGAKSYPFTSERLKVVESELEE  479

Query  653  AT  658
             T
Sbjct  480  MT  481



>ref|XP_010417977.1| PREDICTED: probable nucleoredoxin 1 [Camelina sativa]
Length=578

 Score =   226 bits (575),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 138/182 (76%), Gaps = 0/182 (0%)
 Frame = +2

Query  173  QNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATV  352
              GDA DL S+L S  RDFL+RN G QVK+D L GKKIG YFSA+WCGPC RFTP L  V
Sbjct  9    NGGDAQDLLSLLSSPARDFLVRNDGEQVKIDSLIGKKIGFYFSAAWCGPCQRFTPQLVEV  68

Query  353  YNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLV  532
            YNEL PK  FEVVFVS DEDEESF +YF KMPW AVPF+DS TR+RLD LF V GIP+LV
Sbjct  69   YNELAPKVGFEVVFVSGDEDEESFGDYFSKMPWLAVPFADSETRDRLDGLFKVTGIPNLV  128

Query  533  ILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYV  712
            I+D+ GK+   +GV ++  +G  AYPFT E++KEIK+ E+    EQ+L +VLV+ SRD+V
Sbjct  129  IVDDHGKLVNNNGVGVIRSYGAGAYPFTPEKMKEIKEEEDRARIEQTLSSVLVTPSRDFV  188

Query  713  IA  718
            I+
Sbjct  189  IS  190


 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 98/154 (64%), Gaps = 2/154 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A    S+L S D ++++   G +V V DL GK I +YFSA WC PC  FTP L  +Y +
Sbjct  332  EAQTTESLLVSGDLNYVLGKDGAKVLVSDLVGKNILMYFSAHWCPPCRAFTPELVEIYKQ  391

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  +   FE++F+S+D D+ESF EY+ +MPW A+PF D   +E L   F V GIP L  L
Sbjct  392  IKERDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP-RKESLARTFKVGGIPMLAAL  450

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +GK  T++  D+V  HG +AYPFT ER+KEI+
Sbjct  451  GPTGKTVTKEARDLVAIHGADAYPFTEERLKEIE  484


 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 107/176 (61%), Gaps = 2/176 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP-  370
            L S+L +  RDF+I   G++V V +L+G+ IG+ FS +    C  FTP L   Y++L   
Sbjct  176  LSSVLVTPSRDFVISPDGNKVPVSELEGRTIGLLFSVASYSKCKEFTPTLVEFYSKLKEN  235

Query  371  KGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            K +FE+V +S ++DEESF + F   PW A+PF+D  +  +L   F +  +P LVIL   G
Sbjct  236  KEDFEIVLISLEDDEESFNQDFKSKPWLALPFNDK-SSSKLARHFMLSTLPTLVILGPDG  294

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  + + ++G+ AYPFT E+ KE+++ E+A    Q+ +++LVS   +YV+ 
Sbjct  295  KTRHLNVAEAIDDYGLLAYPFTPEKFKELEEIEKAKIEAQTTESLLVSGDLNYVLG  350



>ref|XP_011014070.1| PREDICTED: probable nucleoredoxin 1 [Populus euphratica]
Length=539

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +HDL ++L S +RDFLIRN+G QVKV +L GK +G YFS SWCGPC  FTP L  VY +L
Sbjct  7    SHDLSALLSSEERDFLIRNNGDQVKVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQL  66

Query  365  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              KG+FEVVF+S+D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP+LVI D 
Sbjct  67   SSKGDFEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFDT  126

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            +GKV+ + GV  V EHGV+ YPF L+R+  +K+ EE   + Q++ ++LVS+SRDYVI+
Sbjct  127  NGKVSCDSGVSTVKEHGVDGYPFNLDRLNFLKEQEENAKKNQTISSILVSSSRDYVIS  184


 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 119/188 (63%), Gaps = 5/188 (3%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            + EQ  +A     + SIL SS RD++I N G  + V DL+GK +G+YFSA     C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKTIPVLDLEGKLVGLYFSAHARRMCREFT  216

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  +Y  L  K  NFEVV +S D++EE+FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLVELYKTLTEKRENFEVVLISLDDEEENFKESFETMPWLALPFKDK-SCEKLVRYFEL  275

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            R IP+LVI+ + GK    +  +++ +HG+EAYPFT E+++E+   E+A    Q+L++VLV
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEDHGIEAYPFTPEKLEELAAIEKAKLESQTLESVLV  335

Query  692  STSRDYVI  715
            +   D+VI
Sbjct  336  NGENDFVI  343


 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 107/179 (60%), Gaps = 4/179 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K EE  A   A+   ++  L S+L + + DF+I  SG +V V +L GK I +YF
Sbjct  307  YPFTPEKLEELAAIEKAKL--ESQTLESVLVNGENDFVIDKSGSKVPVSELVGKNILLYF  364

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDE  424

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
              ++ L   F + GIP  V +  SG+  T++    +  +G +A+PFT E +K++++ EE
Sbjct  425  -RKQILGRKFKIEGIPAAVAIGPSGRTITKEARMHLTAYGADAFPFTEEHLKQLEELEE  482



>ref|XP_010510950.1| PREDICTED: probable nucleoredoxin 1 [Camelina sativa]
Length=578

 Score =   225 bits (574),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 140/182 (77%), Gaps = 0/182 (0%)
 Frame = +2

Query  173  QNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATV  352
              GDA DL S+L S  RDF +RN G QVK++ L GKKIG+YFSA+WCGPC RFTP L  V
Sbjct  9    NGGDAQDLLSLLSSPARDFFVRNDGEQVKIESLMGKKIGLYFSAAWCGPCQRFTPQLVEV  68

Query  353  YNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLV  532
            YNEL PK  FEVVFVS DEDEESF +YF KMPW AVPF+DS TR+RLD LF V GIP+LV
Sbjct  69   YNELAPKVGFEVVFVSGDEDEESFGDYFSKMPWLAVPFADSETRDRLDGLFKVTGIPNLV  128

Query  533  ILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYV  712
            ++D+ GK+   +GV ++  +G +AYPFT E++KEIK+ E+   REQ+L +VLV+ +RD+V
Sbjct  129  MVDDHGKLVNGNGVGVIRSYGADAYPFTPEKMKEIKEEEDRARREQTLSSVLVTPTRDFV  188

Query  713  IA  718
            ++
Sbjct  189  VS  190


 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 98/154 (64%), Gaps = 2/154 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A    S+L S D ++++   G +V V DL GK I +YFSA WC PC  FTP L  +Y +
Sbjct  332  EAQTTESLLVSGDLNYVLGKDGAKVLVSDLVGKNILMYFSAHWCPPCRAFTPELVEIYKQ  391

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  +   FE++F+S+D D+ESF EY+ +MPW A+PF D   +E L   F V GIP L  L
Sbjct  392  IKERDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP-RKESLARTFKVGGIPMLAAL  450

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +GK  T++  D+V  HG +AYPFT ER+KEI+
Sbjct  451  GPTGKTVTKEARDLVAIHGADAYPFTEERLKEIE  484


 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 105/176 (60%), Gaps = 2/176 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP-  370
            L S+L +  RDF++   G++V V +L G+ IG+ FS +    C  FTP L   Y++L   
Sbjct  176  LSSVLVTPTRDFVVSPDGNKVPVSELVGRTIGLLFSVASYSKCTEFTPTLVKFYSKLKEN  235

Query  371  KGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            K +FE+V +S ++DEESF + F   PW  +PF+D  +  +L   F +  +P LVIL   G
Sbjct  236  KEDFEIVLISLEDDEESFNQDFKSKPWLGLPFNDK-SSSKLARHFMLSTLPTLVILGPDG  294

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  + + ++G+ AYPFT E+ KE+++ E+A    Q+ +++LVS   +YV+ 
Sbjct  295  KTRHLNVAEAIDDYGLLAYPFTPEKFKELEEIEKAKIEAQTTESLLVSGDLNYVLG  350



>ref|XP_004297482.1| PREDICTED: probable nucleoredoxin 1 [Fragaria vesca subsp. vesca]
Length=567

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 142/186 (76%), Gaps = 0/186 (0%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            MA  +G  HDL S+L S DRDFL+RN+G QVK++ L GK +G+YFS SWCGPC RFTP L
Sbjct  1    MAHGDGVTHDLVSLLGSGDRDFLVRNNGDQVKINTLSGKILGLYFSGSWCGPCRRFTPYL  60

Query  344  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
              VY EL  KG+FEVVF+S+D DEESF  YF +MPW AVPFSD  TR+ +  LF VRGIP
Sbjct  61   VEVYQELASKGDFEVVFISSDRDEESFSGYFSEMPWLAVPFSDLETRKGVKDLFKVRGIP  120

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
            H V++D +GKV T+ GV +V E+GVE YPFT ER+  +K+ EEA  ++QSL ++LVS+SR
Sbjct  121  HFVVIDANGKVCTDQGVVVVREYGVEGYPFTAERISFLKEQEEAAKKDQSLSSLLVSSSR  180

Query  704  DYVIAA  721
            DY+I++
Sbjct  181  DYLISS  186


 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 98/158 (62%), Gaps = 2/158 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L S+L S D DF+I  SG +V V +L GK I +YFSA WC PC  F P L T Y+E
Sbjct  326  EAQTLESLLVSEDTDFVIETSGAKVPVSELVGKHILLYFSAHWCPPCRSFLPKLITAYHE  385

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K N FEV+F+S+D D+ SF ++F  MPW A+PF D   +  L   F ++GIP +V +
Sbjct  386  IKAKDNAFEVIFISSDRDQSSFDDFFSSMPWLALPFGDP-RKAFLQRKFKIQGIPAVVAI  444

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
              +GK  T     ++L HG +A+PFT E +K +++  E
Sbjct  445  SPTGKTVTTTARKLILAHGADAFPFTEEHLKHLEEKIE  482


 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +2

Query  221  RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFV  397
            RD+LI + G++V V +L+GK +G+YF+ +    C  FT  L   YN L  KG +FE+V +
Sbjct  180  RDYLISSEGNKVSVSELEGKLVGLYFTLNIRKACKDFTQTLVKFYNSLKEKGEDFEIVLI  239

Query  398  SADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVD  577
            S D +EE FKE    +PW A+PF D    E+L   F +  +P LVI+   GK    +  +
Sbjct  240  SLDFEEEHFKEGIA-VPWLALPFKDK-NCEKLARYFELETVPTLVIIGHDGKTLHPNVTE  297

Query  578  IVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            ++ EHG+EAYPF+ E++ E+ + E+     Q+L+++LVS   D+VI
Sbjct  298  LIEEHGIEAYPFSAEKIAELAEIEKVKLEAQTLESLLVSEDTDFVI  343



>emb|CBI28536.3| unnamed protein product [Vitis vinifera]
Length=542

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = +2

Query  176  NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
            +G +HDL  +L S DRDFL+RN+GHQVKV+ LKGKKI +YFSASWCGPC +FTP L  VY
Sbjct  7    DGVSHDLVLLLTSEDRDFLVRNNGHQVKVESLKGKKIWLYFSASWCGPCRQFTPKLVEVY  66

Query  356  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
            +E   KG+FE++FVS D+ ++ F EYF KMPW A+PFSDS TR+ L  LF +RGIP L +
Sbjct  67   DEFSSKGDFEIIFVSLDKGDQLFNEYFSKMPWLAIPFSDSDTRDHLKKLFKMRGIPSLAM  126

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            LDESGKV + +GV+I+ ++GVE YPFT E++KE+K+ EE   +EQSL+++LVS SRDYVI
Sbjct  127  LDESGKVLSSEGVEIIKDYGVEGYPFTAEKIKELKEKEETAKKEQSLRSILVSQSRDYVI  186

Query  716  AA  721
            +A
Sbjct  187  SA  188


 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              LRSIL S  RD++I   G +V V +L+GK +G+YFS S    C  FT  LA VY EL 
Sbjct  171  QSLRSILVSQSRDYVISADGRKVSVSELEGKLVGLYFSLSSYNACQEFTTTLAEVYEELR  230

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             KG +FE+V +S D++E+SFK+YF  MPW A+PF+D  +  +L   F +R +P LV++ +
Sbjct  231  AKGESFEIVMISLDDEEQSFKKYFESMPWFALPFNDK-SCGKLARYFKLRVLPTLVVIGQ  289

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK    +  + + +HG++AYPFT E+  E+++ E+A    Q+L+++LVS   D+VI 
Sbjct  290  DGKTLHSNVAEAIEQHGIQAYPFTPEKFVELEEIEKAKREAQTLESILVSGDTDFVIG  347


 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 93/154 (60%), Gaps = 2/154 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L SIL S D DF+I   G ++ V  L GK I +YFSA WC PC  F P L   Y  
Sbjct  329  EAQTLESILVSGDTDFVIGKDGVKIPVSHLAGKNILLYFSAHWCPPCRAFLPKLIEAYQN  388

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K   FEV+F+S+D D+ SF E+F  MPW A+PF D   +  L   F VR IP L+ +
Sbjct  389  IKAKDEAFEVIFISSDRDQASFDEFFSGMPWLALPFGDK-RKASLGRTFKVRSIPKLIAV  447

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
            + +G+  T +  ++V+ HG +AYPFT E +KEI+
Sbjct  448  EPTGRTVTTEARNLVMIHGADAYPFTDEHIKEIE  481



>ref|XP_011014064.1| PREDICTED: probable nucleoredoxin 1 [Populus euphratica]
Length=195

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = +2

Query  221  RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVS  400
            RDFLIRN+G QV V +L GK +G+YFS SWCGPC  FTP L  VY +L  KG+FEVVF+S
Sbjct  19   RDFLIRNNGDQVPVSNLVGKIVGVYFSGSWCGPCRNFTPLLVEVYEQLSSKGDFEVVFIS  78

Query  401  ADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDI  580
            +D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP+LVI D +GKV+ + GV  
Sbjct  79   SDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFDTNGKVSCDSGVST  138

Query  581  VLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            V EHGV+ YPF L+R+  +K+ EE   + Q++ ++LVS+SRDYVI+
Sbjct  139  VKEHGVDGYPFNLDRLNFLKEQEENAKKNQTISSILVSSSRDYVIS  184



>gb|ABK25230.1| unknown [Picea sitchensis]
Length=387

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 140/183 (77%), Gaps = 1/183 (1%)
 Frame = +2

Query  173  QNGDAHD-LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  349
            Q G++H+ L S+LCS +RDFLIRN+G +VKV++L+GK +G+YFSA WC PC  FTP L+ 
Sbjct  10   QAGESHESLSSLLCSEERDFLIRNNGEKVKVEELEGKYVGLYFSAHWCPPCRYFTPVLSE  69

Query  350  VYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  529
            +Y +LL KG+FE+VF+SAD DE+SF+EY   MPW A+PFSD  TR++LD +F V GIP L
Sbjct  70   IYKKLLEKGDFEIVFISADRDEKSFEEYHHTMPWLALPFSDENTRKKLDQVFKVDGIPCL  129

Query  530  VILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDY  709
            V LD+ G+  T +GV+ + E+GVEAYPFT ER+ E+K  EEA    Q+++++L+S  RD+
Sbjct  130  VFLDKEGRAITTEGVETIGEYGVEAYPFTAERIDELKAKEEALRAAQTVESLLLSDERDF  189

Query  710  VIA  718
            V+ 
Sbjct  190  VLG  192


 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 124/187 (66%), Gaps = 4/187 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  + +E KA   A +   A  + S+L S +RDF++ + G QV V +L GK +G+YF
Sbjct  155  YPFTAERIDELKAKEEALRA--AQTVESLLLSDERDFVLGHEGTQVPVAELAGKTVGLYF  212

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WCGPC  FTP L  +YNELL KG  FE+VF+S D++E++F+EY+  MPW A+PF+D+
Sbjct  213  SAHWCGPCRSFTPQLVEIYNELLKKGEAFEIVFLSRDKEEKAFEEYYASMPWLALPFADN  272

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
             T+++L   F + GIP L+IL   GK    D V ++ E+G+ AYPFT ER+ +++  E+A
Sbjct  273  -TQKKLSRYFRIEGIPTLIILGSDGKTIRNDAVGLIREYGIRAYPFTKERLDDLEAEEKA  331

Query  656  T*REQSL  676
                Q+L
Sbjct  332  KREAQTL  338



>ref|XP_008353015.1| PREDICTED: probable nucleoredoxin 1 [Malus domestica]
Length=399

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 138/184 (75%), Gaps = 0/184 (0%)
 Frame = +2

Query  167  AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  346
             +++G  HDL S+L S+DR+FL+RN+G QV++  L GK +G+YFSA+WCGPC RFTP+L 
Sbjct  4    GDEHGVTHDLLSLLSSADRNFLLRNNGDQVEISSLTGKIVGLYFSATWCGPCLRFTPDLV  63

Query  347  TVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  526
             V+ EL  KG+FEVVF+S+D DEES+  YF KMPW ++PF DS TR+RL   F VRGIP+
Sbjct  64   EVHQELAAKGDFEVVFISSDRDEESYTGYFSKMPWLSIPFWDSETRKRLKEFFKVRGIPN  123

Query  527  LVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRD  706
            LVI+D +GKV+ +DG  IV ++G   YPFT ER  E+ + E+A  + Q+L+++L+S  R+
Sbjct  124  LVIIDANGKVSIDDGTKIVRDYGANGYPFTAERFAELVEIEKAEEKAQTLESILISGDRN  183

Query  707  YVIA  718
            +VI 
Sbjct  184  FVIG  187


 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 92/145 (63%), Gaps = 2/145 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A  L SIL S DR+F+I   G Q+ V DL GK I +YFSA WC PC  F P L   Y+E+
Sbjct  170  AQTLESILISGDRNFVIGKDGTQIPVADLVGKNILLYFSAHWCPPCRAFLPTLVEAYHEI  229

Query  365  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K + FEV+F+S+D D++SF E+F  MPW A+PF DS  +  L   F V+GIP LV + 
Sbjct  230  KAKDDAFEVIFISSDRDQDSFDEFFATMPWLALPFGDS-RKAFLSRKFKVQGIPMLVAIG  288

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFT  616
             +G+  T +  + ++ HG +AYPFT
Sbjct  289  PTGQTVTREARNHIMAHGAKAYPFT  313



>ref|XP_010937371.1| PREDICTED: probable nucleoredoxin 1-1 [Elaeis guineensis]
Length=564

 Score =   223 bits (567),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 134/182 (74%), Gaps = 1/182 (1%)
 Frame = +2

Query  173  QNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATV  352
              G  HDL+ +L + +RDFL+ N+G QVK+ +L+GK IG+YFSASWC  C RFTP L   
Sbjct  13   NGGKGHDLKLLLATDERDFLVCNNGDQVKIANLEGKTIGLYFSASWCRRCGRFTPKLVET  72

Query  353  YNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  529
            Y EL  +G  FEVV VS D DE+SF   F KMPW A+PFSDS  R+RLD LF VRGIPHL
Sbjct  73   YGELSSEGKEFEVVLVSGDRDEDSFNGSFSKMPWLAIPFSDSKARDRLDELFKVRGIPHL  132

Query  530  VILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDY  709
            VILD +G+V  + GV  V ++G E YPFTLE++ ++K+ EEAT REQ+L+TVLVS SRDY
Sbjct  133  VILDANGEVLNKKGVQAVGDYGSEGYPFTLEKINKLKEEEEATKREQTLQTVLVSPSRDY  192

Query  710  VI  715
            +I
Sbjct  193  LI  194


 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 113/179 (63%), Gaps = 4/179 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            F FS+ K +     + A+  G  H L S+L S + D++I   G +V V +L GK I +YF
Sbjct  322  FPFSQDKVDMLAEKAKAKLEG--HTLESLLVSGELDYVIGKDGVKVPVSELNGKNILLYF  379

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WCGPC  F P L   YN +  K + FE+VF+S+D D+ SF+++F  MPW A+P+ D 
Sbjct  380  SAQWCGPCRAFLPKLVEEYNNIKDKDSAFEMVFISSDRDQNSFEDFFSGMPWLALPYGDE  439

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
              ++ L ++F +RGIP LV +  +G+  T+D   +++ HG +AYPFT ER+KE++D  E
Sbjct  440  -RKKSLSSVFKIRGIPSLVAIGPTGRTITKDAKLLMMVHGADAYPFTEERIKELEDQLE  497


 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 112/179 (63%), Gaps = 4/179 (2%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            L+++L S  RD+LI N+G++V + +L+GK + +YFS +    C  FT  LA +Y  L  +
Sbjct  181  LQTVLVSPSRDYLILNNGNKVSISELEGKMVCLYFSINGSKTCDEFTLVLAKIYRNLKER  240

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            G +FEVV VS D++E SFKE F  MPW A+PF+D  + +RL   F +RGIP LV+L   G
Sbjct  241  GESFEVVMVSLDDEESSFKEGFATMPWLAIPFNDKKSCKRLARYFELRGIPTLVVLGTDG  300

Query  551  KVTTEDGVDIVLEHGVEA---YPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  +IV EHG EA   +PF+ ++V  + +  +A     +L+++LVS   DYVI 
Sbjct  301  KTLHNNIAEIVEEHGEEAWEGFPFSQDKVDMLAEKAKAKLEGHTLESLLVSGELDYVIG  359



>gb|EPS71977.1| hypothetical protein M569_02774, partial [Genlisea aurea]
Length=573

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 132/178 (74%), Gaps = 0/178 (0%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            +DL  IL S +RD+L+RN+G +V +  LKGK IGIYFSASWCGPC  FTP L  VYNEL 
Sbjct  9    YDLSLILSSENRDYLVRNNGDRVDLSRLKGKVIGIYFSASWCGPCRLFTPTLVQVYNELA  68

Query  368  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  547
               +FE+VF S D+++ SF  YF +MPW A+PFSDS TRE+L  LF+V GIPHLV LDE 
Sbjct  69   RDKDFEIVFSSGDQEDASFDAYFSEMPWLAIPFSDSETREKLGELFSVAGIPHLVFLDEK  128

Query  548  GKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            GK+ T DGV+ V E+G +A+PFT ER+ + +  EE   R QSLK++LVS SRDYVIAA
Sbjct  129  GKLLTGDGVEAVREYGSDAFPFTSERIAKFRAEEEEAKRNQSLKSLLVSESRDYVIAA  186


 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 98/155 (63%), Gaps = 3/155 (2%)
 Frame = +2

Query  182  DAHDLRSILCSSD-RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  358
            +A  L SIL  +D  +F+I   G +V V DL GK + +YFSA WC PC  F P L   Y 
Sbjct  330  EAQTLESILVLNDSENFVIGKDGIKVPVSDLSGKTVLLYFSAHWCPPCRSFLPTLIKAYE  389

Query  359  ELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
            ++  KGN  EV+F+S+D D++SF E+F  MPW A+PF D   +E L   F VRGIP ++ 
Sbjct  390  QMKEKGNEIEVIFISSDRDQQSFDEFFSTMPWLALPFGDG-RKESLGRAFKVRGIPMVIA  448

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
            +  +GK  T +  ++++ HG  AYPFT ERVKEI+
Sbjct  449  IGPNGKTLTTEARELIMSHGAGAYPFTAERVKEIE  483


 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 118/202 (58%), Gaps = 9/202 (4%)
 Frame = +2

Query  128  SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  307
            S+R  + R     A++N     L+S+L S  RD++I   G +V V +L+GK + +YFS S
Sbjct  152  SERIAKFRAEEEEAKRN---QSLKSLLVSESRDYVIAADGSKVPVSELQGKTVCLYFSLS  208

Query  308  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADED---EESFKEYFGKMPWTAVPFSDS  475
              G C  F P L  ++  L  +G NFE+V +  D+D   EE+F++ F K+PW ++P  D 
Sbjct  209  EDGGCKAFNPKLIELHKALKQEGDNFEIVMIPLDDDDDKEEAFQQQFEKLPWLSLPAKDK  268

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
            ++  +L   F + G+P +V++   G     D  + + EHG +AYPFT E+  E+++ E+A
Sbjct  269  ISM-KLAKYFELAGLPTVVVIGPEGNTIHSDVAEAIEEHGAKAYPFTPEKFLELEEIEKA  327

Query  656  T*REQSLKTVLV-STSRDYVIA  718
                Q+L+++LV + S ++VI 
Sbjct  328  KREAQTLESILVLNDSENFVIG  349



>ref|XP_011041504.1| PREDICTED: probable nucleoredoxin 1 isoform X3 [Populus euphratica]
Length=499

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +HDL S+L S +RDFLIRN+G QV+V +L GK +G YFS SWCGPC  FTP L  VY +L
Sbjct  7    SHDLSSLLSSGERDFLIRNNGDQVRVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQL  66

Query  365  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              KG+FEVVF+S+D D+ESF  YF +MPW A+PFSD+ TR+RL  +F V GIP+LVI D 
Sbjct  67   SSKGDFEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRQRLKEVFEVTGIPNLVIFDT  126

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            +GKV+ +DGV  V+EHGV+ YPF L+R+  +K+ EE   + Q++ ++LVS+SRDYVI+
Sbjct  127  NGKVSCDDGVSTVMEHGVDGYPFNLDRLNFLKEQEENAKKNQTISSILVSSSRDYVIS  184


 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 117/188 (62%), Gaps = 7/188 (4%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFS      C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVLDLEGKLVGLYFSIH--AICCEFT  214

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  +Y  L  KG NFEVV +S D DEE FKE F  MPW A+PF D + + +L   F +
Sbjct  215  PKLVELYKTLKEKGENFEVVLISLDYDEEDFKESFETMPWLALPFKDKICK-KLVRYFEL  273

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            R IP+LVI+ + GK    +  +++ EHGVEAYPFT +++ E+   E+A    Q+L++VLV
Sbjct  274  RTIPNLVIIGQDGKTLNPNVAELIEEHGVEAYPFTPKKLDELAAIEKAKLESQTLESVLV  333

Query  692  STSRDYVI  715
            +   D+VI
Sbjct  334  NGENDFVI  341


 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 99/167 (59%), Gaps = 4/167 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+ +K +E  A   A+   ++  L S+L + + DF+I  SG +V V +L GK I +YF
Sbjct  305  YPFTPKKLDELAAIEKAKL--ESQTLESVLVNGENDFVIDKSGSKVPVSELVGKNILLYF  362

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  363  SAQWCSPCRAFLPKLIEAYHTIKGKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDG  422

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFT  616
              ++ L   F + GIP  V +  SG+  T++    +  +G +A+PFT
Sbjct  423  -RKQILSRKFKIEGIPAAVAIGPSGRTITKEARMHLTAYGADAFPFT  468



>ref|XP_010682545.1| PREDICTED: probable nucleoredoxin 1 [Beta vulgaris subsp. vulgaris]
Length=572

 Score =   218 bits (554),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 135/188 (72%), Gaps = 3/188 (2%)
 Frame = +2

Query  164  MAEQNG---DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            MAE+N    + +DL S+L S +RDFLIRN+G +V + DL GK + +YFSASWC PC  FT
Sbjct  1    MAEENSINSECYDLSSLLSSEERDFLIRNNGDKVTIKDLSGKILALYFSASWCPPCRGFT  60

Query  335  PNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  514
            P L  VY EL  KG+FEVVFVS+D DEESF+ YF KMPW A+P SD  T + L   F+V 
Sbjct  61   PILIEVYKELSSKGDFEVVFVSSDFDEESFQNYFSKMPWLAIPISDEATIKSLGEKFSVM  120

Query  515  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVS  694
            GIPHLVIL++ GKV+T++GV +V EH  EAYPFT +R+ ++K+ EEA  R QSL  +L  
Sbjct  121  GIPHLVILNKDGKVSTDEGVKVVKEHEAEAYPFTPDRINQLKEEEEAAKRNQSLTNLLAH  180

Query  695  TSRDYVIA  718
              RDYVI+
Sbjct  181  GPRDYVIS  188


 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 104/178 (58%), Gaps = 3/178 (2%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L ++L    RD++I N   +V + +L+GK +G+YF      PC  FT  L  VY  L 
Sbjct  172  QSLTNLLAHGPRDYVISNDEKKVPITELEGKMVGLYFCVGSYKPCTEFTRKLVEVYKSLK  231

Query  368  PKG-NFEVVFVSADEDEES-FKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              G NFEVV +  DED+E  FKE   +MPW A+PF D     RL   F +R IP LVI+ 
Sbjct  232  ENGENFEVVLIYLDEDDEGGFKEGLAEMPWVALPFKDKKIA-RLVRYFELRNIPRLVIIG  290

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
              GK    D V+++ EHG  AYPFT E++ E+ + E+A    Q+L+++LVS  +DYV+
Sbjct  291  PDGKTLNPDVVELIDEHGAVAYPFTPEKLAELAEIEKAKLESQTLESILVSAEKDYVV  348


 Score =   134 bits (338),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 96/155 (62%), Gaps = 2/155 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            ++  L SIL S+++D+++  SG +V V  L GK + IYFSA WC PC  FTP L   Y+E
Sbjct  331  ESQTLESILVSAEKDYVVDKSGSKVSVSQLVGKHVLIYFSAHWCPPCRAFTPKLIETYHE  390

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K + FE++FVS+D D+ SF EY+  MPW A+PF D   +  L   F V+GIP LV +
Sbjct  391  IKAKESAFEIIFVSSDRDQSSFDEYYSHMPWLALPFGDE-RKAYLSRKFKVKGIPCLVAI  449

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKD  643
               GK  T +  +++  HG +A+PF    +K +++
Sbjct  450  GPQGKTITTEARELIGSHGADAFPFNEGHMKNLEE  484



>ref|NP_001105407.1| nucleoredoxin1 [Zea mays]
 gb|AAD04231.1| PDI-like protein [Zea mays]
Length=569

 Score =   217 bits (553),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 134/174 (77%), Gaps = 2/174 (1%)
 Frame = +2

Query  203  ILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-N  379
            IL +SDRDFL+RNSG QVK+  ++   + IYFSASWC PC RFTP L  VY +L  +G +
Sbjct  15   ILATSDRDFLVRNSGEQVKISSVEASPVAIYFSASWCPPCRRFTPKLIEVYEKLASQGKS  74

Query  380  FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD-ESGKV  556
            FEVVF SAD +EE+F EYF KMPW AVPFSDS  RE LD  F V GIPHLVILD ++G+V
Sbjct  75   FEVVFASADRNEEAFNEYFAKMPWLAVPFSDSEGREALDGQFKVSGIPHLVILDAKTGEV  134

Query  557  TTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             TEDGV+ V E+GVEAYPFT +R+ E+K+ E+A    Q++++VLV+++RDY+I+
Sbjct  135  YTEDGVEFVSEYGVEAYPFTPDRINELKEQEKAEKENQTIQSVLVTSTRDYLIS  188


 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 103/175 (59%), Gaps = 4/175 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            F FS  K E    +  A+    +  L SIL S   DF+I   G +V V +L GK + +YF
Sbjct  314  FPFSAEKLE--ILAEKAKIKAASQTLESILISGHLDFVIGKDGAKVPVSELVGKTVLVYF  371

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            S  WC PC  F P L   YN++  K  +FE+VF+S+DED+ SF ++F +MPW AVP+ D 
Sbjct  372  SGKWCPPCRAFLPTLVKEYNKIKEKNSDFEIVFISSDEDQSSFDDFFSEMPWLAVPWEDE  431

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +  L   F +RGIP LV +  +G+  + D    ++ HG +A+PFT ER++E++
Sbjct  432  -RKASLKKTFKIRGIPSLVAIGPTGQTVSRDAKSQLMIHGADAFPFTEERLEELQ  485


 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 113/204 (55%), Gaps = 7/204 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  +  E K    AE+  +   ++S+L +S RD+LI N G +V + +L+GK +G+ F
Sbjct  151  YPFTPDRINELKEQEKAEK--ENQTIQSVLVTSTRDYLISNKGDKVPISELEGKYVGLCF  208

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
                  P   FT  LA +Y +L   G  FEVV VS D +E SF E F KMPW A+P  D 
Sbjct  209  VVDGFPPLAEFTEVLAKIYEKLKEVGEKFEVVAVSLDSEESSFNESFAKMPWLAIPQGD-  267

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEA---YPFTLERVKEIKDA  646
            +  + L   F +  +P LV++   GK    +  DI+ +HG EA   +PF+ E+++ + + 
Sbjct  268  IKCQTLVRYFELSSLPTLVLIGPDGKTLNNNVADIIDDHGFEAWEGFPFSAEKLEILAEK  327

Query  647  EEAT*REQSLKTVLVSTSRDYVIA  718
             +     Q+L+++L+S   D+VI 
Sbjct  328  AKIKAASQTLESILISGHLDFVIG  351



>gb|ERM99464.1| hypothetical protein AMTR_s00131p00113720 [Amborella trichopoda]
Length=603

 Score =   218 bits (554),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = +2

Query  191  DLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP  370
            D++S+L    RDFL+RN+G QVK+D+L+GK +G+YFSASWCGPC RFTP L   Y++L  
Sbjct  25   DIKSLLSGEGRDFLVRNNGDQVKIDNLEGKLVGLYFSASWCGPCRRFTPKLIKTYDQLST  84

Query  371  KGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
             G+FEVVFVS D DE+SF++YF KMPW A+PFSDS  R +LD  F V GIPHLVI+ +  
Sbjct  85   NGDFEVVFVSGDSDEKSFEDYFHKMPWLAIPFSDSTVRSKLDEGFEVYGIPHLVIVGKDS  144

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K+ T +GV  V E+GV+ YPFT ER++E+K+ +E   + Q+L+T+LV+  RD+VI+
Sbjct  145  KILTSEGVGTVSEYGVDGYPFTNERLEELKEQDEEIRQNQNLRTLLVTDRRDFVIS  200


 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 99/150 (66%), Gaps = 2/150 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            L S+L S D DF+I   G +V + +L GK + +YFSA WC PC  F P L   YNE+   
Sbjct  346  LESLLMSDDGDFIIGKGGIKVPISELVGKNVCLYFSAEWCPPCRAFLPKLIEAYNEIKTN  405

Query  374  -GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
              NFE+VF+S+D+D+  F E+F  MPW A+PF D   +E+L   F +RGIP LV LD+ G
Sbjct  406  DSNFEIVFISSDQDQGKFDEFFSSMPWLALPFGDK-AKEKLSRTFKIRGIPSLVALDKKG  464

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
            ++ T D  ++++ HG +A+PFT ER+KE++
Sbjct  465  RLVTNDARNLIMRHGSKAFPFTEERLKEVE  494


 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 121/201 (60%), Gaps = 4/201 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  + EE K     E+     +LR++L +  RDF+I N G Q+ + +L+GK IG+YF
Sbjct  163  YPFTNERLEELKEQD--EEIRQNQNLRTLLVTDRRDFVISNDGRQIPISELEGKTIGLYF  220

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            + S    C +FTP L  VY +L  KG +FE+V VS+DE+ + F E+F  MPW A+PF D 
Sbjct  221  AVSGHPFCEKFTPELIEVYKKLKEKGESFEIVLVSSDENIKDFNEHFSSMPWLALPFED-  279

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
            +   RL  LF ++G P L ++   GK   +D V+ + +HG EAYPFT ER  ++ + E+ 
Sbjct  280  IALSRLRRLFELQGFPTLTVIGPDGKTLKDDVVETIGDHGPEAYPFTPERFIQLAEIEKK  339

Query  656  T*REQSLKTVLVSTSRDYVIA  718
                 +L+++L+S   D++I 
Sbjct  340  RLESMTLESLLMSDDGDFIIG  360



>ref|XP_011041502.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Populus euphratica]
Length=562

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +HDL S+L S +RDFLIRN+G QV+V +L GK +G YFS SWCGPC  FTP L  VY +L
Sbjct  7    SHDLSSLLSSGERDFLIRNNGDQVRVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQL  66

Query  365  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              KG+FEVVF+S+D D+ESF  YF +MPW A+PFSD+ TR+RL  +F V GIP+LVI D 
Sbjct  67   SSKGDFEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRQRLKEVFEVTGIPNLVIFDT  126

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            +GKV+ +DGV  V+EHGV+ YPF L+R+  +K+ EE   + Q++ ++LVS+SRDYVI+
Sbjct  127  NGKVSCDDGVSTVMEHGVDGYPFNLDRLNFLKEQEENAKKNQTISSILVSSSRDYVIS  184


 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 117/188 (62%), Gaps = 7/188 (4%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFS      C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVLDLEGKLVGLYFSIH--AICCEFT  214

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  +Y  L  KG NFEVV +S D DEE FKE F  MPW A+PF D + + +L   F +
Sbjct  215  PKLVELYKTLKEKGENFEVVLISLDYDEEDFKESFETMPWLALPFKDKICK-KLVRYFEL  273

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            R IP+LVI+ + GK    +  +++ EHGVEAYPFT +++ E+   E+A    Q+L++VLV
Sbjct  274  RTIPNLVIIGQDGKTLNPNVAELIEEHGVEAYPFTPKKLDELAAIEKAKLESQTLESVLV  333

Query  692  STSRDYVI  715
            +   D+VI
Sbjct  334  NGENDFVI  341


 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 99/167 (59%), Gaps = 4/167 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+ +K +E  A   A+   ++  L S+L + + DF+I  SG +V V +L GK I +YF
Sbjct  305  YPFTPKKLDELAAIEKAKL--ESQTLESVLVNGENDFVIDKSGSKVPVSELVGKNILLYF  362

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  363  SAQWCSPCRAFLPKLIEAYHTIKGKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDG  422

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFT  616
              ++ L   F + GIP  V +  SG+  T++    +  +G +A+PFT
Sbjct  423  -RKQILSRKFKIEGIPAAVAIGPSGRTITKEARMHLTAYGADAFPFT  468



>ref|XP_008353016.1| PREDICTED: LOW QUALITY PROTEIN: probable nucleoredoxin 1 [Malus 
domestica]
Length=571

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = +2

Query  176  NGDAH----DLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            NGD H    DL S+L S+DR+FL+RN+G QV++  L GK +G+YFSASWCGPC RFTPNL
Sbjct  3    NGDGHGVTHDLLSLLASADRNFLLRNNGDQVEISSLTGKIVGLYFSASWCGPCRRFTPNL  62

Query  344  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
              V+ +L  KG+FEVVF+S+D DEESF  YF KMPW ++PFSD  TR+RL   F VRGIP
Sbjct  63   VEVHQDLAAKGDFEVVFISSDRDEESFNGYFSKMPWLSIPFSDLETRKRLKEFFKVRGIP  122

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
            HLVI+D +GKV+ +DG  IV++HGV+ YPFT E++  + + E      QSL ++LVS SR
Sbjct  123  HLVIIDANGKVSIDDGTKIVMDHGVDGYPFTAEKMNFLIEQEAVAKENQSLSSLLVSNSR  182

Query  704  DYVIA  718
            DY+I+
Sbjct  183  DYLIS  187


 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 92/158 (58%), Gaps = 2/158 (1%)
 Frame = +2

Query  152  KASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRF  331
            K + +AE   +   ++S+L +  RDF++  +G +V V +L GK I +YFSA WC PC  F
Sbjct  315  KIAELAELKLEEQTVQSLLVAGGRDFVVEKNGSRVPVSELAGKHILLYFSAHWCRPCRAF  374

Query  332  TPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFT  508
             P L   YN++  K N  E++F+S+D D  SFKE+F  MPW A+P  D   +  L   F 
Sbjct  375  MPKLIKAYNQIKAKDNAIEIIFLSSDRDHHSFKEFFETMPWLAIPLGDP-RKALLQRKFK  433

Query  509  VRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLE  622
            ++ IP LV +  SG+  +     ++  HG +AYPFT E
Sbjct  434  IQAIPALVAISPSGQTLSTQARQLIQAHGADAYPFTEE  471


 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 101/166 (61%), Gaps = 6/166 (4%)
 Frame = +2

Query  221  RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFV  397
            RD+LI   G++V V +L+GK +G+YFS     PC   T  L   + EL  KG NFE+V +
Sbjct  182  RDYLISKDGNKVSVSELEGKIVGLYFSLYTHKPCKEXTQALVKFHEELKEKGENFEIVLI  241

Query  398  SADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVD  577
            S D +EE FKE F ++ W A+PF D    E+L   F +  +P LVI+ + GK    +  +
Sbjct  242  SLDLEEEHFKEGF-QVSWLALPFKDK-NCEKLARYFALESLPRLVIIGQDGKTLHSNAAE  299

Query  578  IVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            ++ E+G EAYPFT E++ E+    E    EQ+++++LV+  RD+V+
Sbjct  300  LIEEYGAEAYPFTAEKIAELA---ELKLEEQTVQSLLVAGGRDFVV  342



>ref|XP_011041503.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Populus euphratica]
Length=562

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +HDL S+L S +RDFLIRN+G QV+V +L GK +G YFS SWCGPC  FTP L  VY +L
Sbjct  7    SHDLSSLLSSGERDFLIRNNGDQVRVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQL  66

Query  365  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              KG+FEVVF+S+D D+ESF  YF +MPW A+PFSD+ TR+RL  +F V GIP+LVI D 
Sbjct  67   SSKGDFEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRQRLKEVFEVTGIPNLVIFDT  126

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            +GKV+ +DGV  V+EHGV+ YPF L+R+  +K+ EE   + Q++ ++LVS+SRDYVI+
Sbjct  127  NGKVSCDDGVSTVMEHGVDGYPFNLDRLNFLKEQEENAKKNQTISSILVSSSRDYVIS  184


 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 117/188 (62%), Gaps = 7/188 (4%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFS      C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVLDLEGKLVGLYFSIH--AICCEFT  214

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  +Y  L  KG NFEVV +S D DEE FKE F  MPW A+PF D + + +L   F +
Sbjct  215  PKLVELYKTLKEKGENFEVVLISLDYDEEDFKESFETMPWLALPFKDKICK-KLVRYFEL  273

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            R IP+LVI+ + GK    +  +++ EHGVEAYPFT +++ E+   E+A    Q+L++VLV
Sbjct  274  RTIPNLVIIGQDGKTLNPNVAELIEEHGVEAYPFTPKKLDELAAIEKAKLESQTLESVLV  333

Query  692  STSRDYVI  715
            +   D+VI
Sbjct  334  NGENDFVI  341


 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 99/167 (59%), Gaps = 4/167 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+ +K +E  A   A+   ++  L S+L + + DF+I  SG +V V +L GK I +YF
Sbjct  305  YPFTPKKLDELAAIEKAKL--ESQTLESVLVNGENDFVIDKSGSKVPVSELVGKNILLYF  362

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  363  SAQWCSPCRAFLPKLIEAYHTIKGKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDG  422

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFT  616
              ++ L   F + GIP  V +  SG+  T++    +  +G +A+PFT
Sbjct  423  -RKQILSRKFKIEGIPAAVAIGPSGRTITKEARMHLTAYGADAFPFT  468



>gb|ABK25413.1| unknown [Picea sitchensis]
Length=587

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 140/183 (77%), Gaps = 1/183 (1%)
 Frame = +2

Query  173  QNGDAHD-LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  349
            Q G++H+ L S+LCS +RDFLIRN+G +VKV++L+GK +G+YFSA WC PC  FTP L+ 
Sbjct  10   QAGESHESLSSLLCSEERDFLIRNNGEKVKVEELEGKYVGLYFSAHWCPPCRYFTPVLSE  69

Query  350  VYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  529
            +Y +LL KG+FE+VF+SAD DE+SF+EY   MPW A+PFSD  TR++LD +F V GIP L
Sbjct  70   IYKKLLEKGDFEIVFISADRDEKSFEEYHHTMPWLALPFSDENTRKKLDQVFKVDGIPCL  129

Query  530  VILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDY  709
            V LD+ G+  T +GV+ + E+GVEAYPFT ER+ E+K  EEA    Q+++++L+S  RD+
Sbjct  130  VFLDKEGRAITTEGVETIGEYGVEAYPFTAERIDELKAKEEALRAAQTVESLLLSDERDF  189

Query  710  VIA  718
            V+ 
Sbjct  190  VLG  192


 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 135/200 (68%), Gaps = 4/200 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  + +E KA   A +   A  + S+L S +RDF++ + G QV V +L GK +G+YF
Sbjct  155  YPFTAERIDELKAKEEALRA--AQTVESLLLSDERDFVLGHEGTQVPVAELAGKTVGLYF  212

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WCGPC  FTP L  +YNELL KG  FE+VF+S D++E++F+EY+  MPW A+PF+D+
Sbjct  213  SAHWCGPCRSFTPQLVEIYNELLKKGEAFEIVFLSRDKEEKAFEEYYASMPWLALPFADN  272

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
             T+++L   F + GIP L+IL   GK    D V ++ E+G+ AYPFT ER+ +++  E+A
Sbjct  273  -TQKKLSRYFRIEGIPTLIILGPDGKTIRNDAVGLIREYGIRAYPFTKERLDDLEAEEKA  331

Query  656  T*REQSLKTVLVSTSRDYVI  715
                Q+L++VLVS  R++VI
Sbjct  332  KREAQTLESVLVSDERNFVI  351


 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 125/188 (66%), Gaps = 8/188 (4%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+K + ++ +A   A++  +A  L S+L S +R+F+I++ G QV V +L GK + +YF
Sbjct  315  YPFTKERLDDLEAEEKAKR--EAQTLESVLVSDERNFVIKHGGAQVLVSELVGKTVALYF  372

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  FTP L  VYNEL  +G  FE+VF+S+D+D+E+F++Y+  MPW A+PF D 
Sbjct  373  SAHWCPPCRGFTPKLIQVYNELKERGEAFEIVFISSDKDQEAFEDYYKSMPWLALPFGDK  432

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFT---LERV-KEIKD  643
             T++ L  +F VRGIP L+++   GK  T++    V  HG +AYPFT   LER+ KE+++
Sbjct  433  -TKKDLSRIFRVRGIPSLIVVGPDGKTLTDNARGAVSTHGAKAYPFTDAHLERLEKEMEE  491

Query  644  AEEAT*RE  667
              E + +E
Sbjct  492  LVEKSPKE  499



>ref|XP_006378294.1| hypothetical protein POPTR_0010s06990g [Populus trichocarpa]
 gb|ERP56091.1| hypothetical protein POPTR_0010s06990g [Populus trichocarpa]
Length=553

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = +2

Query  218  DRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFV  397
            +RDFLIRN+G QV+V +L GK +G YFS SWCGPC  FTP L  VY +L  KG+FEVVF+
Sbjct  18   ERDFLIRNNGDQVRVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQLSSKGDFEVVFI  77

Query  398  SADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVD  577
            S+D D+ESF  YF +MPW A+PFSD+ TR RL  +F VRGIPHLVI D +GKV+ +DGV 
Sbjct  78   SSDGDDESFNTYFSEMPWLAIPFSDTETRLRLKEVFEVRGIPHLVIFDTNGKVSCDDGVS  137

Query  578  IVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             V+EHGV+ YPF L+R+  +K  EE   + Q++ ++LVS+SRDYVI+
Sbjct  138  TVMEHGVDGYPFNLDRLNFLKKQEENAKKNQTISSILVSSSRDYVIS  184


 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 113/182 (62%), Gaps = 7/182 (4%)
 Frame = +2

Query  149  RKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHR  328
            +K    A++N     + SIL SS RD++I N G ++ + DL+GK +G+ FS      C  
Sbjct  158  KKQEENAKKN---QTISSILVSSSRDYVISNDGKKIPLLDLEGKLVGLCFSIH--TMCCE  212

Query  329  FTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  505
            FTP L  +Y  L  KG NFEVV +S D++EE FKE F  MPW A+PF+D  + E+L   F
Sbjct  213  FTPKLVELYKTLKEKGENFEVVLISLDDEEEDFKESFETMPWLALPFNDK-SCEKLVRYF  271

Query  506  TVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTV  685
             +  IP+LVI+ + GK    +  +++ EHG+EAYPFT E++ E+   E+A    Q+L++V
Sbjct  272  ELSTIPNLVIIGQDGKTLNSNVAELIEEHGIEAYPFTPEKLDELAAIEKAKLESQTLESV  331

Query  686  LV  691
            LV
Sbjct  332  LV  333


 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 75/121 (62%), Gaps = 2/121 (2%)
 Frame = +2

Query  257  KVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEY  433
            KV +L GK I +YFSA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E+
Sbjct  340  KVSELVGKNILLYFSAQWCPPCRAFLPKLIEAYHTIKGKDNAFEVIFISSDSDQSTFDEF  399

Query  434  FGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  613
            + +MPW A+PF D   ++ L   F ++GIP  V +  SG+  T++    +  +G +A+PF
Sbjct  400  YSEMPWLALPFVDG-RKQILSRKFKIQGIPAAVAIGPSGRTITKEARKHLTAYGADAFPF  458

Query  614  T  616
            T
Sbjct  459  T  459



>ref|XP_004984067.1| PREDICTED: probable nucleoredoxin 1-1-like [Setaria italica]
Length=580

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 131/174 (75%), Gaps = 2/174 (1%)
 Frame = +2

Query  206  LCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NF  382
            L + DRDFL+RNSG QVK+  ++   + +YFSASWC PC RFTP L   Y EL  +G +F
Sbjct  19   LAAGDRDFLVRNSGEQVKISSIEASPVALYFSASWCPPCRRFTPKLIEAYKELASQGKSF  78

Query  383  EVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD-ESGKVT  559
            EVVFVS D+DEE+F EYF KMPW AVPFSDS  RE LD  F V GIPHLVILD ++G+V 
Sbjct  79   EVVFVSGDQDEEAFNEYFAKMPWLAVPFSDSEGREALDGRFKVSGIPHLVILDAKTGEVY  138

Query  560  TEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            TEDGV +V E+GVEAYPFT ER+ E+K+ E+A    Q++K+VL +++RDY+I +
Sbjct  139  TEDGVGLVSEYGVEAYPFTPERINELKEQEKAAKENQTIKSVLGTSTRDYLITS  192


 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 97/153 (63%), Gaps = 2/153 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +  L S+L S D DF+I   G +V V +L GK + +YFSA WCGPC  F P L   YN++
Sbjct  337  SQTLESLLISGDLDFVIGKGGAKVPVSELVGKTVLLYFSAKWCGPCRAFLPMLVKEYNKI  396

Query  365  LPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K  +FE+VF+S+D D+ SF E+F +MPW A+P  D   +  L+  F +RGIP LV + 
Sbjct  397  KEKHSDFEIVFISSDSDQSSFDEFFTEMPWLALPLEDE-RKAFLEKTFRIRGIPSLVAIG  455

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
             +G+  + D    ++ HG EA+PFT ER++E++
Sbjct  456  PNGQTVSRDAKAQLMIHGAEAFPFTEERLEELQ  488


 Score =   121 bits (303),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 114/200 (57%), Gaps = 8/200 (4%)
 Frame = +2

Query  131  KRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASW  310
            +R  E ++    A++N     ++S+L +S RD+LI + G +V + +L+GK +G+ F    
Sbjct  159  ERINELKEQEKAAKEN---QTIKSVLGTSTRDYLITSKGDKVPISELEGKYVGLCFVVPG  215

Query  311  CGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRE  487
             GP   F   LA +Y +L   G  FEVV VS D DE SF E   KMPW A+P  D +  E
Sbjct  216  YGPVDEFISVLAKIYEKLKEVGEKFEVVAVSLDSDESSFNESLAKMPWLAIPQGDKMC-E  274

Query  488  RLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEA---YPFTLERVKEIKDAEEAT  658
            +L   F +R +P LV++   GK    +  DI+ EHG EA   +PF+ E+++ + +  +A 
Sbjct  275  KLVRYFELRTLPTLVLIGTDGKTLNTNVADIIEEHGFEAWEGFPFSAEKLETLAEKAKAK  334

Query  659  *REQSLKTVLVSTSRDYVIA  718
               Q+L+++L+S   D+VI 
Sbjct  335  AASQTLESLLISGDLDFVIG  354



>ref|XP_002314537.2| hypothetical protein POPTR_0010s06940g [Populus trichocarpa]
 gb|EEF00708.2| hypothetical protein POPTR_0010s06940g [Populus trichocarpa]
Length=564

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = +2

Query  218  DRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFV  397
            +RDFLIRN+G QVKV +L GK +G YFS SWCGPC  FTP L  VY +L  KG+FEVVF+
Sbjct  18   ERDFLIRNNGDQVKVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQLSSKGDFEVVFI  77

Query  398  SADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVD  577
            S+D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP+LVI D +GKV+ +DGV 
Sbjct  78   SSDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFDTNGKVSCDDGVS  137

Query  578  IVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             V EHGV+ YPF L+R+  +K+ EE   + Q++ ++LVS+SRDYVI+
Sbjct  138  TVKEHGVDGYPFNLDRLNFLKEQEENAKKNQTISSILVSSSRDYVIS  184


 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 119/188 (63%), Gaps = 5/188 (3%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFS      C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVLDLEGKLVGLYFSIHAHRMCREFT  216

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  +Y  L  KG NFEVV +S D +E+ FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLVELYKRLKEKGENFEVVLISLDSEEKHFKESFETMPWFALPFKDK-SCEKLARYFEL  275

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            R IP+LVI+ + GK    +  +++ +HG+EAYPFT E+++E+ + E+A    Q+L++VLV
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEDHGIEAYPFTPEKLEELAEIEKAKLESQTLESVLV  335

Query  692  STSRDYVI  715
            +   D+VI
Sbjct  336  NGENDFVI  343


 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 100/167 (60%), Gaps = 4/167 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K EE   + + +   ++  L S+L + + DF+I  SG +V+V DL GK I +YF
Sbjct  307  YPFTPEKLEE--LAEIEKAKLESQTLESVLVNGENDFVIDKSGSKVRVSDLVGKNILLYF  364

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDE  424

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFT  616
              ++ L   F ++GIP  V +  SG+  T++    +  +G +A+PFT
Sbjct  425  -RKQILSRKFKIQGIPAAVAIGPSGRTITKEARMHLTAYGADAFPFT  470



>ref|XP_006378293.1| disulfide isomerase family protein [Populus trichocarpa]
 gb|ERP56090.1| disulfide isomerase family protein [Populus trichocarpa]
Length=553

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 134/178 (75%), Gaps = 0/178 (0%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +HDL S+L S +RD LIRN+G QV+V +L GK +G YFS SWCGPC  FTP L  VY +L
Sbjct  7    SHDLSSLLSSEERDSLIRNNGDQVRVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQL  66

Query  365  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              KG+FEVVF+S+D D+ESF  YF +MPW A+PFSD+ TR RL  +F VRGIPHLVI D 
Sbjct  67   SSKGDFEVVFISSDGDDESFNTYFSEMPWLAIPFSDTETRLRLKEVFEVRGIPHLVIFDT  126

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            +GKV+ +DGV  V+EHGV+ YPF L+R+  +K  EE   + Q++ ++LVS+SRDYVI+
Sbjct  127  NGKVSCDDGVSTVMEHGVDGYPFNLDRLNFLKKQEENAKKNQTISSILVSSSRDYVIS  184


 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 113/182 (62%), Gaps = 7/182 (4%)
 Frame = +2

Query  149  RKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHR  328
            +K    A++N     + SIL SS RD++I N G ++ + DL+GK +G+ FS      C  
Sbjct  158  KKQEENAKKN---QTISSILVSSSRDYVISNDGKKIPLLDLEGKLVGLCFSIH--TMCCE  212

Query  329  FTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  505
            FTP L  +Y  L  KG NFEVV +S D++EE FKE F  MPW A+PF+D  + E+L   F
Sbjct  213  FTPKLVELYKTLKEKGENFEVVLISLDDEEEDFKESFETMPWLALPFNDK-SCEKLVRYF  271

Query  506  TVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTV  685
             +  IP+LVI+ + GK    +  +++ EHG+EAYPFT E++ E+   E+A    Q+L++V
Sbjct  272  ELSTIPNLVIIGQDGKTLNSNVAELIEEHGIEAYPFTPEKLDELAAIEKAKLESQTLESV  331

Query  686  LV  691
            LV
Sbjct  332  LV  333


 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 75/121 (62%), Gaps = 2/121 (2%)
 Frame = +2

Query  257  KVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEY  433
            KV +L GK I +YFSA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E+
Sbjct  340  KVSELVGKNILLYFSAQWCPPCRAFLPKLIEAYHTIKGKDNAFEVIFISSDSDQSTFDEF  399

Query  434  FGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  613
            + +MPW A+PF D   ++ L   F ++GIP  V +  SG+  T++    +  +G +A+PF
Sbjct  400  YSEMPWLALPFVDG-RKQILSRKFKIQGIPAAVAIGPSGRTITKEARKHLTAYGADAFPF  458

Query  614  T  616
            T
Sbjct  459  T  459



>ref|XP_008389657.1| PREDICTED: probable nucleoredoxin 1 [Malus domestica]
Length=566

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 137/184 (74%), Gaps = 0/184 (0%)
 Frame = +2

Query  167  AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  346
             +++G  HDL S++ S+DR+FL+RN+G Q ++  L GK +G+YFSASWCGPC RFTPNL 
Sbjct  4    GDEDGVTHDLLSLISSADRNFLLRNNGGQAEISSLTGKIVGLYFSASWCGPCLRFTPNLV  63

Query  347  TVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  526
             V+ +L  KG FEVVF+S+D DEESF  YF KMPW ++PFSD  TR+RL   F VRGIPH
Sbjct  64   EVHQDLAAKGGFEVVFISSDRDEESFTGYFSKMPWLSIPFSDLETRKRLKEFFKVRGIPH  123

Query  527  LVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRD  706
            LVI+D +G+V T DG  IV++HG + YPFT E++  +K+ E      QSL ++LVS+SRD
Sbjct  124  LVIIDANGRVCTNDGTKIVMDHGADGYPFTAEKMNLLKEKEATVKENQSLSSLLVSSSRD  183

Query  707  YVIA  718
            Y+I+
Sbjct  184  YLIS  187


 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 94/159 (59%), Gaps = 2/159 (1%)
 Frame = +2

Query  152  KASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRF  331
            K + +AE       ++S+L +  RDF+I N+G +V V +L GK I +YFSA WC PC  F
Sbjct  315  KIAVLAELKLKEQTIQSLLVAGGRDFVIENNGSKVPVSELAGKHILLYFSAHWCPPCRAF  374

Query  332  TPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFT  508
             P L   YN++  KGN  E++F+S+D D+ SFKE F  MPW A+P  D   +  L   F 
Sbjct  375  MPKLIKAYNQIKAKGNAIEIIFLSSDRDQPSFKELFATMPWLAIPLGDP-RQALLQHKFK  433

Query  509  VRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLER  625
            ++GIP LV +  +G+  +     ++  HG +AYPFT E 
Sbjct  434  IQGIPALVAISPNGQTLSTQARQLIQAHGSDAYPFTEEH  472


 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 103/166 (62%), Gaps = 6/166 (4%)
 Frame = +2

Query  221  RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFV  397
            RD+LI   G++V V +L+GK +G+YFS +   PC  FT  L   + ++  KG NFE+V +
Sbjct  182  RDYLISKDGNKVSVSELEGKIVGLYFSLNTHKPCKEFTQALVKFHEKMKEKGENFEIVLI  241

Query  398  SADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVD  577
            S D +EE FKE F ++ W A+PF D    E+L   F +  +P LVI+ + GK    +  +
Sbjct  242  SLDLEEEHFKEGF-QVSWLALPFKDK-NCEKLARYFELENLPTLVIIGQDGKTLHSNAAE  299

Query  578  IVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            ++ E+G EAYPFT E++  +    E   +EQ+++++LV+  RD+VI
Sbjct  300  LIEEYGAEAYPFTPEKIAVLA---ELKLKEQTIQSLLVAGGRDFVI  342



>ref|XP_004147954.1| PREDICTED: probable nucleoredoxin 1 [Cucumis sativus]
 gb|KGN55925.1| hypothetical protein Csa_3G036510 [Cucumis sativus]
Length=562

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 139/178 (78%), Gaps = 0/178 (0%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            H L S+  S  +++L+RN+G +V+++ LKGK +G+YFSA+WCG   RFTP+L  VYNEL 
Sbjct  12   HFLHSLFRSESQNYLLRNNGDKVEIEMLKGKTLGLYFSAAWCGQSQRFTPSLVEVYNELS  71

Query  368  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  547
             K NFEV+FVSAD+DE+SFK+YF +MPW AVPFSD   R+ LD+LF VRG+P L+ILD++
Sbjct  72   SKANFEVIFVSADDDEKSFKKYFSEMPWLAVPFSDLERRDHLDSLFEVRGVPQLIILDKN  131

Query  548  GKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            GK++T+ GVD V E G E YPFT++++ ++ + E A  R +SL++++VS+SRD+VI +
Sbjct  132  GKLSTDTGVDFVQEFGAEGYPFTVDKITQLLNQELAARRNESLRSIMVSSSRDFVITS  189


 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 105/175 (60%), Gaps = 2/175 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            LRSI+ SS RDF+I + G +V V +L+GK IG+YF  S    C  FTP L   Y +L  K
Sbjct  174  LRSIMVSSSRDFVITSKGEKVPVAELEGKIIGLYFLLSSYERCIAFTPKLVDAYEKLKAK  233

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            G  FE+V ++ D+DEE +KE   K+PW A+PF D+   ++L   F V  +P LVI+ + G
Sbjct  234  GERFEIVLITIDQDEELYKEALRKVPWFALPFRDNRC-DKLIRYFEVSTLPTLVIIGQDG  292

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            K    +  + V EHG   YPFT E+  E+ +  +A    Q+L+++LV    ++VI
Sbjct  293  KTLYSNVANAVDEHGFLPYPFTKEKFAELAEIVKAKEEAQTLESILVLGEHNHVI  347


 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 99/178 (56%), Gaps = 8/178 (4%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+K K  E   + + +   +A  L SIL   + + +I+N   ++ V +L GK I IY 
Sbjct  311  YPFTKEKFAE--LAEIVKAKEEAQTLESILVLGEHNHVIKNDETKIPVSNLVGKNILIYI  368

Query  299  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSD-  472
            SA WC PC  F P L   Y+ +  K  N EV+F+S D DE SFK  F +MPW AVPF D 
Sbjct  369  SADWCPPCRVFLPKLIETYHNVKKKDDNLEVIFISCDRDESSFKNMFSRMPWLAVPFDDP  428

Query  473  --SVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +  R +      V G+P L+ + E G+  T D V+++  +G +A+PF   R++E+K
Sbjct  429  RKAWIRRKFKV--QVEGMPALISIGEDGRTATNDAVELISNYGAKAFPFNAGRIEEMK  484



>ref|XP_008459538.1| PREDICTED: probable nucleoredoxin 1 [Cucumis melo]
 gb|AAU04765.1| protein disulfide isomerase (PDI)-like protein 1 [Cucumis melo]
 gb|AGH33852.1| PDI1 [Cucumis melo]
Length=341

 Score =   209 bits (533),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 136/180 (76%), Gaps = 3/180 (2%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            +DL+S+L S  RDFLIRN+G QVK+  L GK +G+YFSA WC PC  FTP LA VY EL 
Sbjct  7    YDLKSLLSSEGRDFLIRNNGDQVKISSLSGKIVGLYFSAGWCPPCRFFTPKLAKVYKELA  66

Query  368  PKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             + N FEVVF+S+D DE SF+ YF +MPW ++PF DS T+ +L +LF + GIPHLV++D 
Sbjct  67   SENNDFEVVFISSDGDEYSFEAYFLRMPWLSIPFEDSETKTKLKSLFQLSGIPHLVVIDG  126

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKE--IKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            +GKV+++DGVD+V + GV+AYPFT +R K+  I+  EEA    Q++ ++LVSTSR+YV++
Sbjct  127  NGKVSSDDGVDLVRDFGVDAYPFTSDRKKQLLIQKEEEAKRNNQTIDSLLVSTSRNYVVS  186


 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 107/190 (56%), Gaps = 4/190 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  + ++       E   +   + S+L S+ R++++ N G+Q+ V +L+GK IG+YF
Sbjct  147  YPFTSDRKKQLLIQKEEEAKRNNQTIDSLLVSTSRNYVVSNDGNQIPVYELEGKLIGLYF  206

Query  299  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSAD--EDEESFKEYFGKMPWTAVPFS  469
            S      C  FTP L   YN+L  K  NFE+VF+S D  EDE  FKE F  MPW A+PF 
Sbjct  207  SKQGHEDCGNFTPKLIEAYNKLKKKEENFEIVFISLDEEEDENLFKEAFKTMPWLALPFK  266

Query  470  DSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAE  649
            D   +E L   F V  IP LVI+ + GK +  + V+++  HG++AYPFT + +  + D  
Sbjct  267  DERCQE-LKLYFEVTHIPALVIIGQDGKTSNPNAVELIKGHGIDAYPFTPKNLDVLDDIP  325

Query  650  EAT*REQSLK  679
             A    QS K
Sbjct  326  NARLESQSPK  335



>emb|CCP27784.1| unnamed protein product [Arabidopsis halleri subsp. halleri]
Length=662

 Score =   217 bits (552),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = +2

Query  251  QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKE  430
            QVK+D L GKKIG+YFSA+WCGPC RFTP L  VYNEL  K  FE+VFVS DEDEESF +
Sbjct  307  QVKIDSLIGKKIGLYFSAAWCGPCQRFTPQLVEVYNELSSKVGFEIVFVSGDEDEESFGD  366

Query  431  YFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYP  610
            YF KMPW AVPF+DS TR+RLD LF VRGIP+LV++D+ GK+  E+GV ++  +G +AYP
Sbjct  367  YFSKMPWLAVPFTDSETRDRLDELFKVRGIPNLVMVDDHGKLVNENGVGVIRSYGADAYP  426

Query  611  FTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            FT E++KEIK+ E+   REQ+L++VLV+ SRD+VI+
Sbjct  427  FTPEKMKEIKEDEDRARREQTLRSVLVTPSRDFVIS  462



>ref|XP_002314536.2| hypothetical protein POPTR_0010s06970g [Populus trichocarpa]
 gb|EEF00707.2| hypothetical protein POPTR_0010s06970g [Populus trichocarpa]
Length=473

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = +2

Query  218  DRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFV  397
            +RDFLIRN+G QVKV DL GK +G YFS SWCGPC  FTP L  VY  L  KG+FEVVF+
Sbjct  18   ERDFLIRNNGDQVKVSDLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEHLSSKGDFEVVFI  77

Query  398  SADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVD  577
            S+D D+ESF  YF +MPW A+PFS++ TR+RL  +F VRGIP LVI D +GKV+ ++GV 
Sbjct  78   SSDGDDESFNTYFSEMPWLAIPFSETETRQRLKEVFKVRGIPRLVIFDTNGKVSCDNGVS  137

Query  578  IVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             V EHGV+ YPF L+R+  +K+ EE   + Q++ ++LVS+SRDYVI+
Sbjct  138  TVKEHGVDGYPFNLDRLNFLKEQEENAKKNQTISSILVSSSRDYVIS  184


 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 117/189 (62%), Gaps = 5/189 (3%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFS      C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVSDLEGKLVGLYFSVHAHRMCGEFT  216

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  +Y  L  KG NFEVV +S D++EE FKE F  MPW A+P  D  + E+L   F +
Sbjct  217  PKLVELYKTLKEKGENFEVVLLSLDDEEEDFKESFETMPWLALPLKDK-SCEKLVRYFEL  275

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            R IP+LVI+ + GK    +  +++ EHG+EAYPFT E++ E+   E+A    Q+L++VLV
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEEHGIEAYPFTPEKLDELAAIEKAKLESQTLESVLV  335

Query  692  STSRDYVIA  718
            +   D+VI 
Sbjct  336  NGENDFVIG  344


 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 97/166 (58%), Gaps = 4/166 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K +E  A   A+   ++  L S+L + + DF+I  SG +V V DL GK I +YF
Sbjct  307  YPFTPEKLDELAAIEKAKL--ESQTLESVLVNGENDFVIGKSGSKVPVSDLVGKNILLYF  364

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKRKDNAFEVIFISSDRDQSTFDEFYSEMPWLALPFGDE  424

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  613
              ++ L   F ++GIP  V +  SG+  T++    +  +G +A+P 
Sbjct  425  -RKQILSRKFKIQGIPAAVAIGPSGRTITKEARMHLTAYGADAFPL  469



>tpg|DAA45727.1| TPA: PDI-like protein [Zea mays]
Length=569

 Score =   215 bits (547),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 133/174 (76%), Gaps = 2/174 (1%)
 Frame = +2

Query  203  ILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-N  379
            IL +SDRDFL+RNSG QVK+  ++   + IYFSASWC PC RFTP L  VY +L  +G +
Sbjct  15   ILATSDRDFLVRNSGEQVKISSVEASPVAIYFSASWCPPCRRFTPKLIEVYEKLASQGKS  74

Query  380  FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD-ESGKV  556
            FEVVF SAD +EE+F EYF KMPW AVPFSDS  RE LD  F V GIPHLVILD ++G+V
Sbjct  75   FEVVFASADRNEEAFNEYFAKMPWLAVPFSDSEGREALDGQFKVSGIPHLVILDAKTGEV  134

Query  557  TTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             TEDGV+ V E+GVEAYPFT +R+ E+K+ E+A    Q++++VL +++RDY+I+
Sbjct  135  YTEDGVEFVSEYGVEAYPFTPDRINELKEQEKAEKENQTIQSVLGTSTRDYLIS  188


 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 104/175 (59%), Gaps = 4/175 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            F FS  K E    +  A+    +  L SIL S   DF+I   G +V V +L GK + +YF
Sbjct  314  FPFSAEKLE--ILAEKAKIKAASQTLESILISGHLDFVIGKDGAKVPVSELVGKTVLVYF  371

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   YN++  K  +FE+VF+S+DED+ SF ++F +MPW AVP+ D 
Sbjct  372  SAKWCPPCRAFLPTLVKEYNKIKEKNSDFEIVFISSDEDQSSFDDFFSEMPWLAVPWEDE  431

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +  L   F +RGIP LV +  +G+  + D    ++ HG +A+PFT ER++E++
Sbjct  432  -RKASLKKTFKIRGIPSLVAIGPTGQTVSRDAKSQLMIHGADAFPFTEERLEELQ  485


 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 113/204 (55%), Gaps = 7/204 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  +  E K    AE+  +   ++S+L +S RD+LI N G +V + +L+GK +G+ F
Sbjct  151  YPFTPDRINELKEQEKAEK--ENQTIQSVLGTSTRDYLISNKGDKVPISELEGKYVGLCF  208

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
                  P   FT  LA +Y +L   G  FEVV VS D +E SF E F KMPW A+P  D 
Sbjct  209  VVDGFPPLAEFTEVLAKIYEKLKEVGEKFEVVAVSLDSEESSFNESFAKMPWLAIPQGD-  267

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEA---YPFTLERVKEIKDA  646
            +  + L   F +  +P LV++   GK    +  DI+ +HG EA   +PF+ E+++ + + 
Sbjct  268  IKCQTLVRYFELSSLPTLVLIGPDGKTLNNNVADIIDDHGFEAWEGFPFSAEKLEILAEK  327

Query  647  EEAT*REQSLKTVLVSTSRDYVIA  718
             +     Q+L+++L+S   D+VI 
Sbjct  328  AKIKAASQTLESILISGHLDFVIG  351



>emb|CBI28543.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   214 bits (545),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 143/187 (76%), Gaps = 2/187 (1%)
 Frame = +2

Query  164  MAEQN--GDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            MA +N  G AHDL  +L   DRDFL+R +GHQVKV+ LKGKKI +YFSASWCGP  +FTP
Sbjct  1    MASENVDGVAHDLVPLLTREDRDFLVRCNGHQVKVESLKGKKIWLYFSASWCGPRRQFTP  60

Query  338  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  517
             L  VY+E   KG+FE++FVS D+ ++ F EYF KMPW A+PFSDS TR+ L  LF VRG
Sbjct  61   ELVEVYDEFSSKGDFEIIFVSRDKGDQLFNEYFSKMPWLAIPFSDSDTRDHLKKLFKVRG  120

Query  518  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVST  697
            IP L +LDESGKV + +GV+I+ ++GVE YPFT E++KE+K+ EE   +EQSL ++LVS 
Sbjct  121  IPSLAMLDESGKVLSSEGVEIIKDYGVEGYPFTAEKIKELKEKEETAKKEQSLISILVSQ  180

Query  698  SRDYVIA  718
            SRDYVI+
Sbjct  181  SRDYVIS  187


 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 111/178 (62%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L SIL S  RD++I   G +V V +L+GK +G+YFS S   P  +FT  L  VY +L 
Sbjct  171  QSLISILVSQSRDYVISTDGKRVPVSELEGKFVGLYFSLSSSKPRLQFTRTLVDVYKKLR  230

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             KG +FE+V +S D++ ESFK  FG MPW A+PF D   + +L   F +  +P LV++  
Sbjct  231  AKGESFEIVMISLDDEIESFKTNFGSMPWLALPFKDRSCK-KLARYFELSALPTLVVIGP  289

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK    +  + + EHG++AYPFT E+  E+++ E+A    Q+L+++LVS +RD+VI 
Sbjct  290  DGKTLHSNVAEAIQEHGIQAYPFTPEKFAELEEIEKAKREAQTLESILVSGNRDFVIG  347


 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 93/154 (60%), Gaps = 2/154 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L SIL S +RDF+I     ++ V DL GK I +YFSA WC PC  F P L   Y  
Sbjct  329  EAQTLESILVSGNRDFVIGKDRVKIPVSDLVGKNILLYFSAHWCPPCRAFLPKLIEAYQN  388

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K   FEV+F+S+D D+ SF E+F  MPW A+PF D   +  L   F VR IP L+ +
Sbjct  389  IKAKDEAFEVIFISSDRDQASFDEFFSGMPWLALPFGDK-RKASLGRTFKVRSIPKLIAV  447

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
            + +G+  T +   +V+ HG +AYPFT E +KEI+
Sbjct  448  EPTGRTVTTEARTLVMIHGADAYPFTEEHIKEIE  481



>gb|ACF82903.1| unknown [Zea mays]
Length=569

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 133/174 (76%), Gaps = 2/174 (1%)
 Frame = +2

Query  203  ILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-N  379
            IL +SDRDFL+RNSG QVK+  ++   + IYFSASWC PC RFTP L  VY +L  +G +
Sbjct  15   ILATSDRDFLVRNSGEQVKISSVEASPVAIYFSASWCPPCRRFTPKLIEVYEKLASQGKS  74

Query  380  FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD-ESGKV  556
            FEVVF SAD +EE+F EYF KMPW AVPFSDS  RE LD  F V GIPHLVILD ++G+V
Sbjct  75   FEVVFASADRNEEAFNEYFAKMPWLAVPFSDSEGREALDGRFKVSGIPHLVILDAKTGEV  134

Query  557  TTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             TEDGV+ V E+GVEAYPFT +R+ E+K+ E+A    Q++++VL +++RDY+I+
Sbjct  135  YTEDGVEFVSEYGVEAYPFTPDRINELKEQEKAEKENQTIQSVLGTSTRDYLIS  188


 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 104/175 (59%), Gaps = 4/175 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            F FS  K E    +  A+    +  L SIL S   DF+I   G +V V +L GK + +YF
Sbjct  314  FPFSAEKLE--ILAEKAKIKAASQTLESILISGHLDFVIGKDGAKVPVSELVGKTVLVYF  371

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   YN++  K  +FE+VF+S+DED+ SF ++F +MPW AVP+ D 
Sbjct  372  SAKWCPPCRAFLPTLVKEYNKIKEKNSDFEIVFISSDEDQSSFDDFFSEMPWLAVPWEDE  431

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +  L   F +RGIP LV +  +G+  + D    ++ HG +A+PFT ER++E++
Sbjct  432  -RKASLKKTFKIRGIPSLVAIGPTGQTVSRDAKSQLMIHGADAFPFTEERLEELQ  485


 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 112/204 (55%), Gaps = 7/204 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  +  E K    AE+      ++S+L +S RD+LI N G +V + +L+GK +G+ F
Sbjct  151  YPFTPDRINELKEQEKAEKEN--QTIQSVLGTSTRDYLISNKGDKVPISELEGKYVGLCF  208

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
                  P   FT  LA +Y +L   G  FEVV VS D +E SF E F KMPW A+P  D 
Sbjct  209  VVDGFPPLAEFTEVLAKIYEKLKEVGEKFEVVAVSLDSEESSFNESFAKMPWLAIPQGD-  267

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEA---YPFTLERVKEIKDA  646
            +  + L   F +  +P LV++   GK    +  DI+ +HG EA   +PF+ E+++ + + 
Sbjct  268  IKCQTLVRYFELSSLPTLVLIGPDGKTLNNNVADIIDDHGFEAWEGFPFSAEKLEILAEK  327

Query  647  EEAT*REQSLKTVLVSTSRDYVIA  718
             +     Q+L+++L+S   D+VI 
Sbjct  328  AKIKAASQTLESILISGHLDFVIG  351



>ref|XP_002314533.2| hypothetical protein POPTR_0010s06960g [Populus trichocarpa]
 gb|EEF00704.2| hypothetical protein POPTR_0010s06960g [Populus trichocarpa]
Length=564

 Score =   214 bits (545),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +HDL S+L S +RDFLIRN+G QVKV +L GK +G YFS SWCGPC  FTP L  VY +L
Sbjct  7    SHDLSSLLSSEERDFLIRNNGDQVKVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQL  66

Query  365  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              KG FEVVF+S+D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP LVI D 
Sbjct  67   SSKGGFEVVFISSDGDDESFNTYFSEMPWLAIPFSDTETRQRLKEVFKVRGIPRLVIFDT  126

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            +GKV++++GV  V EHGV+ YPF L+R+  +K+ EE   + Q++ ++LVS+SRDYVI+
Sbjct  127  NGKVSSDNGVRHVKEHGVDGYPFNLDRLNFLKEQEENAKKNQTISSILVSSSRDYVIS  184


 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 118/188 (63%), Gaps = 5/188 (3%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFSA     C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVLDLEGKLVGLYFSAHAHRMCREFT  216

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  +Y  L  KG NFEVV +S D++EE FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLVELYKTLKEKGENFEVVLISLDDEEEDFKESFETMPWLALPFKDK-SCEKLVRYFEL  275

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            R IP+LVI+ + GK       +++ EHG+EAYPFT E++ E+   E+A    Q+L++VLV
Sbjct  276  RTIPNLVIIGQDGKTLNPYVAELIEEHGIEAYPFTPEKLDELAAIEKAKLESQTLESVLV  335

Query  692  STSRDYVI  715
            +   D+VI
Sbjct  336  NGENDFVI  343


 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 99/167 (59%), Gaps = 4/167 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K +E  A   A+   ++  L S+L + + DF+I  SG +V V +L GK I +YF
Sbjct  307  YPFTPEKLDELAAIEKAKL--ESQTLESVLVNGENDFVIDKSGSKVPVSELVGKNILLYF  364

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKRKDNAFEVIFISSDRDQSTFDEFYSEMPWLALPFGDG  424

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFT  616
              ++ L   F ++GIP  V +  SG+  T++    +  +G +A+PFT
Sbjct  425  -RKQILSRKFKIQGIPAAVAIGPSGRTITKEARMHLTAYGADAFPFT  470



>ref|XP_008448920.1| PREDICTED: probable nucleoredoxin 1 [Cucumis melo]
Length=562

 Score =   214 bits (545),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            H L ++  S  +++L+RN+G +V+++ LKGK +G+YFSA+WCG   RFTP+L  VYNEL 
Sbjct  12   HFLHALFRSETQNYLLRNNGEKVEIEMLKGKTLGLYFSAAWCGQSQRFTPSLVEVYNELS  71

Query  368  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  547
             K NFEV+FVSAD+DE+SF++YF KMPW AVPFSD   R+ LD+LF VRGIP L+ILD++
Sbjct  72   SKANFEVIFVSADDDEKSFRKYFSKMPWLAVPFSDLERRDHLDSLFEVRGIPQLIILDKN  131

Query  548  GKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            GK +T+ GVD VLE G E YPFT++++ ++ + E      +SL++++VS+SRD+VI +
Sbjct  132  GKFSTDSGVDFVLEFGAEGYPFTVDKITQLLNQEAVARMNESLRSIMVSSSRDFVITS  189


 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 105/175 (60%), Gaps = 2/175 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            LRSI+ SS RDF+I + G +V V +L+GK IG+YFS S    C  FTP L   Y +L  K
Sbjct  174  LRSIMVSSSRDFVITSKGEKVPVAELEGKVIGLYFSLSSYERCIAFTPKLVDAYEKLKAK  233

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            G  FE+V ++ D+DEE +KE    +PW A+PF D+   ++L   F V  +P LVI+ + G
Sbjct  234  GEKFEIVLIAIDQDEELYKEALRNVPWFALPFRDNRC-DKLIRYFEVSTLPTLVIIGQDG  292

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            K    +  + V EHG   YPFT E+  E+   E+A    Q+L+++LV    DYVI
Sbjct  293  KTLHSNVANAVAEHGFLPYPFTEEKFAELAKIEKAKEEAQTLESILVLGEHDYVI  347


 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 99/176 (56%), Gaps = 4/176 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F++ K  E      A++  +A  L SIL   + D++I+N   ++ V +L GK I IY 
Sbjct  311  YPFTEEKFAELAKIEKAKE--EAQTLESILVLGEHDYVIKNDETKIPVSNLVGKNILIYI  368

Query  299  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+ +  K  N EV+F+S D DE SFK  F +MPW AVPF D 
Sbjct  369  SADWCPPCRVFLPKLIETYHNVKKKDDNLEVIFISCDRDESSFKNMFSRMPWLAVPFDDQ  428

Query  476  VTRE-RLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
                 R      V G+P L+ + E G+  T+D V+++  +G +AYPF   R++E+K
Sbjct  429  RKASIRRKFKVQVEGMPALISIGEDGRTVTDDAVELISNYGAKAYPFNAGRIEELK  484



>ref|XP_002314534.2| hypothetical protein POPTR_0010s07000g [Populus trichocarpa]
 gb|EEF00705.2| hypothetical protein POPTR_0010s07000g [Populus trichocarpa]
Length=564

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +HDL S+L S +RDFLIRN+G QVKV +L GK +G YFS SWCGPC  FTP L  VY +L
Sbjct  7    SHDLSSLLSSEERDFLIRNNGDQVKVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQL  66

Query  365  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              KG+FEVVF+S+D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP LVI D 
Sbjct  67   SSKGDFEVVFISSDGDDESFNTYFSEMPWLAIPFSDTETRQRLKEVFKVRGIPRLVIFDT  126

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            +GKV+ ++GV  V EHGV+ YPF L+R+  +K+ EE   + Q++ ++LVS+SRDYVI+
Sbjct  127  NGKVSCDNGVRHVKEHGVDGYPFNLDRLNFLKEQEENAKKNQTISSILVSSSRDYVIS  184


 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 118/188 (63%), Gaps = 5/188 (3%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFSA     C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVLDLEGKLVGLYFSAHAHRMCREFT  216

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  +Y  L  K  NFEVV +S D++EE FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLVELYKTLKEKRENFEVVLISLDDEEEDFKESFETMPWLALPFKDK-SCEKLVRYFEL  275

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            R IP+LVI+ + GK    +  +++ EHG+EAYPFT E++ E+   E+A    Q+L++VLV
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEEHGIEAYPFTPEKLDELAAIEKAKLESQTLESVLV  335

Query  692  STSRDYVI  715
            +   D+VI
Sbjct  336  NGENDFVI  343


 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 99/167 (59%), Gaps = 4/167 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K +E  A   A+   ++  L S+L + + DF+I  SG +V V +L GK I +YF
Sbjct  307  YPFTPEKLDELAAIEKAKL--ESQTLESVLVNGENDFVIDKSGSKVPVSELVGKNILLYF  364

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKRKDNAFEVIFISSDRDQSTFDEFYSEMPWLALPFGDG  424

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFT  616
              ++ L   F ++GIP  V +  SG+  T++    +  +G +A+PFT
Sbjct  425  -RKQILSRKFKIQGIPAAVAIGPSGRTITKEARMHLTAYGADAFPFT  470



>emb|CAN63033.1| hypothetical protein VITISV_044051 [Vitis vinifera]
Length=570

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 143/187 (76%), Gaps = 2/187 (1%)
 Frame = +2

Query  164  MAEQN--GDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            MA +N  G AHDL  +L   DRDFL+R +GHQVKV+ LKGKKI +YFSASWCGP  +FTP
Sbjct  1    MASENVDGVAHDLVPLLTREDRDFLVRCNGHQVKVESLKGKKIWLYFSASWCGPRRQFTP  60

Query  338  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  517
             L  VY+E   KG+FE++FVS D+ ++ F EYF KMPW A+PFSDS TR+ L  LF VRG
Sbjct  61   ELVEVYDEFSSKGDFEIIFVSRDKGDQLFNEYFSKMPWLAIPFSDSDTRDHLKKLFKVRG  120

Query  518  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVST  697
            IP L +LDESGKV + +GV+I+ ++GVE YPFT E++KE+K+ EE   +EQSL ++LVS 
Sbjct  121  IPSLAMLDESGKVLSSEGVEIIKDYGVEGYPFTAEKIKELKEKEETAKKEQSLISILVSQ  180

Query  698  SRDYVIA  718
            SRDYVI+
Sbjct  181  SRDYVIS  187


 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 111/178 (62%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L SIL S  RD++I   G +V V +L+GK +G+YFS S   P  +FT  L  VY +L 
Sbjct  171  QSLISILVSQSRDYVISTDGKRVPVSELEGKFVGLYFSLSSSKPRLQFTRTLVDVYKKLR  230

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             KG +FE+V +S D++ ESFK  FG MPW A+PF D   + +L   F +  +P LV++  
Sbjct  231  AKGESFEIVMISLDDEIESFKTNFGSMPWLALPFKDRSCK-KLARYFELSALPTLVVIGP  289

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK    +  + + EHG++AYPFT E+  E+++ E+A    Q+L+++LVS +RD+VI 
Sbjct  290  DGKTLHSNVAEAIQEHGIQAYPFTPEKFAELEEIEKAKREAQTLESILVSGNRDFVIG  347


 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 93/154 (60%), Gaps = 2/154 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L SIL S +RDF+I     ++ V DL GK I +YFSA WC PC  F P L   Y  
Sbjct  329  EAQTLESILVSGNRDFVIGKDRVKIPVSDLVGKNILLYFSAHWCPPCRAFLPKLIEAYQN  388

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K   FEV+F+S+D D+ SF E+F  MPW A+PF D   +  L   F VR IP L+ +
Sbjct  389  IKAKDEAFEVIFISSDRDQASFDEFFSGMPWXALPFGDK-RKASLGRTFKVRSIPKLIAV  447

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
            + +G+  T +   +V+ HG +AYPFT E +KEI+
Sbjct  448  EPTGRTVTTEARTLVMIHGADAYPFTEEHIKEIE  481



>ref|XP_010651408.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Vitis vinifera]
Length=570

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 143/187 (76%), Gaps = 2/187 (1%)
 Frame = +2

Query  164  MAEQN--GDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            MA +N  G AHDL  +L   DRDFL+R +GHQVKV+ LKGKKI +YFSASWCGP  +FTP
Sbjct  1    MASENVDGVAHDLVPLLTREDRDFLVRCNGHQVKVESLKGKKIWLYFSASWCGPRRQFTP  60

Query  338  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  517
             L  VY+E   KG+FE++FVS D+ ++ F EYF KMPW A+PFSDS TR+ L  LF VRG
Sbjct  61   ELVEVYDEFSSKGDFEIIFVSRDKGDQLFNEYFSKMPWLAIPFSDSDTRDHLKKLFKVRG  120

Query  518  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVST  697
            IP L +LDESGKV + +GV+I+ ++GVE YPFT E++KE+K+ EE   +EQSL ++LVS 
Sbjct  121  IPSLAMLDESGKVLSSEGVEIIKDYGVEGYPFTAEKIKELKEKEETAKKEQSLISILVSQ  180

Query  698  SRDYVIA  718
            SRDYVI+
Sbjct  181  SRDYVIS  187


 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 111/178 (62%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L SIL S  RD++I   G +V V +L+GK +G+YFS S   P  +FT  L  VY +L 
Sbjct  171  QSLISILVSQSRDYVISTDGKRVPVSELEGKFVGLYFSLSSSKPRLQFTRTLVDVYKKLR  230

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             KG +FE+V +S D++ ESFK  FG MPW A+PF D   + +L   F +  +P LV++  
Sbjct  231  AKGESFEIVMISLDDEIESFKTNFGSMPWLALPFKDRSCK-KLARYFELSALPTLVVIGP  289

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK    +  + + EHG++AYPFT E+  E+++ E+A    Q+L+++LVS +RD+VI 
Sbjct  290  DGKTLHSNVAEAIQEHGIQAYPFTPEKFAELEEIEKAKREAQTLESILVSGNRDFVIG  347


 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 93/154 (60%), Gaps = 2/154 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L SIL S +RDF+I     ++ V DL GK I +YFSA WC PC  F P L   Y  
Sbjct  329  EAQTLESILVSGNRDFVIGKDRVKIPVSDLVGKNILLYFSAHWCPPCRAFLPKLIEAYQN  388

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K   FEV+F+S+D D+ SF E+F  MPW A+PF D   +  L   F VR IP L+ +
Sbjct  389  IKAKDEAFEVIFISSDRDQASFDEFFSGMPWLALPFGDK-RKASLGRTFKVRSIPKLIAV  447

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
            + +G+  T +   +V+ HG +AYPFT E +KEI+
Sbjct  448  EPTGRTVTTEARTLVMIHGADAYPFTEEHIKEIE  481



>ref|XP_009762379.1| PREDICTED: probable nucleoredoxin 1 [Nicotiana sylvestris]
Length=547

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 129/183 (70%), Gaps = 0/183 (0%)
 Frame = +2

Query  170  EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  349
            +Q    HDL  +L S +RDFLI  +G QVK+  +KGK +G+YFS  WCG C +FTP L  
Sbjct  6    DQESFPHDLAVVLSSEERDFLICGNGEQVKISSIKGKIVGLYFSGLWCGLCRQFTPKLVE  65

Query  350  VYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  529
             Y +L PKG+FE+VF+S+D+D ESF EYFGKMPW AVPF+D+  R++L   F VR IPHL
Sbjct  66   AYEDLYPKGDFEIVFISSDKDNESFNEYFGKMPWLAVPFADAEARKKLKQSFKVRAIPHL  125

Query  530  VILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDY  709
            VILD +GKV + +GV  +   G EAYPFT ERV  +++ EE     QSL+++LV  SRD+
Sbjct  126  VILDGTGKVLSNEGVKFIKHFGPEAYPFTSERVNYLREEEEKAKENQSLRSILVHESRDF  185

Query  710  VIA  718
            +I+
Sbjct  186  LIS  188


 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 108/183 (59%), Gaps = 2/183 (1%)
 Frame = +2

Query  170  EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  349
            E+  +   LRSIL    RDFLI N   ++ V DL+GK +G+YF+ +    C  FT  LA 
Sbjct  166  EKAKENQSLRSILVHESRDFLISNEESKIVVSDLEGKTVGLYFAMASHKGCRNFTLKLAD  225

Query  350  VYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  529
            VY +L  K NFE+V +S DE  E F E F  MPW A+ F D    ERL   F  + +P L
Sbjct  226  VYKKLKQK-NFEIVLLSLDEKYEDFNEGFEAMPWLALSFKDK-NCERLVRYFEHKLLPQL  283

Query  530  VILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDY  709
            V++   GK   ++ V +V E+G +A+PFT E++  + + ++     Q+L+++LV+  RD+
Sbjct  284  VVISPDGKTLQQNAVKLVEEYGDQAFPFTQEKLITLANLKKEKLEAQTLESILVTADRDF  343

Query  710  VIA  718
            VI+
Sbjct  344  VIS  346


 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 93/168 (55%), Gaps = 2/168 (1%)
 Frame = +2

Query  158  SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            +++ ++  +A  L SIL ++DRDF+I N G +V V  L G  I +YF+A W  P   F P
Sbjct  320  ANLKKEKLEAQTLESILVTADRDFVISNGGLKVPVSKLVGNNIVLYFAAQWSLPSREFLP  379

Query  338  NLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  514
             L T Y E+  K   FEV+F+S+D+DE SF   F +MPW  +PF D   +  L   F + 
Sbjct  380  KLITTYQEIKKKDETFEVIFISSDQDESSFNNLFSRMPWLELPFDDD-RKAFLWRRFNIV  438

Query  515  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT  658
            GIP ++ +  SG         ++  HG  AYPFT E +K ++   + T
Sbjct  439  GIPVVIAISPSGCTVNTQVRQLLETHGAGAYPFTEEHIKNLQQRLDKT  486



>ref|XP_006378292.1| hypothetical protein POPTR_0010s06950g [Populus trichocarpa]
 gb|ERP56089.1| hypothetical protein POPTR_0010s06950g [Populus trichocarpa]
Length=564

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = +2

Query  218  DRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFV  397
            +RDFLIRN+G QVKV DL GK +G YFS SWCGPC  FTP L  VY  L  KG+FEVVF+
Sbjct  18   ERDFLIRNNGDQVKVSDLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEHLSSKGDFEVVFI  77

Query  398  SADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVD  577
            S+D D+ESF  YF +MPW A+PFS++ TR+RL  LF VRGIP LVI D +GKV+ ++GV 
Sbjct  78   SSDGDDESFNTYFSEMPWLAIPFSETETRQRLKELFKVRGIPRLVIFDTNGKVSCDNGVS  137

Query  578  IVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             V EHGV+ YPF L+R+  +K+ EE   + Q++ ++LVS+SRDYVI+
Sbjct  138  TVKEHGVDGYPFNLDRLNFLKEQEENAKKNQTISSILVSSSRDYVIS  184


 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 117/189 (62%), Gaps = 5/189 (3%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFS      C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVLDLEGKLVGLYFSIHAHRMCREFT  216

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  +Y  L  KG NFEVV +S D +E+ FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLVELYKRLKEKGENFEVVLISLDSEEKHFKESFETMPWFALPFKDK-SCEKLARYFEL  275

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            R IP+LVI+ + GK    +  +++ +HG+EAYPFT E++ E+ D + A    Q+L++VLV
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEDHGIEAYPFTPEKLDELADIKRAKLESQTLESVLV  335

Query  692  STSRDYVIA  718
            +   D+VI 
Sbjct  336  NGENDFVIG  344


 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 90/146 (62%), Gaps = 2/146 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            ++  L S+L + + DF+I  SG +V V DL GK I +YFSA WC PC  F P L   Y+ 
Sbjct  326  ESQTLESVLVNGENDFVIGKSGSKVPVSDLVGKNILLYFSAQWCPPCRAFLPKLIEAYHA  385

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D   ++ L   F ++GIP  V +
Sbjct  386  IKAKDNAFEVIFISSDSDQTTFDEFYSEMPWLALPFGDG-RKQILSRKFKIQGIPAAVAI  444

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFT  616
              SG+  T++    +  +G +A+PFT
Sbjct  445  GPSGRTITKEARMHLTAYGADAFPFT  470



>ref|XP_011041505.1| PREDICTED: probable nucleoredoxin 1 [Populus euphratica]
Length=561

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +HDL S+L S +RDFLIRN+G QV+V +L GK +G YFS SWCGPC  FTP L  VY +L
Sbjct  7    SHDLSSLLSSGERDFLIRNNGDQVRVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQL  66

Query  365  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              KG+FEVVF+S+D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP+ VI D 
Sbjct  67   SSKGDFEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNHVIFDT  126

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            +GKV+ ++GV  V EHGV+ YPF L+R+  +K+ EE   + Q++ ++LVS+SRDYVI+
Sbjct  127  NGKVSCDNGVSTVKEHGVDGYPFNLDRLNFLKEQEENAKKNQTISSILVSSSRDYVIS  184


 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 116/188 (62%), Gaps = 7/188 (4%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFS      C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVLDLEGKLVGLYFSIH--AICCEFT  214

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  +Y  L  KG NFEVV +S D DEE FKE F  MPW A+PF D   + +L   F +
Sbjct  215  PKLVELYKTLKEKGENFEVVLISLDYDEEDFKESFETMPWLALPFKDKSCK-KLVRYFEL  273

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            R IP+LVI+ + GK    +  +++ EHGVEAYPFT +++ E+   E+A    Q+L++VLV
Sbjct  274  RTIPNLVIIGQDGKTLNPNVAELIEEHGVEAYPFTPKKLDELAAIEKAKLESQTLESVLV  333

Query  692  STSRDYVI  715
            +   D+VI
Sbjct  334  NGENDFVI  341


 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 110/179 (61%), Gaps = 4/179 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+ +K +E  A   A+   ++  L S+L + + DF+I  SG +V+V DL GK I +YF
Sbjct  305  YPFTPKKLDELAAIEKAKL--ESQTLESVLVNGENDFVIDKSGSKVRVSDLVGKNILLYF  362

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  363  SAQWCPPCRAFLPKLIEAYHTIKAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDG  422

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
              ++ L   F ++GIP  V +  SG+  T++    +  +G +A+PFT E +K++++ EE
Sbjct  423  -RKQILSRKFKIQGIPAAVAIGPSGRTITKEARMHLTAYGADAFPFTEEHLKQLEELEE  480



>ref|XP_006365237.1| PREDICTED: probable nucleoredoxin 1-like [Solanum tuberosum]
Length=547

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 126/177 (71%), Gaps = 0/177 (0%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            +DL  +L S +RDFLI  +G QV +  + GK +G+YFS SWCGPC +FTP L   Y  L 
Sbjct  12   NDLTVVLSSKERDFLICTNGEQVTLSSITGKIVGLYFSGSWCGPCRQFTPKLVEAYESLY  71

Query  368  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  547
            PKG+FE+VF+S+D+D+ESF EYFGKMPW AVPFSD+  R+ L  LF VR IPHLVILD +
Sbjct  72   PKGDFEIVFISSDKDDESFNEYFGKMPWLAVPFSDAEARKNLKQLFKVRAIPHLVILDGT  131

Query  548  GKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            GKV + DGV  +   G EAYPFT ER+  ++  EE     QSL+++LV  SRD++I+
Sbjct  132  GKVLSNDGVKFIKNFGPEAYPFTSERINYLRLEEERAKENQSLRSLLVYGSRDFLIS  188


 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 106/183 (58%), Gaps = 2/183 (1%)
 Frame = +2

Query  170  EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  349
            E+  +   LRS+L    RDFLI N   ++ V +L+GK + +YF  S    C  FT  LA 
Sbjct  166  ERAKENQSLRSLLVYGSRDFLISNEEKKISVSELEGKTVCLYFGTSTHRGCKNFTLKLAE  225

Query  350  VYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  529
            VY E L   NFE+V +S DE  E FKE F  MPW A+PF D    ERL   F  + +P L
Sbjct  226  VY-EKLKGNNFEIVLISLDEKYEDFKEGFEAMPWLALPFKDK-NCERLVQYFEHKLLPQL  283

Query  530  VILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDY  709
            V+L   GK   ++ V  V E+G EA+PFT E++  + + ++     Q+L+++LV+  RD+
Sbjct  284  VVLSPDGKTLQQNAVKFVEEYGDEAFPFTQEKLVTLANLKKKKLEAQTLESILVTADRDF  343

Query  710  VIA  718
            VI+
Sbjct  344  VIS  346


 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 91/159 (57%), Gaps = 2/159 (1%)
 Frame = +2

Query  158  SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            +++ ++  +A  L SIL ++DRDF+I N G +V V  L G  I +YF+ASW  P   F P
Sbjct  320  ANLKKKKLEAQTLESILVTADRDFVISNGGLKVPVHKLVGNNIVLYFAASWSLPSREFQP  379

Query  338  NLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  514
             L T Y+E+  K   FEV+F+S+D+DE SF   F  MPW A+PF D   R  L   F++ 
Sbjct  380  KLVTAYHEIKKKDETFEVIFISSDQDEPSFNNIFSSMPWLALPFDDE-RRSFLSRRFSIV  438

Query  515  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVK  631
            GIP  + +  +G         ++  HG  AYPFT + +K
Sbjct  439  GIPVAIAISPNGCTVNTQVRQLLEAHGAGAYPFTEDHIK  477



>ref|XP_009626672.1| PREDICTED: probable nucleoredoxin 1 [Nicotiana tomentosiformis]
Length=547

 Score =   212 bits (539),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 128/183 (70%), Gaps = 0/183 (0%)
 Frame = +2

Query  170  EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  349
            +Q    HDL  +L S+ RDFLI  +G +V++  +KGK +G+YFS  WCG C +FTP L  
Sbjct  6    DQESIPHDLTVVLSSTQRDFLICRNGERVRISSIKGKIVGLYFSGLWCGLCRQFTPKLVE  65

Query  350  VYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  529
             Y +L PKG+FE+VF+S+D+D ESF EYFGKMPW AVPFSD+  R+ L  LF VR IPH 
Sbjct  66   AYEDLYPKGDFEIVFISSDKDNESFNEYFGKMPWLAVPFSDADARKNLKQLFKVRAIPHF  125

Query  530  VILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDY  709
            VILD +GKV + +GV  +   G EAYPFT ERV  +++ EE     QSL+++LV  SRD+
Sbjct  126  VILDGTGKVLSNEGVKFIKHFGSEAYPFTSERVNYLREEEEKAKENQSLRSILVHESRDF  185

Query  710  VIA  718
            +I+
Sbjct  186  LIS  188


 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 109/183 (60%), Gaps = 2/183 (1%)
 Frame = +2

Query  170  EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  349
            E+  +   LRSIL    RDFLI N  +++ V +L+GK +G+YF+ +    C  FT  LA 
Sbjct  166  EKAKENQSLRSILVHESRDFLISNEENKISVSELEGKTVGLYFAMASHKGCKNFTLKLAD  225

Query  350  VYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  529
            VY +L  K NFE+  +S DE  E FK+ F  MPW  +PF D    ERL   F  + +P L
Sbjct  226  VYKKLKQK-NFEIALISLDEKYEDFKQGFETMPWLGLPFKDK-NCERLVRYFEHKLLPQL  283

Query  530  VILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDY  709
            V++   GK   ++ V +V E+G +A+PFT E++  + + ++     Q+L+++LV+  RD+
Sbjct  284  VVISPDGKTLQQNAVKLVEEYGDQAFPFTQEKLVTLANLKKEKLEAQTLESILVTADRDF  343

Query  710  VIA  718
            VI+
Sbjct  344  VIS  346


 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 93/168 (55%), Gaps = 2/168 (1%)
 Frame = +2

Query  158  SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            +++ ++  +A  L SIL ++DRDF+I N G +V V  L G  I +YF+A W  P   F P
Sbjct  320  ANLKKEKLEAQTLESILVTADRDFVISNVGLKVPVSKLVGNNIVLYFAAQWSLPSREFLP  379

Query  338  NLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  514
             L T Y E+  K  NFEV+F+S+D+DE SF   F  MPW A+PF D   +  L   F + 
Sbjct  380  KLITTYEEIKKKDENFEVIFISSDQDESSFNNLFSSMPWLALPFDDE-RKTFLSRRFNIV  438

Query  515  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT  658
            GIP  + +  SG         ++  HG  AYPFT E +K ++   + T
Sbjct  439  GIPVAIAISTSGCTVNTQVRQLLETHGAGAYPFTEEHIKNLQQRLDKT  486



>ref|XP_006836611.2| PREDICTED: uncharacterized protein LOC18427500 [Amborella trichopoda]
Length=1172

 Score =   218 bits (555),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = +2

Query  191  DLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP  370
            D++S+L    RDFL+RN+G QVK+D+L+GK +G+YFSASWCGPC RFTP L   Y++L  
Sbjct  25   DIKSLLSGEGRDFLVRNNGDQVKIDNLEGKLVGLYFSASWCGPCRRFTPKLIKTYDQLST  84

Query  371  KGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
             G+FEVVFVS D DE+SF++YF KMPW A+PFSDS  R +LD  F V GIPHLVI+ +  
Sbjct  85   NGDFEVVFVSGDSDEKSFEDYFHKMPWLAIPFSDSTVRSKLDEGFEVYGIPHLVIVGKDS  144

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K+ T +GV  V E+GV+ YPFT ER++E+K+ +E   + Q+L+T+LV+  RD+VI+
Sbjct  145  KILTSEGVGTVSEYGVDGYPFTNERLEELKEQDEEIRQNQNLRTLLVTDRRDFVIS  200


 Score =   202 bits (513),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 133/184 (72%), Gaps = 2/184 (1%)
 Frame = +2

Query  173  QNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATV  352
            QNG + D++S+L   +RDFLIR++  QVK+ +L GK IG++FSASW GPC  FTP L  +
Sbjct  627  QNGFSLDIKSLLSGEERDFLIRSNDDQVKIGELNGKVIGLFFSASWSGPCMTFTPELIAI  686

Query  353  YNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  526
            Y EL    KG+FEVVFVS D +E+SF+EYF KMPW A+PFSDS TR +L+  F V  IPH
Sbjct  687  YKELEIAIKGDFEVVFVSLDSEEKSFEEYFSKMPWLAIPFSDSKTRSKLEKDFKVSSIPH  746

Query  527  LVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRD  706
            L+I+ + GK+ T  GVDI   +GV+ YPF  ER++E+ + +EA  + QSL+ +LV+ +R 
Sbjct  747  LIIVGKDGKILTTGGVDIASNYGVDGYPFLPERLEEVNEEDEAIRQNQSLRPLLVTNTRG  806

Query  707  YVIA  718
            +VI+
Sbjct  807  FVIS  810


 Score =   153 bits (386),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 99/150 (66%), Gaps = 2/150 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            L S+L S D DF+I   G +V + +L GK + +YFSA WC PC  F P L   YNE+   
Sbjct  346  LESLLMSDDGDFIIGKGGIKVPISELVGKNVCLYFSAEWCPPCRAFLPKLIEAYNEIKTN  405

Query  374  -GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
              NFE+VF+S+D+D+  F E+F  MPW A+PF D   +E+L   F +RGIP LV LD+ G
Sbjct  406  DSNFEIVFISSDQDQGKFDEFFSSMPWLALPFGDK-AKEKLSRTFKIRGIPSLVALDKKG  464

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
            ++ T D  ++++ HG +A+PFT ER+KE++
Sbjct  465  RLVTNDARNLIMRHGSKAFPFTEERLKEVE  494


 Score =   147 bits (371),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 121/201 (60%), Gaps = 4/201 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  + EE K     E+     +LR++L +  RDF+I N G Q+ + +L+GK IG+YF
Sbjct  163  YPFTNERLEELKEQD--EEIRQNQNLRTLLVTDRRDFVISNDGRQIPISELEGKTIGLYF  220

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            + S    C +FTP L  VY +L  KG +FE+V VS+DE+ + F E+F  MPW A+PF D 
Sbjct  221  AVSGHPFCEKFTPELIEVYKKLKEKGESFEIVLVSSDENIKDFNEHFSSMPWLALPFED-  279

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
            +   RL  LF ++G P L ++   GK   +D V+ + +HG EAYPFT ER  ++ + E+ 
Sbjct  280  IALSRLRRLFELQGFPTLTVIGPDGKTLKDDVVETIGDHGPEAYPFTPERFIQLAEIEKK  339

Query  656  T*REQSLKTVLVSTSRDYVIA  718
                 +L+++L+S   D++I 
Sbjct  340  RLESMTLESLLMSDDGDFIIG  360


 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 108/177 (61%), Gaps = 2/177 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              LR +L ++ R F+I N   Q+ V +L+GK IG YF+A     C  FTP L  VY +L 
Sbjct  794  QSLRPLLVTNTRGFVISNDNKQIPVSELEGKTIGFYFAAYGHPYCQTFTPELIRVYEKLK  853

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              G NFE+V VS+D   ESF ++F  MPW A+PF D+    RL  +F ++G P L+++  
Sbjct  854  ENGENFEIVLVSSDLKLESFNKHFSSMPWFALPFQDTALT-RLTRIFQIQGFPTLLVVGP  912

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
             GK   +D V  + EHGVEAYPFT ER  E+ + E+   +  +++++L++  RD+VI
Sbjct  913  DGKTLKDDAVGAIEEHGVEAYPFTPERFIELVEIEKERLKSLNIESLLLTEDRDFVI  969


 Score =   141 bits (355),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 100/152 (66%), Gaps = 2/152 (1%)
 Frame = +2

Query  191   DLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP  370
             ++ S+L + DRDF+I  SG++V + DL GK + +YF+A WC  CH F P L  VYN++  
Sbjct  955   NIESLLLTEDRDFVIDKSGNEVPISDLAGKNVCLYFAAKWCHLCHDFMPKLIHVYNDIKA  1014

Query  371   KG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  547
             +  NFE+VF+S D+DE SF ++   MPW A+P+ D     +L  LF +  +P LV++ + 
Sbjct  1015  RDPNFEIVFISGDQDEASFNDFLWDMPWLALPYGDMAVG-KLLQLFKIASVPTLVVVGKD  1073

Query  548   GKVTTEDGVDIVLEHGVEAYPFTLERVKEIKD  643
             G + + + + ++ +HG  +YPFT +R+KEIK+
Sbjct  1074  GGLVSSNAIKLLWKHGPRSYPFTEKRLKEIKE  1105



>ref|XP_010651414.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Vitis vinifera]
Length=562

 Score =   212 bits (539),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 141/185 (76%), Gaps = 2/185 (1%)
 Frame = +2

Query  164  MAEQN--GDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            MA +N  G AHDL  +L   DRDFL+R +GHQVKV+ LKGKKI +YFSASWCGP  +FTP
Sbjct  1    MASENVDGVAHDLVPLLTREDRDFLVRCNGHQVKVESLKGKKIWLYFSASWCGPRRQFTP  60

Query  338  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  517
             L  VY+E   KG+FE++FVS D+ ++ F EYF KMPW A+PFSDS TR+ L  LF VRG
Sbjct  61   ELVEVYDEFSSKGDFEIIFVSRDKGDQLFNEYFSKMPWLAIPFSDSDTRDHLKKLFKVRG  120

Query  518  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVST  697
            IP L +LDESGKV + +GV+I+ ++GVE YPFT E++KE+K+ EE   +EQSL ++LVS 
Sbjct  121  IPSLAMLDESGKVLSSEGVEIIKDYGVEGYPFTAEKIKELKEKEETAKKEQSLISILVSQ  180

Query  698  SRDYV  712
            SRDYV
Sbjct  181  SRDYV  185


 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 93/154 (60%), Gaps = 2/154 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L SIL S +RDF+I     ++ V DL GK I +YFSA WC PC  F P L   Y  
Sbjct  321  EAQTLESILVSGNRDFVIGKDRVKIPVSDLVGKNILLYFSAHWCPPCRAFLPKLIEAYQN  380

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K   FEV+F+S+D D+ SF E+F  MPW A+PF D   +  L   F VR IP L+ +
Sbjct  381  IKAKDEAFEVIFISSDRDQASFDEFFSGMPWLALPFGDK-RKASLGRTFKVRSIPKLIAV  439

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
            + +G+  T +   +V+ HG +AYPFT E +KEI+
Sbjct  440  EPTGRTVTTEARTLVMIHGADAYPFTEEHIKEIE  473


 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 107/178 (60%), Gaps = 10/178 (6%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L SIL S  RD+        V V +L+GK +G+YFS S   P  +FT  L  VY +L 
Sbjct  171  QSLISILVSQSRDY--------VPVSELEGKFVGLYFSLSSSKPRLQFTRTLVDVYKKLR  222

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             KG +FE+V +S D++ ESFK  FG MPW A+PF D   + +L   F +  +P LV++  
Sbjct  223  AKGESFEIVMISLDDEIESFKTNFGSMPWLALPFKDRSCK-KLARYFELSALPTLVVIGP  281

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK    +  + + EHG++AYPFT E+  E+++ E+A    Q+L+++LVS +RD+VI 
Sbjct  282  DGKTLHSNVAEAIQEHGIQAYPFTPEKFAELEEIEKAKREAQTLESILVSGNRDFVIG  339



>ref|XP_002467709.1| hypothetical protein SORBIDRAFT_01g032910 [Sorghum bicolor]
 gb|EER94707.1| hypothetical protein SORBIDRAFT_01g032910 [Sorghum bicolor]
Length=584

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 133/174 (76%), Gaps = 2/174 (1%)
 Frame = +2

Query  203  ILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-N  379
            IL +++RDFL+RNSG QVK+  ++   + IYFSASWC PC RFTP L  VY EL  +G +
Sbjct  22   ILATAERDFLVRNSGEQVKISSIEASPVAIYFSASWCPPCRRFTPKLIEVYKELAEQGKS  81

Query  380  FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD-ESGKV  556
            FEV+F SAD++EE F EYF KMPW AVPFSD+  R  LDA F V GIPHLVILD ++G+V
Sbjct  82   FEVIFASADQNEEGFNEYFAKMPWLAVPFSDTEGRAALDARFKVSGIPHLVILDAKTGEV  141

Query  557  TTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             TEDGV+ V E+GVEAYPFT +R+ E+K+ E+A    Q++++VL +++RDY+I+
Sbjct  142  YTEDGVEFVSEYGVEAYPFTPDRINELKEQEKAEKENQTIQSVLGTSTRDYLIS  195


 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 96/153 (63%), Gaps = 2/153 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +  L S+L S D DF+I   G +V V +L GK + +YFSA WCGPC  F P L   YN++
Sbjct  341  SQTLESLLISGDLDFVIGKGGAKVPVSELVGKTVLLYFSAKWCGPCRAFLPTLVKEYNKI  400

Query  365  LPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K  +FE+VF+S+D D+ SF ++F +MPW A+P  D   +  L   F +RGIP LV + 
Sbjct  401  KEKNSDFEIVFISSDRDQSSFDDFFSQMPWLALPLEDE-RKVSLKKTFKIRGIPSLVAIG  459

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
             +G+  + D    ++ HG +A+PFT ER++E++
Sbjct  460  PTGQTVSRDAKAQLMIHGADAFPFTEERLEELQ  492


 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 117/204 (57%), Gaps = 7/204 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  +  E K    AE+  +   ++S+L +S RD+LI N G +V + +L+GK +G+ F
Sbjct  158  YPFTPDRINELKEQEKAEK--ENQTIQSVLGTSTRDYLISNKGDKVPISELEGKYVGLCF  215

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
                 GP   FT +LA +Y +L   G  FEVV VS D +E +F E F KMPW A+P  D 
Sbjct  216  VVDGYGPVIEFTDSLAKIYEKLKEVGEKFEVVAVSLDSEESAFNESFAKMPWLAIPQGDQ  275

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEA---YPFTLERVKEIKDA  646
               E+L   F +R +P LV++   GK    +  DI+ EHG EA   +PF+ E+++ + + 
Sbjct  276  KC-EKLVRYFELRSLPTLVLIGPDGKTLNSNVADIIDEHGFEAWEGFPFSAEKLEILAEK  334

Query  647  EEAT*REQSLKTVLVSTSRDYVIA  718
             +A    Q+L+++L+S   D+VI 
Sbjct  335  AKAKAASQTLESLLISGDLDFVIG  358



>ref|XP_002314535.2| hypothetical protein POPTR_0010s06980g [Populus trichocarpa]
 gb|EEF00706.2| hypothetical protein POPTR_0010s06980g [Populus trichocarpa]
Length=564

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 133/178 (75%), Gaps = 0/178 (0%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +HDL S+L S +RDFLIRN+G QVK  +L GK +G YFS SWCGPC  FTP L  VY +L
Sbjct  7    SHDLSSLLSSEERDFLIRNNGDQVKFSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQL  66

Query  365  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              KG+FEVVFVS+D D+ESF  YF +MPW A+PF D+ TR+RL  +F VRGIP LVI D 
Sbjct  67   SSKGDFEVVFVSSDGDDESFNTYFSEMPWLAIPFPDTETRQRLKEVFKVRGIPKLVIFDT  126

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            +GKV+ ++GV  V EHGV+ YPF L+R+  +K+ EE   + Q++ ++LVS+SRDYVI+
Sbjct  127  NGKVSCDNGVRHVKEHGVDGYPFNLDRLNFLKEQEENAKKNQTISSILVSSSRDYVIS  184


 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 118/188 (63%), Gaps = 5/188 (3%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFSA     C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVSDLEGKLVGLYFSAHAHRMCREFT  216

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  +Y  L  K  NFEVV +S D++EE FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLVELYKTLKEKRENFEVVLLSLDDEEEDFKESFETMPWLALPFKDK-SCEKLVRYFEL  275

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            R IP+LVI+ + GK    +  +++ EHG+EAYPFT E++ E+   E+A    Q+L++VLV
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEEHGIEAYPFTPEKLDELAAIEKAKLESQTLESVLV  335

Query  692  STSRDYVI  715
            +   D++I
Sbjct  336  NGENDFLI  343


 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 98/167 (59%), Gaps = 4/167 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K +E  A   A+   ++  L S+L + + DFLI  SG +V V DL GK I +YF
Sbjct  307  YPFTPEKLDELAAIEKAKL--ESQTLESVLVNGENDFLIDKSGSKVPVSDLVGKNILLYF  364

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+ +  K   FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKRKDKAFEVIFISSDRDQSTFDEFYSEMPWLALPFGDG  424

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFT  616
              ++ L   F ++GIP  + +  SG+  T++    +  +G +A+PFT
Sbjct  425  -RKQILSRKFKIQGIPAALAIGPSGRTVTKEARMHLTAYGADAFPFT  470



>ref|XP_006378291.1| hypothetical protein POPTR_0010s06930g [Populus trichocarpa]
 gb|ERP56088.1| hypothetical protein POPTR_0010s06930g [Populus trichocarpa]
Length=564

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = +2

Query  218  DRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFV  397
            +RDFLIRN+G QVKV +L GK +G YFS SWCGPC  FTP L  VY +L  KG+FEVVF+
Sbjct  18   ERDFLIRNNGDQVKVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQLSSKGDFEVVFI  77

Query  398  SADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVD  577
            S+D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP+LVI   +GKV+ ++GV 
Sbjct  78   SSDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFYTNGKVSCDNGVS  137

Query  578  IVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             V EHGV+ YPF L+R+  +K+ EE   + Q++ ++LVS+SRDYVI+
Sbjct  138  TVKEHGVDGYPFNLDRLNFLKEQEENAKKNQTISSILVSSSRDYVIS  184


 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 119/188 (63%), Gaps = 5/188 (3%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFS      C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVLDLEGKLVGLYFSIHAHRMCREFT  216

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  +Y  L  KG NFEVV +S + +E+ FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLVELYKRLKEKGENFEVVLISLNSEEKHFKESFETMPWFALPFKDK-SCEKLARYFEL  275

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            R IP+LVI+ + GK    +  +++ +HG+EAYPFT E+++E+ + E+A    Q+L++VLV
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEDHGIEAYPFTPEKLEELAEIEKAKLESQTLESVLV  335

Query  692  STSRDYVI  715
            +   D+VI
Sbjct  336  NGENDFVI  343


 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 100/167 (60%), Gaps = 4/167 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K EE   + + +   ++  L S+L + + DF+I  SG +V+V DL GK I +YF
Sbjct  307  YPFTPEKLEE--LAEIEKAKLESQTLESVLVNGENDFVIDKSGSKVRVSDLVGKNILLYF  364

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDE  424

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFT  616
              ++ L   F ++GIP  V +  SG+  T++    +  +G +A+PFT
Sbjct  425  -RKQILSRKFKIQGIPAAVAIGPSGRTITKEARMHLTSYGADAFPFT  470



>ref|NP_001050329.1| Os03g0405500 [Oryza sativa Japonica Group]
 sp|Q7Y0E8.1|NRX11_ORYSJ RecName: Full=Probable nucleoredoxin 1-1; Short=OsNrx1-1 [Oryza 
sativa Japonica Group]
 gb|AAP50936.1| putative trypanothione-dependent peroxidase [Oryza sativa Japonica 
Group]
 gb|ABF96507.1| PDI, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF12243.1| Os03g0405500 [Oryza sativa Japonica Group]
 gb|EAZ27269.1| hypothetical protein OsJ_11206 [Oryza sativa Japonica Group]
 dbj|BAG91502.1| unnamed protein product [Oryza sativa Japonica Group]
Length=569

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 133/182 (73%), Gaps = 2/182 (1%)
 Frame = +2

Query  179  GDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  358
             DA  + ++L +  RDFL+RNS  QVK+  ++   + +YFSASWC PC RFTP L   YN
Sbjct  2    ADAAGIATVLAADGRDFLLRNSADQVKISSIEASTVALYFSASWCPPCRRFTPKLIEAYN  61

Query  359  ELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
            EL+ +G NFEVVFVS D+D+E+F  YF KMPW AVPFSDS  R +L+  F VRGIPHLVI
Sbjct  62   ELVSQGKNFEVVFVSGDKDQEAFDAYFAKMPWLAVPFSDSECRAKLNKRFKVRGIPHLVI  121

Query  536  LDE-SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYV  712
            L+  SG+V TEDGV++V  HG EAYPFT ER+ E+K+ E+A    Q++++VL + +RDY+
Sbjct  122  LNATSGEVYTEDGVELVTVHGTEAYPFTTERINELKEQEKAAKDNQTVQSVLGTPTRDYL  181

Query  713  IA  718
            ++
Sbjct  182  LS  183


 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 100/177 (56%), Gaps = 8/177 (5%)
 Frame = +2

Query  119  FQFSKRKGE--ERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGI  292
            F F+  K E    KA + AE       L S+L   D DF++   G +V V +L GK + +
Sbjct  309  FPFTAEKMEILAEKAKAKAE----LQTLESLLVIGDLDFVLGKDGAKVPVSELVGKTVLL  364

Query  293  YFSASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFS  469
            YFSA WCGPC  F P L   YN++  K N FE++F+S+D D+ S+ E+F  MPW A+P  
Sbjct  365  YFSAKWCGPCRAFLPKLVDEYNKIKEKHNDFEIIFISSDRDQSSYDEFFSGMPWLALPLG  424

Query  470  DSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
            D   ++ L   F VRGIP LV +   G+    D    +  HG +A+PFT ER+ E++
Sbjct  425  DE-RKQHLSKTFRVRGIPSLVAIGADGRTVARDAKTPLTAHGADAFPFTEERLLEME  480


 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 114/204 (56%), Gaps = 7/204 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  +  E K    A +  D   ++S+L +  RD+L+ N G +V + DL+GK +G+ F
Sbjct  146  YPFTTERINELKEQEKAAK--DNQTVQSVLGTPTRDYLLSNKGDRVPISDLEGKYVGLCF  203

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
              +  GP  +FT  LA  Y +L   G  FEVV VS D DEE   E F  MPW A+P  D 
Sbjct  204  VVNGYGPVVQFTSLLAKFYEKLKEVGEKFEVVAVSLDSDEELSNESFAGMPWLAIPQEDK  263

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEA---YPFTLERVKEIKDA  646
            +  E+L   F +RG+P LV++   GK    +  DI+ EHG +A   +PFT E+++ + + 
Sbjct  264  MG-EKLARYFELRGLPTLVLIGPDGKTLNNNVADIIDEHGQDAWEGFPFTAEKMEILAEK  322

Query  647  EEAT*REQSLKTVLVSTSRDYVIA  718
             +A    Q+L+++LV    D+V+ 
Sbjct  323  AKAKAELQTLESLLVIGDLDFVLG  346



>ref|XP_011014066.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Populus euphratica]
Length=563

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = +2

Query  221  RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVS  400
            RD+LIRN+G QV V +L GK +G+YFS SWCGPC  FTP L  VY +L  KG+FEVVF+S
Sbjct  19   RDYLIRNNGDQVPVSNLVGKIVGVYFSGSWCGPCRNFTPLLVEVYEQLSSKGDFEVVFIS  78

Query  401  ADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDI  580
            +D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP+LVI D +GKV+ + GV  
Sbjct  79   SDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFDTNGKVSCDSGVST  138

Query  581  VLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            V EHGV+ YPF L+R+  +K+ EE   + Q++ ++LVS+SRDYVI+
Sbjct  139  VKEHGVDGYPFNLDRLNFLKEQEENAKKNQTISSILVSSSRDYVIS  184


 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 116/188 (62%), Gaps = 5/188 (3%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            + EQ  +A     + SIL SS RD++I N G +  V DL+GK +G+YFSA     C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKNPVLDLEGKLVGLYFSAHAHRMCCEFT  216

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  +Y  L  KG NFEVV +S D +E+ FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLMELYKRLREKGENFEVVLISLDFEEKHFKESFETMPWLALPFEDR-SCEKLARYFEL  275

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            R IP+LVI+ + GK    +  +++ +HG+EAYPFT E+++E+   E+A    Q+L++VL 
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEDHGIEAYPFTPEKLEELAAIEKAKLESQTLESVLG  335

Query  692  STSRDYVI  715
                D++I
Sbjct  336  YGGNDFLI  343


 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 106/179 (59%), Gaps = 4/179 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K EE  A   A+   ++  L S+L     DFLI  SG +V+V DL GK I +YF
Sbjct  307  YPFTPEKLEELAAIEKAKL--ESQTLESVLGYGGNDFLIDKSGSKVRVSDLGGKNILLYF  364

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDE  424

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
              ++ L   F + GIP  V +  SG+  T++    +  +G +A+PFT E +K++++ EE
Sbjct  425  -RKQILGRKFKIEGIPAAVAIGPSGRTITKEARMHLTAYGADAFPFTEEHLKQLEELEE  482



>ref|XP_011014067.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Populus euphratica]
Length=563

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = +2

Query  221  RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVS  400
            RD+LIRN+G QV V +L GK +G+YFS SWCGPC  FTP L  VY +L  KG+FEVVF+S
Sbjct  19   RDYLIRNNGDQVPVSNLVGKIVGVYFSGSWCGPCRNFTPLLVEVYEQLSSKGDFEVVFIS  78

Query  401  ADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDI  580
            +D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP+LVI D +GKV+ + GV  
Sbjct  79   SDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFDTNGKVSCDSGVST  138

Query  581  VLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            V EHGV+ YPF L+R+  +K+ EE   + Q++ ++LVS+SRDYVI+
Sbjct  139  VKEHGVDGYPFNLDRLNFLKEQEENAKKNQTISSILVSSSRDYVIS  184


 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 116/188 (62%), Gaps = 5/188 (3%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            + EQ  +A     + SIL SS RD++I N G +  V DL+GK +G+YFSA     C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKNPVLDLEGKLVGLYFSAHAHRMCCEFT  216

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  +Y  L  KG NFEVV +S D +E+ FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLMELYKRLREKGENFEVVLISLDFEEKHFKESFETMPWLALPFEDR-SCEKLARYFEL  275

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            R IP+LVI+ + GK    +  +++ +HG+EAYPFT E+++E+   E+A    Q+L++VL 
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEDHGIEAYPFTPEKLEELAAIEKAKLESQTLESVLG  335

Query  692  STSRDYVI  715
                D++I
Sbjct  336  YGGNDFLI  343


 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 106/179 (59%), Gaps = 4/179 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K EE  A   A+   ++  L S+L     DFLI  SG +V+V DL GK I +YF
Sbjct  307  YPFTPEKLEELAAIEKAKL--ESQTLESVLGYGGNDFLIDKSGSKVRVSDLGGKNILLYF  364

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDE  424

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
              ++ L   F + GIP  V +  SG+  T++    +  +G +A+PFT E +K++++ EE
Sbjct  425  -RKQILGRKFKIEGIPAAVAIGPSGRTITKEARMHLTAYGADAFPFTEEHLKQLEELEE  482



>ref|XP_011014069.1| PREDICTED: probable nucleoredoxin 1 isoform X4 [Populus euphratica]
Length=563

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = +2

Query  221  RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVS  400
            RD+LIRN+G QV V +L GK +G+YFS SWCGPC  FTP L  VY +L  KG+FEVVF+S
Sbjct  19   RDYLIRNNGDQVPVSNLVGKIVGVYFSGSWCGPCRNFTPLLVEVYEQLSSKGDFEVVFIS  78

Query  401  ADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDI  580
            +D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP+LVI D +GKV+ + GV  
Sbjct  79   SDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFDTNGKVSCDSGVST  138

Query  581  VLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            V EHGV+ YPF L+R+  +K+ EE   + Q++ ++LVS+SRDYVI+
Sbjct  139  VKEHGVDGYPFNLDRLNFLKEQEENAKKNQTISSILVSSSRDYVIS  184


 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 116/188 (62%), Gaps = 5/188 (3%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            + EQ  +A     + SIL SS RD++I N G +  V DL+GK +G+YFSA     C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKNPVLDLEGKLVGLYFSAHAHRMCCEFT  216

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  +Y  L  KG NFEVV +S D +E+ FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLMELYKRLREKGENFEVVLISLDFEEKHFKESFETMPWLALPFEDR-SCEKLARYFEL  275

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            R IP+LVI+ + GK    +  +++ +HG+EAYPFT E+++E+   E+A    Q+L++VL 
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEDHGIEAYPFTPEKLEELAAIEKAKLESQTLESVLG  335

Query  692  STSRDYVI  715
                D++I
Sbjct  336  YGGNDFLI  343


 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 106/179 (59%), Gaps = 4/179 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K EE  A   A+   ++  L S+L     DFLI  SG +V+V DL GK I +YF
Sbjct  307  YPFTPEKLEELAAIEKAKL--ESQTLESVLGYGGNDFLIDKSGSKVRVSDLGGKNILLYF  364

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDE  424

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
              ++ L   F + GIP  V +  SG+  T++    +  +G +A+PFT E +K++++ EE
Sbjct  425  -RKQILGRKFKIEGIPAAVAIGPSGRTITKEARMHLTAYGADAFPFTEEHLKQLEELEE  482



>ref|XP_011014068.1| PREDICTED: probable nucleoredoxin 1 isoform X3 [Populus euphratica]
Length=563

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = +2

Query  221  RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVS  400
            RD+LIRN+G QV V +L GK +G+YFS SWCGPC  FTP L  VY +L  KG+FEVVF+S
Sbjct  19   RDYLIRNNGDQVPVSNLVGKIVGVYFSGSWCGPCRNFTPLLVEVYEQLSSKGDFEVVFIS  78

Query  401  ADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDI  580
            +D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP+LVI D +GKV+ + GV  
Sbjct  79   SDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFDTNGKVSCDSGVST  138

Query  581  VLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            V EHGV+ YPF L+R+  +K+ EE   + Q++ ++LVS+SRDYVI+
Sbjct  139  VKEHGVDGYPFNLDRLNFLKEQEENAKKNQTISSILVSSSRDYVIS  184


 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 116/188 (62%), Gaps = 5/188 (3%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            + EQ  +A     + SIL SS RD++I N G +  V DL+GK +G+YFSA     C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKNPVLDLEGKLVGLYFSAHAHRMCCEFT  216

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  +Y  L  KG NFEVV +S D +E+ FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLMELYKRLREKGENFEVVLISLDFEEKHFKESFETMPWLALPFEDR-SCEKLARYFEL  275

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            R IP+LVI+ + GK    +  +++ +HG+EAYPFT E+++E+   E+A    Q+L++VL 
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEDHGIEAYPFTPEKLEELAAIEKAKLESQTLESVLG  335

Query  692  STSRDYVI  715
                D++I
Sbjct  336  YGGNDFLI  343


 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 106/179 (59%), Gaps = 4/179 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K EE  A   A+   ++  L S+L     DFLI  SG +V+V DL GK I +YF
Sbjct  307  YPFTPEKLEELAAIEKAKL--ESQTLESVLGYGGNDFLIDKSGSKVRVSDLGGKNILLYF  364

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDE  424

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
              ++ L   F + GIP  V +  SG+  T++    +  +G +A+PFT E +K++++ EE
Sbjct  425  -RKQILGRKFKIEGIPAAVAIGPSGRTITKEARMHLTAYGADAFPFTEEHLKQLEELEE  482



>ref|XP_003562828.1| PREDICTED: probable nucleoredoxin 1-2 [Brachypodium distachyon]
Length=577

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 135/187 (72%), Gaps = 2/187 (1%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            MA  +     + +IL + +RD+L+RNSG QVK+  ++   + +YFSASWC PC RFTP L
Sbjct  1    MAAASTTDGGVGAILTAGERDYLVRNSGEQVKISSIEAGTVALYFSASWCPPCRRFTPKL  60

Query  344  ATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
               Y EL  +G +FEVVFVS D+DEE+F  YF KMPW AVPF+DS  R+ LD  F VRGI
Sbjct  61   IEAYKELASQGKSFEVVFVSGDQDEEAFNAYFAKMPWLAVPFTDSEGRKSLDERFQVRGI  120

Query  521  PHLVILD-ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVST  697
            PHLVILD ++GKV TEDGV+ V E+G++AYPFT ER+ E+K+ E+A    Q++ +VL + 
Sbjct  121  PHLVILDAKTGKVCTEDGVEFVSEYGIDAYPFTPERINELKEQEKAAKDNQTIHSVLSAP  180

Query  698  SRDYVIA  718
            +RDY+I+
Sbjct  181  TRDYLIS  187


 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 97/159 (61%), Gaps = 2/159 (1%)
 Frame = +2

Query  167  AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  346
            A    ++  L+S+L + D DF+I   G +V V  L GK + +YFSA WCGPC  F P L 
Sbjct  327  ARAKAESQTLQSLLVTGDLDFVIGKDGAKVPVSQLVGKTVLLYFSAQWCGPCRAFLPTLV  386

Query  347  TVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
             VYN++  K  +FE+VF+S+D D+ SF ++F  MPW A+P  D   +  L  +F +RGIP
Sbjct  387  DVYNKIKEKNSDFEIVFISSDRDQSSFDDFFSGMPWLALPLEDE-RKAYLKKMFKIRGIP  445

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
             LV +  SGK    D    +  HG +A+PFT E+++E++
Sbjct  446  SLVAIGPSGKTVNTDAKAPLAVHGADAFPFTEEKIQELE  484


 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 113/204 (55%), Gaps = 7/204 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  +  E K    A +  D   + S+L +  RD+LI N G +V + DL+GK +G+ F
Sbjct  150  YPFTPERINELKEQEKAAK--DNQTIHSVLSAPTRDYLISNKGDKVPISDLEGKYVGLCF  207

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
              S  GP   FT  LA +Y +L   G  FEVV VS D DE SF E F  MPW A+P  D 
Sbjct  208  VVSGYGPVEEFTTVLAKIYGKLKEVGKKFEVVAVSMDNDEASFNESFQNMPWLAIPQGDK  267

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEA---YPFTLERVKEIKDA  646
            +  ++L + F +  +P LV++   GK    +  DI+ E+GVE+   +PF  E+++ + + 
Sbjct  268  MC-QKLVSYFELNDLPTLVLIGPDGKTLNSNIADIIEENGVESWEGFPFNAEKLEILAEK  326

Query  647  EEAT*REQSLKTVLVSTSRDYVIA  718
              A    Q+L+++LV+   D+VI 
Sbjct  327  ARAKAESQTLQSLLVTGDLDFVIG  350



>ref|XP_003557743.1| PREDICTED: probable nucleoredoxin 1-2 [Brachypodium distachyon]
Length=577

 Score =   209 bits (533),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 135/187 (72%), Gaps = 2/187 (1%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            MA  +     + +IL + +RD+L+RNSG QVK+  ++   + +YFSASWC PC RFTP L
Sbjct  1    MAAASTTDGGVGAILTAGERDYLVRNSGEQVKISSIEAGTVALYFSASWCPPCRRFTPKL  60

Query  344  ATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
               Y EL  +G +FEVVFVS D+DEE+F  YF KMPW AVPF+DS  R+ LD  F VRGI
Sbjct  61   IEAYKELASQGKSFEVVFVSGDQDEEAFNAYFAKMPWLAVPFTDSEGRKSLDERFQVRGI  120

Query  521  PHLVILD-ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVST  697
            PHLVILD ++GKV TEDGV+ V E+G++AYPFT ER+ E+K+ E+A    Q++ +VL + 
Sbjct  121  PHLVILDAKTGKVCTEDGVEFVSEYGIDAYPFTPERINELKEQEKAAKDNQTIHSVLSTP  180

Query  698  SRDYVIA  718
            +RDY+I+
Sbjct  181  TRDYLIS  187


 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 97/159 (61%), Gaps = 2/159 (1%)
 Frame = +2

Query  167  AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  346
            A    ++  L+S+L + D DF+I   G +V V  L GK + +YFSA WCGPC  F P L 
Sbjct  327  ARAKAESQTLQSLLVTGDLDFVIGKDGAKVPVSQLVGKTVLLYFSAQWCGPCRAFLPTLV  386

Query  347  TVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
             VYN++  K  +FE+VF+S+D D+ SF ++F  MPW A+P  D   +  L  +F +RGIP
Sbjct  387  DVYNKIKEKNSDFEIVFISSDRDQSSFDDFFSGMPWLALPLEDE-RKAYLKKMFKIRGIP  445

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
             LV +  SGK    D    +  HG +A+PFT E+++E++
Sbjct  446  SLVAIGPSGKTVNTDAKAPLAVHGADAFPFTEEKIQELE  484


 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 113/204 (55%), Gaps = 7/204 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  +  E K    A +  D   + S+L +  RD+LI N G +V + DL+GK +G+ F
Sbjct  150  YPFTPERINELKEQEKAAK--DNQTIHSVLSTPTRDYLISNKGDKVPISDLEGKYVGLCF  207

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
              S  GP   FT  LA +Y +L   G  FEVV VS D DE SF E F  MPW A+P  D 
Sbjct  208  VVSGYGPVEEFTTVLAKIYGKLKEVGEKFEVVAVSMDNDEASFNESFQNMPWLAIPQGDK  267

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEA---YPFTLERVKEIKDA  646
            +  ++L + F +  +P LV++   GK    +  DI+ E+GVE+   +PF  E+++ + + 
Sbjct  268  MC-QKLVSYFELNDLPTLVLIGPDGKTLNSNIADIIEENGVESWEGFPFNAEKLEILAEK  326

Query  647  EEAT*REQSLKTVLVSTSRDYVIA  718
              A    Q+L+++LV+   D+VI 
Sbjct  327  ARAKAESQTLQSLLVTGDLDFVIG  350



>gb|EMT12941.1| Nucleoredoxin [Aegilops tauschii]
Length=577

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 130/177 (73%), Gaps = 2/177 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            L +IL + DRD+LIRNSG QVK+  ++G  + IYFSASWC PC RFTP L   Y EL   
Sbjct  12   LGAILAAGDRDYLIRNSGEQVKISSIEGDTVAIYFSASWCPPCQRFTPKLIEAYKELTSH  71

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD-ES  547
            G +FEV+FVS D+DEE+F  YF KMPW AVPFSDS  R+ LD  F V GIPHLV LD ++
Sbjct  72   GKSFEVIFVSGDQDEEAFNAYFAKMPWLAVPFSDSEGRKSLDERFEVNGIPHLVFLDAKT  131

Query  548  GKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            G+V T++GV+ V E+G+EAYPFT ER+ E+K+ E+A    Q++ +VL + +R+YVI+
Sbjct  132  GEVLTDEGVEFVSEYGIEAYPFTTERINELKEQEKAAKDNQTIHSVLATPNRNYVIS  188


 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 93/153 (61%), Gaps = 2/153 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +  L S+L + D DF+I   G +V V +L GK + +YFSA WCGPC  F P L  VYN++
Sbjct  334  SQTLESLLVTGDVDFVIGKDGAKVPVAELVGKTVLLYFSAKWCGPCRAFLPTLVDVYNKI  393

Query  365  LPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K  +FE+VF+S+D D+ SF ++F  MPW A+P  D   +  L   F +RGIP LV + 
Sbjct  394  KEKNSDFEIVFISSDRDQSSFDDFFSGMPWLAIPLEDE-RKAYLKKKFKIRGIPSLVAIG  452

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              GK    D    +  HG +A+PFT ER++E++
Sbjct  453  PDGKTVNTDAKTSLAVHGADAFPFTSERIQELE  485


 Score =   121 bits (303),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 116/204 (57%), Gaps = 7/204 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  +  E K    A +  D   + S+L + +R+++I N+G +V + DL+GK +GI F
Sbjct  151  YPFTTERINELKEQEKAAK--DNQTIHSVLATPNRNYVISNTGEKVPIVDLEGKYVGICF  208

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
              +   P   FTP LA +Y +L   G  FEVV VS D DEESF   F  MPW A+P  D 
Sbjct  209  VVNGYPPVEEFTPVLAKIYAKLKEVGEKFEVVAVSLDSDEESFNNSFSSMPWLAIPQGDK  268

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGV---EAYPFTLERVKEIKDA  646
            +  ++L + F +  +P LV++   GK  + +  DI+ EHG+   E +PF  E+++ + + 
Sbjct  269  MC-QKLVSYFELSDLPTLVLIGPDGKTLSSNIADIINEHGLDAWEGFPFNAEKLEILAEK  327

Query  647  EEAT*REQSLKTVLVSTSRDYVIA  718
             +A    Q+L+++LV+   D+VI 
Sbjct  328  AKAKAASQTLESLLVTGDVDFVIG  351



>gb|AHL29285.1| nucleoredoxin [Triticum aestivum]
Length=577

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 130/177 (73%), Gaps = 2/177 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            L +IL + DRD+LIRNSG QVK+  ++G  + IYFSASWC PC RFTP L   Y EL   
Sbjct  12   LGAILAAGDRDYLIRNSGEQVKISSIEGDTVAIYFSASWCPPCQRFTPKLIEAYKELTSH  71

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD-ES  547
            G +FEV+FVS D+DEE+F  YF KMPW AVPFSDS  R+ LD  F V GIPHLV LD ++
Sbjct  72   GKSFEVIFVSGDQDEEAFNAYFAKMPWLAVPFSDSEGRKSLDERFEVNGIPHLVFLDAKT  131

Query  548  GKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            G+V T++GV+ V E+G+EAYPFT ER+ E+K+ E+A    Q++ +VL + +R+YVI+
Sbjct  132  GEVLTDEGVEFVSEYGIEAYPFTTERINELKEQEKAAKDNQTIHSVLATPNRNYVIS  188


 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 93/153 (61%), Gaps = 2/153 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +  L S+L + D DF+I   G +V V +L GK + +YFSA WCGPC  F P L  VYN++
Sbjct  334  SQTLESLLVTGDVDFVIGKDGAKVPVAELVGKTVLLYFSAKWCGPCRAFLPTLVDVYNKI  393

Query  365  LPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K  +FE+VFVS+D D+ SF ++F  MPW A+P  D   +  L   F +RGIP LV + 
Sbjct  394  KEKNSDFEIVFVSSDRDQSSFDDFFSGMPWLAIPLEDE-RKAYLKKKFKIRGIPSLVAIG  452

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              GK    D    +  HG +A+PFT ER++E++
Sbjct  453  PDGKTVNTDAKTSLAVHGADAFPFTDERIQELE  485


 Score =   121 bits (303),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 116/204 (57%), Gaps = 7/204 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  +  E K    A +  D   + S+L + +R+++I N+G +V + DL+GK +GI F
Sbjct  151  YPFTTERINELKEQEKAAK--DNQTIHSVLATPNRNYVISNTGEKVPIVDLEGKYVGICF  208

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
              +   P   FTP LA +Y +L   G  FEVV VS D DEESF   F  MPW A+P  D 
Sbjct  209  VVNGYPPVEEFTPVLAKIYAKLKEVGEKFEVVAVSLDSDEESFNNSFSSMPWLAIPQGDK  268

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGV---EAYPFTLERVKEIKDA  646
            +  ++L + F +  +P LV++   GK  + +  DI+ EHG+   E +PF  E+++ + + 
Sbjct  269  MC-QKLVSYFELSDLPTLVLIGPDGKTLSSNIADIINEHGLDAWEGFPFNAEKLEILAEK  327

Query  647  EEAT*REQSLKTVLVSTSRDYVIA  718
             +A    Q+L+++LV+   D+VI 
Sbjct  328  AKAKAASQTLESLLVTGDVDFVIG  351



>gb|ABR16144.1| unknown [Picea sitchensis]
 gb|ACN41140.1| unknown [Picea sitchensis]
Length=586

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 136/181 (75%), Gaps = 1/181 (1%)
 Frame = +2

Query  179  GDAHD-LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
            G+ H+ L S+LC+ +RDFLIRN+G +VKV++L+GK +G+YFSA WC PC  FTP L+ +Y
Sbjct  14   GETHESLSSLLCNEERDFLIRNNGDKVKVEELEGKYVGLYFSAHWCPPCRSFTPVLSEIY  73

Query  356  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
             +LL KG+F++VF+SAD DE+SF+EY   MPW A+PFSD  TR+ L+  F V GIP LVI
Sbjct  74   KKLLEKGDFDIVFISADRDEKSFEEYHHTMPWLALPFSDENTRKNLNQAFQVHGIPCLVI  133

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            LD+ G+V T  GV+I+ E+  EAYPFT ER+ E++  EEA    Q+++++L+S  RD+V+
Sbjct  134  LDKEGRVITAKGVEIIKEYSAEAYPFTAERLDELRAKEEAIRAAQTVESLLLSDERDFVL  193

Query  716  A  718
             
Sbjct  194  G  194


 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 133/200 (67%), Gaps = 4/200 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  + +E +A   A +   A  + S+L S +RDF++ + G QV V +L GK +G+YF
Sbjct  157  YPFTAERLDELRAKEEAIRA--AQTVESLLLSDERDFVLGHEGTQVPVAELAGKTVGLYF  214

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WCGPC  FTP L  +YNELL KG  FE+VF+S D++E++F+EY+  MPW A+PF+D+
Sbjct  215  SAHWCGPCRSFTPQLVEIYNELLKKGEAFEIVFLSRDKEEKAFEEYYASMPWLALPFADN  274

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
             T + L   F V GIP L+IL   GK    D V ++ ++G+ AYPFT ER+ E++  EEA
Sbjct  275  -TEKNLSRYFRVPGIPTLIILGPDGKTVQTDAVGLIRDYGIRAYPFTKERLDELEAEEEA  333

Query  656  T*REQSLKTVLVSTSRDYVI  715
                Q+L+++LVS  R++VI
Sbjct  334  KREAQTLESLLVSDERNFVI  353


 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 103/163 (63%), Gaps = 6/163 (4%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            L S+L S +R+F+I +   QV V +L GK + +YFSA WC PC  FTP L  VYNEL  +
Sbjct  340  LESLLVSDERNFVINHGDAQVLVSELVGKTVALYFSAHWCPPCRSFTPELTKVYNELKER  399

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            G  FE+VF+S D ++++F++Y+  MPW A+PF D  T++ L   F VRGIP L+++   G
Sbjct  400  GETFEIVFISMDRNQDAFEDYYKSMPWLALPFGDK-TKKDLSRFFRVRGIPSLIVVGPDG  458

Query  551  KVTTEDGVDIVLEHGVEAYPFT---LERV-KEIKDAEEAT*RE  667
            K  T +    V  HG  AYPFT    +R+ KE+K+  E + +E
Sbjct  459  KTVTSNARSAVSTHGARAYPFTEAHFQRLQKEMKELVENSPKE  501



>ref|XP_008221830.1| PREDICTED: probable nucleoredoxin 1 [Prunus mume]
Length=561

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 136/184 (74%), Gaps = 0/184 (0%)
 Frame = +2

Query  167  AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  346
             +++G  HDL S+L S DR+FL+RN+  QV +  L GK +G+YFS SWCGPC RFTP+L 
Sbjct  4    GDEDGVVHDLFSLLSSEDRNFLVRNNADQVDISSLSGKIVGLYFSGSWCGPCRRFTPSLV  63

Query  347  TVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  526
             VY +L  KG+FEVVF+S+D D++SF  YF +MPW A+PFSD   R+RL  LF VRGIP+
Sbjct  64   EVYQDLASKGDFEVVFISSDRDDKSFSGYFSEMPWLAIPFSDLEARKRLKELFKVRGIPN  123

Query  527  LVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRD  706
            LVI+D +GKV+T+ G  +V+EHGV+ YPFT E +  +K+ E A    QSL ++LVS SRD
Sbjct  124  LVIIDANGKVSTDQGTRVVMEHGVDGYPFTAENINFLKEQEAAAKENQSLSSLLVSRSRD  183

Query  707  YVIA  718
            Y+I+
Sbjct  184  YLIS  187


 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 105/165 (64%), Gaps = 3/165 (2%)
 Frame = +2

Query  224  DFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVS  400
            D+LI   G +V V +L+GK +G+YFS     PC  FT  L   + +L  KG NFE+V +S
Sbjct  183  DYLISKEGSKVPVSELEGKMVGLYFSLHTHKPCKDFTQALLKFHEKLKEKGENFEIVLIS  242

Query  401  ADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDI  580
             D +EE FKE F + PW A+PF  + + E+L   F +  +P LVI+ + GK    + V++
Sbjct  243  LDYEEEHFKEGF-QAPWLALPFK-AKSCEKLARHFELENVPTLVIIGQDGKTLRPNAVEL  300

Query  581  VLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            + E+G+EAYPFT E++ E+ +  +A   EQ+L+++LV+  R++VI
Sbjct  301  IEEYGIEAYPFTAEKIAELAEISKAKLEEQTLESLLVAGDRNFVI  345


 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 85/142 (60%), Gaps = 8/142 (6%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            L S+L + DR+F+I  +G +V V +L GK I +YFSA WC PC  F P L   YN++  K
Sbjct  332  LESLLVAGDRNFVIEKTGSKVPVSELAGKHIMLYFSAHWCPPCRAFMPKLIKAYNQIKAK  391

Query  374  GN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
             + FE++F+S+D D  SFKE+F  MPW A+P  D   +  +   F ++  P+    D S 
Sbjct  392  DSAFEIIFISSDRDHSSFKEFFLTMPWLALPLGDP-RKALVQRKFKIQP-PN----DSSH  445

Query  551  KVTTEDGVDIVLEHGVEAYPFT  616
             +TT+    ++  +G +AYPFT
Sbjct  446  HITTQ-ARQLIQAYGADAYPFT  466



>ref|XP_007222607.1| hypothetical protein PRUPE_ppa003530mg [Prunus persica]
 gb|EMJ23806.1| hypothetical protein PRUPE_ppa003530mg [Prunus persica]
Length=567

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 137/184 (74%), Gaps = 0/184 (0%)
 Frame = +2

Query  167  AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  346
             +++G  HDL S+L S DR+FL+ N+  QV++  L GK +G+YFS SWCGPC RFTP+L 
Sbjct  4    GDEDGVVHDLFSLLSSEDRNFLVHNNADQVEISSLSGKIVGLYFSGSWCGPCRRFTPSLV  63

Query  347  TVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  526
             VY +L  KG+FEVVF+S+D D++SF  YF +MPW A+PFSD   R+RL  LF VRGIP+
Sbjct  64   EVYQDLASKGDFEVVFISSDRDDKSFSGYFSEMPWLAIPFSDLEARKRLKELFKVRGIPN  123

Query  527  LVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRD  706
            LVI+D +GKV+T+ G  +V+EHGV+ YPFT E++  +K+ E A    QSL ++LVS SRD
Sbjct  124  LVIIDANGKVSTDQGTRVVMEHGVDGYPFTAEKINFLKEQEAAAKENQSLSSLLVSRSRD  183

Query  707  YVIA  718
            Y+I+
Sbjct  184  YLIS  187


 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = +2

Query  224  DFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVS  400
            D+LI   G +V V +L+GK +G+YFS     PC  FT  L   + +L  KG NFE+V +S
Sbjct  183  DYLISKDGSKVPVSELEGKMVGLYFSLHTHKPCQDFTQALLKFHEKLKEKGENFEIVLIS  242

Query  401  ADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDI  580
             D +EE FK+ F ++PW A+PF  + + E+L   F +  +P LVI+ + GK    + V++
Sbjct  243  LDYEEEHFKQGF-QVPWLALPFK-AKSCEKLARHFELENVPTLVIIGQDGKTLRPNAVEL  300

Query  581  VLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            + E+G+EAYPFT E++ E+ D  +A   EQ+L+++LV+  R++VI
Sbjct  301  IEEYGIEAYPFTAEKIAELADISKAKLEEQTLESLLVAGDRNFVI  345


 Score =   129 bits (324),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 87/142 (61%), Gaps = 2/142 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            L S+L + DR+F+I  +G +V V +L GK I +YFSA WC PC  F P L   YN++  K
Sbjct  332  LESLLVAGDRNFVIEKTGSKVPVSELAGKHIMLYFSAHWCPPCRAFMPKLIKAYNQIKAK  391

Query  374  GN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
             + FE++F+S+D D  SFKE+F  MPW A+P  D   +  +   F ++GIP LV +  +G
Sbjct  392  DSAFEIIFISSDRDHSSFKEFFSTMPWLALPLGDP-RKALVQRKFKIQGIPALVAISPNG  450

Query  551  KVTTEDGVDIVLEHGVEAYPFT  616
            +  +     ++  +G +AYPFT
Sbjct  451  QTLSTQARQLIQAYGADAYPFT  472



>gb|ABK25089.1| unknown [Picea sitchensis]
Length=398

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 142/193 (74%), Gaps = 2/193 (1%)
 Frame = +2

Query  140  GEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGP  319
             ++    S+A+++  +  LRS+LC  +R+F IRN+G +VK+++L+GK +G+YFSA WC P
Sbjct  5    NQQENVVSLADESQKS--LRSLLCDEERNFFIRNNGEKVKIEELEGKYVGLYFSAHWCPP  62

Query  320  CHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDA  499
            C  FTP L+ +Y +LL KG+FE+VF+SAD DE+SF++Y   MPW A+PFSD  TR++L+ 
Sbjct  63   CRAFTPILSEIYAKLLEKGDFEIVFISADVDEKSFEKYHRIMPWLALPFSDENTRQKLEQ  122

Query  500  LFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLK  679
             F V  IP LV++D+ GKV T +GV I+ ++GVEAYPF+  R+ +++  EEA    Q+++
Sbjct  123  AFQVNSIPCLVVIDKEGKVVTTEGVKIIGDYGVEAYPFSAGRLDQLRAEEEALRAAQTVE  182

Query  680  TVLVSTSRDYVIA  718
            ++LVS  RD+VIA
Sbjct  183  SLLVSDERDFVIA  195


 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 107/166 (64%), Gaps = 6/166 (4%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A  + S+L S +RDF+I + G ++ V +L GK + +YFSA WC PC  FTP L  VY EL
Sbjct  178  AQTVESLLVSDERDFVIAHGGRKIPVSELVGKTVALYFSAHWCPPCRSFTPKLIQVYTEL  237

Query  365  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              +G  FEVVF+S+DE +++F++Y+  MPW A+PF D  T++ L   F V GIP +++L 
Sbjct  238  KERGEVFEVVFISSDEHQDAFEDYYSSMPWLALPFGDK-TKKDLTRHFRVEGIPTMIVLG  296

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFT----LERVKEIKDAEEAT*RE  667
             +GK  T+D + +V  HG +AYPFT    +   KEI+D  E + +E
Sbjct  297  PNGKTVTDDAISVVSIHGSKAYPFTDAQLIRLQKEIEDLAEKSPKE  342



>ref|XP_012085395.1| PREDICTED: probable nucleoredoxin 1 [Jatropha curcas]
Length=202

 Score =   197 bits (500),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 119/164 (73%), Gaps = 0/164 (0%)
 Frame = +2

Query  227  FLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSAD  406
            F+IR++G Q+++  L GK +G+YFS SWCGPC  FTP L   Y EL  KG+FEVVF+S+D
Sbjct  24   FVIRSNGDQIRISSLVGKIVGLYFSGSWCGPCRHFTPILVEAYEELSSKGDFEVVFISSD  83

Query  407  EDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVL  586
             D+ESF  YF KMPW A+PF D  T +RL  LF VRGIP+LV+LD +GKV+ + GVDI+ 
Sbjct  84   RDDESFNGYFSKMPWLAIPFPDQGTLKRLKELFKVRGIPNLVVLDANGKVSCDRGVDIIR  143

Query  587  EHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             +G E YPFT E++  ++  EE     Q++ ++LVS+SRDY+I+
Sbjct  144  NYGAEGYPFTPEKLDYLRQEEENAKNNQTISSILVSSSRDYLIS  187



>ref|XP_002965590.1| hypothetical protein SELMODRAFT_143457 [Selaginella moellendorffii]
 gb|EFJ33010.1| hypothetical protein SELMODRAFT_143457 [Selaginella moellendorffii]
Length=490

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 138/200 (69%), Gaps = 10/200 (5%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
             Q  +++ EERKA+           L+S+L S DRDF+I N G +VKV+ L+GK + +YF
Sbjct  65   IQALEKEAEERKAN---------QSLKSLLVSPDRDFVIANDGSKVKVESLEGKIVALYF  115

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            S  WCGPC  FTP LA +Y +L  KG  FEVVFVSAD DE++F+EY  +MPW A+PFSDS
Sbjct  116  SGHWCGPCRSFTPVLARLYKQLKDKGEEFEVVFVSADNDEDAFEEYHKEMPWLAIPFSDS  175

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
             TR++LD +F + GIP LV+L + GK    D V +V +HGV+AYPFT E++ EIK  +E 
Sbjct  176  KTRKQLDRIFDIGGIPSLVVLGKDGKTVHTDAVQLVSKHGVDAYPFTPEKLDEIKAEQEK  235

Query  656  T*REQSLKTVLVSTSRDYVI  715
               +Q+L ++LVS SRD+V+
Sbjct  236  RRAQQTLDSLLVSNSRDFVV  255


 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 108/178 (61%), Gaps = 3/178 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K +E KA    E+      L S+L S+ RDF++ + G +VK+ +LKGK +G+YF
Sbjct  219  YPFTPEKLDEIKAEQ--EKRRAQQTLDSLLVSNSRDFVVTHDGKEVKISELKGKTVGLYF  276

Query  299  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  FTP L  VYNEL  K   FE++FVS+D DE +FK YF  MPW A+PFSD 
Sbjct  277  SAHWCPPCRGFTPELVQVYNELKQKNAEFEIIFVSSDRDEGAFKSYFASMPWLALPFSDR  336

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAE  649
             ++  L + F V GIP LVIL   GK  T  G  +V  +   A+PFT   ++ +K  E
Sbjct  337  ESKSELSSYFEVEGIPTLVILGPDGKTLTAAGRRLVGAYKAAAFPFTGSHIEALKSKE  394


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 59/91 (65%), Gaps = 1/91 (1%)
 Frame = +2

Query  449  WTAVPFSDSVTRERL-DALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLER  625
            W AVP  DS TRE L   L +  GI HL ++ E G+V T+DG+D++ + G E +PF+ ER
Sbjct  5    WMAVPLEDSATRESLLKDLRSGAGIFHLAVIGEDGEVLTQDGLDVIYKWGAEGFPFSDER  64

Query  626  VKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            ++ ++   E     QSLK++LVS  RD+VIA
Sbjct  65   IQALEKEAEERKANQSLKSLLVSPDRDFVIA  95



>ref|XP_002968070.1| hypothetical protein SELMODRAFT_440252 [Selaginella moellendorffii]
 gb|EFJ30324.1| hypothetical protein SELMODRAFT_440252 [Selaginella moellendorffii]
Length=596

 Score =   204 bits (519),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 138/200 (69%), Gaps = 10/200 (5%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
             Q  +++ EERKA+           L+S+L S DRDF+I N G +VKV+ L+GK + +YF
Sbjct  171  IQALEKEAEERKAN---------QSLKSLLVSPDRDFVIANDGSKVKVESLEGKIVALYF  221

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            S  WCGPC  FTP LA +Y +L  KG  FEVVFVSAD DE++F+EY  +MPW A+PFSDS
Sbjct  222  SGHWCGPCRSFTPVLARLYKQLKDKGEEFEVVFVSADNDEDAFEEYHKEMPWLAIPFSDS  281

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
             TR++LD +F + GIP LV+L + GK    D V +V +HGV+AYPFT E++ EIK  +E 
Sbjct  282  KTRKQLDRIFDIGGIPSLVVLGKDGKTVHTDAVQLVSKHGVDAYPFTPEKLDEIKAEQEK  341

Query  656  T*REQSLKTVLVSTSRDYVI  715
               +Q+L ++LVS SRD+V+
Sbjct  342  RRAQQTLDSLLVSNSRDFVV  361


 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 112/183 (61%), Gaps = 5/183 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K +E KA    E+      L S+L S+ RDF++ + G +VK+ +LKGK +G+YF
Sbjct  325  YPFTPEKLDEIKAEQ--EKRRAQQTLDSLLVSNSRDFVVTHDGKEVKISELKGKTVGLYF  382

Query  299  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  FTP L  VYNEL  K   FE++FVS+D DEE+FK YF  MPW A+PFSD 
Sbjct  383  SAHWCPPCRGFTPELVQVYNELKQKNAEFEIIFVSSDRDEEAFKSYFASMPWLALPFSDR  442

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEI--KDAE  649
             ++  L + F V GIP LVIL   GK  T  G  +V  +   A+PFT   ++ +  K+ E
Sbjct  443  ESKSELSSYFEVEGIPTLVILGPDGKTLTAAGRRLVGAYKAAAFPFTGSHIEALTSKEME  502

Query  650  EAT  658
            EA 
Sbjct  503  EAN  505


 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 93/186 (50%), Gaps = 27/186 (15%)
 Frame = +2

Query  242  SGHQVKVDD-LKGKKIGIYFSASWCG-PCHRFTPNLATVYNELLPKGN-FEVVFVSADED  412
            SG  +K  D L+ K   +  +  W   P  +   +L  V +EL  +G    +V+V+ D D
Sbjct  16   SGESIKAADALRNKVTLLAIAPHWLPMPLRQTMASLVEVVDELQQQGKEIALVYVAVDRD  75

Query  413  E---------------------ESFKEYFGKMP--WTAVPFSDSVTRERL-DALFTVRGI  520
            E                     E F +   +M   W AVP  DS TRE L   L +  GI
Sbjct  76   EDMIAKLKARGNDRVLDDRPSQECFDDLRKQMSQGWMAVPLEDSATRESLLKDLRSGAGI  135

Query  521  PHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTS  700
             HL ++ E G+V T+DG+D++ + G E +PF+ ER++ ++   E     QSLK++LVS  
Sbjct  136  FHLAVIGEDGEVLTQDGLDVIYKWGAEGFPFSDERIQALEKEAEERKANQSLKSLLVSPD  195

Query  701  RDYVIA  718
            RD+VIA
Sbjct  196  RDFVIA  201



>ref|XP_004239348.2| PREDICTED: probable nucleoredoxin 1 [Solanum lycopersicum]
Length=540

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 123/178 (69%), Gaps = 0/178 (0%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A+DL  +L S +RDFLI  +G QV +  + GK +G+YFS  WCGPC +FTP L   Y  L
Sbjct  4    ANDLTVVLSSKERDFLISTNGEQVTLSSITGKIVGLYFSGLWCGPCRQFTPKLVEAYESL  63

Query  365  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
             PKG+FE+VF+S+D+D+ESF EYF KM W AVPFSD   R+ L  LF VR IPHLVILD 
Sbjct  64   YPKGDFEIVFISSDKDDESFNEYFEKMLWLAVPFSDVEARKNLKQLFKVRTIPHLVILDG  123

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            +GKV + DGV  +   G EAYPFT ER+  ++  EE     QSL+++LV  SRD++I+
Sbjct  124  TGKVLSSDGVKYIKHFGPEAYPFTSERINYLRLEEEKAKENQSLRSLLVYGSRDFLIS  181


 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 105/183 (57%), Gaps = 2/183 (1%)
 Frame = +2

Query  170  EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  349
            E+  +   LRS+L    RDFLI N  +++ V +L+GK + +YF  S       FT  LA 
Sbjct  159  EKAKENQSLRSLLVYGSRDFLISNEENKISVSELEGKTVCLYFGTSTHRGGKNFTLKLAE  218

Query  350  VYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  529
            VY E     NFE+V +S DE  E FKE F  MPW A+PF D    ERL   F  + +P L
Sbjct  219  VY-EKHKGNNFEIVLISLDEKYEDFKESFEAMPWLALPFKDK-NCERLVQYFEHKLLPQL  276

Query  530  VILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDY  709
            V+L   GK   ++ V  V E+G EA+PFT E++  + + ++     Q+L+++LV+  RD+
Sbjct  277  VVLSPDGKTLQQNAVKFVEEYGDEAFPFTQEKLATLANLKKKKLEAQTLESILVTADRDF  336

Query  710  VIA  718
            VI+
Sbjct  337  VIS  339


 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 93/163 (57%), Gaps = 2/163 (1%)
 Frame = +2

Query  158  SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            +++ ++  +A  L SIL ++DRDF+I N G +V V  L G  I +YF+ASW  P   F P
Sbjct  313  ANLKKKKLEAQTLESILVTADRDFVISNGGLKVPVHKLVGNNIVLYFAASWSLPSREFQP  372

Query  338  NLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  514
             L T Y E+  K  NFEV+F+S+D+DE SF  +F  MPW A+PF D   R  L   F + 
Sbjct  373  KLETAYQEIKKKDENFEVIFISSDQDESSFTNFFSSMPWLALPFDDE-RRSFLSRRFNIV  431

Query  515  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKD  643
            GIP  + +  SG         ++  HG  AYPFT E +K ++ 
Sbjct  432  GIPVAIAISPSGFTVNTQVRQLLETHGSGAYPFTEEHIKNLQQ  474



>gb|KGN52628.1| hypothetical protein Csa_5G647500 [Cucumis sativus]
Length=342

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 130/181 (72%), Gaps = 4/181 (2%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            +DL S+L S  RDFLIRN+G QVK+  L GK +G+YFSA WC PC  FTP L   Y EL 
Sbjct  7    YDLNSLLSSEGRDFLIRNNGDQVKISSLSGKIVGLYFSAGWCPPCRFFTPKLLKTYKELA  66

Query  368  PKG--NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
             K   +FEVVF+S+D DE SF+ YF +MPW ++PF DS T+++L +LF + GIPHLV++D
Sbjct  67   SKNINDFEVVFISSDGDEYSFEAYFLRMPWLSIPFEDSETKQKLKSLFQLSGIPHLVVID  126

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKE--IKDAEEAT*REQSLKTVLVSTSRDYVI  715
             +GKV+++DGV +V + G +AYPFT +R  +  I+  EEA    Q++ ++LVSTSR YV+
Sbjct  127  GNGKVSSDDGVGLVRDFGADAYPFTSDRKMQLLIQREEEARRNNQTIDSLLVSTSRTYVV  186

Query  716  A  718
            +
Sbjct  187  S  187


 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 101/173 (58%), Gaps = 4/173 (2%)
 Frame = +2

Query  170  EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  349
            E   +   + S+L S+ R +++ N G+Q+ + +L+GK IG+YFS      C  FTP L  
Sbjct  165  EARRNNQTIDSLLVSTSRTYVVSNDGNQIPISELEGKLIGLYFSKQGHEDCGNFTPKLIE  224

Query  350  VYNELLPK-GNFEVVFVSADEDEES-FKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
             YN+L  K  NFE+VF+S DE+ E  FKE F  MPW A+PF D   +E L   F V  IP
Sbjct  225  AYNKLKKKEENFEIVFISLDEENEDLFKEAFKTMPWLALPFKDEKCQE-LKLYFEVTHIP  283

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVK-EIKDAEEAT*REQSLK  679
             LVI+ + GK +  + V+++   G++AYPFT +++  ++ D   A    QS K
Sbjct  284  ALVIIGQDGKTSNPNAVELIKGRGIDAYPFTPKKLDVQVDDTPNARLESQSPK  336



>ref|XP_008459536.1| PREDICTED: probable nucleoredoxin 1 isoform X6 [Cucumis melo]
Length=371

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 130/182 (71%), Gaps = 5/182 (3%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            HD+ S+L S  RDFLIRN+G QVK+  L GK++G+YFSA WC PC  FTP L+  Y ELL
Sbjct  7    HDISSLLSSERRDFLIRNNGDQVKISSLIGKRVGLYFSAGWCPPCRLFTPKLSEFYKELL  66

Query  368  PKG----NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
                   +FE++F+S+D D  SFK YF KMPW ++PF D  T+++L  LF +R IP+LV+
Sbjct  67   ANNSKNNDFEIIFISSDRDALSFKAYFSKMPWLSIPFDDLETQKKLKILFQLRSIPYLVV  126

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKE-IKDAEEAT*REQSLKTVLVSTSRDYV  712
            +D +GKV+++DGV++V E GV+AYPFT +R K+ +   EEA    Q++ +VL S SR+Y+
Sbjct  127  IDGNGKVSSDDGVNLVKEFGVDAYPFTADRKKQLLAQKEEAKKNTQTITSVLASASRNYL  186

Query  713  IA  718
            ++
Sbjct  187  VS  188


 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 98/165 (59%), Gaps = 6/165 (4%)
 Frame = +2

Query  146  ERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  316
            +RK   +A   E   +   + S+L S+ R++L+ N G Q+ V  L+GK IG+YFS     
Sbjct  155  DRKKQLLAQKEEAKKNTQTITSVLASASRNYLVSNDGKQIPVSKLEGKLIGLYFSLPGHE  214

Query  317  PCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEY-FGKMPWTAVPFSDSVTRER  490
             C  FTP L+ VYN+L  K  NFE+VFVS +E++E   +  F  MPW A+PF D    ++
Sbjct  215  HCEDFTPKLSEVYNKLKKKDENFEIVFVSLEEEDEDLFDEAFESMPWLALPFKDEKC-QK  273

Query  491  LDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLER  625
            L   F V  IP LVI  + G+    + VD++ +HG++AYPFT ++
Sbjct  274  LKLYFDVGEIPALVITGQDGRTLNPNAVDLIKQHGIDAYPFTPKK  318



>gb|ERM99461.1| hypothetical protein AMTR_s00131p00112160 [Amborella trichopoda]
Length=559

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 133/184 (72%), Gaps = 2/184 (1%)
 Frame = +2

Query  173  QNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATV  352
            QNG + D++S+L   +RDFLIR++  QVK+ +L GK IG++FSASW GPC  FTP L  +
Sbjct  14   QNGFSLDIKSLLSGEERDFLIRSNDDQVKIGELNGKVIGLFFSASWSGPCMTFTPELIAI  73

Query  353  YNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  526
            Y EL    KG+FEVVFVS D +E+SF+EYF KMPW A+PFSDS TR +L+  F V  IPH
Sbjct  74   YKELEIAIKGDFEVVFVSLDSEEKSFEEYFSKMPWLAIPFSDSKTRSKLEKDFKVSSIPH  133

Query  527  LVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRD  706
            L+I+ + GK+ T  GVDI   +GV+ YPF  ER++E+ + +EA  + QSL+ +LV+ +R 
Sbjct  134  LIIVGKDGKILTTGGVDIASNYGVDGYPFLPERLEEVNEEDEAIRQNQSLRPLLVTNTRG  193

Query  707  YVIA  718
            +VI+
Sbjct  194  FVIS  197


 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 108/177 (61%), Gaps = 2/177 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              LR +L ++ R F+I N   Q+ V +L+GK IG YF+A     C  FTP L  VY +L 
Sbjct  181  QSLRPLLVTNTRGFVISNDNKQIPVSELEGKTIGFYFAAYGHPYCQTFTPELIRVYEKLK  240

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              G NFE+V VS+D   ESF ++F  MPW A+PF D+    RL  +F ++G P L+++  
Sbjct  241  ENGENFEIVLVSSDLKLESFNKHFSSMPWFALPFQDTALT-RLTRIFQIQGFPTLLVVGP  299

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
             GK   +D V  + EHGVEAYPFT ER  E+ + E+   +  +++++L++  RD+VI
Sbjct  300  DGKTLKDDAVGAIEEHGVEAYPFTPERFIELVEIEKERLKSLNIESLLLTEDRDFVI  356


 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 100/152 (66%), Gaps = 2/152 (1%)
 Frame = +2

Query  191  DLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP  370
            ++ S+L + DRDF+I  SG++V + DL GK + +YF+A WC  CH F P L  VYN++  
Sbjct  342  NIESLLLTEDRDFVIDKSGNEVPISDLAGKNVCLYFAAKWCHLCHDFMPKLIHVYNDIKA  401

Query  371  KG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  547
            +  NFE+VF+S D+DE SF ++   MPW A+P+ D    + L  LF +  +P LV++ + 
Sbjct  402  RDPNFEIVFISGDQDEASFNDFLWDMPWLALPYGDMAVGKLLQ-LFKIASVPTLVVVGKD  460

Query  548  GKVTTEDGVDIVLEHGVEAYPFTLERVKEIKD  643
            G + + + + ++ +HG  +YPFT +R+KEIK+
Sbjct  461  GGLVSSNAIKLLWKHGPRSYPFTEKRLKEIKE  492



>ref|XP_008459535.1| PREDICTED: probable nucleoredoxin 1-1 isoform X5 [Cucumis melo]
Length=403

 Score =   197 bits (501),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 130/182 (71%), Gaps = 5/182 (3%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            HD+ S+L S  RDFLIRN+G QVK+  L GK++G+YFSA WC PC  FTP L+  Y ELL
Sbjct  7    HDISSLLSSERRDFLIRNNGDQVKISSLIGKRVGLYFSAGWCPPCRLFTPKLSEFYKELL  66

Query  368  PKG----NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
                   +FE++F+S+D D  SFK YF KMPW ++PF D  T+++L  LF +R IP+LV+
Sbjct  67   ANNSKNNDFEIIFISSDRDALSFKAYFSKMPWLSIPFDDLETQKKLKILFQLRSIPYLVV  126

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKE-IKDAEEAT*REQSLKTVLVSTSRDYV  712
            +D +GKV+++DGV++V E GV+AYPFT +R K+ +   EEA    Q++ +VL S SR+Y+
Sbjct  127  IDGNGKVSSDDGVNLVKEFGVDAYPFTADRKKQLLAQKEEAKKNTQTITSVLASASRNYL  186

Query  713  IA  718
            ++
Sbjct  187  VS  188


 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 98/165 (59%), Gaps = 6/165 (4%)
 Frame = +2

Query  146  ERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  316
            +RK   +A   E   +   + S+L S+ R++L+ N G Q+ V  L+GK IG+YFS     
Sbjct  155  DRKKQLLAQKEEAKKNTQTITSVLASASRNYLVSNDGKQIPVSKLEGKLIGLYFSLPGHE  214

Query  317  PCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEY-FGKMPWTAVPFSDSVTRER  490
             C  FTP L+ VYN+L  K  NFE+VFVS +E++E   +  F  MPW A+PF D    ++
Sbjct  215  HCEDFTPKLSEVYNKLKKKDENFEIVFVSLEEEDEDLFDEAFESMPWLALPFKDEKC-QK  273

Query  491  LDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLER  625
            L   F V  IP LVI  + G+    + VD++ +HG++AYPFT ++
Sbjct  274  LKLYFDVGEIPALVITGQDGRTLNPNAVDLIKQHGIDAYPFTPKK  318



>ref|XP_002525368.1| nucleoredoxin, putative [Ricinus communis]
 gb|EEF37006.1| nucleoredoxin, putative [Ricinus communis]
Length=553

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 119/164 (73%), Gaps = 0/164 (0%)
 Frame = +2

Query  227  FLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSAD  406
            FLIR++G QVK+ +L GK +G+YFS SWCGPC  FTPNL  VY EL  KG+FEVVF+S+D
Sbjct  24   FLIRSNGDQVKISNLVGKIVGLYFSGSWCGPCRHFTPNLVQVYEELSLKGDFEVVFISSD  83

Query  407  EDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVL  586
             D ESF  YF KMPW A+PFSD  T + L  LF VRGIP+LV LD  GKV+ + GV  + 
Sbjct  84   RDAESFDAYFSKMPWLAIPFSDQETCKHLKDLFKVRGIPNLVFLDADGKVSCDQGVRFIR  143

Query  587  EHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            E+G E YPFT ERV+  +  EE   + Q+L ++LVS+SRD++I+
Sbjct  144  EYGAEGYPFTPERVEYFRQEEENAKKNQTLSSILVSSSRDFLIS  187


 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 116/190 (61%), Gaps = 5/190 (3%)
 Frame = +2

Query  149  RKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHR  328
            R+    A++N     L SIL SS RDFLI   G ++ V +L+GK +G+YFS      C  
Sbjct  161  RQEEENAKKN---QTLSSILVSSSRDFLISKDGTKIPVSELEGKMVGLYFSVHSHRLCLD  217

Query  329  FTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  505
            FTP L  VY +L  KG  FEVV +S D DE +FK+    MPW A+PF D  +RERL   F
Sbjct  218  FTPRLEEVYKKLKEKGEKFEVVLISMDYDENNFKQGLETMPWLALPFEDK-SRERLARYF  276

Query  506  TVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTV  685
             +  +P LVI+ E GK   ++  +++  HG++AYPFT E++ E+ + E+A    Q+L++V
Sbjct  277  ELSALPTLVIIGEDGKTLNKNVAELIEGHGIQAYPFTPEKLVELAEIEKARLEAQTLESV  336

Query  686  LVSTSRDYVI  715
            LV   +D+VI
Sbjct  337  LVHGDKDFVI  346


 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 98/158 (62%), Gaps = 2/158 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L S+L   D+DF+I  SG +V V +L GK I +YFSA WC PC  F P L   Y+E
Sbjct  329  EAQTLESVLVHGDKDFVIEESGSKVPVSELVGKNILLYFSAKWCPPCRAFLPKLIEAYHE  388

Query  362  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K N FE++F+S+D D+ SF E++ +MPW A+PF D   +  L   F ++GIP  + +
Sbjct  389  IKAKDNAFEIIFISSDRDQSSFDEFYTEMPWLALPFGDD-RKTILQRKFKIKGIPAAIAI  447

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
              +GK  T++  + +  +G +AYPF  + +K++ D +E
Sbjct  448  SPTGKTLTKEAREHITAYGADAYPFNEDHLKQLNDKQE  485



>ref|XP_008459534.1| PREDICTED: probable nucleoredoxin 1-1 isoform X4 [Cucumis melo]
Length=414

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 130/182 (71%), Gaps = 5/182 (3%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            HD+ S+L S  RDFLIRN+G QVK+  L GK++G+YFSA WC PC  FTP L+  Y ELL
Sbjct  7    HDISSLLSSERRDFLIRNNGDQVKISSLIGKRVGLYFSAGWCPPCRLFTPKLSEFYKELL  66

Query  368  PKG----NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
                   +FE++F+S+D D  SFK YF KMPW ++PF D  T+++L  LF +R IP+LV+
Sbjct  67   ANNSKNNDFEIIFISSDRDALSFKAYFSKMPWLSIPFDDLETQKKLKILFQLRSIPYLVV  126

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKE-IKDAEEAT*REQSLKTVLVSTSRDYV  712
            +D +GKV+++DGV++V E GV+AYPFT +R K+ +   EEA    Q++ +VL S SR+Y+
Sbjct  127  IDGNGKVSSDDGVNLVKEFGVDAYPFTADRKKQLLAQKEEAKKNTQTITSVLASASRNYL  186

Query  713  IA  718
            ++
Sbjct  187  VS  188


 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 98/165 (59%), Gaps = 6/165 (4%)
 Frame = +2

Query  146  ERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  316
            +RK   +A   E   +   + S+L S+ R++L+ N G Q+ V  L+GK IG+YFS     
Sbjct  155  DRKKQLLAQKEEAKKNTQTITSVLASASRNYLVSNDGKQIPVSKLEGKLIGLYFSLPGHE  214

Query  317  PCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEY-FGKMPWTAVPFSDSVTRER  490
             C  FTP L+ VYN+L  K  NFE+VFVS +E++E   +  F  MPW A+PF D    ++
Sbjct  215  HCEDFTPKLSEVYNKLKKKDENFEIVFVSLEEEDEDLFDEAFESMPWLALPFKDEKC-QK  273

Query  491  LDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLER  625
            L   F V  IP LVI  + G+    + VD++ +HG++AYPFT ++
Sbjct  274  LKLYFDVGEIPALVITGQDGRTLNPNAVDLIKQHGIDAYPFTPKK  318



>ref|XP_008459533.1| PREDICTED: probable nucleoredoxin 1 isoform X3 [Cucumis melo]
Length=417

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 130/182 (71%), Gaps = 5/182 (3%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            HD+ S+L S  RDFLIRN+G QVK+  L GK++G+YFSA WC PC  FTP L+  Y ELL
Sbjct  7    HDISSLLSSERRDFLIRNNGDQVKISSLIGKRVGLYFSAGWCPPCRLFTPKLSEFYKELL  66

Query  368  PKG----NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
                   +FE++F+S+D D  SFK YF KMPW ++PF D  T+++L  LF +R IP+LV+
Sbjct  67   ANNSKNNDFEIIFISSDRDALSFKAYFSKMPWLSIPFDDLETQKKLKILFQLRSIPYLVV  126

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKE-IKDAEEAT*REQSLKTVLVSTSRDYV  712
            +D +GKV+++DGV++V E GV+AYPFT +R K+ +   EEA    Q++ +VL S SR+Y+
Sbjct  127  IDGNGKVSSDDGVNLVKEFGVDAYPFTADRKKQLLAQKEEAKKNTQTITSVLASASRNYL  186

Query  713  IA  718
            ++
Sbjct  187  VS  188


 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 98/165 (59%), Gaps = 6/165 (4%)
 Frame = +2

Query  146  ERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  316
            +RK   +A   E   +   + S+L S+ R++L+ N G Q+ V  L+GK IG+YFS     
Sbjct  155  DRKKQLLAQKEEAKKNTQTITSVLASASRNYLVSNDGKQIPVSKLEGKLIGLYFSLPGHE  214

Query  317  PCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEY-FGKMPWTAVPFSDSVTRER  490
             C  FTP L+ VYN+L  K  NFE+VFVS +E++E   +  F  MPW A+PF D    ++
Sbjct  215  HCEDFTPKLSEVYNKLKKKDENFEIVFVSLEEEDEDLFDEAFESMPWLALPFKDEKC-QK  273

Query  491  LDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLER  625
            L   F V  IP LVI  + G+    + VD++ +HG++AYPFT ++
Sbjct  274  LKLYFDVGEIPALVITGQDGRTLNPNAVDLIKQHGIDAYPFTPKK  318



>ref|XP_008459531.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Cucumis melo]
Length=428

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 130/182 (71%), Gaps = 5/182 (3%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            HD+ S+L S  RDFLIRN+G QVK+  L GK++G+YFSA WC PC  FTP L+  Y ELL
Sbjct  7    HDISSLLSSERRDFLIRNNGDQVKISSLIGKRVGLYFSAGWCPPCRLFTPKLSEFYKELL  66

Query  368  PKG----NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
                   +FE++F+S+D D  SFK YF KMPW ++PF D  T+++L  LF +R IP+LV+
Sbjct  67   ANNSKNNDFEIIFISSDRDALSFKAYFSKMPWLSIPFDDLETQKKLKILFQLRSIPYLVV  126

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKE-IKDAEEAT*REQSLKTVLVSTSRDYV  712
            +D +GKV+++DGV++V E GV+AYPFT +R K+ +   EEA    Q++ +VL S SR+Y+
Sbjct  127  IDGNGKVSSDDGVNLVKEFGVDAYPFTADRKKQLLAQKEEAKKNTQTITSVLASASRNYL  186

Query  713  IA  718
            ++
Sbjct  187  VS  188


 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 98/165 (59%), Gaps = 6/165 (4%)
 Frame = +2

Query  146  ERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  316
            +RK   +A   E   +   + S+L S+ R++L+ N G Q+ V  L+GK IG+YFS     
Sbjct  155  DRKKQLLAQKEEAKKNTQTITSVLASASRNYLVSNDGKQIPVSKLEGKLIGLYFSLPGHE  214

Query  317  PCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEY-FGKMPWTAVPFSDSVTRER  490
             C  FTP L+ VYN+L  K  NFE+VFVS +E++E   +  F  MPW A+PF D    ++
Sbjct  215  HCEDFTPKLSEVYNKLKKKDENFEIVFVSLEEEDEDLFDEAFESMPWLALPFKDEKC-QK  273

Query  491  LDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLER  625
            L   F V  IP LVI  + G+    + VD++ +HG++AYPFT ++
Sbjct  274  LKLYFDVGEIPALVITGQDGRTLNPNAVDLIKQHGIDAYPFTPKK  318



>ref|XP_008459532.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Cucumis melo]
Length=425

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 130/182 (71%), Gaps = 5/182 (3%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            HD+ S+L S  RDFLIRN+G QVK+  L GK++G+YFSA WC PC  FTP L+  Y ELL
Sbjct  7    HDISSLLSSERRDFLIRNNGDQVKISSLIGKRVGLYFSAGWCPPCRLFTPKLSEFYKELL  66

Query  368  PKG----NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
                   +FE++F+S+D D  SFK YF KMPW ++PF D  T+++L  LF +R IP+LV+
Sbjct  67   ANNSKNNDFEIIFISSDRDALSFKAYFSKMPWLSIPFDDLETQKKLKILFQLRSIPYLVV  126

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKE-IKDAEEAT*REQSLKTVLVSTSRDYV  712
            +D +GKV+++DGV++V E GV+AYPFT +R K+ +   EEA    Q++ +VL S SR+Y+
Sbjct  127  IDGNGKVSSDDGVNLVKEFGVDAYPFTADRKKQLLAQKEEAKKNTQTITSVLASASRNYL  186

Query  713  IA  718
            ++
Sbjct  187  VS  188


 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 98/165 (59%), Gaps = 6/165 (4%)
 Frame = +2

Query  146  ERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  316
            +RK   +A   E   +   + S+L S+ R++L+ N G Q+ V  L+GK IG+YFS     
Sbjct  155  DRKKQLLAQKEEAKKNTQTITSVLASASRNYLVSNDGKQIPVSKLEGKLIGLYFSLPGHE  214

Query  317  PCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEY-FGKMPWTAVPFSDSVTRER  490
             C  FTP L+ VYN+L  K  NFE+VFVS +E++E   +  F  MPW A+PF D    ++
Sbjct  215  HCEDFTPKLSEVYNKLKKKDENFEIVFVSLEEEDEDLFDEAFESMPWLALPFKDEKC-QK  273

Query  491  LDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLER  625
            L   F V  IP LVI  + G+    + VD++ +HG++AYPFT ++
Sbjct  274  LKLYFDVGEIPALVITGQDGRTLNPNAVDLIKQHGIDAYPFTPKK  318



>gb|KGN52627.1| hypothetical protein Csa_5G647490 [Cucumis sativus]
Length=462

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 129/182 (71%), Gaps = 5/182 (3%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            HDL S+L S  RDFLIRN+G QVK+  L GK++G+YFSA WC PC  FTP L+  Y ELL
Sbjct  7    HDLTSLLSSDRRDFLIRNNGDQVKISSLIGKRVGLYFSAGWCPPCRLFTPKLSEFYKELL  66

Query  368  PK----GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
                   +FE++F+S+D D  SFK YF KMPW A+PF D  T+++L  LF +  IP+LV+
Sbjct  67   ANKSKNNDFEIIFISSDRDALSFKAYFSKMPWLAIPFDDLETQKKLKILFQLSSIPYLVV  126

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKE-IKDAEEAT*REQSLKTVLVSTSRDYV  712
            +D +GKV++ DGV++V E GV+AYPFT++R K+ +   EEA    Q++ +VL S SR+Y+
Sbjct  127  IDGNGKVSSADGVNLVKEFGVDAYPFTIDRKKQLLAQKEEAKKNNQTITSVLASASRNYL  186

Query  713  IA  718
            ++
Sbjct  187  VS  188


 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 99/165 (60%), Gaps = 6/165 (4%)
 Frame = +2

Query  146  ERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  316
            +RK   +A   E   +   + S+L S+ R++L+ N G Q+ V +L+GK IG+YFS     
Sbjct  155  DRKKQLLAQKEEAKKNNQTITSVLASASRNYLVSNDGKQIPVSELEGKLIGLYFSLPGHE  214

Query  317  PCHRFTPNLATVYNELLPKG-NFEVVFVS-ADEDEESFKEYFGKMPWTAVPFSDSVTRER  490
             C  FTP L+ VYN L  K  NFE+VFVS  +EDE+ F E F  MPW A+PF D    ++
Sbjct  215  HCDAFTPKLSEVYNNLKKKKENFEIVFVSLEEEDEDFFNEAFKSMPWLALPFKDEKC-QK  273

Query  491  LDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLER  625
            L   F V  IP LVI  + G+    + VD++ +HG++AYPFT ++
Sbjct  274  LKLYFDVDDIPALVITGQDGRTLNPNAVDLIKQHGIDAYPFTPKK  318



>gb|EAY90397.1| hypothetical protein OsI_11974 [Oryza sativa Indica Group]
Length=588

 Score =   199 bits (506),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 133/201 (66%), Gaps = 21/201 (10%)
 Frame = +2

Query  179  GDAHDLRSILCSSDRDFLIRNSGHQ-------------------VKVDDLKGKKIGIYFS  301
             DA  + ++L +  RDFL+RNS  Q                   VK+  ++   + +YFS
Sbjct  2    ADAAGIATVLAADGRDFLLRNSADQLPATRAAVRCCAIEMSHEKVKISSIEASTVALYFS  61

Query  302  ASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSV  478
            ASWC PC RFTP L   YNEL+ +G NFEVVFVS D+D+E+F  YF KMPW AVPFSDS 
Sbjct  62   ASWCPPCRRFTPKLIEAYNELVSQGKNFEVVFVSGDKDQEAFDAYFAKMPWLAVPFSDSE  121

Query  479  TRERLDALFTVRGIPHLVILDE-SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
             R +L+  F VRGIPHLVIL+  SG+V TEDGV++V  HG EAYPFT ER+ E+K+ E+A
Sbjct  122  CRAKLNKRFKVRGIPHLVILNATSGEVYTEDGVELVTVHGTEAYPFTTERINELKEQEKA  181

Query  656  T*REQSLKTVLVSTSRDYVIA  718
                Q++++VL + +RDY+++
Sbjct  182  AKDNQTVQSVLGTPTRDYLLS  202


 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 100/177 (56%), Gaps = 8/177 (5%)
 Frame = +2

Query  119  FQFSKRKGE--ERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGI  292
            F F+  K E    KA + AE       L S+L   D DF++   G +V V +L GK + +
Sbjct  328  FPFTAEKMEILAEKAKAKAE----LQTLESLLVIGDLDFVLGKDGAKVPVSELVGKTVLL  383

Query  293  YFSASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFS  469
            YFSA WCGPC  F P L   YN++  K N FE++F+S+D D+ S+ E+F  MPW A+P  
Sbjct  384  YFSAKWCGPCRAFLPKLVDEYNKIKEKHNDFEIIFISSDRDQSSYDEFFSGMPWLALPLG  443

Query  470  DSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
            D   ++ L   F VRGIP LV +   G+    D    +  HG +A+PFT ER+ E++
Sbjct  444  DE-RKQHLSKTFRVRGIPSLVAIGADGRTVARDAKTPLTAHGADAFPFTEERLLEME  499


 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 114/204 (56%), Gaps = 7/204 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  +  E K    A +  D   ++S+L +  RD+L+ N G +V + DL+GK +G+ F
Sbjct  165  YPFTTERINELKEQEKAAK--DNQTVQSVLGTPTRDYLLSNKGDRVPISDLEGKYVGLCF  222

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
              +  GP  +FT  LA  Y +L   G  FEVV VS D DEE   E F  MPW A+P  D 
Sbjct  223  VVNGYGPVVQFTSLLAKFYEKLKEVGEKFEVVAVSLDSDEELSNESFAGMPWLAIPQEDK  282

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEA---YPFTLERVKEIKDA  646
            +  E+L   F +RG+P LV++   GK    +  DI+ EHG +A   +PFT E+++ + + 
Sbjct  283  MG-EKLARYFELRGLPTLVLIGPDGKTLNNNVADIIDEHGQDAWEGFPFTAEKMEILAEK  341

Query  647  EEAT*REQSLKTVLVSTSRDYVIA  718
             +A    Q+L+++LV    D+V+ 
Sbjct  342  AKAKAELQTLESLLVIGDLDFVLG  365



>gb|EEC75442.1| hypothetical protein OsI_11975 [Oryza sativa Indica Group]
Length=581

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 134/189 (71%), Gaps = 5/189 (3%)
 Frame = +2

Query  164  MAEQNGDAHD--LRSILCSSD-RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            MA+    A D  + +IL S+D RDFL+RNS  +VK+  +K   + +YFSASWC PC RFT
Sbjct  1    MADATHAAADGGVATILASADGRDFLLRNSADKVKISSIKASTVALYFSASWCPPCRRFT  60

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L   YNEL+ +G +FEVVFVS D D+++F  YF KMPW AVPFSDS    +L+  + V
Sbjct  61   PKLIEAYNELVSQGKSFEVVFVSGDSDQDAFNAYFAKMPWLAVPFSDSEALAKLNERYKV  120

Query  512  RGIPHLVILD-ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVL  688
             GIPHLVILD +SG++ TEDGV++V E+G EAYPFT ER+ E+K+ E+A    Q++ ++ 
Sbjct  121  MGIPHLVILDAKSGEIYTEDGVELVHEYGTEAYPFTTERINELKEQEKAAKDNQTIHSLF  180

Query  689  VSTSRDYVI  715
             + +RDY+I
Sbjct  181  GTPTRDYLI  189


 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 99/169 (59%), Gaps = 8/169 (5%)
 Frame = +2

Query  119  FQFSKRKGE--ERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGI  292
            F FS  K E    KA + AE    +  L S+L + D DF++   G +V V +L GK + +
Sbjct  316  FPFSAEKLEILAEKAKAKAE----SQTLESLLVTGDLDFVLGKDGAKVPVSELVGKTVLL  371

Query  293  YFSASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFS  469
            YFSA WC PC  F P L   YN++  K N FE+VF+S+D ++ S+ E+F  MPW A+P  
Sbjct  372  YFSAKWCPPCRAFLPKLVNEYNKIKEKHNDFEIVFISSDREQSSYDEFFSGMPWLALPLG  431

Query  470  DSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFT  616
            D   +++L  +F + GIP LV +   GK  T+D    ++ HG +A+PFT
Sbjct  432  DE-RKQQLSKIFKITGIPSLVAIGPDGKTVTKDAKTPLVAHGADAFPFT  479


 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 116/204 (57%), Gaps = 7/204 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  +  E K    A +  D   + S+  +  RD+LI N G +V + DL+GK +G+ F
Sbjct  153  YPFTTERINELKEQEKAAK--DNQTIHSLFGTPTRDYLITNKGDKVPISDLEGKYVGLCF  210

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
              +  GP  +FT  LA +Y +L   G  FEVV VS D DEESF E F  MPW A+P  D 
Sbjct  211  VVNGYGPVVQFTSVLAKIYEKLKVVGEKFEVVMVSLDGDEESFNESFADMPWLAIPQGDK  270

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEA---YPFTLERVKEIKDA  646
            +  E+L   F + G+P LV++   GK   +D  DI+ EHG +A   +PF+ E+++ + + 
Sbjct  271  MC-EKLARYFELSGLPMLVLIGPDGKTLNDDIADIIDEHGPDAWEGFPFSAEKLEILAEK  329

Query  647  EEAT*REQSLKTVLVSTSRDYVIA  718
             +A    Q+L+++LV+   D+V+ 
Sbjct  330  AKAKAESQTLESLLVTGDLDFVLG  353



>sp|Q7Y0F2.1|NRX12_ORYSJ RecName: Full=Probable nucleoredoxin 1-2; Short=OsNrx1-2 [Oryza 
sativa Japonica Group]
 gb|AAP50932.1| putative trypanothione-dependent peroxidase [Oryza sativa Japonica 
Group]
 gb|ABF96516.1| PDI, putative, expressed [Oryza sativa Japonica Group]
 gb|EEE59229.1| hypothetical protein OsJ_11208 [Oryza sativa Japonica Group]
Length=581

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 134/189 (71%), Gaps = 5/189 (3%)
 Frame = +2

Query  164  MAEQNGDAHD--LRSILCSSD-RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            MA+    A D  + +IL S+D RDFL+RNS  +VK+  +K   + +YFSASWC PC RFT
Sbjct  1    MADATHAAADGGVATILASADGRDFLLRNSADKVKISSIKASTVALYFSASWCPPCRRFT  60

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L   YNEL+ +G +FEVVFVS D D+++F  YF KMPW AVPFSDS    +L+  + V
Sbjct  61   PKLIEAYNELVSQGKSFEVVFVSGDSDQDAFNAYFAKMPWLAVPFSDSEALAKLNERYKV  120

Query  512  RGIPHLVILD-ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVL  688
             GIPHLVILD +SG++ TEDGV++V E+G EAYPFT ER+ E+K+ E+A    Q++ ++ 
Sbjct  121  MGIPHLVILDAKSGEIYTEDGVELVHEYGTEAYPFTTERINELKEQEKAAKDNQTIHSLF  180

Query  689  VSTSRDYVI  715
             + +RDY+I
Sbjct  181  GTPTRDYLI  189


 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 99/169 (59%), Gaps = 8/169 (5%)
 Frame = +2

Query  119  FQFSKRKGE--ERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGI  292
            F FS  K E    KA + AE    +  L S+L + D DF++   G +V V +L GK + +
Sbjct  316  FPFSAEKLEILAEKAKAKAE----SQTLESLLVTGDLDFVLGKDGAKVPVSELVGKTVLL  371

Query  293  YFSASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFS  469
            YFSA WC PC  F P L   YN++  K N FE+VF+S+D ++ S+ E+F  MPW A+P  
Sbjct  372  YFSAKWCPPCRAFLPKLVNEYNKIKEKHNDFEIVFISSDREQSSYDEFFSGMPWLALPLG  431

Query  470  DSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFT  616
            D   +++L  +F + GIP LV +   GK  T+D    ++ HG +A+PFT
Sbjct  432  DE-RKQQLSKIFKITGIPSLVAIGPDGKTVTKDAKTPLVAHGADAFPFT  479


 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 116/204 (57%), Gaps = 7/204 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  +  E K    A +  D   + S+  +  RD+LI N G +V + DL+GK +G+ F
Sbjct  153  YPFTTERINELKEQEKAAK--DNQTIHSLFGTPTRDYLITNKGDKVPISDLEGKYVGLCF  210

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
              +  GP  +FT  LA +Y +L   G  FEVV VS D DEESF E F  MPW A+P  D 
Sbjct  211  VVNGYGPVVQFTSVLAKIYEKLKAVGEKFEVVMVSLDGDEESFNESFADMPWLAIPQGDK  270

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEA---YPFTLERVKEIKDA  646
            +  E+L   F + G+P LV++   GK   +D  DI+ EHG +A   +PF+ E+++ + + 
Sbjct  271  MC-EKLARYFELSGLPMLVLIGPDGKTLNDDIADIIDEHGPDAWEGFPFSAEKLEILAEK  329

Query  647  EEAT*REQSLKTVLVSTSRDYVIA  718
             +A    Q+L+++LV+   D+V+ 
Sbjct  330  AKAKAESQTLESLLVTGDLDFVLG  353



>dbj|BAJ87919.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=577

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 123/169 (73%), Gaps = 2/169 (1%)
 Frame = +2

Query  218  DRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVF  394
            DRD+L+RNSG QVK+  ++   + +YFSASWC PC RFTP L   Y EL   G +FEVVF
Sbjct  20   DRDYLVRNSGEQVKISGIEADTVALYFSASWCPPCRRFTPKLIEAYKELTSLGKSFEVVF  79

Query  395  VSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD-ESGKVTTEDG  571
            VS D+DEE+F  YF KMPW AVPFSDS  R+ LD  F V GIPHLV LD ++G+V T++G
Sbjct  80   VSGDQDEEAFNAYFAKMPWLAVPFSDSEGRKNLDERFEVNGIPHLVFLDAKTGEVLTDEG  139

Query  572  VDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            V+ V E+G+EAYPFT ER+ E+K+ E+A    Q++ +VL + +R YVI+
Sbjct  140  VEFVSEYGIEAYPFTTERINELKEQEKAAKDNQTIHSVLGTANRAYVIS  188


 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 94/153 (61%), Gaps = 2/153 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +  L S+L + D DF+I   G +V V +L GK + +YFSA WCGPC  F P L  VYN++
Sbjct  334  SQTLESLLVTGDLDFVIGKDGAKVPVAELVGKTVLLYFSAKWCGPCRAFLPTLVDVYNKI  393

Query  365  LPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K  +FE+VF+S+D+D+ SF ++F  MPW A+P  D   +  L   F +RGIP LV + 
Sbjct  394  KEKNSDFEIVFISSDKDQSSFDDFFSGMPWLAIPLEDE-RKADLKKRFKIRGIPSLVAIG  452

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              GK    D    +  HG +A+PFT ER++E++
Sbjct  453  PDGKTVNTDAKTSLAVHGADAFPFTDERIEELE  485


 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 116/204 (57%), Gaps = 7/204 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  +  E K    A +  D   + S+L +++R ++I N+G +V + DL+GK +GI F
Sbjct  151  YPFTTERINELKEQEKAAK--DNQTIHSVLGTANRAYVISNTGKKVPIVDLEGKYVGICF  208

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
              +   P   FT  LA +Y +L   G  FEVV VS D DEESF   F  MPW A+P  D 
Sbjct  209  VVNGYPPVEEFTSVLAKIYAKLKEVGEKFEVVAVSLDSDEESFNTSFSSMPWLAIPQGDK  268

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEA---YPFTLERVKEIKDA  646
            +  ++L + F +  +P LV++   GK  + +   I+ EHG++A   +PF+ E+++ + + 
Sbjct  269  MC-QKLVSYFELSDLPTLVLIGPDGKTLSSNIAGIIDEHGLDAWEGFPFSAEKLEILAEK  327

Query  647  EEAT*REQSLKTVLVSTSRDYVIA  718
             +A    Q+L+++LV+   D+VI 
Sbjct  328  AKAKAASQTLESLLVTGDLDFVIG  351



>gb|AAU89249.1| C1-like domain containing protein [Oryza sativa Japonica Group]
Length=764

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 134/189 (71%), Gaps = 5/189 (3%)
 Frame = +2

Query  164  MAEQNGDAHD--LRSILCSSD-RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            MA+    A D  + +IL S+D RDFL+RNS  +VK+  +K   + +YFSASWC PC RFT
Sbjct  1    MADATHAAADGGVATILASADGRDFLLRNSADKVKISSIKASTVALYFSASWCPPCRRFT  60

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L   YNEL+ +G +FEVVFVS D D+++F  YF KMPW AVPFSDS    +L+  + V
Sbjct  61   PKLIEAYNELVSQGKSFEVVFVSGDSDQDAFNAYFAKMPWLAVPFSDSEALAKLNERYKV  120

Query  512  RGIPHLVILD-ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVL  688
             GIPHLVILD +SG++ TEDGV++V E+G EAYPFT ER+ E+K+ E+A    Q++ ++ 
Sbjct  121  MGIPHLVILDAKSGEIYTEDGVELVHEYGTEAYPFTTERINELKEQEKAAKDNQTIHSLF  180

Query  689  VSTSRDYVI  715
             + +RDY+I
Sbjct  181  GTPTRDYLI  189


 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 99/169 (59%), Gaps = 8/169 (5%)
 Frame = +2

Query  119  FQFSKRKGE--ERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGI  292
            F FS  K E    KA + AE    +  L S+L + D DF++   G +V V +L GK + +
Sbjct  316  FPFSAEKLEILAEKAKAKAE----SQTLESLLVTGDLDFVLGKDGAKVPVSELVGKTVLL  371

Query  293  YFSASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFS  469
            YFSA WC PC  F P L   YN++  K N FE+VF+S+D ++ S+ E+F  MPW A+P  
Sbjct  372  YFSAKWCPPCRAFLPKLVNEYNKIKEKHNDFEIVFISSDREQSSYDEFFSGMPWLALPLG  431

Query  470  DSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFT  616
            D   +++L  +F + GIP LV +   GK  T+D    ++ HG +A+PFT
Sbjct  432  DE-RKQQLSKIFKITGIPSLVAIGPDGKTVTKDAKTPLVAHGADAFPFT  479


 Score =   128 bits (322),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 116/204 (57%), Gaps = 7/204 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  +  E K    A +  D   + S+  +  RD+LI N G +V + DL+GK +G+ F
Sbjct  153  YPFTTERINELKEQEKAAK--DNQTIHSLFGTPTRDYLITNKGDKVPISDLEGKYVGLCF  210

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
              +  GP  +FT  LA +Y +L   G  FEVV VS D DEESF E F  MPW A+P  D 
Sbjct  211  VVNGYGPVVQFTSVLAKIYEKLKAVGEKFEVVMVSLDGDEESFNESFADMPWLAIPQGDK  270

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEA---YPFTLERVKEIKDA  646
            +  E+L   F + G+P LV++   GK   +D  DI+ EHG +A   +PF+ E+++ + + 
Sbjct  271  MC-EKLARYFELSGLPMLVLIGPDGKTLNDDIADIIDEHGPDAWEGFPFSAEKLEILAEK  329

Query  647  EEAT*REQSLKTVLVSTSRDYVIA  718
             +A    Q+L+++LV+   D+V+ 
Sbjct  330  AKAKAESQTLESLLVTGDLDFVLG  353


 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 60/97 (62%), Gaps = 7/97 (7%)
 Frame = +2

Query  377  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG-IPHLVILDE--S  547
            +FE+V VS D+ EESF  +     W AVPFSDS  R  L A F   G +P LV++ E  +
Sbjct  589  SFEIVLVSCDDGEESFDAHLA---WHAVPFSDSERRRALVARFNAAGEVPRLVVVLEATT  645

Query  548  GKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT  658
            G+  TE GV+++ EHG + YPFT  RV E+ + E AT
Sbjct  646  GEAVTECGVELIAEHGADTYPFTPARVDEL-EPERAT  681



>ref|XP_012085394.1| PREDICTED: probable nucleoredoxin 1 [Jatropha curcas]
 gb|KDP26596.1| hypothetical protein JCGZ_17754 [Jatropha curcas]
Length=567

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 119/164 (73%), Gaps = 0/164 (0%)
 Frame = +2

Query  227  FLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSAD  406
            F+IR++G Q+++  L GK +G+YFS SWCGPC  FTP L   Y EL  KG+FEVVF+S+D
Sbjct  24   FVIRSNGDQIRISSLVGKIVGLYFSGSWCGPCRHFTPILVEAYEELSSKGDFEVVFISSD  83

Query  407  EDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVL  586
             D+ESF  YF KMPW A+PF D  T +RL  LF VRGIP+LV+LD +GKV+ + GVDI+ 
Sbjct  84   RDDESFNGYFSKMPWLAIPFPDQGTLKRLKELFKVRGIPNLVVLDANGKVSCDRGVDIIR  143

Query  587  EHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             +G E YPFT E++  ++  EE     Q++ ++LVS+SRDY+I+
Sbjct  144  NYGAEGYPFTPEKLDYLRQEEENAKNNQTISSILVSSSRDYLIS  187


 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 117/183 (64%), Gaps = 2/183 (1%)
 Frame = +2

Query  170  EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  349
            E   +   + SIL SS RD+LI N G ++ V DL+GK +G+YFSA     C  FTP L  
Sbjct  165  ENAKNNQTISSILVSSSRDYLISNEGTKIPVSDLQGKMVGLYFSAYPHRLCLEFTPKLVE  224

Query  350  VYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  526
            +Y +L  KG NFE+V +S D DE+ FK+ F KMPW A+PF D   RE+L   F +  +P 
Sbjct  225  IYKKLKEKGENFEIVLISIDYDEKDFKQSFEKMPWLALPFQDK-GREKLARYFELSALPS  283

Query  527  LVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRD  706
            LVI+ E GK   ++  +++ +HG+EAYPFT +++ E+ + E+A    Q+L++VLV   +D
Sbjct  284  LVIIGEDGKTLNQNVAELIEDHGIEAYPFTPDKLDELAEIEKARLEAQTLESVLVHGDKD  343

Query  707  YVI  715
            +VI
Sbjct  344  FVI  346


 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 97/158 (61%), Gaps = 2/158 (1%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +A  L S+L   D+DF+I  +G +V V +L G+ + +YFSA WC PC  F P L   Y E
Sbjct  329  EAQTLESVLVHGDKDFVIEKTGSKVPVSELAGRNVLLYFSAKWCPPCRAFLPKLIEAYKE  388

Query  362  LLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            +  K   FE++FVS+D D+ SF+E++  MPW A+PF D   +  L   F ++GIP  + +
Sbjct  389  IKEKDSRFEIIFVSSDRDQSSFEEFYSGMPWLALPFGDE-RKTILQKKFKIKGIPAAIAI  447

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
              SGK  T++  + +  +G +AYPFT + +K++K+  E
Sbjct  448  SSSGKTVTKEAKEHLTAYGADAYPFTEQHLKQLKEKLE  485



>ref|XP_004141531.2| PREDICTED: probable nucleoredoxin 1-2 [Cucumis sativus]
Length=788

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 130/181 (72%), Gaps = 4/181 (2%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            +DL S+L S  RDFLIRN+G QVK+  L GK +G+YFSA WC PC  FTP L   Y EL 
Sbjct  7    YDLNSLLSSEGRDFLIRNNGDQVKISSLSGKIVGLYFSAGWCPPCRFFTPKLLKTYKELA  66

Query  368  PKG--NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
             K   +FEVVF+S+D DE SF+ YF +MPW ++PF DS T+++L +LF + GIPHLV++D
Sbjct  67   SKNINDFEVVFISSDGDEYSFEAYFLRMPWLSIPFEDSETKQKLKSLFQLSGIPHLVVID  126

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKE--IKDAEEAT*REQSLKTVLVSTSRDYVI  715
             +GKV+++DGV +V + G +AYPFT +R  +  I+  EEA    Q++ ++LVSTSR YV+
Sbjct  127  GNGKVSSDDGVGLVRDFGADAYPFTSDRKMQLLIQREEEARRNNQTIDSLLVSTSRTYVV  186

Query  716  A  718
            +
Sbjct  187  S  187


 Score =   187 bits (474),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 122/171 (71%), Gaps = 5/171 (3%)
 Frame = +2

Query  221  RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK----GNFEV  388
            RDFLIRN+G QVK+  L GK++G+YFSA WC PC  FTP L+  Y ELL       +FE+
Sbjct  344  RDFLIRNNGDQVKISSLIGKRVGLYFSAGWCPPCRLFTPKLSEFYKELLANKSKNNDFEI  403

Query  389  VFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTED  568
            +F+S+D D  SFK YF KMPW A+PF D  T+++L  LF +  IP+LV++D +GKV++ D
Sbjct  404  IFISSDRDALSFKAYFSKMPWLAIPFDDLETQKKLKILFQLSSIPYLVVIDGNGKVSSAD  463

Query  569  GVDIVLEHGVEAYPFTLERVKE-IKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            GV++V E GV+AYPFT++R K+ +   EEA    Q++ +VL S SR+Y+++
Sbjct  464  GVNLVKEFGVDAYPFTIDRKKQLLAQKEEAKKNNQTITSVLASASRNYLVS  514


 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 108/177 (61%), Gaps = 4/177 (2%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            + S+L S+ R +++ N G+Q+ + +L+GK IG+YFS      C  FTP L   YN+L  K
Sbjct  173  IDSLLVSTSRTYVVSNDGNQIPISELEGKLIGLYFSKQGHEDCGNFTPKLIEAYNKLKKK  232

Query  374  -GNFEVVFVSADEDEES-FKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  547
              NFE+VF+S DE+ E  FKE F  MPW A+PF D   +E L   F V  IP LVI+ + 
Sbjct  233  EENFEIVFISLDEENEDLFKEAFKTMPWLALPFKDEKCQE-LKLYFEVTHIPALVIIGQD  291

Query  548  GKVTTEDGVDIVLEHGVEAYPFTLERVK-EIKDAEEAT*REQSLKTVLVSTSRDYVI  715
            GK +  + V+++   G++AYPFT +++  ++ D   A    QSL ++L S  RD++I
Sbjct  292  GKTSNPNAVELIKGRGIDAYPFTPKKLDVQVDDTPNARLESQSLTSLLSSDRRDFLI  348


 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 99/165 (60%), Gaps = 6/165 (4%)
 Frame = +2

Query  146  ERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  316
            +RK   +A   E   +   + S+L S+ R++L+ N G Q+ V +L+GK IG+YFS     
Sbjct  481  DRKKQLLAQKEEAKKNNQTITSVLASASRNYLVSNDGKQIPVSELEGKLIGLYFSLPGHE  540

Query  317  PCHRFTPNLATVYNELLPKG-NFEVVFVS-ADEDEESFKEYFGKMPWTAVPFSDSVTRER  490
             C  FTP L+ VYN L  K  NFE+VFVS  +EDE+ F E F  MPW A+PF D    ++
Sbjct  541  HCDAFTPKLSEVYNNLKKKKENFEIVFVSLEEEDEDFFNEAFKSMPWLALPFKDEKC-QK  599

Query  491  LDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLER  625
            L   F V  IP LVI  + G+    + VD++ +HG++AYPFT ++
Sbjct  600  LKLYFDVDDIPALVITGQDGRTLNPNAVDLIKQHGIDAYPFTPKK  644



>gb|AGH33853.1| PDI4 [Cucumis melo]
Length=487

 Score =   192 bits (487),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 130/183 (71%), Gaps = 6/183 (3%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQV-KVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            HD+ S+L S  RDFLIRN+G QV K+  L GK++G+YFSA WC PC  FTP L+  Y EL
Sbjct  7    HDISSLLSSERRDFLIRNNGDQVVKISSLIGKRVGLYFSAGWCPPCRLFTPKLSEFYKEL  66

Query  365  LPKG----NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLV  532
            L       +FE++F+S+D D  SFK YF KMPW ++PF D  T+++L  LF +R IP+LV
Sbjct  67   LANNSKNNDFEIIFISSDRDALSFKAYFSKMPWLSIPFDDLETQKKLKILFQLRSIPYLV  126

Query  533  ILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKE-IKDAEEAT*REQSLKTVLVSTSRDY  709
            ++D +GKV+++DGV++V E GV+AYPFT +R K+ +   EEA    Q++ +VL S SR+Y
Sbjct  127  VIDGNGKVSSDDGVNLVKEFGVDAYPFTADRKKQLLAQKEEAKKNTQTITSVLASASRNY  186

Query  710  VIA  718
            +++
Sbjct  187  LVS  189


 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 98/165 (59%), Gaps = 6/165 (4%)
 Frame = +2

Query  146  ERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  316
            +RK   +A   E   +   + S+L S+ R++L+ N G Q+ V  L+GK IG+YFS     
Sbjct  156  DRKKQLLAQKEEAKKNTQTITSVLASASRNYLVSNDGKQIPVSKLEGKLIGLYFSLPGHE  215

Query  317  PCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEY-FGKMPWTAVPFSDSVTRER  490
             C  FTP L+ VYN+L  K  NFE+VFVS +E++E   +  F  MPW A+PF D    ++
Sbjct  216  HCEDFTPKLSEVYNKLKKKDENFEIVFVSLEEEDEDLFDEAFESMPWLALPFKDEKC-QK  274

Query  491  LDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLER  625
            L   F V  IP LVI  + G+    + VD++ +HG++AYPFT ++
Sbjct  275  LKLYFDVGEIPALVITGQDGRTLNPNAVDLIKQHGIDAYPFTPKK  319



>gb|AAU04768.1| protein disulfide isomerase (PDI)-like protein 4 [Cucumis melo]
Length=486

 Score =   189 bits (479),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 127/182 (70%), Gaps = 5/182 (3%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
            HD+ S+L S  RDFLIRN+G QVK+  L GK++G+YFSA WC PC  FTP L+  Y ELL
Sbjct  7    HDISSLLSSERRDFLIRNNGDQVKISSLIGKRVGLYFSAGWCPPCRLFTPKLSEFYKELL  66

Query  368  PKG----NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  535
                   +FE++F+S+D D  SFK YF KMPW ++PF D  T+++L  LF ++ IP+LV 
Sbjct  67   ANNSKNNDFEIIFISSDRDALSFKAYFSKMPWLSIPFDDLETQKKLKILFQLKSIPYLVG  126

Query  536  LDESGKVTTEDGVDIVLEHGVEAYPFTLERVKE-IKDAEEAT*REQSLKTVLVSTSRDYV  712
            +D +GK +++DGV++V E G +AYPFT +R K+ +   EEA    Q++ +VL S SR+Y+
Sbjct  127  IDGNGKSSSDDGVNLVKEFGSDAYPFTADRKKQLLAQKEEAKKNTQTITSVLASASRNYL  186

Query  713  IA  718
            ++
Sbjct  187  VS  188


 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 98/165 (59%), Gaps = 6/165 (4%)
 Frame = +2

Query  146  ERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  316
            +RK   +A   E   +   + S+L S+ R++L+ N G Q+ V  L+GK IG+YFS     
Sbjct  155  DRKKQLLAQKEEAKKNTQTITSVLASASRNYLVSNDGKQIPVSKLEGKLIGLYFSLPGHE  214

Query  317  PCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEY-FGKMPWTAVPFSDSVTRER  490
             C  FTP L+ VYN+L  K  NFE+VFVS +E++E   +  F  MPW A+PF D    ++
Sbjct  215  HCEDFTPKLSEVYNKLKKKDENFEIVFVSLEEEDEDLFDEAFESMPWLALPFKDEKC-QK  273

Query  491  LDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLER  625
            L   F V  IP LVI  + G+    + VD++ +HG++AYPFT ++
Sbjct  274  LKLYFDVGEIPALVITGQDGRTLNPNAVDLIKQHGIDAYPFTPKK  318



>gb|ABR18079.1| unknown [Picea sitchensis]
Length=487

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 135/200 (68%), Gaps = 4/200 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  + +E KA   A +   A  + S+L S +RDF++ + G QV V +L GK +G+YF
Sbjct  55   YPFTAERIDELKAKEEALRA--AQTVESLLLSDERDFVLGHEGTQVPVAELAGKTVGLYF  112

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WCGPC  FTP L  +YNELL KG  FE+VF+S D++E++F+EY+  MPW A+PF+D+
Sbjct  113  SAHWCGPCRSFTPQLVEIYNELLKKGEAFEIVFLSRDKEEKAFEEYYASMPWLALPFADN  172

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
             T+++L   F + GIP L+IL   GK    D V ++ E+G+ AYPFT ER+ +++  E+A
Sbjct  173  -TQKKLSRYFRIEGIPTLIILGPDGKTIRNDAVGLIREYGIRAYPFTKERLDDLEAEEKA  231

Query  656  T*REQSLKTVLVSTSRDYVI  715
                Q+L++VLVS  R++VI
Sbjct  232  KREAQTLESVLVSDERNFVI  251


 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 125/188 (66%), Gaps = 8/188 (4%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+K + ++ +A   A++  +A  L S+L S +R+F+I++ G QV V +L GK + +YF
Sbjct  215  YPFTKERLDDLEAEEKAKR--EAQTLESVLVSDERNFVIKHGGAQVLVSELVGKTVALYF  272

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  FTP L  VYNEL  +G  FE+VF+S+D+D+E+F++Y+  MPW A+PF D 
Sbjct  273  SAHWCPPCRGFTPKLIQVYNELKERGEAFEIVFISSDKDQEAFEDYYKSMPWLALPFGDK  332

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFT---LERV-KEIKD  643
             T++ L  +F VRGIP L+++   GK  T++    V  HG +AYPFT   LER+ KE+++
Sbjct  333  -TKKDLSRIFRVRGIPSLIVVGPDGKTLTDNARGAVSTHGAKAYPFTDAHLERLEKEMEE  391

Query  644  AEEAT*RE  667
              E + +E
Sbjct  392  LVEKSPKE  399


 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +2

Query  443  MPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLE  622
            MPW A+PFSD  TR++LD +F V GIP LV LD+ G+  T +GV+ + E+GVEAYPFT E
Sbjct  1    MPWLALPFSDENTRKKLDQVFKVDGIPCLVFLDKEGRAITTEGVETIGEYGVEAYPFTAE  60

Query  623  RVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            R+ E+K  EEA    Q+++++L+S  RD+V+ 
Sbjct  61   RIDELKAKEEALRAAQTVESLLLSDERDFVLG  92



>ref|XP_010256393.1| PREDICTED: uncharacterized protein LOC104596799 [Nelumbo nucifera]
Length=1312

 Score =   189 bits (479),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 132/186 (71%), Gaps = 1/186 (1%)
 Frame = +2

Query  161   SMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPN  340
             ++ +  GD H+L S+LC+  RDFL++N+G QV+V +  GK +G+YF+  W    H FT  
Sbjct  833   AIGQTEGDFHNLTSLLCTEQRDFLVQNNGKQVRVQEFMGKFVGLYFAGWWHSAVHWFTQI  892

Query  341   LATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
             L   YN+L  K +FEV+FVS+D+D ESF ++F KMPW AVPFSD++TR+RL  +F V  I
Sbjct  893   LVETYNDLYHKNDFEVIFVSSDKDNESFIQHFSKMPWFAVPFSDAMTRDRLHEVFKVNNI  952

Query  521   PHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTS  700
             P LVILD+ G+V++ +G  IV  HGV+ YPFT E ++++++ E+   +EQSL +++ S S
Sbjct  953   PSLVILDKKGRVSSYNGAWIVRVHGVQGYPFTPEWIEKLQEDEKVVRKEQSLLSIMTSIS  1012

Query  701   RDYVIA  718
              D++I+
Sbjct  1013  -DHLIS  1017


 Score =   128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 96/161 (60%), Gaps = 4/161 (2%)
 Frame = +2

Query  164   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
             M   N +   L SIL S ++DF+IRN   ++ V +L GK I  YFSA W  PC      L
Sbjct  1153  MGNLNPNQQSLESILVSGEKDFVIRNDDARIHVSELVGKSILFYFSAQWFPPCRVSLQKL  1212

Query  344   ATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRER-LDALFTVRG  517
                Y+E+  K + FEV+++S D D  SFKE+F  MPW A+P+ D   RE+ L   F + G
Sbjct  1213  IKAYHEIKHKDDEFEVIYISYDTDLASFKEFFSGMPWLALPYGDD--REKLLSRKFKIEG  1270

Query  518   IPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
             IP +V + ++G+  T++  D ++ HG  AYPFT E +KE++
Sbjct  1271  IPTVVAIGQTGRTITKNAWDHLMVHGANAYPFTSEHLKEME  1311


 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 102/177 (58%), Gaps = 3/177 (2%)
 Frame = +2

Query  188   HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
               L SI+ +S  D LI N  ++V + +L+ K +G+YF+ +    C  FT  L  VY EL 
Sbjct  1002  QSLLSIM-TSISDHLISNERNKVPISELQQKVVGMYFTTTSEVECLDFTAKLVEVYKELK  1060

Query  368   PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              KG +FEV+++S    +ES++  F  MPW A PF D  + ++L     +  +P LV+L  
Sbjct  1061  NKGESFEVIWISLGNSQESYENGFRNMPWLAFPFEDK-SYKKLYPYLELTTLPTLVVLGP  1119

Query  545   SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
             +G+    + VD+V E+   AYPF+ + + E ++       +QSL+++LVS  +D+VI
Sbjct  1120  NGETLNSNAVDLVREYAALAYPFSQKNLIEPEEMGNLNPNQQSLESILVSGEKDFVI  1176



>ref|XP_006292691.1| hypothetical protein CARUB_v10018937mg, partial [Capsella rubella]
 gb|EOA25589.1| hypothetical protein CARUB_v10018937mg, partial [Capsella rubella]
Length=496

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 111/155 (72%), Gaps = 0/155 (0%)
 Frame = +2

Query  254  VKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEY  433
            VK++ L+GKKIG+YFS S CG   +FTP L  VYNEL P   FE+VFVS DEDEESFK+Y
Sbjct  1    VKIESLEGKKIGLYFSVSRCGLSQKFTPQLVEVYNELSPTVGFEIVFVSFDEDEESFKDY  60

Query  434  FGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  613
            F KMPW AVPF+ S T + L  +F VRG P LVI+++ G+V  ED       +G +AYPF
Sbjct  61   FIKMPWLAVPFTSSETCKHLAEMFKVRGSPTLVIVNDRGEVVNEDAFCFTRTYGADAYPF  120

Query  614  TLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            T ER+KE+KD E     EQSL++VLV+ SRD+VI+
Sbjct  121  TPERMKEVKDEEGRARIEQSLESVLVTPSRDFVIS  155


 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 105/177 (59%), Gaps = 5/177 (3%)
 Frame = +2

Query  116  IFQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIY  295
            ++ F+  K EE K    A+   +   L S+L S D ++++   G +V V DL GK + +Y
Sbjct  241  VYHFTTEKFEELKEIEKAK--AEPQTLESLLVSDDLNYVLGKDGDKVLVYDLVGKDVLLY  298

Query  296  FSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            FSA W   C  FT  L  VY  +     FE++F+S+D D+E+F+EY+ +MPW A+PF DS
Sbjct  299  FSAQWSFRCRAFTQILVEVYKHINKDQAFELIFISSDRDQEAFEEYYSQMPWLALPFGDS  358

Query  476  VTRERLDALFTVRG--IPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
              +  L   F V+G  IP LV   ++GK  T++ +D+V     +AYP T+ER+KEI+
Sbjct  359  -KKPSLAKTFKVKGNCIPRLVSAGQTGKTVTKEAIDLVRCLLADAYPVTVERMKEIQ  414


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 80/177 (45%), Gaps = 36/177 (20%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L S+L +  RDF+I   G++    +LK  +                            
Sbjct  139  QSLESVLVTPSRDFVISQDGNKSLSRNLKNGE----------------------------  170

Query  368  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  547
               +FE+V ++  +    FK+     PW ++P  DS    +L   F V  +P LVIL   
Sbjct  171  ---DFEIVLIAPGD----FKQDLTTHPWMSLPL-DSKNALKLARHFNVSRVPTLVILGPD  222

Query  548  GKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            GK    +  + + E+GV  Y FT E+ +E+K+ E+A    Q+L+++LVS   +YV+ 
Sbjct  223  GKTRHSNVAEAIDEYGVLVYHFTTEKFEELKEIEKAKAEPQTLESLLVSDDLNYVLG  279



>ref|XP_011627599.1| PREDICTED: probable nucleoredoxin 2 isoform X2 [Amborella trichopoda]
Length=400

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 119/177 (67%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  DLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP  370
            +L+S+L S +RDFLI  +G QVKV++L G  +G+YF+A+W   C  FTP LA+VY +L  
Sbjct  22   NLKSLLSSDERDFLITPTGTQVKVEELHGMTVGLYFAANWYFQCQNFTPVLASVYEQLKQ  81

Query  371  K-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  547
            +  NFE+VF+S DED+ SF +Y   MPW A+PFSD  T++ L+ +F V GIP L+ILD+ 
Sbjct  82   RDANFEIVFISCDEDQSSFDKYHATMPWLAIPFSDLKTKKSLNDMFQVEGIPCLIILDQH  141

Query  548  GKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
                  + V+++  +GV A+PFT ERV E++  E+A    Q+L+ ++    RD+VI 
Sbjct  142  AHTVQTEAVELIYRYGVWAFPFTKERVVELESEEKAKHESQTLENLISIDGRDFVIG  198


 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 88/173 (51%), Gaps = 32/173 (18%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            F F+K +  E ++   A+   ++  L +++    RDF+I +   QV +  L GK +G+YF
Sbjct  161  FPFTKERVVELESEEKAKH--ESQTLENLISIDGRDFVIGHDNEQVPISSLVGKTVGLYF  218

Query  299  SASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSV  478
            SA WC PC +FTP                        DE  F E F  MPW A+PF D  
Sbjct  219  SAQWCPPCVKFTPR-----------------------DEAGFLECFKPMPWLALPFGD--  253

Query  479  TRERLDAL---FTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERV  628
              ER+  L   F ++GIP LVI+  +GK  T +G +++  H  +AYPFT + +
Sbjct  254  --ERIKGLSRYFNIQGIPALVIIGPNGKTVTREGRNLINLHMEKAYPFTQDHI  304



>ref|XP_006855862.1| PREDICTED: probable nucleoredoxin 2 isoform X1 [Amborella trichopoda]
 gb|ERN17329.1| hypothetical protein AMTR_s00037p00109800 [Amborella trichopoda]
Length=424

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 119/177 (67%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  DLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP  370
            +L+S+L S +RDFLI  +G QVKV++L G  +G+YF+A+W   C  FTP LA+VY +L  
Sbjct  22   NLKSLLSSDERDFLITPTGTQVKVEELHGMTVGLYFAANWYFQCQNFTPVLASVYEQLKQ  81

Query  371  K-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  547
            +  NFE+VF+S DED+ SF +Y   MPW A+PFSD  T++ L+ +F V GIP L+ILD+ 
Sbjct  82   RDANFEIVFISCDEDQSSFDKYHATMPWLAIPFSDLKTKKSLNDMFQVEGIPCLIILDQH  141

Query  548  GKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
                  + V+++  +GV A+PFT ERV E++  E+A    Q+L+ ++    RD+VI 
Sbjct  142  AHTVQTEAVELIYRYGVWAFPFTKERVVELESEEKAKHESQTLENLISIDGRDFVIG  198


 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 102/174 (59%), Gaps = 10/174 (6%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            F F+K +  E ++   A+   ++  L +++    RDF+I +   QV +  L GK +G+YF
Sbjct  161  FPFTKERVVELESEEKAKH--ESQTLENLISIDGRDFVIGHDNEQVPISSLVGKTVGLYF  218

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC +FTP L ++Y+       +FE+VFVS D DE  F E F  MPW A+PF D 
Sbjct  219  SAQWCPPCVKFTPRLVSIYDTHKQNNEDFEIVFVSCDRDEAGFLECFKPMPWLALPFGD-  277

Query  476  VTRERLDAL---FTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERV  628
               ER+  L   F ++GIP LVI+  +GK  T +G +++  H  +AYPFT + +
Sbjct  278  ---ERIKGLSRYFNIQGIPALVIIGPNGKTVTREGRNLINLHMEKAYPFTQDHI  328



>ref|XP_011083440.1| PREDICTED: probable nucleoredoxin 2 [Sesamum indicum]
Length=432

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 118/182 (65%), Gaps = 4/182 (2%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A  L S+L S DRDFL+  SG QVK+ DL+GK +GIYFSA+W  PCH+FTP LA  Y +L
Sbjct  40   ASRLFSLLASKDRDFLLSPSGSQVKIADLEGKIVGIYFSANWYQPCHKFTPVLANAYEQL  99

Query  365  LPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
                  FE+VFVS+DED  +F +Y   MPW AVPFSD   +  L   F V GIP L+IL 
Sbjct  100  KNSDPGFEIVFVSSDEDVNAFDDYRSSMPWLAVPFSDLELKRALSRRFDVEGIPCLIILQ  159

Query  542  ES---GKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYV  712
             +   G     DGVD++  +GV+AYPFT ERV+E+ + E+     Q+L+ +L +  RD++
Sbjct  160  PNNCKGDSIVIDGVDLIYRYGVQAYPFTKERVEELLEKEKDKHENQTLRDLLTNHERDFL  219

Query  713  IA  718
            I+
Sbjct  220  IS  221


 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 112/192 (58%), Gaps = 18/192 (9%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHD---LRSILCSSDRDFLIRNS-GHQVKVDDLKGKKI  286
            + F+K + EE     + E+  D H+   LR +L + +RDFLI +    QV V  L GK I
Sbjct  184  YPFTKERVEE-----LLEKEKDKHENQTLRDLLTNHERDFLISHKIPKQVSVASLIGKTI  238

Query  287  GIYFSASWCGPCHRFTPNLATVYNELLPKG-------NFEVVFVSADEDEESFKEYFGKM  445
            G+YFSA WC P  +FTP LA++Y ++  +        +FE+VFVS+D D+ SF  YF  M
Sbjct  239  GLYFSAKWCFPGVKFTPKLASIYQKINQESSLNSHHQDFEIVFVSSDHDQTSFLSYFQTM  298

Query  446  PWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLER  625
            PW A+P+ D   +  L   F +RGIP LVIL   GK  T+ G +++  +   AYPFT  R
Sbjct  299  PWLALPYGDPNIKA-LTKHFDIRGIPSLVILGPDGKTVTKQGRNLLNLYQENAYPFTEAR  357

Query  626  VKEI-KDAEEAT  658
            V+ + + A+EA 
Sbjct  358  VEFLERQADEAA  369



>ref|XP_010431903.1| PREDICTED: probable nucleoredoxin 1 [Camelina sativa]
Length=178

 Score =   159 bits (403),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 103/138 (75%), Gaps = 1/138 (1%)
 Frame = +2

Query  290  IYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFS  469
            I FSA+WCGPC RFTP L  VYNEL PK  FEVVFVS DEDEESF +YF KMPW  VPF+
Sbjct  6    IVFSAAWCGPCQRFTPQLVEVYNELAPKVGFEVVFVSGDEDEESFGDYFSKMPWLTVPFA  65

Query  470  DSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAE  649
            DS T ERLD LF V GIP+L+I+D+ GK+   +GV ++  +G  AYPFT E++KEIK+ E
Sbjct  66   DSETHERLDGLFKVTGIPNLMIVDDHGKLVNNNGVGVIRSYGAGAYPFTPEKMKEIKEEE  125

Query  650  EAT*REQSLKTV-LVSTS  700
            +   REQ+L +V LVS +
Sbjct  126  DRARREQTLSSVSLVSVN  143



>ref|NP_001130856.1| hypothetical protein [Zea mays]
 gb|ACF79225.1| unknown [Zea mays]
 gb|ACF87677.1| unknown [Zea mays]
 gb|ACN29161.1| unknown [Zea mays]
 tpg|DAA45730.1| TPA: hypothetical protein ZEAMMB73_073655 [Zea mays]
Length=580

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 120/174 (69%), Gaps = 2/174 (1%)
 Frame = +2

Query  203  ILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-N  379
            IL + DRDFL+RNSG QVK+  ++   + IYFS SW  P   FTP L  VY +L  +G +
Sbjct  15   ILVTRDRDFLVRNSGEQVKISSIEASPVAIYFSNSWFPPSRWFTPKLIQVYKQLASEGKS  74

Query  380  FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD-ESGKV  556
            FEV+F   D  E++F EYF KMPW A+PFSD   RE LD  F V   PHLVILD ++G+V
Sbjct  75   FEVIFAWGDLKEKTFNEYFAKMPWLALPFSDIERREALDIRFKVTDTPHLVILDAKTGEV  134

Query  557  TTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             T+DGV IV E+GV+AYPFT +R+ E+K+ E+     Q+++ VL +++RDY+I+
Sbjct  135  YTKDGVRIVSEYGVDAYPFTPDRINELKELEKEEKENQTIQIVLGTSTRDYLIS  188


 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 94/150 (63%), Gaps = 2/150 (1%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            L S+L S   DF+I   G +V V +L GK + +YFS+ WCGP   F P L   Y+++  K
Sbjct  337  LESLLISGHLDFVIGKDGVKVPVSELVGKTVLLYFSSKWCGPSRGFLPTLVEAYSKIKEK  396

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
              +FEVVF+S D D+ SF EYF +MPW AVP+ D  T   L   F  RG P LV++  +G
Sbjct  397  NSDFEVVFISHDRDQRSFDEYFSEMPWLAVPWEDERTAP-LKTTFKARGFPILVVIGPNG  455

Query  551  KVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
            K  + D  ++++ HG +A+PFT ER++E++
Sbjct  456  KTVSWDATELLVVHGADAFPFTEERLEELQ  485


 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 98/179 (55%), Gaps = 5/179 (3%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  373
            ++ +L +S RD+LI N G +V + +L+GK +G++F      P   F   LA +Y +L   
Sbjct  174  IQIVLGTSTRDYLISNKGDKVPISELEGKYVGLFFVGVGYPPFIEFIDLLAKIYEKLKEV  233

Query  374  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  550
            G  FEVV VS   +E SF E F KMPW A+P  D+     L   F    +P LV++   G
Sbjct  234  GEKFEVVAVSIYSEESSFNESFAKMPWLAIPHGDNKCL-TLTRYFGFMSLPTLVLIGPDG  292

Query  551  KVTTEDGVDIVLEHGV---EAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            K    +  +I+++HG    E +PF+ E++  + +  +     Q+L+++L+S   D+VI 
Sbjct  293  KTLNNNVAEIIIDHGFDVWEGFPFSAEKLDFLAEKVKVKAATQTLESLLISGHLDFVIG  351



>ref|XP_010470488.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Camelina sativa]
Length=203

 Score =   159 bits (401),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 107/158 (68%), Gaps = 0/158 (0%)
 Frame = +2

Query  227  FLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSAD  406
            F +   G  + V     +K  I FSA+WCGPC RFTP L  VYNEL PK  FEVVFVS D
Sbjct  40   FSLLRRGISLFVTTANREKDWIVFSAAWCGPCQRFTPQLVEVYNELAPKVGFEVVFVSGD  99

Query  407  EDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVL  586
            EDEESF +YF KMPW  VPF+DS T +RLD LF V GIP+LVI+D+ GK+   +G  ++ 
Sbjct  100  EDEESFGDYFSKMPWLTVPFADSETHDRLDGLFKVTGIPNLVIVDDHGKLVNNNGFGVIR  159

Query  587  EHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTS  700
             +G  AYPFT E++KEIK+ E+   REQ+L +   S+S
Sbjct  160  SYGAGAYPFTPEKMKEIKEKEDRARREQTLSSDTASSS  197



>ref|XP_010470487.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Camelina sativa]
Length=232

 Score =   159 bits (401),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 109/159 (69%), Gaps = 1/159 (1%)
 Frame = +2

Query  227  FLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSAD  406
            F +   G  + V     +K  I FSA+WCGPC RFTP L  VYNEL PK  FEVVFVS D
Sbjct  40   FSLLRRGISLFVTTANREKDWIVFSAAWCGPCQRFTPQLVEVYNELAPKVGFEVVFVSGD  99

Query  407  EDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVL  586
            EDEESF +YF KMPW  VPF+DS T +RLD LF V GIP+LVI+D+ GK+   +G  ++ 
Sbjct  100  EDEESFGDYFSKMPWLTVPFADSETHDRLDGLFKVTGIPNLVIVDDHGKLVNNNGFGVIR  159

Query  587  EHGVEAYPFTLERVKEIKDAEEAT*REQSLKTV-LVSTS  700
             +G  AYPFT E++KEIK+ E+   REQ+L +V LVS +
Sbjct  160  SYGAGAYPFTPEKMKEIKEKEDRARREQTLSSVSLVSVN  198



>ref|XP_008466458.1| PREDICTED: probable nucleoredoxin 2 isoform X1 [Cucumis melo]
 ref|XP_008466459.1| PREDICTED: probable nucleoredoxin 2 isoform X2 [Cucumis melo]
Length=412

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 118/180 (66%), Gaps = 9/180 (5%)
 Frame = +2

Query  200  SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-  376
            S+L S DRD+L+  +G QVKV +L GK +G+YFSA+W  PC  F   L   Y +L   G 
Sbjct  21   SLLASGDRDYLLSPTGAQVKVSNLDGKVLGLYFSANWYPPCRNFNQILVRTYEKLQDNGS  80

Query  377  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL------  538
            NFEVV+VS+DED ++F EY   MPW A+PFSD  T+  L+  F + GIP L+IL      
Sbjct  81   NFEVVYVSSDEDSDAFNEYRASMPWPAIPFSDLETKIALNRKFGIEGIPCLIILQPRESK  140

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            DE+G  T  +GV++V  +GV+A+PFT ER++++K+ +      Q+L T+L +  RDY++A
Sbjct  141  DETG--TLNEGVEVVYRYGVDAFPFTKERLEQLKEEDREKEENQTLVTLLTNNYRDYLLA  198


 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 108/180 (60%), Gaps = 11/180 (6%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNS-GHQVKVDDLKGKKIGIY  295
            F F+K + E+ K     ++  +   L ++L ++ RD+L+ +    QV V  L GK IG+Y
Sbjct  161  FPFTKERLEQLKEEDREKE--ENQTLVTLLTNNYRDYLLAHPFPKQVPVVSLVGKTIGLY  218

Query  296  FSASWCGPCHRFTPNLATVYN------ELLPKGNFEVVFVSADEDEESFKEYFGKMPWTA  457
            FS  WC P   FTP L +VYN      E+    +FE+VFVS+D DE+SF  YFG MPW A
Sbjct  219  FSGKWCLP-GMFTPKLISVYNKIKRMVEMKEDEDFEIVFVSSDRDEDSFHSYFGSMPWLA  277

Query  458  VPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEI  637
            +PF D + RE L   F V+GIP L+IL  +GK  T+ G +++  +   AYPFT  R++E+
Sbjct  278  LPFGDPMIRE-LAKHFDVQGIPCLIILAPNGKTITKQGRNLINLYRENAYPFTEARLEEL  336



>emb|CDP07350.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 120/199 (60%), Gaps = 4/199 (2%)
 Frame = +2

Query  134  RKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWC  313
            R  +   A+   +Q     +  SIL + DRDFL+  +G QVK+ +L+GK +GIYFSA+W 
Sbjct  9    RVRDSNNATEEGDQEFKNTNFLSILATEDRDFLLSATGSQVKISELEGKIVGIYFSANWY  68

Query  314  GPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRER  490
             PC  FTP L   + E   +   FEVVFVS DED ++F  Y   MPW A+PFSD  T++ 
Sbjct  69   PPCKNFTPLLVNAFEEFKSQTPGFEVVFVSCDEDLDAFNNYRACMPWLAIPFSDLNTKKN  128

Query  491  LDALFTVRGIPHLVILDESGKVTTE---DGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*  661
            L++ F V GIP L+IL        E   DGV+++  +G +A+PFT ER++E+++ E    
Sbjct  129  LNSRFDVEGIPSLIILQPDNYKVDEAIHDGVELLYRYGKQAFPFTKERLQELQEREREKH  188

Query  662  REQSLKTVLVSTSRDYVIA  718
              Q+L  +L S +RD+++ 
Sbjct  189  ENQTLMNLLTSQNRDFLLG  207


 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 106/180 (59%), Gaps = 16/180 (9%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHD---LRSILCSSDRDFLIRNSGHQ-VKVDDLKGKKI  286
            F F+K + +E     + E+  + H+   L ++L S +RDFL+ +S  + V V  LKGK +
Sbjct  170  FPFTKERLQE-----LQEREREKHENQTLMNLLTSQNRDFLLGHSTSKLVPVASLKGKTV  224

Query  287  GIYFSASWCGPCHRFTPNLATVYNE----LLPKG--NFEVVFVSADEDEESFKEYFGKMP  448
            G+YFSA WC P  +FT  L ++Y +    LL  G  +FE+VFVS D DE SF  +FG MP
Sbjct  225  GLYFSAQWCFPGVKFTSRLISIYQKIKEVLLENGGEDFEIVFVSTDHDELSFNLFFGTMP  284

Query  449  WTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERV  628
            W A+PF+D  T + L   F V+ IP LVIL   GK  T+ G ++V  +   AYPFT  R 
Sbjct  285  WLALPFNDP-TIKNLTKHFDVQWIPSLVILGPDGKTVTKKGRNLVNLYQENAYPFTEART  343



>ref|XP_007221797.1| hypothetical protein PRUPE_ppa006064mg [Prunus persica]
 gb|EMJ22996.1| hypothetical protein PRUPE_ppa006064mg [Prunus persica]
Length=429

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 113/171 (66%), Gaps = 4/171 (2%)
 Frame = +2

Query  218  DRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVF  394
            DRDFL+  +G+QVKV DL+GK IG+YFSA+W  PC  F   L  +Y +L   G NFE+V+
Sbjct  41   DRDFLLSPTGNQVKVCDLEGKIIGLYFSANWYPPCWNFNQVLVGIYEQLKSSGSNFEIVY  100

Query  395  VSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL---DESGKVTTE  565
            VS+DED ++F  Y   MPW A+PFSD  T++ L+  F + GIP LVIL   D   + T  
Sbjct  101  VSSDEDADAFNIYHACMPWLAIPFSDLDTKKALNRRFDIEGIPSLVILHPNDNKDEATLR  160

Query  566  DGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            DGV+++  +GVEA+PFT +R++E++D E A    Q+L  +L +  RD ++ 
Sbjct  161  DGVELIYRYGVEAFPFTKQRLEELQDEERARHENQTLTNLLTNHDRDNLLG  211


 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/191 (41%), Positives = 110/191 (58%), Gaps = 15/191 (8%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRN-SGHQVKVDDLKGKKIGIY  295
            F F+K++ EE +    A    +   L ++L + DRD L+ + +  QV V  L GK IG+Y
Sbjct  174  FPFTKQRLEELQDEERARH--ENQTLTNLLTNHDRDNLLGHPTPEQVPVASLVGKTIGLY  231

Query  296  FSASWCGPCHRFTPNLATVYN----ELLPKG-----NFEVVFVSADEDEESFKEYFGKMP  448
            FSA WC PC  FTP L ++Y     ++L  G     +FE+VFVS+D D+ SF  YF  MP
Sbjct  232  FSAHWCRPCVNFTPRLISIYQKIKEQMLVDGDQDGEDFEIVFVSSDRDQASFDSYFDTMP  291

Query  449  WTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERV  628
            W A+PF D   ++ L   F V+GIP LVIL   GK  T+ G +++  +   AYPFT  ++
Sbjct  292  WLALPFGDPNIKQ-LVKHFDVKGIPCLVILGPDGKTVTKQGRNLINLYQENAYPFTEAKL  350

Query  629  K--EIKDAEEA  655
            +  E K  EEA
Sbjct  351  ELLEKKMDEEA  361



>ref|XP_008221212.1| PREDICTED: probable nucleoredoxin 2 [Prunus mume]
Length=427

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 111/167 (66%), Gaps = 4/167 (2%)
 Frame = +2

Query  218  DRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVF  394
            DRDFL+  +G+QVKV DL+GK IG+YFSA+W  PC  F   L  +Y +L   G NFE+V+
Sbjct  41   DRDFLLSPTGNQVKVCDLEGKIIGLYFSANWYPPCWNFNQVLVGIYEQLKSSGSNFEIVY  100

Query  395  VSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL---DESGKVTTE  565
            VS+DED ++F  Y G MPW A+PFSD  T++ L+  F + GIP LVIL   D   + T  
Sbjct  101  VSSDEDADAFNIYHGCMPWLAIPFSDLDTKKALNRRFDIEGIPSLVILHPNDNKDEATLR  160

Query  566  DGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRD  706
            DG +++  +GVEA+PFT +R++E++D E A    Q+L  +L +  RD
Sbjct  161  DGAELIYRYGVEAFPFTKQRLEELQDEERARHENQTLTNLLTNHDRD  207


 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/210 (39%), Positives = 117/210 (56%), Gaps = 17/210 (8%)
 Frame = +2

Query  62   SVLRSIAQFLSTFLLR*SIFQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRN  241
            + LR  A+ +  + +    F F+K++ EE +    A    +   L ++L + DRD L  +
Sbjct  157  ATLRDGAELIYRYGVE--AFPFTKQRLEELQDEERARH--ENQTLTNLLTNHDRDNLWGH  212

Query  242  -SGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN----ELLPKG-----NFEVV  391
             +  QV V  L GK IG+YFSA WC PC  FTP L ++Y     ++L  G     +FE+V
Sbjct  213  PTPEQVPVAALVGKTIGLYFSAHWCRPCVNFTPRLISIYQKIKEQMLVDGDQDGEDFEIV  272

Query  392  FVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDG  571
            FVS+D D+ SF  YF  MPW A+PF D   ++ L   F V+GIP LVIL   GK  T+ G
Sbjct  273  FVSSDRDQASFDSYFVTMPWLALPFGDPNIKQ-LVKHFDVKGIPCLVILGPDGKTVTKQG  331

Query  572  VDIVLEHGVEAYPFTLERVK--EIKDAEEA  655
             +++  +   AYPFT  +++  E K  EEA
Sbjct  332  RNLINLYQENAYPFTEAKLELLEKKMDEEA  361



>ref|XP_008377128.1| PREDICTED: probable nucleoredoxin 2 [Malus domestica]
Length=443

 Score =   158 bits (400),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 112/171 (65%), Gaps = 4/171 (2%)
 Frame = +2

Query  218  DRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVF  394
            DRD+L+  +G+QVKV DL    IG+YFSA+W  PC  F   L  +Y +L   G NFE+V+
Sbjct  47   DRDYLLSPTGNQVKVSDLNEMIIGLYFSANWYPPCWNFNQVLVGIYEQLKSSGSNFEIVY  106

Query  395  VSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL---DESGKVTTE  565
            VS+DED E+F +Y   MPW A+PFSD  T++ L+  F V  IP LVIL   D   +VT  
Sbjct  107  VSSDEDSEAFNKYHACMPWLAIPFSDLDTKKALNRKFDVESIPSLVILQPNDNKEEVTLH  166

Query  566  DGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            DGV+I+  +GV+A+PFT +R++E++D E A    Q+L  +L +  RDY++ 
Sbjct  167  DGVEIIYRYGVDAFPFTEQRLEELQDEERARHENQTLTNLLTAHDRDYLLG  217


 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 110/193 (57%), Gaps = 20/193 (10%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGH----QVKVDDLKGKKI  286
            F F++++ EE +    A    +   L ++L + DRD+L+   GH    QV V  L GK I
Sbjct  180  FPFTEQRLEELQDEERARH--ENQTLTNLLTAHDRDYLL---GHPMPKQVSVASLSGKTI  234

Query  287  GIYFSASWCGPCHRFTPNLATVYNELLPK--------GNFEVVFVSADEDEESFKEYFGK  442
            G+YFSA WC PC  FTP L ++Y+ +  K         +FE+VFVS+D D+ SF  YF  
Sbjct  235  GLYFSAQWCRPCVNFTPKLISIYDMIKEKVLEDDHDGEDFEIVFVSSDRDQTSFDSYFNT  294

Query  443  MPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLE  622
            MPW A+PF D   +E L   F V+GIP LVIL   GK  T+ G +++  +   AYPFT  
Sbjct  295  MPWLALPFGDPNIKE-LVKHFDVKGIPLLVILGPDGKTVTQQGRNLINLYKENAYPFTDA  353

Query  623  RVK--EIKDAEEA  655
            +V+  E K  EEA
Sbjct  354  KVELLEKKMDEEA  366



>ref|XP_004986914.1| PREDICTED: LOW QUALITY PROTEIN: probable nucleoredoxin 1-2-like 
[Setaria italica]
Length=554

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 107/159 (67%), Gaps = 2/159 (1%)
 Frame = +2

Query  251  QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFK  427
            QVK+  ++   + +YFSASWC PC RFTP    VY EL  + N  EVVFVS D DEESF 
Sbjct  18   QVKISAIEASTVALYFSASWCPPCRRFTPTFVEVYEELTSQDNSLEVVFVSRDRDEESFN  77

Query  428  EYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD-ESGKVTTEDGVDIVLEHGVEA  604
             Y  KMPW AVP +DS   +RL   + V GIP+LVIL  E+G + T++GV  + E+G+ A
Sbjct  78   AYLAKMPWLAVPLADSECLQRLMKGYKVNGIPNLVILSGETGXIYTKEGVKFISEYGIGA  137

Query  605  YPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
             PFTL+R+ E+K+ E+A    Q++ +VL + +RDY+I++
Sbjct  138  SPFTLQRINELKEQEKAAKDNQTIHSVLGTPTRDYLISS  176


 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 90/153 (59%), Gaps = 2/153 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +  L S+L   D +F+    G +V V +L GK + +YFS  WC PC  F P L   Y ++
Sbjct  318  SQSLESLLVKDDLEFVTGKDGVKVPVSELVGKTVILYFSTKWCPPCRDFLPTLVKEYKKM  377

Query  365  LPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K  +FE++F+S D+DE S+ E+F  MPW A+P  D   +E L   F +R IP L+++ 
Sbjct  378  KEKNSDFEILFISIDKDEXSYDEFFSDMPWLALPLGDE-RKELLMKKFRIREIPSLIVIG  436

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
             SG   T+D    +L HG +A+PFT E ++E++
Sbjct  437  PSGLTLTKDAKSHLLAHGADAFPFTEETLQELE  469


 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 107/214 (50%), Gaps = 12/214 (6%)
 Frame = +2

Query  83   QFLSTFLLR*SIFQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKV  262
            +F+S + +  S F   +R  E ++    A+ N   H   S+L +  RD+LI + G +V +
Sbjct  128  KFISEYGIGASPFTL-QRINELKEQEKAAKDNQTIH---SVLGTPTRDYLISSEGDKVPI  183

Query  263  DDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFG  439
              L+GK + ++F      P   FT  L  +Y +L   G  FEVV V    +E  F E F 
Sbjct  184  SVLEGKYVALFFMVR---PIDEFTAVLTKIYEKLRAVGEKFEVVAVYFGSNESVFNESFA  240

Query  440  KMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEA---YP  610
             MPW A+P  D +  ++L   F +  +P LV++   G     +  D++ EHG EA   +P
Sbjct  241  SMPWFAIPHGDKMC-DKLVRYFELTTLPTLVLIGPDGNTLNNNIADVIEEHGSEAWEGFP  299

Query  611  FTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYV  712
            F  E+++   D  +     QSL+++LV    ++V
Sbjct  300  FNAEKLEIFADKSKTKAASQSLESLLVKDDLEFV  333



>ref|XP_007017892.1| DC1 domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY15117.1| DC1 domain-containing protein isoform 3 [Theobroma cacao]
Length=427

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 121/195 (62%), Gaps = 14/195 (7%)
 Frame = +2

Query  176  NGDAHDLR-----SILCSSDRDFLIRNS-----GHQVKVDDLKGKKIGIYFSASWCGPCH  325
            NGD+  +      S+L S DRD+L+ +S       QVK+ DL+G+ IG+YFSA+W  PC 
Sbjct  19   NGDSEKISTSRFSSLLASKDRDYLLSSSEAEAEADQVKISDLEGRVIGLYFSANWYPPCR  78

Query  326  RFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDAL  502
             F   L  VY++L   G NFE+VFVS+DED ++F  Y   MPW ++PFSD  T++ L+  
Sbjct  79   NFNQVLVDVYDQLKSNGSNFEIVFVSSDEDLDAFNNYRKSMPWLSIPFSDLETKKALNRK  138

Query  503  FTVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQS  673
            F V GIP L+IL   D     T  DGV+++  +GVEA+PFT E+++E++  E      Q+
Sbjct  139  FEVEGIPCLIILQPEDNKDGATFYDGVELIYRYGVEAFPFTKEKLEELQREERMRHETQT  198

Query  674  LKTVLVSTSRDYVIA  718
            LK +L +  RDY++ 
Sbjct  199  LKNLLTNPDRDYILG  213


 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 108/188 (57%), Gaps = 11/188 (6%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNS-GHQVKVDDLKGKKIGIY  295
            F F+K K EE +         +   L+++L + DRD+++      +V+VD L  K IG+Y
Sbjct  176  FPFTKEKLEELQREERMRH--ETQTLKNLLTNPDRDYILGQPITRKVQVDSLIDKTIGLY  233

Query  296  FSASWCGPCHRFTPNLATVYNE----LLPKG--NFEVVFVSADEDEESFKEYFGKMPWTA  457
            FSA WC P   FTP L ++Y +    L  KG  +F++VFVS D D+ SF  YFG MPW A
Sbjct  234  FSAQWCLPGVTFTPRLISIYQKIKQTLEEKGGEDFDIVFVSNDRDQSSFDTYFGSMPWLA  293

Query  458  VPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEI  637
            +PF D   +  L   F V+GIP L+I+   GK  T+ G +++  +   AYPFT  +V+ +
Sbjct  294  LPFGDPSIKS-LAKYFDVQGIPCLIIIGPDGKTVTKQGRNLINLYQENAYPFTDAKVELL  352

Query  638  -KDAEEAT  658
             K+ EEA 
Sbjct  353  EKEMEEAA  360



>ref|XP_007017890.1| DC1 domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY15115.1| DC1 domain-containing protein isoform 1 [Theobroma cacao]
Length=428

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 121/196 (62%), Gaps = 15/196 (8%)
 Frame = +2

Query  176  NGDAHDLR-----SILCSSDRDFLIRNS------GHQVKVDDLKGKKIGIYFSASWCGPC  322
            NGD+  +      S+L S DRD+L+ +S        QVK+ DL+G+ IG+YFSA+W  PC
Sbjct  19   NGDSEKISTSRFSSLLASKDRDYLLSSSEAEAEADQQVKISDLEGRVIGLYFSANWYPPC  78

Query  323  HRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDA  499
              F   L  VY++L   G NFE+VFVS+DED ++F  Y   MPW ++PFSD  T++ L+ 
Sbjct  79   RNFNQVLVDVYDQLKSNGSNFEIVFVSSDEDLDAFNNYRKSMPWLSIPFSDLETKKALNR  138

Query  500  LFTVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQ  670
             F V GIP L+IL   D     T  DGV+++  +GVEA+PFT E+++E++  E      Q
Sbjct  139  KFEVEGIPCLIILQPEDNKDGATFYDGVELIYRYGVEAFPFTKEKLEELQREERMRHETQ  198

Query  671  SLKTVLVSTSRDYVIA  718
            +LK +L +  RDY++ 
Sbjct  199  TLKNLLTNPDRDYILG  214


 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 108/188 (57%), Gaps = 11/188 (6%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNS-GHQVKVDDLKGKKIGIY  295
            F F+K K EE +         +   L+++L + DRD+++      +V+VD L  K IG+Y
Sbjct  177  FPFTKEKLEELQREERMRH--ETQTLKNLLTNPDRDYILGQPITRKVQVDSLIDKTIGLY  234

Query  296  FSASWCGPCHRFTPNLATVYNE----LLPKG--NFEVVFVSADEDEESFKEYFGKMPWTA  457
            FSA WC P   FTP L ++Y +    L  KG  +F++VFVS D D+ SF  YFG MPW A
Sbjct  235  FSAQWCLPGVTFTPRLISIYQKIKQTLEEKGGEDFDIVFVSNDRDQSSFDTYFGSMPWLA  294

Query  458  VPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEI  637
            +PF D   +  L   F V+GIP L+I+   GK  T+ G +++  +   AYPFT  +V+ +
Sbjct  295  LPFGDPSIKS-LAKYFDVQGIPCLIIIGPDGKTVTKQGRNLINLYQENAYPFTDAKVELL  353

Query  638  -KDAEEAT  658
             K+ EEA 
Sbjct  354  EKEMEEAA  361



>ref|XP_010266892.1| PREDICTED: probable nucleoredoxin 2 [Nelumbo nucifera]
Length=429

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 121/177 (68%), Gaps = 4/177 (2%)
 Frame = +2

Query  200  SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-  376
            S+L S DRDFL+ ++G QVKV DL+GK +GIYFSA+W  PC  FTP LA VY +L  +G 
Sbjct  35   SLLASKDRDFLLSSTGDQVKVSDLEGKVVGIYFSANWYQPCRNFTPVLAGVYEQLKDRGC  94

Query  377  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL---DES  547
             FEVVFVS+DED ++F  Y   MPW A+PFSD  +++ L+  F V GIP L+IL   D  
Sbjct  95   GFEVVFVSSDEDSDAFASYRACMPWLAIPFSDLESKKALNRRFQVEGIPCLIILQPDDNE  154

Query  548  GKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             + T  +GV+++  +GV A+PFT +R++E++  E+     Q++  +L++ +R ++++
Sbjct  155  DESTLREGVELIYRYGVRAFPFTKQRLEELEKEEKEKHENQTITKLLINHNRSFLLS  211


 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 100/169 (59%), Gaps = 16/169 (9%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNS-GHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL-  367
            +  +L + +R FL+  S   QV+V+ L G+ IG+YFSA WC PC RFTP L ++Y+++  
Sbjct  197  ITKLLINHNRSFLLSQSILKQVEVESLVGRTIGLYFSAQWCLPCLRFTPKLISIYHKIKQ  256

Query  368  -----------PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  514
                        +  FE+VFVS+D D  +F  YFG MPW A+PF D  T + L   F V+
Sbjct  257  VIVEKKRAADSKEEGFEIVFVSSDRDRAAFDSYFGTMPWLALPFGDP-TIKNLTRYFDVQ  315

Query  515  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVK--EIKDAEEA  655
            GIP LVIL   GK  T+ G +++  +  +AYPFT  +++  E +  EEA
Sbjct  316  GIPCLVILGPDGKTLTKHGRNLINLYQEKAYPFTKAQLEILEKQRNEEA  364



>ref|XP_003603818.1| Nucleoredoxin [Medicago truncatula]
 gb|AES74069.1| nucleoredoxin, putative [Medicago truncatula]
Length=429

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 119/178 (67%), Gaps = 8/178 (4%)
 Frame = +2

Query  203  ILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL---LPK  373
            +L S DRDFL+ ++G QVK+ +L+GK +G+ F+A+W  PC  FT  L  +Y +L   +P+
Sbjct  40   LLASKDRDFLLSSTGTQVKISELEGKVVGLLFAANWYPPCRGFTQLLIGIYEQLKSNIPQ  99

Query  374  GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD---E  544
              FE+V+VS+DED ++F  ++G MPW A+PFSD  T++ L+  + V GIP LV+L     
Sbjct  100  --FEIVYVSSDEDLDAFNGFYGNMPWLAIPFSDLETKKALNRKYDVEGIPCLVMLQPDHS  157

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             G+ T  DGV+++  +GV+AYPF+ ER++++  AE      Q+L  +L +  RDYV++
Sbjct  158  KGEATLRDGVELIYRYGVQAYPFSKERLEQLHVAEREKLENQTLANLLANNHRDYVLS  215


 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 101/182 (55%), Gaps = 15/182 (8%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGH----QVKVDDLKGKKI  286
            + FSK + E+   +    +  +   L ++L ++ RD+++ ++G     QV V  L GK I
Sbjct  178  YPFSKERLEQLHVAE--REKLENQTLANLLANNHRDYVLSHTGTGLLTQVPVASLVGKTI  235

Query  287  GIYFSASWCGPCHRFTPNLATVY----NELL----PKGNFEVVFVSADEDEESFKEYFGK  442
            G+YFSA WC PC +FTP L  VY     EL     P  +FE+V VS D D+ESF  Y+  
Sbjct  236  GLYFSAGWCVPCTKFTPKLINVYQIIKQELAEKQDPHEDFEIVLVSNDRDQESFDSYYNI  295

Query  443  MPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLE  622
            MPW A+PF D   +  L   F V+GIP LVI+   GK  T  G +++  +   AYPFT  
Sbjct  296  MPWLALPFGDPEIK-NLARHFDVQGIPCLVIIGPDGKTITIHGRNLINLYQENAYPFTAS  354

Query  623  RV  628
            +V
Sbjct  355  KV  356



>ref|XP_008387909.1| PREDICTED: probable nucleoredoxin 2 [Malus domestica]
Length=436

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 112/172 (65%), Gaps = 4/172 (2%)
 Frame = +2

Query  215  SDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVV  391
             D D+L+  +G+QVKV DL+GK IG+YFSA+W  PC  F   L  +Y +L   G NFE+V
Sbjct  47   QDHDYLLTPTGNQVKVSDLEGKIIGLYFSANWYPPCWNFNQVLVGIYEQLKNSGTNFEIV  106

Query  392  FVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL---DESGKVTT  562
            +VS+DED ++F  Y   MPW A+PFSD  T++ L+  F V  IP LVIL   D   + T 
Sbjct  107  YVSSDEDSDAFNIYHACMPWLAIPFSDLDTKKALNRKFDVESIPSLVILQPNDNKDEATL  166

Query  563  EDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             DGV+I+  +GVEA+PFT ++++E++D + A    Q+L  +L +  RDY++ 
Sbjct  167  HDGVEIIYRYGVEAFPFTKQKLEELQDEDRARHENQTLTNLLTNHDRDYLLG  218


 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 110/193 (57%), Gaps = 20/193 (10%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGH----QVKVDDLKGKKI  286
            F F+K+K EE +    A    +   L ++L + DRD+L+   GH    QV V  L+GK I
Sbjct  181  FPFTKQKLEELQDEDRARH--ENQTLTNLLTNHDRDYLL---GHPTPKQVSVASLRGKTI  235

Query  287  GIYFSASWCGPCHRFTPNLATVYNELLPKG--------NFEVVFVSADEDEESFKEYFGK  442
            G+YFSA WC PC  FTP L ++Y ++  K         +FE+V VS+D D+ SF  YF  
Sbjct  236  GLYFSAQWCRPCVNFTPKLISIYEKIKEKMLVDDHDGEDFEIVLVSSDRDQTSFDSYFNT  295

Query  443  MPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLE  622
            MPW A+PF D   +E L   F V+GIP LVIL   GK  T+ G +++  +   AYPFT  
Sbjct  296  MPWLALPFGDPNIKE-LVKHFDVKGIPCLVILGPDGKTVTQQGRNLINLYKENAYPFTDA  354

Query  623  RVK--EIKDAEEA  655
            +++  E K  EEA
Sbjct  355  KLELLEKKMDEEA  367



>ref|XP_009334668.1| PREDICTED: probable nucleoredoxin 2 [Pyrus x bretschneideri]
 ref|XP_009334675.1| PREDICTED: probable nucleoredoxin 2 [Pyrus x bretschneideri]
Length=432

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 111/172 (65%), Gaps = 4/172 (2%)
 Frame = +2

Query  215  SDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVV  391
             DRD+L+  +G+QVKV DL GK IG+YFSA+W  PC  F   L  +Y +L   G NFE+V
Sbjct  45   QDRDYLLTPTGNQVKVSDLDGKIIGLYFSANWYPPCWNFNQVLVGIYEQLKNSGTNFEIV  104

Query  392  FVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL---DESGKVTT  562
            +VS+DED ++F  Y   MPW A+PFSD  T++ L+  F V  IP LVIL   D   + T 
Sbjct  105  YVSSDEDSDAFNIYHACMPWLAIPFSDLDTKKALNRKFDVESIPSLVILQPNDNKDEATL  164

Query  563  EDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             DGV+I+  +GV A+PFT ++++E++D + A    Q+L  +L +  RDY++ 
Sbjct  165  HDGVEIIYRYGVVAFPFTTQKLEELQDEDRARHENQTLTNLLANHDRDYLLG  216


 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 110/193 (57%), Gaps = 20/193 (10%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGH----QVKVDDLKGKKI  286
            F F+ +K EE +    A    +   L ++L + DRD+L+   GH    QV V  L+GK I
Sbjct  179  FPFTTQKLEELQDEDRARH--ENQTLTNLLANHDRDYLL---GHPTPKQVSVASLRGKTI  233

Query  287  GIYFSASWCGPCHRFTPNLATVYNELLPKG--------NFEVVFVSADEDEESFKEYFGK  442
            G+YFSA WC PC  FTP L ++Y ++  K         +FE+VFVS+D D+ SF  YF  
Sbjct  234  GLYFSAQWCRPCVNFTPKLISIYEKIKEKMLVDDHDGEDFEIVFVSSDRDQTSFDSYFNT  293

Query  443  MPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLE  622
            MPW A+PF D   +E L   F V+GIP LVIL   GK  T+ G +++  +   AYPFT  
Sbjct  294  MPWVALPFGDPNIKE-LVKHFDVKGIPCLVILGPDGKTVTQQGRNLINLYKENAYPFTDA  352

Query  623  RVK--EIKDAEEA  655
            +++  E K  EEA
Sbjct  353  KLELLEKKMDEEA  365



>ref|XP_004136369.1| PREDICTED: probable nucleoredoxin 2 [Cucumis sativus]
 gb|KGN60060.1| hypothetical protein Csa_3G874380 [Cucumis sativus]
Length=410

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 115/180 (64%), Gaps = 9/180 (5%)
 Frame = +2

Query  200  SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-  376
            S+L S  RD+L+  +G QVKV +L GK +G+YFSA+W  PC  F   L   Y +L   G 
Sbjct  21   SLLASGGRDYLLSPTGAQVKVSNLDGKVLGLYFSANWYPPCRNFNQILVRTYEKLQDNGS  80

Query  377  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL------  538
            NFEVV+VS+DED ++F EY   MPW A+PFSD  T+  L+  F + GIP L+IL      
Sbjct  81   NFEVVYVSSDEDSDAFNEYRASMPWPAIPFSDLETKIALNRKFGIEGIPCLIILQPRESK  140

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            DE+   T  +GV++V  +GV+A+PFT ER++++K+ +      Q+L T+L +  RDY+ A
Sbjct  141  DETA--TLHEGVEVVYRYGVDAFPFTQERLEQLKEEDREKEENQTLVTLLTNNYRDYLFA  198


 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 108/180 (60%), Gaps = 11/180 (6%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNS-GHQVKVDDLKGKKIGIY  295
            F F++ + E+ K     ++  +   L ++L ++ RD+L  +S   QV V  L GK +G+Y
Sbjct  161  FPFTQERLEQLKEEDREKE--ENQTLVTLLTNNYRDYLFAHSFPKQVPVVSLVGKTVGLY  218

Query  296  FSASWCGPCHRFTPNLATVYN------ELLPKGNFEVVFVSADEDEESFKEYFGKMPWTA  457
            FSA WC P   FTP L +VY+      E+    +FE+VFVS+D DE+SF  YFG MPW  
Sbjct  219  FSAKWCLP-GMFTPKLISVYSKIKRMVEMKEDEDFEIVFVSSDRDEDSFHSYFGSMPWLG  277

Query  458  VPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEI  637
            +P+ D + +E L   F V+GIP L+IL  +GK  T+ G +++  +   AYPFT  R++E+
Sbjct  278  LPYGDPMIKE-LAKHFDVQGIPCLIILAPNGKTITKQGRNLINLYRENAYPFTEARLEEL  336



>ref|XP_002306954.1| hypothetical protein POPTR_0005s26610g [Populus trichocarpa]
 gb|EEE93950.1| hypothetical protein POPTR_0005s26610g [Populus trichocarpa]
Length=423

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 125/197 (63%), Gaps = 10/197 (5%)
 Frame = +2

Query  158  SSMAEQNGDAHDLRS-----ILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPC  322
            +S AE NGD+H + S     +L S DRD+L+   G QVKV DL+GK +G+YFSA+W  PC
Sbjct  12   ASKAEANGDSHRISSSRFSSLLASKDRDYLLSQDGTQVKVSDLEGKVLGLYFSANWYAPC  71

Query  323  HRFTPN-LATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLD  496
              FT   L   Y +L   G NFE+VFVS+DED ++F  Y   MPW ++PFSD  T++ L+
Sbjct  72   RSFTSQVLIGAYQDLKSNGSNFEIVFVSSDEDLDAFNNYRANMPWLSIPFSDLETKKALN  131

Query  497  ALFTVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*RE  667
            + F V  IP LVIL   D   + T  DGV+++   GV+A+PFT ER++E+K  E+     
Sbjct  132  SKFDVEAIPCLVILHPKDNKDEATLHDGVELLHRFGVQAFPFTKERLEELKLEEKEKHER  191

Query  668  QSLKTVLVSTSRDYVIA  718
            Q+L  +L+  +RDY++ 
Sbjct  192  QTLTNLLICHNRDYLLG  208


 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 91/153 (59%), Gaps = 9/153 (6%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSG-HQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE---  361
            L ++L   +RD+L+ +    QV V  L GK IG+YFS+ WC P  +FTP L ++Y +   
Sbjct  194  LTNLLICHNRDYLLGHPAPRQVPVASLVGKTIGLYFSSHWCLPGGKFTPKLISIYQKIKQ  253

Query  362  -LLPKGN---FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  529
             L+ KGN   FE+VFVS+D D+  F  YF  MPW A+PF D   +  L   F V+GIP L
Sbjct  254  MLVNKGNDDDFEIVFVSSDRDQAEFDSYFNSMPWLALPFGDPANKT-LAKHFDVKGIPCL  312

Query  530  VILDESGKVTTEDGVDIVLEHGVEAYPFTLERV  628
            VIL   GK  ++ G +++  +   AYPFT  +V
Sbjct  313  VILGPDGKTVSKHGRNLINLYQENAYPFTEAQV  345



>ref|XP_010100128.1| hypothetical protein L484_014319 [Morus notabilis]
 gb|EXB81511.1| hypothetical protein L484_014319 [Morus notabilis]
Length=472

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 113/178 (63%), Gaps = 5/178 (3%)
 Frame = +2

Query  200  SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-  376
            S+L S DRD+L+   G+QVK+ DL GK +G+YFSA+W  PC  F   L  +Y +L   G 
Sbjct  33   SLLASKDRDYLLSPKGNQVKISDLNGKVVGLYFSANWYPPCRNFNQVLVEIYEQLKQSGS  92

Query  377  NFEVVFVSADEDEESFKEYF-GKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL---DE  544
            NFE+V+VS+DED  +F  Y+   MPW A+PFSD  T++ L+  F + GIP LV+L   D 
Sbjct  93   NFEIVYVSSDEDIAAFNTYYHACMPWLAIPFSDLETKKALNRKFDIEGIPCLVVLQPNDN  152

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
              + T  DGV++V  +GV+ +PFT ER++E++  +      Q+L  +L S  RDY++ 
Sbjct  153  KDEATLFDGVELVYRYGVQVFPFTKERLEELQREDRERHENQNLTNLLTSQHRDYLLG  210


 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 103/187 (55%), Gaps = 22/187 (12%)
 Frame = +2

Query  116  IFQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGH----QVKVDDLKGKK  283
            +F F+K + EE +      +  +  +L ++L S  RD+L+   GH    QV V  L GK 
Sbjct  172  VFPFTKERLEELQRED--RERHENQNLTNLLTSQHRDYLL---GHPRPKQVHVASLVGKT  226

Query  284  IGIYFSASWCGPCHRFTPNLATVYNELLP-----KGN-------FEVVFVSADEDEESFK  427
            IG++FSA W  PC +F   L + Y+++       +GN       FE+VFVS+D D+ SF 
Sbjct  227  IGLFFSAEWGIPCVKFITKLMSNYHKIKQMIADKQGNNGHDDEDFEIVFVSSDHDQTSFD  286

Query  428  EYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAY  607
             YFG MPW A+PF D   +  L   F V+GIP LVIL   GK  T +G +++  +   AY
Sbjct  287  FYFGSMPWLALPFGDPNIK-NLVKHFDVKGIPSLVILGPDGKTITRNGRNLINLYQENAY  345

Query  608  PFTLERV  628
            PFT  R+
Sbjct  346  PFTEARI  352



>gb|KHN45956.1| Putative nucleoredoxin 2 [Glycine soja]
Length=419

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 118/189 (62%), Gaps = 4/189 (2%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            +   NG+      +L S DRD+L+  +G QVKV DL+GK +G+ F+A+W  PC  FT  L
Sbjct  9    VMNHNGNHGKFSHLLASQDRDYLLSPTGAQVKVSDLEGKVVGLLFAANWYPPCRGFTQVL  68

Query  344  ATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
            A +Y EL  +   FE+V+VS+DED  +F  ++G MPW A+PFSD  T++ L   F V  +
Sbjct  69   AGIYEELKSRVPQFEIVYVSSDEDLNAFNSFYGSMPWIAIPFSDLETKKSLTRKFDVEAV  128

Query  521  PHLVIL---DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            P L++L   D     T  DGV+++  +G++AYPF+ +R+++++  ++     Q+L  +L 
Sbjct  129  PCLILLQPDDRKEHATVRDGVELIYRYGIQAYPFSKDRLEQLQKEDKVKRDNQTLTNLLA  188

Query  692  STSRDYVIA  718
            +  RDYV++
Sbjct  189  NHHRDYVLS  197


 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 112/202 (55%), Gaps = 14/202 (7%)
 Frame = +2

Query  50   KASHSVLRSIAQFLSTFLLR*SIFQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDF  229
            +  H+ +R   + +  + ++   + FSK + E+ +     ++  D   L ++L +  RD+
Sbjct  139  RKEHATVRDGVELIYRYGIQ--AYPFSKDRLEQLQKEDKVKR--DNQTLTNLLANHHRDY  194

Query  230  LIRNSG---HQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY----NELLPKG--NF  382
            ++ ++     +V V  L GK IG+YFSA WC PC +FTP L +VY    +EL  KG  +F
Sbjct  195  VLSHTHTGLKKVPVASLVGKTIGLYFSAEWCVPCAKFTPKLISVYEKIKHELAEKGEEDF  254

Query  383  EVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTT  562
            EVV +S+D D+ SF  Y+  MPW A+PF D   +  L   + V+GIP LVI+   GK  T
Sbjct  255  EVVLISSDRDQASFDSYYSTMPWLALPFGDPEIK-NLVRHYNVQGIPWLVIIGPDGKTIT  313

Query  563  EDGVDIVLEHGVEAYPFTLERV  628
              G  ++  +   AYPFT  +V
Sbjct  314  VHGRSLINLYQENAYPFTKAKV  335



>ref|NP_001276271.1| probable nucleoredoxin 2-like [Glycine max]
 gb|ACU20924.1| unknown [Glycine max]
Length=423

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 118/189 (62%), Gaps = 4/189 (2%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            +   NG+      +L S DRD+L+  +G QVKV DL+GK +G+ F+A+W  PC  FT  L
Sbjct  13   VMNHNGNHGKFSHLLASQDRDYLLSPTGAQVKVSDLEGKVVGLLFAANWYPPCRGFTQVL  72

Query  344  ATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
            A +Y EL  +   FE+V+VS+DED  +F  ++G MPW A+PFSD  T++ L   F V  +
Sbjct  73   AGIYEELKSRVPQFEIVYVSSDEDLNAFNSFYGSMPWIAIPFSDLETKKSLTRKFDVEAV  132

Query  521  PHLVIL---DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            P L++L   D     T  DG++++  +G++AYPF+ +R+++++  ++     Q+L  +L 
Sbjct  133  PCLILLQPDDRKEHATVRDGIELIYRYGIQAYPFSKDRLEQLQKEDKVKRDNQTLTNLLA  192

Query  692  STSRDYVIA  718
            +  RDYV++
Sbjct  193  NHHRDYVLS  201


 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 112/202 (55%), Gaps = 14/202 (7%)
 Frame = +2

Query  50   KASHSVLRSIAQFLSTFLLR*SIFQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDF  229
            +  H+ +R   + +  + ++   + FSK + E+ +     ++  D   L ++L +  RD+
Sbjct  143  RKEHATVRDGIELIYRYGIQ--AYPFSKDRLEQLQKEDKVKR--DNQTLTNLLANHHRDY  198

Query  230  LIRNSG---HQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY----NELLPKG--NF  382
            ++ ++     +V V  L GK IG+YFSA WC PC +FTP L +VY    +EL  KG  +F
Sbjct  199  VLSHTHTGLKKVPVASLVGKTIGLYFSAEWCVPCAKFTPKLISVYEKIKHELAEKGEEDF  258

Query  383  EVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTT  562
            EVV +S+D D+ SF  Y+  MPW A+PF D   +  L   + V+GIP LVI+   GK  T
Sbjct  259  EVVLISSDRDQASFDSYYSTMPWLALPFGDPEIK-NLVRHYNVQGIPWLVIIGPDGKTIT  317

Query  563  EDGVDIVLEHGVEAYPFTLERV  628
              G  ++  +   AYPFT  +V
Sbjct  318  VHGRSLINLYQENAYPFTKAKV  339



>ref|XP_006577959.1| PREDICTED: probable nucleoredoxin 2-like isoform X2 [Glycine 
max]
Length=446

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 118/189 (62%), Gaps = 4/189 (2%)
 Frame = +2

Query  164  MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            +   NG+      +L S DRD+L+  +G QVKV DL+GK +G+ F+A+W  PC  FT  L
Sbjct  13   VMNHNGNHGKFSHLLASQDRDYLLSPTGAQVKVSDLEGKVVGLLFAANWYPPCRGFTQVL  72

Query  344  ATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
            A +Y EL  +   FE+V+VS+DED  +F  ++G MPW A+PFSD  T++ L   F V  +
Sbjct  73   AGIYEELKSRVPQFEIVYVSSDEDLNAFNSFYGSMPWIAIPFSDLETKKSLTRKFDVEAV  132

Query  521  PHLVIL---DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            P L++L   D     T  DGV+++  +G++AYPF+ +R+++++  ++     Q+L  +L 
Sbjct  133  PCLILLQPDDRKEHATVRDGVELIYRYGIQAYPFSKDRLEQLQKEDKVKRDNQTLTNLLA  192

Query  692  STSRDYVIA  718
            +  RDYV++
Sbjct  193  NHHRDYVLS  201


 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 112/225 (50%), Gaps = 37/225 (16%)
 Frame = +2

Query  50   KASHSVLRSIAQFLSTFLLR*SIFQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDF  229
            +  H+ +R   + +  + ++   + FSK + E+ +     ++  D   L ++L +  RD+
Sbjct  143  RKEHATVRDGVELIYRYGIQ--AYPFSKDRLEQLQKEDKVKR--DNQTLTNLLANHHRDY  198

Query  230  LIRN--------------------------SGHQVKVDDLKGKKIGIYFSASWCGPCHRF  331
            ++ +                          S  QV V  L GK IG+YFSA WC PC +F
Sbjct  199  VLSHTHTGLKKFYLNCMQRIMDPVPRDGCCSCTQVPVASLVGKTIGLYFSAEWCVPCAKF  258

Query  332  TPNLATVY----NELLPKG--NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERL  493
            TP L +VY    +EL  KG  +FEVV +S+D D+ SF  Y+  MPW A+PF D   +  L
Sbjct  259  TPKLISVYEKIKHELAEKGEEDFEVVLISSDRDQASFDSYYSTMPWLALPFGDPEIKN-L  317

Query  494  DALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERV  628
               + V+GIP LVI+   GK  T  G  ++  +   AYPFT  +V
Sbjct  318  VRHYNVQGIPWLVIIGPDGKTITVHGRSLINLYQENAYPFTKAKV  362



>ref|XP_009620045.1| PREDICTED: probable nucleoredoxin 2 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009620046.1| PREDICTED: probable nucleoredoxin 2 isoform X2 [Nicotiana tomentosiformis]
Length=442

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 114/182 (63%), Gaps = 5/182 (3%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A D RSIL S D DFL+ ++G QVKV DL+ K +G+YFSA+W  PC +FT  L  VY +L
Sbjct  49   AEDYRSILASKDSDFLLSSTGAQVKVSDLESKVVGLYFSANWYAPCTKFTDLLINVYEQL  108

Query  365  LPKGN--FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
                N  FE+VFVS+DED ++F  Y   MPW A+PFSD  TR  L   F V GIP L+IL
Sbjct  109  KDHINPGFEIVFVSSDEDSDAFNTYKSSMPWLAIPFSDLETRRALTRKFDVEGIPCLIIL  168

Query  539  DESGK---VTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDY  709
              +         DGV++V  +GV+A+PFT +R+ E+K+ E+     Q+L  +L    RDY
Sbjct  169  QPNSNKDAAVISDGVELVYRYGVQAFPFTKDRLAELKEKEKEKHDNQTLSNLLTRDGRDY  228

Query  710  VI  715
            ++
Sbjct  229  LL  230


 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 89/156 (57%), Gaps = 8/156 (5%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSG-HQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  358
            D   L ++L    RD+L+   G  QV V  L GK +G+YFSA WC P  +FTP L +VY 
Sbjct  213  DNQTLSNLLTRDGRDYLLVQPGSKQVPVASLVGKTVGLYFSAQWCIPAFKFTPRLMSVYQ  272

Query  359  ELLPK------GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
            ++  +       +FE+VFVS+D D+  F  YF  MPW AVP+ D  T + L   F +RGI
Sbjct  273  KIKQQLEGKEDEDFEIVFVSSDRDQVQFLTYFETMPWLAVPYDDP-TIKNLAKYFDIRGI  331

Query  521  PHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERV  628
            P LV+L   GK  T+ G  ++  +   AYPFT  RV
Sbjct  332  PSLVVLGPDGKTVTKQGRSLINLYKENAYPFTKTRV  367



>ref|XP_011003080.1| PREDICTED: probable nucleoredoxin 2 [Populus euphratica]
Length=423

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 123/197 (62%), Gaps = 10/197 (5%)
 Frame = +2

Query  158  SSMAEQNGDAHDLRS-----ILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPC  322
            +S AE NGD+H + S     +L S DRD+L+   G QVKV DL+GK +G+YFSA+W  PC
Sbjct  12   ASKAEANGDSHRISSSRFSSLLASKDRDYLLSQDGTQVKVSDLEGKVLGLYFSANWYAPC  71

Query  323  HRFTPN-LATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLD  496
              FT   L   Y +L   G NFE+VFVS+DED ++F  Y   MPW ++PFSD  T++ L+
Sbjct  72   RSFTSQVLIGAYQDLKSNGSNFEIVFVSSDEDLDAFNNYRANMPWLSIPFSDLETKKALN  131

Query  497  ALFTVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*RE  667
            + F V  IP LVIL   D   + T  DGV+++   GV+A+PFT ER++E+K  E+     
Sbjct  132  SKFDVEAIPCLVILHPKDNKDEATLHDGVELLHRFGVQAFPFTKERLEELKLEEKEKHER  191

Query  668  QSLKTVLVSTSRDYVIA  718
            Q+L  +L    RDY++ 
Sbjct  192  QTLTNLLACHDRDYLLG  208


 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 91/153 (59%), Gaps = 9/153 (6%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSG-HQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE---  361
            L ++L   DRD+L+ +    QV V  L GK IG+YFS+ WC P  +FTP L ++Y +   
Sbjct  194  LTNLLACHDRDYLLGHPAPRQVPVASLVGKTIGLYFSSHWCLPGGKFTPKLISIYQKIKE  253

Query  362  -LLPKGN---FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  529
             L+ KGN   FE+VFVS+D D+  F  YF  MPW A+PF D   +  L   F V+GIP L
Sbjct  254  ILVNKGNDDDFEIVFVSSDRDQAEFDSYFNSMPWLALPFGDPANK-TLAKHFDVKGIPCL  312

Query  530  VILDESGKVTTEDGVDIVLEHGVEAYPFTLERV  628
            VIL   GK  ++ G +++  +   AYPFT  +V
Sbjct  313  VILGPDGKTVSKHGRNLINLYQENAYPFTEAQV  345



>ref|XP_012073729.1| PREDICTED: probable nucleoredoxin 2 [Jatropha curcas]
 gb|KDP36878.1| hypothetical protein JCGZ_08169 [Jatropha curcas]
Length=418

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 121/189 (64%), Gaps = 5/189 (3%)
 Frame = +2

Query  167  AEQNGDAH-DLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  343
            A+ NG  H    S+L S DRDFL+ + G Q+KV +L+GK +G+YFSA+W  PC  FT  L
Sbjct  15   AKTNGGPHCRFSSLLASKDRDFLLSSDGTQIKVSELEGKVLGLYFSANWYPPCGSFTQFL  74

Query  344  ATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
               Y EL   G +FEVVFVS+DED E+F +Y   MPW ++PF D  T++ LD  F + GI
Sbjct  75   VGAYEELKRNGCDFEVVFVSSDEDLEAFNKYRASMPWLSIPFPDLETKKALDHKFNIEGI  134

Query  521  PHLVIL---DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            P L+IL   D   + T  DGV+++   GV+A+PFT ER++E+K  E+A    Q+L  +L 
Sbjct  135  PCLIILQPHDYKDEATLHDGVELLYRFGVQAFPFTKERLEELKLEEKAKHERQTLTNLLT  194

Query  692  STSRDYVIA  718
            +  RD++ A
Sbjct  195  NHHRDFLFA  203


 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 95/160 (59%), Gaps = 8/160 (5%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGH-QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP  370
            L ++L +  RDFL  +    QV VD L GK IG++FSA WC P  +FTP L ++YN++  
Sbjct  189  LTNLLTNHHRDFLFAHPARKQVAVDSLVGKTIGLFFSAEWCRPGLKFTPKLISIYNKIKQ  248

Query  371  K------GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLV  532
                    +FE+V+VS D D++ F+ YF  MPW A+PF D  T + L   F V+GIP L+
Sbjct  249  MVKQKDDEDFEIVYVSTDRDQQGFESYFSIMPWLALPFGDP-TIKSLAKHFEVQGIPCLI  307

Query  533  ILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
            IL   GK  T  G +++  +  +AYPFT  RV+ ++   E
Sbjct  308  ILGPDGKTITRHGRNLINLYQEKAYPFTEARVELLEKQME  347



>ref|XP_007136118.1| hypothetical protein PHAVU_009G019400g [Phaseolus vulgaris]
 gb|ESW08112.1| hypothetical protein PHAVU_009G019400g [Phaseolus vulgaris]
Length=418

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 120/199 (60%), Gaps = 4/199 (2%)
 Frame = +2

Query  134  RKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWC  313
            R   + +A ++     +      +L S DRD+L+  +G QVKV DL+GK +G+ F+A+W 
Sbjct  2    RAEMKHEAQAVVNNICNTGKFSQLLASQDRDYLLSPTGSQVKVSDLEGKVVGLLFAANWY  61

Query  314  GPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRER  490
             PC  FT  L  +Y EL      FE+V+VS+DED ++F  ++G MPW A+PFSD  T++ 
Sbjct  62   PPCRGFTQVLVGIYEELKSSFREFEIVYVSSDEDLDAFSSFYGNMPWLAIPFSDLETKKS  121

Query  491  LDALFTVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*  661
            L   + V GIP L+ L   D   + T  DGV+++  +GV+AYPF  ER+++++  ++   
Sbjct  122  LTRKYDVEGIPCLIFLQPQDRKDQATVRDGVELIYRYGVQAYPFCNERLEQLRKEDKIKR  181

Query  662  REQSLKTVLVSTSRDYVIA  718
              Q+L  +L +  RDYV++
Sbjct  182  ENQTLLNLLSNRHRDYVLS  200


 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 100/176 (57%), Gaps = 13/176 (7%)
 Frame = +2

Query  128  SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSG---HQVKVDDLKGKKIGIYF  298
            ++R  + RK   +  +N     L ++L +  RD+++ ++     QV +  L GK I +YF
Sbjct  167  NERLEQLRKEDKIKREN---QTLLNLLSNRHRDYVLSHTHFGLKQVPLASLVGKTIALYF  223

Query  299  SASWCGPCHRFTPNLATVY----NELLPKG--NFEVVFVSADEDEESFKEYFGKMPWTAV  460
            SA WC PC +FTP L +VY     EL  KG  +FEVV VS+D D+ SF  Y+  MPW A+
Sbjct  224  SAEWCVPCAKFTPKLISVYEKIKQELAEKGEEDFEVVLVSSDRDKASFDSYYSSMPWLAL  283

Query  461  PFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERV  628
            PF D+ T+  L   F V+GIP LVI+   GK  T  G  ++  +   AYPFT  +V
Sbjct  284  PFGDTETKN-LVRHFNVQGIPWLVIIGPDGKTITVHGRSLINLYRENAYPFTNAKV  338



>ref|XP_004238384.1| PREDICTED: probable nucleoredoxin 2 [Solanum lycopersicum]
Length=440

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 117/194 (60%), Gaps = 12/194 (6%)
 Frame = +2

Query  161  SMAEQNGDAH----DLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHR  328
            S A ++  +H    D  SIL S D +FL+  +G QVKV +L+GK +G+YFSA+W  PC +
Sbjct  31   SFASKSYHSHLVSDDYLSILASKDGEFLLSPTGAQVKVSELEGKVVGLYFSANWYSPCTK  90

Query  329  FTPNLATVYNELLPKGN----FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLD  496
            FT  L  VY +L    N    FE+VFVS+DED  +F  Y   MPW A+PFSD  TR  L 
Sbjct  91   FTNLLVNVYQQLKECSNINLGFEIVFVSSDEDLNAFNTYRSSMPWLAIPFSDLETRRALT  150

Query  497  ALFTVRGIPHLVIL----DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*R  664
              F V GIP L++L    D+      +DGV++V  +GV+A+PFT ER+ E++  E+    
Sbjct  151  QKFDVEGIPCLIVLLPNDDKLDTAVIKDGVELVYRYGVQAFPFTKERLDELRKKEKEKRD  210

Query  665  EQSLKTVLVSTSRD  706
             Q+L ++L   +RD
Sbjct  211  NQTLSSLLTHDARD  224


 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 100/180 (56%), Gaps = 16/180 (9%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGH----QVKVDDLKGKKI  286
            F F+K + +E +     ++  D   L S+L    RD L   SGH    QV V  LKGK +
Sbjct  191  FPFTKERLDELRKKE--KEKRDNQTLSSLLTHDARDVL---SGHPSPKQVSVASLKGKTV  245

Query  287  GIYFSASWCGPCHRFTPNLATVYNELLPK------GNFEVVFVSADEDEESFKEYFGKMP  448
            G+YFSA WC P  +FTP L +VY ++  +       +FE+VFVS+D ++  F  YF  MP
Sbjct  246  GLYFSAQWCNPAKKFTPRLISVYKKIKQQLEGKDDEDFEIVFVSSDHNQVDFTTYFETMP  305

Query  449  WTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERV  628
            W A+PF D  T + L   F +RGIP LVIL   GK  T+ G  ++  +   AYPFT  R+
Sbjct  306  WLAIPFDDP-TIKALAKYFDIRGIPSLVILGPDGKTVTKQGRSLINLYKENAYPFTKTRI  364



>gb|KHN09060.1| Putative nucleoredoxin 2 [Glycine soja]
Length=411

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/192 (37%), Positives = 119/192 (62%), Gaps = 4/192 (2%)
 Frame = +2

Query  155  ASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            A  +   NG+      +L S DRD+L+  +G QVKV DL+G+ +G+ F+A+W  PC  FT
Sbjct  5    AQVVVNDNGNYGKFSHLLASQDRDYLLSPTGAQVKVSDLEGRVVGLLFAANWYPPCRGFT  64

Query  335  PNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
              L  +Y EL  +    E+V+VS+DE+ ++F  ++G MPW A+PFSD  T++ L   + V
Sbjct  65   QILVGIYEELKSRVPQLEIVYVSSDENLDAFNSFYGNMPWLAIPFSDLETKKSLTRKYDV  124

Query  512  RGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKT  682
              +P L++L   D    VT  DGV+++  +G++AYPF+ ER+++++  ++     Q+L  
Sbjct  125  EAVPCLILLQPDDRKEHVTVRDGVELIYRYGIQAYPFSNERLEQLQKEDKVKRDNQTLTN  184

Query  683  VLVSTSRDYVIA  718
            +L +  RDYV++
Sbjct  185  LLANHHRDYVLS  196


 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 101/179 (56%), Gaps = 12/179 (7%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSG---HQVKVDDLKGKKIG  289
            + FS  + E+ +     ++  D   L ++L +  RD+++ ++     +V V  L GK IG
Sbjct  159  YPFSNERLEQLQKEDKVKR--DNQTLTNLLANHHRDYVLSHTHTGLKKVPVAWLVGKTIG  216

Query  290  IYFSASWCGPCHRFTPNLATVY----NELLPKG--NFEVVFVSADEDEESFKEYFGKMPW  451
            +YFSA WC PC +FTP L +VY    +EL  KG  +FEVV +S+D D+ SF  Y+  MPW
Sbjct  217  LYFSAEWCVPCAKFTPKLISVYEKIKHELAGKGEEDFEVVLISSDRDQASFDSYYSTMPW  276

Query  452  TAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERV  628
             A+PF D   +  L   + V+GIP LVI+   GK  T  G  ++  +   AYPFT  +V
Sbjct  277  LALPFGDPEIKN-LVRHYNVQGIPWLVIIGPDGKTITVHGRSLINLYQENAYPFTNAKV  334



>ref|XP_003527520.1| PREDICTED: probable nucleoredoxin 2-like isoform 1 [Glycine max]
Length=411

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/192 (37%), Positives = 119/192 (62%), Gaps = 4/192 (2%)
 Frame = +2

Query  155  ASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            A  +   NG+      +L S DRD+L+  +G QVKV DL+G+ +G+ F+A+W  PC  FT
Sbjct  5    AQVVLNDNGNYGKFSHLLASQDRDYLLSPTGAQVKVSDLEGRVVGLLFAANWYPPCRGFT  64

Query  335  PNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
              L  +Y EL  +    E+V+VS+DE+ ++F  ++G MPW A+PFSD  T++ L   + V
Sbjct  65   QILVGIYEELKSRVPQLEIVYVSSDENLDAFNSFYGNMPWLAIPFSDLETKKSLTRKYDV  124

Query  512  RGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKT  682
              +P L++L   D    VT  DGV+++  +G++AYPF+ ER+++++  ++     Q+L  
Sbjct  125  EAVPCLILLQPDDRKEHVTVRDGVELIYRYGIQAYPFSNERLEQLQKEDKVKRDNQTLTN  184

Query  683  VLVSTSRDYVIA  718
            +L +  RDYV++
Sbjct  185  LLANHHRDYVLS  196


 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 101/179 (56%), Gaps = 12/179 (7%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSG---HQVKVDDLKGKKIG  289
            + FS  + E+ +     ++  D   L ++L +  RD+++ ++     +V V  L GK IG
Sbjct  159  YPFSNERLEQLQKEDKVKR--DNQTLTNLLANHHRDYVLSHTHTGLKKVPVAWLVGKTIG  216

Query  290  IYFSASWCGPCHRFTPNLATVY----NELLPKG--NFEVVFVSADEDEESFKEYFGKMPW  451
            +YFSA WC PC +FTP L +VY    +EL  KG  +FEVV +S+D D+ SF  Y+  MPW
Sbjct  217  LYFSAEWCVPCAKFTPKLISVYEKIKHELAGKGEEDFEVVLISSDRDQASFDSYYSTMPW  276

Query  452  TAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERV  628
             A+PF D   +  L   + V+GIP LVI+   GK  T  G  ++  +   AYPFT  +V
Sbjct  277  LALPFGDPEIKN-LVRHYNVQGIPWLVIIGPDGKTITVHGRSLINLYQENAYPFTNAKV  334



>ref|XP_006342078.1| PREDICTED: probable nucleoredoxin 2-like [Solanum tuberosum]
Length=440

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 112/184 (61%), Gaps = 8/184 (4%)
 Frame = +2

Query  191  DLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP  370
            D  SIL S D DFL+  +G QVKV +L+GK +G+YFSA+W  PC +FT  L  VY +L  
Sbjct  45   DYLSILASKDGDFLLSPTGAQVKVSELEGKVVGLYFSANWYSPCTKFTNLLVNVYQQLKE  104

Query  371  KGN----FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
              N    FE+VFVS+DE+  +F  Y   MPW A+PFSD   R  L   F V GIP ++IL
Sbjct  105  CNNINLGFEIVFVSSDENLNAFNTYRSSMPWFAIPFSDLEKRRALTQKFDVEGIPCMIIL  164

Query  539  ----DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRD  706
                D+      +DGV++V  +GV+A+PFT ER+ E+++ E+     Q+L  +L   +RD
Sbjct  165  QPNDDKLDTAVIKDGVELVYRYGVQAFPFTKERLDELREKEKEKRDNQTLSNLLTHDARD  224

Query  707  YVIA  718
             ++ 
Sbjct  225  VLLG  228


 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 99/177 (56%), Gaps = 10/177 (6%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRN-SGHQVKVDDLKGKKIGIY  295
            F F+K + +E +     ++  D   L ++L    RD L+ N S  QV V  LKGK +G+Y
Sbjct  191  FPFTKERLDELREKE--KEKRDNQTLSNLLTHDARDVLLGNPSPKQVSVASLKGKTVGLY  248

Query  296  FSASWCGPCHRFTPNLATVYNELLPK------GNFEVVFVSADEDEESFKEYFGKMPWTA  457
            FSA WC P  +FTP L +VY ++  +       +FE+VFVS+D ++  F  YF  MPW A
Sbjct  249  FSAQWCIPAKKFTPRLISVYKKIKQQLEGKEDEDFEIVFVSSDHNQVDFTTYFETMPWLA  308

Query  458  VPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERV  628
            +PF D  T   L   F +RGIP LVIL   GK  T+ G  ++  +   AYPFT  RV
Sbjct  309  IPFDDP-TINALAKYFDIRGIPSLVILGPDGKTVTKQGRSLINLYKENAYPFTKTRV  364



>ref|XP_007222806.1| hypothetical protein PRUPE_ppa005061mg [Prunus persica]
 gb|EMJ24005.1| hypothetical protein PRUPE_ppa005061mg [Prunus persica]
Length=479

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 111/179 (62%), Gaps = 4/179 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+ +K EE      A++   A  L SIL S DR+F+I   G ++ V DL GK I +YF
Sbjct  215  YPFTPKKFEELIEIEKAKEK--AQTLESILISGDRNFVIGKGGTEIPVSDLVGKNILLYF  272

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+++  K + FEV+F+S+D D+ +F E+F  MPW A+PF DS
Sbjct  273  SAHWCPPCRAFLPKLVEAYHKIKAKDDAFEVIFISSDRDQGAFDEFFSGMPWLALPFGDS  332

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
              +  L   F V+GIP L+ +  +G+  T++  D+V++HG  AYPFT ER+KEI+   E
Sbjct  333  -RKASLSRRFKVQGIPMLIAIGPTGQTVTKEARDLVMQHGANAYPFTEERLKEIEAESE  390


 Score =   139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 111/178 (62%), Gaps = 2/178 (1%)
 Frame = +2

Query  188  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  367
              L++IL S  RDF+I N G  V V +L+GK +G+YFS S   PC  F+P L  VY +L 
Sbjct  76   QSLKTILVSRLRDFVISNDGKNVPVSELEGKIVGLYFSLSAYSPCVDFSPKLLEVYEKLK  135

Query  368  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  544
              G +FEVV +  D+DEESFK+ F  MPW ++P  D     +L   F +  +P LVI+  
Sbjct  136  ANGESFEVVVIPLDDDEESFKQDFKNMPWFSLPIGDKNVG-KLARYFELSTLPTLVIIGA  194

Query  545  SGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             GK  +++  + + EHGV AYPFT ++ +E+ + E+A  + Q+L+++L+S  R++VI 
Sbjct  195  DGKTVSKNVAEAIEEHGVLAYPFTPKKFEELIEIEKAKEKAQTLESILISGDRNFVIG  252


 Score =   123 bits (308),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +2

Query  443  MPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLE  622
            MPW A+PFSDS  R+ +D LF VRGIPHLVIL E GKV ++ GV+I+ EHGV+ YPFT E
Sbjct  1    MPWLAIPFSDSEARDGVDELFKVRGIPHLVILGEDGKVLSDSGVEIIEEHGVDGYPFTPE  60

Query  623  RVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            ++KE+ D EE+  R+QSLKT+LVS  RD+VI+
Sbjct  61   KIKELNDQEESARRDQSLKTILVSRLRDFVIS  92



>ref|XP_003527521.1| PREDICTED: probable nucleoredoxin 2-like isoform 2 [Glycine max]
Length=434

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/192 (37%), Positives = 119/192 (62%), Gaps = 4/192 (2%)
 Frame = +2

Query  155  ASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            A  +   NG+      +L S DRD+L+  +G QVKV DL+G+ +G+ F+A+W  PC  FT
Sbjct  5    AQVVLNDNGNYGKFSHLLASQDRDYLLSPTGAQVKVSDLEGRVVGLLFAANWYPPCRGFT  64

Query  335  PNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
              L  +Y EL  +    E+V+VS+DE+ ++F  ++G MPW A+PFSD  T++ L   + V
Sbjct  65   QILVGIYEELKSRVPQLEIVYVSSDENLDAFNSFYGNMPWLAIPFSDLETKKSLTRKYDV  124

Query  512  RGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKT  682
              +P L++L   D    VT  DGV+++  +G++AYPF+ ER+++++  ++     Q+L  
Sbjct  125  EAVPCLILLQPDDRKEHVTVRDGVELIYRYGIQAYPFSNERLEQLQKEDKVKRDNQTLTN  184

Query  683  VLVSTSRDYVIA  718
            +L +  RDYV++
Sbjct  185  LLANHHRDYVLS  196


 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 79/132 (60%), Gaps = 7/132 (5%)
 Frame = +2

Query  251  QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY----NELLPKG--NFEVVFVSADED  412
            QV V  L GK IG+YFSA WC PC +FTP L +VY    +EL  KG  +FEVV +S+D D
Sbjct  227  QVPVAWLVGKTIGLYFSAEWCVPCAKFTPKLISVYEKIKHELAGKGEEDFEVVLISSDRD  286

Query  413  EESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEH  592
            + SF  Y+  MPW A+PF D   +  L   + V+GIP LVI+   GK  T  G  ++  +
Sbjct  287  QASFDSYYSTMPWLALPFGDPEIKN-LVRHYNVQGIPWLVIIGPDGKTITVHGRSLINLY  345

Query  593  GVEAYPFTLERV  628
               AYPFT  +V
Sbjct  346  QENAYPFTNAKV  357



>gb|KJB14360.1| hypothetical protein B456_002G121200 [Gossypium raimondii]
Length=380

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 120/191 (63%), Gaps = 9/191 (5%)
 Frame = +2

Query  167  AEQNGDAHDLR-----SILCSSDRDFLIRNSGH--QVKVDDLKGKKIGIYFSASWCGPCH  325
            A  NGD   +      S+L S DRD+L+ ++    QVK+ DL+GK IG+YFSA+W  PC 
Sbjct  13   ALTNGDPEKISTSRFSSLLASKDRDYLLSSTTQDDQVKISDLEGKAIGLYFSANWYPPCR  72

Query  326  RFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDAL  502
             F   L  VY +L   G NFE+VFVS+DED  +F  Y   MPW ++PFSD  T++ L+  
Sbjct  73   NFNKVLIGVYEQLKSNGSNFEIVFVSSDEDLSAFNSYRESMPWLSIPFSDLETKKALNRK  132

Query  503  FTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKT  682
            F V GIP+L+IL   G  T  DGV+++  +G+EA+PFT E+++E++  E      Q+L  
Sbjct  133  FEVEGIPYLIILQPDGS-TLHDGVELIYRYGIEAFPFTEEKLEELRREERMKHESQTLTN  191

Query  683  VLVSTSRDYVI  715
            +L++  RDY++
Sbjct  192  LLINPGRDYLL  202


 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 87/138 (63%), Gaps = 9/138 (7%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLI-RNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  358
            ++  L ++L +  RD+L+ +    +V VD L GK +G+YFSA WC PC +FTP L ++Y+
Sbjct  185  ESQTLTNLLINPGRDYLLDQTMTRKVPVDSLIGKTVGLYFSAQWCFPCAKFTPKLISIYH  244

Query  359  E----LLPKG---NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  517
            +    L  KG   +FE+VFVS D D+ SF  Y+G MPW A+PF + + R  L   F V+G
Sbjct  245  KIKQSLEGKGGGEDFEIVFVSNDRDQSSFDSYYGTMPWLALPFGEPIIRT-LAKYFDVQG  303

Query  518  IPHLVILDESGKVTTEDG  571
            IP L+I+D  GK  T+ G
Sbjct  304  IPCLIIIDPDGKTVTKQG  321



>gb|KHG29175.1| hypothetical protein F383_13074 [Gossypium arboreum]
Length=422

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 120/191 (63%), Gaps = 9/191 (5%)
 Frame = +2

Query  167  AEQNGDAHDLR-----SILCSSDRDFLIRNSGH--QVKVDDLKGKKIGIYFSASWCGPCH  325
            A  NGDA  +      S+L S DRD+L+ ++    QVK+ DL+GK IG+YFSA+W  PC 
Sbjct  13   ALTNGDAEKISTSRFSSLLASKDRDYLLSSTTQDDQVKISDLEGKVIGLYFSANWYPPCR  72

Query  326  RFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDAL  502
             F   L  VY +L   G NFE+VFVS+DED  +F  Y   MPW ++PFSD  T++ L+  
Sbjct  73   NFNKVLIGVYEQLKSNGSNFEIVFVSSDEDLSAFNSYRESMPWLSIPFSDLETKKALNRK  132

Query  503  FTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKT  682
            F V GIP+L+IL   G  T  DGV+++  +G+EA+PFT E+++E++  E      Q+L  
Sbjct  133  FEVEGIPYLIILQPDGS-TLHDGVELIYRYGIEAFPFTEEKLEELRREERMKHESQTLTN  191

Query  683  VLVSTSRDYVI  715
            +L +  RDY++
Sbjct  192  LLTNPGRDYLL  202


 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 94/154 (61%), Gaps = 10/154 (6%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLI-RNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  358
            ++  L ++L +  RD+L+ +    +V VD L GK IG+YFSA WC PC +FTP L ++Y 
Sbjct  185  ESQTLTNLLTNPGRDYLLDQTMTRKVPVDSLIGKTIGLYFSAQWCFPCAKFTPKLISIYQ  244

Query  359  E----LLPKG----NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  514
            +    L  KG    +FE+VFVS D D+ SF  Y+G MPW A+PF D + R  L   F V+
Sbjct  245  KIKQSLEGKGGGVEDFEIVFVSNDRDQSSFDSYYGTMPWLALPFGDPIIRT-LAKYFDVQ  303

Query  515  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFT  616
            GIP L+I+   GK  T+ G +++  +   AYPFT
Sbjct  304  GIPCLIIIGPDGKTVTKQGRNLINLYQENAYPFT  337



>gb|KJB14359.1| hypothetical protein B456_002G121200 [Gossypium raimondii]
Length=421

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 120/191 (63%), Gaps = 9/191 (5%)
 Frame = +2

Query  167  AEQNGDAHDLR-----SILCSSDRDFLIRNSGH--QVKVDDLKGKKIGIYFSASWCGPCH  325
            A  NGD   +      S+L S DRD+L+ ++    QVK+ DL+GK IG+YFSA+W  PC 
Sbjct  13   ALTNGDPEKISTSRFSSLLASKDRDYLLSSTTQDDQVKISDLEGKAIGLYFSANWYPPCR  72

Query  326  RFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDAL  502
             F   L  VY +L   G NFE+VFVS+DED  +F  Y   MPW ++PFSD  T++ L+  
Sbjct  73   NFNKVLIGVYEQLKSNGSNFEIVFVSSDEDLSAFNSYRESMPWLSIPFSDLETKKALNRK  132

Query  503  FTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKT  682
            F V GIP+L+IL   G  T  DGV+++  +G+EA+PFT E+++E++  E      Q+L  
Sbjct  133  FEVEGIPYLIILQPDGS-TLHDGVELIYRYGIEAFPFTEEKLEELRREERMKHESQTLTN  191

Query  683  VLVSTSRDYVI  715
            +L++  RDY++
Sbjct  192  LLINPGRDYLL  202


 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 96/153 (63%), Gaps = 9/153 (6%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLI-RNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  358
            ++  L ++L +  RD+L+ +    +V VD L GK +G+YFSA WC PC +FTP L ++Y+
Sbjct  185  ESQTLTNLLINPGRDYLLDQTMTRKVPVDSLIGKTVGLYFSAQWCFPCAKFTPKLISIYH  244

Query  359  E----LLPKG---NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  517
            +    L  KG   +FE+VFVS D D+ SF  Y+G MPW A+PF + + R  L   F V+G
Sbjct  245  KIKQSLEGKGGGEDFEIVFVSNDRDQSSFDSYYGTMPWLALPFGEPIIRT-LAKYFDVQG  303

Query  518  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPFT  616
            IP L+I+D  GK  T+ G +++  +   AYPFT
Sbjct  304  IPCLIIIDPDGKTVTKQGRNLINLYQENAYPFT  336



>gb|KJB14358.1| hypothetical protein B456_002G121200 [Gossypium raimondii]
Length=422

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 120/192 (63%), Gaps = 10/192 (5%)
 Frame = +2

Query  167  AEQNGDAHDLR-----SILCSSDRDFLIRNSGH---QVKVDDLKGKKIGIYFSASWCGPC  322
            A  NGD   +      S+L S DRD+L+ ++     QVK+ DL+GK IG+YFSA+W  PC
Sbjct  13   ALTNGDPEKISTSRFSSLLASKDRDYLLSSTTQDDQQVKISDLEGKAIGLYFSANWYPPC  72

Query  323  HRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDA  499
              F   L  VY +L   G NFE+VFVS+DED  +F  Y   MPW ++PFSD  T++ L+ 
Sbjct  73   RNFNKVLIGVYEQLKSNGSNFEIVFVSSDEDLSAFNSYRESMPWLSIPFSDLETKKALNR  132

Query  500  LFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLK  679
             F V GIP+L+IL   G  T  DGV+++  +G+EA+PFT E+++E++  E      Q+L 
Sbjct  133  KFEVEGIPYLIILQPDGS-TLHDGVELIYRYGIEAFPFTEEKLEELRREERMKHESQTLT  191

Query  680  TVLVSTSRDYVI  715
             +L++  RDY++
Sbjct  192  NLLINPGRDYLL  203


 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 96/153 (63%), Gaps = 9/153 (6%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLI-RNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  358
            ++  L ++L +  RD+L+ +    +V VD L GK +G+YFSA WC PC +FTP L ++Y+
Sbjct  186  ESQTLTNLLINPGRDYLLDQTMTRKVPVDSLIGKTVGLYFSAQWCFPCAKFTPKLISIYH  245

Query  359  E----LLPKG---NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  517
            +    L  KG   +FE+VFVS D D+ SF  Y+G MPW A+PF + + R  L   F V+G
Sbjct  246  KIKQSLEGKGGGEDFEIVFVSNDRDQSSFDSYYGTMPWLALPFGEPIIRT-LAKYFDVQG  304

Query  518  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPFT  616
            IP L+I+D  GK  T+ G +++  +   AYPFT
Sbjct  305  IPCLIIIDPDGKTVTKQGRNLINLYQENAYPFT  337



>ref|XP_004500916.1| PREDICTED: probable nucleoredoxin 2-like isoform X1 [Cicer arietinum]
 ref|XP_004500917.1| PREDICTED: probable nucleoredoxin 2-like isoform X2 [Cicer arietinum]
Length=425

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 113/177 (64%), Gaps = 4/177 (2%)
 Frame = +2

Query  200  SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-  376
             +L SS RDFL+  +G QVKV +L+GK +G+ F+A+W  PC  FT  L  +Y EL     
Sbjct  32   QLLASSHRDFLLSPTGAQVKVSELEGKVVGLLFAANWYPPCRVFTQLLIGIYEELKTNNP  91

Query  377  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG--  550
            +FE+V+VS+DED ++F E++  MPW A+PF D  T++ L+  + V GIP L++L  S   
Sbjct  92   HFEIVYVSSDEDLDAFNEFYKNMPWLAIPFYDLETKKSLNRKYEVEGIPCLIMLQPSKVD  151

Query  551  -KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
               T   GV+++  +GV+AYPF+ ER+ E+ +AE      Q+L  +L +  RDYV++
Sbjct  152  DATTLRHGVELIYRYGVQAYPFSNERLMELHEAEREKRENQTLINLLANNFRDYVLS  208


 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 91/156 (58%), Gaps = 12/156 (8%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGH----QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY--  355
            L ++L ++ RD+++  +      QV +  L GK IG+YFSA WC PC +FTP L +VY  
Sbjct  194  LINLLANNFRDYVLSQTHTGLFTQVPIASLVGKTIGLYFSAGWCVPCTKFTPKLISVYEK  253

Query  356  --NELLPKG---NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
               EL  KG   +FE+V VS D D+ESF  Y+  MPW A+PF D   +  L   F ++GI
Sbjct  254  IKQELTEKGDNEDFEIVLVSNDRDQESFDSYYNTMPWLALPFGDPEIK-NLARHFDIQGI  312

Query  521  PHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERV  628
            P LVI+   GK  T  G +++  +   AYPFT  +V
Sbjct  313  PCLVIIGPDGKTITIHGRNLINLYQENAYPFTKAKV  348



>ref|XP_002510593.1| nucleoredoxin, putative [Ricinus communis]
 gb|EEF52780.1| nucleoredoxin, putative [Ricinus communis]
Length=389

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 111/175 (63%), Gaps = 4/175 (2%)
 Frame = +2

Query  206  LCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NF  382
            +C   R  L  +  ++VKV +L+GK IG+YFSA+W  PC  F   LA VY +L   G NF
Sbjct  1    MCHYLRLPLALHLRYKVKVSELEGKVIGLYFSANWYPPCRNFNQVLAGVYEQLKENGSNF  60

Query  383  EVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL---DESGK  553
            EVVFVS+DE+ ++F  Y   MPW ++PFSD  T++ LD  F + G+P LVIL   D+  +
Sbjct  61   EVVFVSSDENLDAFNNYRALMPWLSIPFSDLETKKALDRKFNIEGVPCLVILQPKDDKEE  120

Query  554  VTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             T  DGVD++   GV+A+PFT ER++E+K  E+     Q+L  +L +  RDY+ A
Sbjct  121  ATLHDGVDLLYRFGVQAFPFTKERLEELKMQEKEKHESQTLTNLLTNHDRDYLFA  175


 Score =   127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 108/185 (58%), Gaps = 10/185 (5%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSG-HQVKVDDLKGKKIGIY  295
            F F+K + EE K     ++  ++  L ++L + DRD+L  +    QV V  L GK IG++
Sbjct  138  FPFTKERLEELKMQE--KEKHESQTLTNLLTNHDRDYLFAHPAPKQVPVASLIGKTIGLF  195

Query  296  FSASWCGPCHRFTPNLATVYNELLP------KGNFEVVFVSADEDEESFKEYFGKMPWTA  457
            FSA WC P  +FTP L ++Y+++          +FE+VFVS D D+E F  YF  MPW A
Sbjct  196  FSAQWCRPGMKFTPKLISIYHKIKQMLRERESEDFEIVFVSTDRDQEGFDSYFNTMPWLA  255

Query  458  VPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEI  637
            +PF D  T + L   F V+GIP L+I+  +GK  T++G +++  +   AYPFT  +V+ +
Sbjct  256  LPFGDP-TIKTLTKYFDVQGIPCLIIIGPNGKTITKNGRNLINLYQENAYPFTEAKVELL  314

Query  638  KDAEE  652
            +   E
Sbjct  315  EKQME  319



>gb|KJB14361.1| hypothetical protein B456_002G121200 [Gossypium raimondii]
Length=455

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 120/191 (63%), Gaps = 9/191 (5%)
 Frame = +2

Query  167  AEQNGDAHDLR-----SILCSSDRDFLIRNSGH--QVKVDDLKGKKIGIYFSASWCGPCH  325
            A  NGD   +      S+L S DRD+L+ ++    QVK+ DL+GK IG+YFSA+W  PC 
Sbjct  13   ALTNGDPEKISTSRFSSLLASKDRDYLLSSTTQDDQVKISDLEGKAIGLYFSANWYPPCR  72

Query  326  RFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDAL  502
             F   L  VY +L   G NFE+VFVS+DED  +F  Y   MPW ++PFSD  T++ L+  
Sbjct  73   NFNKVLIGVYEQLKSNGSNFEIVFVSSDEDLSAFNSYRESMPWLSIPFSDLETKKALNRK  132

Query  503  FTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKT  682
            F V GIP+L+IL   G  T  DGV+++  +G+EA+PFT E+++E++  E      Q+L  
Sbjct  133  FEVEGIPYLIILQPDGS-TLHDGVELIYRYGIEAFPFTEEKLEELRREERMKHESQTLTN  191

Query  683  VLVSTSRDYVI  715
            +L++  RDY++
Sbjct  192  LLINPGRDYLL  202


 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 83/129 (64%), Gaps = 8/129 (6%)
 Frame = +2

Query  251  QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE----LLPKG---NFEVVFVSADE  409
            +V VD L GK +G+YFSA WC PC +FTP L ++Y++    L  KG   +FE+VFVS D 
Sbjct  243  EVPVDSLIGKTVGLYFSAQWCFPCAKFTPKLISIYHKIKQSLEGKGGGEDFEIVFVSNDR  302

Query  410  DEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLE  589
            D+ SF  Y+G MPW A+PF + + R  L   F V+GIP L+I+D  GK  T+ G +++  
Sbjct  303  DQSSFDSYYGTMPWLALPFGEPIIRT-LAKYFDVQGIPCLIIIDPDGKTVTKQGRNLINL  361

Query  590  HGVEAYPFT  616
            +   AYPFT
Sbjct  362  YQENAYPFT  370



>ref|XP_008221829.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Prunus mume]
Length=479

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 100/153 (65%), Gaps = 2/153 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A  L SIL S DR+F+I   G ++ V DL GK I +YFSA WC PC  F P L   Y+++
Sbjct  235  AQTLESILVSGDRNFVIGKGGTEIPVSDLVGKNILLYFSAHWCPPCRAFLPKLVEAYHKI  294

Query  365  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K + FEV+F+S+D+D+  F E+F  MPW A+PF D + +  L   F VRGIP LV + 
Sbjct  295  KAKDDAFEVIFISSDKDQGDFDEFFSGMPWFALPFGD-LRKASLSRRFKVRGIPMLVAIG  353

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIK  640
             +G+  T++  D+V++HG  AYPFT ER+KEI+
Sbjct  354  PTGQTVTKEARDLVMQHGANAYPFTEERLKEIE  386


 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 120/201 (60%), Gaps = 4/201 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K +E K    A +   +  L++IL S  RDF+I N G  V V +L+GK +G+YF
Sbjct  55   YPFTPEKVKELKDQEEAARRNQS--LKTILVSRSRDFVISNDGKNVPVSELEGKIVGLYF  112

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            S S    C  FTP L  VY +L   G +F+VV +  D+DEESFK+ F  MPW ++P  D 
Sbjct  113  SLSVYNRCVDFTPKLLEVYEKLKANGESFQVVVIPLDDDEESFKQDFKSMPWFSLPIGDK  172

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEA  655
               E+L   F +  +P LVI+   GK  +++  + + EHGV AYPFT E+  E+ + E+A
Sbjct  173  -NVEKLARYFELSTLPTLVIIGADGKTISKNVAEAIEEHGVLAYPFTPEKFAELIEIEKA  231

Query  656  T*REQSLKTVLVSTSRDYVIA  718
              + Q+L+++LVS  R++VI 
Sbjct  232  KEKAQTLESILVSGDRNFVIG  252


 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +2

Query  443  MPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLE  622
            MPW A+PF D   R+R+D LF V GIP LVIL E GKV ++ GV+I+ E+GV+ YPFT E
Sbjct  1    MPWLAIPFFDKKARDRVDKLFKVIGIPCLVILGEDGKVLSDSGVEIIKEYGVDGYPFTPE  60

Query  623  RVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            +VKE+KD EEA  R QSLKT+LVS SRD+VI+
Sbjct  61   KVKELKDQEEAARRNQSLKTILVSRSRDFVIS  92



>ref|XP_009417222.1| PREDICTED: probable nucleoredoxin 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=397

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 123/192 (64%), Gaps = 5/192 (3%)
 Frame = +2

Query  143  EERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPC  322
            E    + +A   GD   L ++L +   +FLI  SG++V   D++GK IG+YF+A+W   C
Sbjct  2    EAPTVTGVASATGDG-GLSALLST---EFLICPSGNKVNPKDIEGKTIGLYFAANWFQKC  57

Query  323  HRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDA  499
              FTP L +VY++L+ +   FE+VFVS+DE++ SF++++  MPW AVPFSD  ++  L  
Sbjct  58   VSFTPVLVSVYHKLMEQELPFEIVFVSSDENQSSFEQFYSSMPWPAVPFSDINSKRSLSH  117

Query  500  LFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLK  679
             F + GIP L+IL   G +   +GV+I+  +G++A+PFT ER+ E++  E+     Q+L+
Sbjct  118  KFQIEGIPALIILKPGGGLIQTEGVEILYRYGLQAFPFTSERIAELEAEEKRKYASQTLE  177

Query  680  TVLVSTSRDYVI  715
             +L  + +D++I
Sbjct  178  KLLAISGKDHMI  189


 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 96/168 (57%), Gaps = 5/168 (3%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +  L  +L  S +D +I+ +  QV    L GK +G+YF+A WC PC +FT  L ++YN L
Sbjct  173  SQTLEKLLAISGKDHMIKRN-DQVTFSSLVGKTVGLYFAAQWCPPCLKFTSRLMSIYNHL  231

Query  365  LPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              +G  FEVVFVS D DE  F +YF  MPW A+P+ +  ++  L   F ++ IP LVI+ 
Sbjct  232  QERGEEFEVVFVSMDRDEAGFLQYFSGMPWLALPYGEESSKA-LARYFDIQEIPMLVIIG  290

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDA--EEAT*REQSLK  679
              GK  T+ G +++  H   AYPFT   ++ +++   EEA     S K
Sbjct  291  PDGKTVTKGGRNLINLHMEMAYPFTEAHIRLLQEKMDEEAQRYPTSFK  338



>ref|XP_004291331.1| PREDICTED: probable nucleoredoxin 2 [Fragaria vesca subsp. vesca]
Length=435

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 116/185 (63%), Gaps = 10/185 (5%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL---  364
            + S+L S DRD+L+  +G+QVKV DL GK IG+YFSA+W  PC  F   L  +YN+L   
Sbjct  35   ISSLLASPDRDYLLSPTGNQVKVSDLDGKIIGLYFSANWYPPCWNFNKVLVGIYNQLKNS  94

Query  365  -LPKGNFEVVFVSADEDEESFKEYFGK-MPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
                 +FE+V++S+DED ++F  Y    MPW A+PFSD  T++ L+  F V GIP LVIL
Sbjct  95   STTGSSFEIVYISSDEDTDAFVRYHAACMPWLAIPFSDLETKKALNRKFEVEGIPSLVIL  154

Query  539  D-----ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
                  +  + T  DGV+I+  +GV+A+PFT +R+++++  E+     QSL  +L +  R
Sbjct  155  QPGDYKDGDEATLRDGVEIIYRYGVQAFPFTKQRLEQLEKEEKEKHENQSLTNLLTNHDR  214

Query  704  DYVIA  718
             Y++ 
Sbjct  215  HYLLG  219


 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 108/192 (56%), Gaps = 16/192 (8%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLI-RNSGHQVKVDDLKGKKIGIY  295
            F F+K++ E+ +     +    +  L ++L + DR +L+   + +QV V  L GK +G+Y
Sbjct  182  FPFTKQRLEQLEKEEKEKHENQS--LTNLLTNHDRHYLLGHGTPNQVPVASLIGKTVGLY  239

Query  296  FSASWCGPCHRFTPNLATVYNELLPKG----------NFEVVFVSADEDEESFKEYFGKM  445
            FSA WC PC  FTP L ++YN++  +           +FE+VFVS+D D  SF+ YF  M
Sbjct  240  FSAQWCIPCVNFTPRLVSIYNKIKEQMLVGDQQQDGEDFEIVFVSSDRDRTSFEAYFSTM  299

Query  446  PWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLER  625
            PW A+PF D   +E L   F V+ IP LVIL   GK  T  G +++  +   AYPFT  +
Sbjct  300  PWLALPFDDPNIKE-LVKHFDVKAIPCLVILGPDGKTVTRQGRNLINLYKENAYPFTDAK  358

Query  626  VK--EIKDAEEA  655
            ++  E K  EEA
Sbjct  359  LELLEKKMDEEA  370



>ref|XP_009798867.1| PREDICTED: probable nucleoredoxin 2 [Nicotiana sylvestris]
Length=442

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 115/183 (63%), Gaps = 5/183 (3%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            A D RSIL S D DFL+ ++G QVKV DL+ K +G+YFSA+W  PC +FT  L  VY +L
Sbjct  48   AQDYRSILASKDGDFLLSSTGAQVKVSDLESKIVGLYFSANWYPPCTKFTDLLINVYQQL  107

Query  365  LPKGN--FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
                +  FEVVFVS+DED ++F  Y   MPW A+PFSD   R  L   F V GIP L+IL
Sbjct  108  KDHSDPGFEVVFVSSDEDLDAFNTYKSSMPWLAIPFSDLDARRALTQKFDVEGIPTLIIL  167

Query  539  DESGK---VTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDY  709
              +         DGV++V  +GV+A+PFT ER++E+K+ E+     Q+L  +L    RDY
Sbjct  168  QPNSNKDAAVISDGVELVYRYGVQAFPFTKERLEELKEKEKEKHDNQTLSNLLTYDGRDY  227

Query  710  VIA  718
            ++A
Sbjct  228  LLA  230


 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 90/156 (58%), Gaps = 8/156 (5%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSG-HQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  358
            D   L ++L    RD+L+ + G  QV V  L GK IG+YFSA WC P  +FTP L +VY 
Sbjct  212  DNQTLSNLLTYDGRDYLLAHPGPKQVPVTSLMGKTIGLYFSAQWCIPAFKFTPRLMSVYQ  271

Query  359  ELLPK------GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
            ++  +       +FE+VFVS+D D+  F  YF  MPW AVP+ D  T + L   F +RGI
Sbjct  272  KIKQQLEGKEDEDFEIVFVSSDRDQVQFVTYFETMPWLAVPYDDP-TIKNLAKYFDIRGI  330

Query  521  PHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERV  628
            P LV+L   GK  T+ G  ++  +   AYPFT  RV
Sbjct  331  PSLVVLGPDGKTVTKQGRSLINLYKGNAYPFTKTRV  366



>ref|XP_006378295.1| hypothetical protein POPTR_0010s07010g [Populus trichocarpa]
 gb|ERP56092.1| hypothetical protein POPTR_0010s07010g [Populus trichocarpa]
Length=470

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 116/188 (62%), Gaps = 7/188 (4%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            + EQ  +A     + SIL SS RD++I N G ++ + DL+GK +G+YFS      C  FT
Sbjct  65   LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPLLDLEGKLVGLYFSIH--TMCGEFT  122

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  +Y  L  KG NFEVV +S D DEE FKE F  MPW A+PF D   + +L   F +
Sbjct  123  PKLVELYKTLKEKGENFEVVLISLDYDEEDFKESFETMPWLALPFKDKSCK-KLAQYFEL  181

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
            R IP+LVI+ + GK    +  +++ +HG+EAYPFT E++ E+   E+A    Q+L++VLV
Sbjct  182  RTIPNLVIIGQDGKTLNPNVAELIEDHGIEAYPFTPEKLDELAAIEKAKLESQTLESVLV  241

Query  692  STSRDYVI  715
            +   D+VI
Sbjct  242  NGENDFVI  249


 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 98/167 (59%), Gaps = 4/167 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F+  K +E  A   A+   ++  L S+L + + DF+I  SG +V V +L GK I +YF
Sbjct  213  YPFTPEKLDELAAIEKAKL--ESQTLESVLVNGENDFVIDKSGSKVPVSELVGKNILLYF  270

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y+ +  K N  EV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  271  SAQWCPPCRAFLPKLIEAYHTIKAKDNAVEVIFISSDSDQTTFDEFYSEMPWLALPFGDE  330

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFT  616
              ++ L   F ++GIP  V +  SG+  T++    +  +G +A+PFT
Sbjct  331  -RKQILSRKFKIQGIPAAVAIGPSGRTITKEARMHLTAYGADAFPFT  376


 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +2

Query  443  MPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLE  622
            MPW A+PFSD+ TR RL  +F VRGIPHLVI D +GKV+ +DGV  V+EHGV+ YPF L+
Sbjct  1    MPWLAIPFSDTETRLRLKEVFEVRGIPHLVIFDTNGKVSCDDGVSTVMEHGVDGYPFNLD  60

Query  623  RVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            R+  +K+ EE   + Q++ ++LVS+SRDYVI+
Sbjct  61   RLNFLKEQEENAKKNQTISSILVSSSRDYVIS  92



>ref|XP_008806406.1| PREDICTED: probable nucleoredoxin 2 [Phoenix dactylifera]
Length=413

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 118/188 (63%), Gaps = 4/188 (2%)
 Frame = +2

Query  158  SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            + +A    D  DL ++L +   DFL+  SG++V + +L+GK IG+YF+A+W   C  FTP
Sbjct  6    TGLAAATEDGIDLFTVLST---DFLLSPSGNKVDLKELEGKTIGLYFAANWYSKCETFTP  62

Query  338  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  514
             LA VY++L   G+ FEVV+VS+DED  SF+ +   M W A+PFSD  +R  L   F + 
Sbjct  63   VLARVYHQLKELGSEFEVVYVSSDEDHASFERFHSLMLWPAIPFSDLKSRRSLTQRFQIE  122

Query  515  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVS  694
            GIP L+IL+  G++   DGV++V  +   A+PFT ER+ E++  E+A    Q+L+ +L  
Sbjct  123  GIPSLIILNSKGELIRTDGVELVNRYECRAFPFTSERMAELEADEKAKHASQTLEKLLSL  182

Query  695  TSRDYVIA  718
              RD VI+
Sbjct  183  HGRDCVIS  190


 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 103/176 (59%), Gaps = 5/176 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            F F+  +  E +A   A+    +  L  +L    RD +I +   QV +  L GK +G+YF
Sbjct  153  FPFTSERMAELEADEKAKHA--SQTLEKLLSLHGRDCVISHE-QQVPISKLVGKTVGLYF  209

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA  C PC +FT  LA++Y+ L  K   FE+VFVS D+DE  + + + +MPW A+P++D 
Sbjct  210  SAQECLPCTKFTSKLASIYDNLKEKNEEFEIVFVSMDKDEAGYLQCYSEMPWLALPYNDE  269

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKD  643
             +R  L   F ++GIP L+I+   GK  T++G +++  H   A+PFT  +++ +++
Sbjct  270  SSR-ALARYFDLQGIPALIIIGPDGKTVTKEGRNLINLHLEMAFPFTEAQIRLLQE  324



>ref|XP_008653605.1| PREDICTED: probable nucleoredoxin 3 [Zea mays]
Length=299

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 105/178 (59%), Gaps = 5/178 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + FS ++   R+  SM +   +   L+ +L   +RDF+I      + + DL GK +G+YF
Sbjct  119  YPFSAQR--RRELESMDDARREGGRLQELLGCEERDFVISADDINIPIADLTGKTVGLYF  176

Query  299  SASWCGPCHRFTPNLATVYNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSD  472
             A WC PCH FT  L  VYNEL  L  G+FEV+FVS D  +  F+     MPW A+P+SD
Sbjct  177  GAHWCPPCHVFTKQLKEVYNELKILRPGSFEVIFVSIDRSKGEFQASMSSMPWLAIPYSD  236

Query  473  SVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDA  646
            + TR+RL  +F+V+GIP L+IL   GK    DG   +  +G  A+PFT  RV E+ +A
Sbjct  237  A-TRKRLTRIFSVKGIPGLLILGLDGKALKTDGRTTISTYGAAAFPFTESRVSEVGEA  293


 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 74/121 (61%), Gaps = 6/121 (5%)
 Frame = +2

Query  377  NFEVVFVSADEDEESFKEYFGKMPWTAVPF-SDSVTRERLDALFTVRGIPHLVILDESGK  553
            + E++FVS D DE SF+++F  M W AVPF +  + R++L A F +  IP L+ L  S  
Sbjct  37   DVEIIFVSLDRDEASFRDHFQGMSWLAVPFDAAGLLRQKLCARFAIERIPALIPLSASAT  96

Query  554  VTT-----EDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
             ++     ED V +V E+GV+AYPF+ +R +E++  ++A      L+ +L    RD+VI+
Sbjct  97   SSSGLGCREDAVRLVGEYGVDAYPFSAQRRRELESMDDARREGGRLQELLGCEERDFVIS  156

Query  719  A  721
            A
Sbjct  157  A  157



>ref|XP_010923905.1| PREDICTED: probable nucleoredoxin 2 [Elaeis guineensis]
Length=390

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 114/184 (62%), Gaps = 4/184 (2%)
 Frame = +2

Query  167  AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  346
            A   GD   L ++L +   D L+  SG++V + +L+GK IG+YF+A+W   C  FTP L 
Sbjct  3    APTTGDGMGLFTVLST---DVLLSPSGNKVDLKELEGKTIGLYFAANWYWKCEAFTPVLT  59

Query  347  TVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
             VY++L   G +FE+VFVS+DED  SF+ +   MPW A+PFSD  +R  L   F + GIP
Sbjct  60   HVYHQLKQDGSDFEIVFVSSDEDHASFERFHSLMPWPAIPFSDLQSRRSLTQRFQIEGIP  119

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
             L+I++  G++   DGV+++  +   A+PFT E++ E++  EEA    Q+L+ +L    R
Sbjct  120  SLIIINSKGELIRTDGVELINRYECRAFPFTSEKMAELEADEEAKHASQTLEKLLSLNGR  179

Query  704  DYVI  715
            D VI
Sbjct  180  DCVI  183


 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 103/176 (59%), Gaps = 5/176 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            F F+  K  E +A   A+    +  L  +L  + RD +I N   QV + +L GK +G+YF
Sbjct  147  FPFTSEKMAELEADEEAKHA--SQTLEKLLSLNGRDCVI-NHKRQVPISELVGKTVGLYF  203

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA  C PC +FT  LA++YN L  K   FE+VFVS D DE  + + + +MPW A+P+ DS
Sbjct  204  SARRCPPCTKFTSKLASIYNNLKEKNEEFEIVFVSMDRDEAGYLQCYSEMPWLALPY-DS  262

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKD  643
             + + L   F V+GIP L+I+   GK  T +G +++  H   A+PFT  +++ +++
Sbjct  263  ESSKALARYFDVQGIPALIIIGPDGKTVTREGRNLINLHLEMAFPFTEAQIRLLQE  318



>ref|XP_010692758.1| PREDICTED: probable nucleoredoxin 2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010692759.1| PREDICTED: probable nucleoredoxin 2 [Beta vulgaris subsp. vulgaris]
Length=416

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 115/187 (61%), Gaps = 6/187 (3%)
 Frame = +2

Query  176  NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
            NG    L S+L S DRDFL+ +   QVK+ +L+GK +GIYFSA+W  PC +F   L  VY
Sbjct  20   NGSLSRLSSLLASKDRDFLLTSDDTQVKISELQGKVVGIYFSANWYSPCRKFNELLIDVY  79

Query  356  NELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLV  532
             +L  +G +FE++ VS+DED  +F  Y   MPW +VP+SD  T++ L+  F V  +P+LV
Sbjct  80   EQLRSQGSDFEIILVSSDEDIGAFNSYRASMPWLSVPYSDLETKKALNQTFDVEAMPYLV  139

Query  533  ILDESG-----KVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVST  697
             L  S        T  DGV+++  +G+EA+PFT ER++ +   +      Q+L T+L + 
Sbjct  140  FLHPSNYSGNDDTTMHDGVELIYRYGIEAFPFTKERLEILHTEQREKEERQTLVTLLTNH  199

Query  698  SRDYVIA  718
             RDYV++
Sbjct  200  DRDYVLS  206


 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 101/181 (56%), Gaps = 19/181 (10%)
 Frame = +2

Query  107  R*SIFQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNS--GHQVKVDDLKGK  280
            R  I    +R+ EER+             L ++L + DRD+++ +    HQV V  L+GK
Sbjct  175  RLEILHTEQREKEERQT------------LVTLLTNHDRDYVLSHDPLTHQVPVTSLQGK  222

Query  281  KIGIYFSASWCGPCHRFTPNLATVY----NELLPKGNFEVVFVSADEDEESFKEYFGKMP  448
             IG+YFSA WC PC  F P L ++Y      L  + +FE+VFVS+D DE SF  YF +MP
Sbjct  223  TIGLYFSAHWCLPCITFIPKLISIYKMIKQNLQEQDDFEIVFVSSDRDEASFHSYFQRMP  282

Query  449  WTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERV  628
            W A+PF D   ++ L   F VR IP LVIL   GK  T+ G  ++  +   AYPFT  R+
Sbjct  283  WLALPFRDRTIKD-LAKHFDVREIPCLVILGPDGKTVTKQGRYLINLYQENAYPFTEARL  341

Query  629  K  631
            +
Sbjct  342  E  342



>gb|KDO82403.1| hypothetical protein CISIN_1g008336mg [Citrus sinensis]
Length=477

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 113/189 (60%), Gaps = 5/189 (3%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            M EQ   A     LRS+L S  RDF+I + G ++ V DL+GK IG+YFS S       FT
Sbjct  65   MKEQEERAKREQSLRSVLTSHSRDFVISSDGRKISVSDLEGKTIGLYFSMSSYKASAEFT  124

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  VY +L  KG +FE+V +S D++EESFK   G MPW A+PF D  +RE+L   F +
Sbjct  125  PRLVEVYEKLKGKGESFEIVLISLDDEEESFKRDLGSMPWLALPFKDK-SREKLARYFEL  183

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
              +P LVI+   GK    +  + + EHGV A+PFT E+  E+ + + A    Q+L++VLV
Sbjct  184  STLPTLVIIGPDGKTLHSNVAEAIEEHGVGAFPFTPEKFAELAEIQRAKEESQTLESVLV  243

Query  692  STSRDYVIA  718
            S   D+V+ 
Sbjct  244  SGDLDFVVG  252


 Score =   143 bits (360),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 104/174 (60%), Gaps = 4/174 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            F F+  K  E      A++  ++  L S+L S D DF++  +G +V V DL GK I +YF
Sbjct  215  FPFTPEKFAELAEIQRAKE--ESQTLESVLVSGDLDFVVGKNGGKVPVSDLAGKTILLYF  272

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y ++  +  + EVVF+S+D D+ SF E+F  MPW A+PF D+
Sbjct  273  SAHWCPPCRAFLPKLIDAYKKIKERNESLEVVFISSDRDQTSFDEFFKGMPWLALPFGDA  332

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEI  637
              +  L   F V GIP LV +  SG+  T++  D++  HG EAYPFT ER+KEI
Sbjct  333  -RKASLSRKFKVSGIPMLVAIGPSGRTITKEARDMIAVHGAEAYPFTEERMKEI  385


 Score =   131 bits (329),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  443  MPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLE  622
            MPW AVPFSDS TR++LD LF V GIPHLVILDE+GKV ++ GV+I+ E+GVE YPFT+E
Sbjct  1    MPWLAVPFSDSETRDKLDELFKVMGIPHLVILDENGKVLSDGGVEIIREYGVEGYPFTVE  60

Query  623  RVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            R+KE+K+ EE   REQSL++VL S SRD+VI++
Sbjct  61   RIKEMKEQEERAKREQSLRSVLTSHSRDFVISS  93



>ref|XP_002285895.1| PREDICTED: probable nucleoredoxin 2 isoform X1 [Vitis vinifera]
Length=425

 Score =   145 bits (365),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 118/191 (62%), Gaps = 10/191 (5%)
 Frame = +2

Query  176  NGDAHDLR------SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            NG + DL       S+L S+ RDFL+  +G QVKV +L  K IG+YFSA+W  PC +FT 
Sbjct  21   NGVSDDLNYRSRFSSLLASTHRDFLLSPTGQQVKVSELNDKVIGLYFSANWYAPCRKFTQ  80

Query  338  NLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  514
             LA  Y +L   G  FE+VFVS+DED ++F  +   MPW AVPFSD  T++ L+  F + 
Sbjct  81   VLAGAYEQLKSCGAGFEIVFVSSDEDSDAFDNFRACMPWLAVPFSDLETKKALNRKFDIE  140

Query  515  GIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTV  685
            GIP LVIL   D   + T  DGV+++  +GV A+PFT  R++E++  E      Q+L  +
Sbjct  141  GIPCLVILQPNDNKDEATLHDGVELIYRYGVNAFPFTKVRLEELRKEEREKHESQTLPNL  200

Query  686  LVSTSRDYVIA  718
            L + +RD+++ 
Sbjct  201  LTNHNRDFLLG  211


 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 100/166 (60%), Gaps = 11/166 (7%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLI-RNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  358
            ++  L ++L + +RDFL+ R +  QV +  L GK IG+YFSA WC P  +FTP L ++Y 
Sbjct  193  ESQTLPNLLTNHNRDFLLGRPTAKQVPISSLIGKTIGLYFSAQWCLPGVKFTPKLISIYQ  252

Query  359  ELLP------KGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
            ++        + +FE+VFVS+D D+ SF  YFG MPW AVPF D  T + L   F V+GI
Sbjct  253  KIKQTLVDDNEEDFEIVFVSSDRDQPSFDSYFGTMPWLAVPFGDP-TIKTLTKYFDVQGI  311

Query  521  PHLVILDESGKVTTEDGVDIVLEHGVEAYPFT---LERVKEIKDAE  649
            P LVIL   GK  T+ G  ++  +   AYPFT   LE +++  D E
Sbjct  312  PCLVILGPDGKTVTKQGRYLINLYQENAYPFTEAKLELLEKQMDEE  357



>ref|XP_011034968.1| PREDICTED: probable nucleoredoxin 2 [Populus euphratica]
Length=458

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 121/198 (61%), Gaps = 11/198 (6%)
 Frame = +2

Query  158  SSMAEQNGD------AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGP  319
            +S  E+NGD      +    S+L + DRD+L+   G QVKV DL+GK +G+YFSA+W  P
Sbjct  46   ASEDEENGDHSQKISSSRFSSLLATKDRDYLLSQDGTQVKVSDLEGKVLGLYFSANWYVP  105

Query  320  CHRFTPN-LATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERL  493
            C  FT   L   Y  L  KG NFE+VF+S+DED ++F  Y   MPW ++PFSD  T+  L
Sbjct  106  CRSFTTQVLVGAYEHLKSKGSNFEIVFISSDEDLDAFNNYRANMPWLSIPFSDLETKRAL  165

Query  494  DALFTVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*R  664
            ++ F V  IP LVIL   D   + T  DGV+++   GV+A+PFT ER++E++  E+    
Sbjct  166  NSKFEVEAIPFLVILQPEDNKYEATIHDGVELLSRFGVQAFPFTKERLEELEMEEKEKRE  225

Query  665  EQSLKTVLVSTSRDYVIA  718
             Q+L  +L +  RDY++ 
Sbjct  226  SQTLINLLTNHDRDYLLG  243


 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 90/152 (59%), Gaps = 9/152 (6%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQ-VKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +  L ++L + DRD+L+     Q V V  L GK IG+YFSA WC P  +FT  L ++Y++
Sbjct  226  SQTLINLLTNHDRDYLLGPPAAQRVPVASLVGKTIGLYFSAQWCLPGVKFTHKLISIYHK  285

Query  362  L----LPKGN---FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
            +    + KGN   FE+VFVS+D D+ +F  YF  MPW  +PF D  ++  L   F V+GI
Sbjct  286  IKQMVVHKGNEDDFEIVFVSSDRDQAAFDSYFNSMPWLTLPFGDPASK-ILAKHFDVKGI  344

Query  521  PHLVILDESGKVTTEDGVDIVLEHGVEAYPFT  616
            P LVIL   GK  T+ G  ++  +   AYPFT
Sbjct  345  PCLVILGPDGKTVTKHGRSLINLYKENAYPFT  376



>ref|XP_006438372.1| hypothetical protein CICLE_v10031097mg [Citrus clementina]
 gb|ESR51612.1| hypothetical protein CICLE_v10031097mg [Citrus clementina]
Length=477

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 112/189 (59%), Gaps = 5/189 (3%)
 Frame = +2

Query  164  MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  334
            M EQ   A     LRS+L S  RDF+I + G ++ V DL+GK IG+YFS S       FT
Sbjct  65   MKEQEERAKREQSLRSVLTSHSRDFVISSDGRKISVSDLEGKTIGLYFSMSSYKASAEFT  124

Query  335  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  511
            P L  VY +L  KG +FE+V +S D++EESFK   G MPW A+PF D  +RE+L   F +
Sbjct  125  PRLVEVYEKLKGKGESFEIVLISLDDEEESFKRDLGSMPWLALPFKDK-SREKLARYFEL  183

Query  512  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLV  691
              +P LVI+   GK    +  + + EHGV A+PFT E+  E+ + + A    Q+L+ VLV
Sbjct  184  STLPTLVIIGPDGKTLHSNVAEAIEEHGVGAFPFTPEKFAELAEIQRAKEESQTLELVLV  243

Query  692  STSRDYVIA  718
            S   D+V+ 
Sbjct  244  SGDLDFVVG  252


 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 103/174 (59%), Gaps = 4/174 (2%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            F F+  K  E      A++  ++  L  +L S D DF++  +G +V V DL GK I +YF
Sbjct  215  FPFTPEKFAELAEIQRAKE--ESQTLELVLVSGDLDFVVGKNGGKVPVSDLVGKTILLYF  272

Query  299  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  475
            SA WC PC  F P L   Y ++  +  + EVVF+S+D D+ SF E+F  MPW A+PF D+
Sbjct  273  SAHWCPPCRAFLPKLIEAYKKIKERNESLEVVFISSDRDQTSFDEFFKGMPWLALPFGDA  332

Query  476  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEI  637
              +  L   F V GIP LV +  SG+  T++  D++  HG EAYPFT ER+KEI
Sbjct  333  -RKASLSRKFKVSGIPMLVAIGPSGRTITKEAKDMIAVHGAEAYPFTEERMKEI  385


 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  443  MPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLE  622
            MPW AVPFSDS TR++LD LF V GIPHLVILDE+GKV ++ GV+I+ E+GVE YPFT+E
Sbjct  1    MPWLAVPFSDSETRDKLDELFKVMGIPHLVILDENGKVLSDGGVEIIREYGVEGYPFTVE  60

Query  623  RVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            R+KE+K+ EE   REQSL++VL S SRD+VI++
Sbjct  61   RIKEMKEQEERAKREQSLRSVLTSHSRDFVISS  93



>ref|XP_008350516.1| PREDICTED: probable nucleoredoxin 2 [Malus domestica]
Length=389

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 101/159 (64%), Gaps = 4/159 (3%)
 Frame = +2

Query  254  VKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKE  430
            VKV DL GK IG+YFSA+W  PC  F   L  +Y +L   G NFE+V+VS+DED  +F  
Sbjct  13   VKVSDLXGKIIGLYFSANWYPPCWNFNQVLVGIYEQLKXSGXNFEIVYVSSDEDSXAFNX  72

Query  431  YFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVE  601
            Y   MPW A+PFSD  T++ L+  F V  IP LVIL   D   + T  DGV+I+  +GVE
Sbjct  73   YHACMPWLAIPFSDLDTKKALNRKFDVESIPSLVILQPNDNKDEATLHDGVEIIYRYGVE  132

Query  602  AYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
            A+PFT ++++E++D + A    Q+L  +L +  RDY++ 
Sbjct  133  AFPFTKQKLEELQDEDRARHENQTLTNLLTNHDRDYLLG  171


 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 110/193 (57%), Gaps = 20/193 (10%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGH----QVKVDDLKGKKI  286
            F F+K+K EE +    A    +   L ++L + DRD+L+   GH    QV V  L+GK I
Sbjct  134  FPFTKQKLEELQDEDRARH--ENQTLTNLLTNHDRDYLL---GHPTPKQVSVASLRGKTI  188

Query  287  GIYFSASWCGPCHRFTPNLATVYNELLPKG--------NFEVVFVSADEDEESFKEYFGK  442
            G+YFSA WC PC  FTP L ++Y ++  K         +FE+V VS+D D+ SF  YF  
Sbjct  189  GLYFSAQWCRPCVNFTPKLISIYEKIKEKMLVDDHDGEDFEIVLVSSDRDQTSFDSYFNT  248

Query  443  MPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLE  622
            MPW A+PF D   +E L   F V+GIP LVIL   GK  T+ G +++  +   AYPFT  
Sbjct  249  MPWLALPFGDPNIKE-LVKHFDVKGIPCLVILGPDGKTVTQQGRNLINLYKENAYPFTDA  307

Query  623  RVK--EIKDAEEA  655
            +++  E K  EEA
Sbjct  308  KLELLEKKMDEEA  320



>ref|XP_010266051.1| PREDICTED: probable nucleoredoxin 2 [Nelumbo nucifera]
Length=416

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 115/179 (64%), Gaps = 6/179 (3%)
 Frame = +2

Query  200  SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-  376
            S+L S DRDFL+  + +QVKV DL GK +GIYFSA+W  PC +FTP LA VY +L  +G 
Sbjct  23   SLLASKDRDFLLSPTENQVKVSDLDGKVVGIYFSANWYPPCRKFTPILAGVYEQLKGRGC  82

Query  377  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL-----D  541
             FEVVFVS+DED ++F  Y   MPW A+PFSD  +++ L+  F +  IP L+IL     D
Sbjct  83   GFEVVFVSSDEDCDAFASYRSSMPWLAIPFSDLESKKGLNRRFEIEDIPCLIILQPVSTD  142

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
                    DGV+++  +GV A+PFT +R++E++  E      Q++  +L + +R++++ 
Sbjct  143  NEEDEILRDGVELIYRYGVRAFPFTKQRLEELEKEEREKHENQTITNLLTNHNRNFLLG  201


 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 101/166 (61%), Gaps = 16/166 (10%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGH----QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN-  358
            + ++L + +R+FL+   GH    QV V  L GK +G+YFSA WC PC +FTP L ++Y+ 
Sbjct  187  ITNLLTNHNRNFLL-GHGHPVPKQVDVGSLVGKTVGLYFSAQWCLPCLKFTPKLISIYHK  245

Query  359  --ELL----PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
              E+L       +FE+VFVS+D ++  F  YFG MPW A+PF D   R  L   F V+ +
Sbjct  246  IKEMLVEEKENEDFEIVFVSSDSEQVGFDSYFGTMPWLALPFGDPTVRS-LTKYFDVQRV  304

Query  521  PHLVILDESGKVTTEDGVDIVLEHGVEAYPFT---LERVKEIKDAE  649
            P LVIL   GK  T+ G +++  +  +AYPFT   LE ++++KD E
Sbjct  305  PCLVILGPDGKTLTKQGRNLINLYQEKAYPFTKAQLEFLEKLKDEE  350



>gb|KCW59852.1| hypothetical protein EUGRSUZ_H025922, partial [Eucalyptus grandis]
Length=370

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 101/163 (62%), Gaps = 2/163 (1%)
 Frame = +2

Query  158  SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  337
            + + ++  ++  L SIL S D DF+I   G ++ V DL GK + +YFSA WC PC  F P
Sbjct  108  AEIEKKREESQTLESILVSGDLDFVIGKDGTKIPVPDLVGKTVLLYFSAHWCPPCRAFLP  167

Query  338  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  514
             L   Y ++   GN  EV+F+S+D+D+ +F  YF +MPW A+PF D   ++ L   F VR
Sbjct  168  VLTEAYEKIKAAGNALEVIFISSDKDQTAFDNYFAQMPWLALPFGDE-RKKSLSRKFKVR  226

Query  515  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKD  643
            GIP LV +  +G+  T    D++++HG +AYPFT E +K+ ++
Sbjct  227  GIPMLVAIGPTGRTVTNKARDLIMDHGADAYPFTAEHLKKFEE  269


 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 80/134 (60%), Gaps = 2/134 (1%)
 Frame = +2

Query  320  CHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLD  496
            C  FTP L  VY +L  +G +FE+V +  D+DE SF + FG MPW ++PF D    E+L 
Sbjct  2    CVDFTPKLLEVYEKLKARGESFEIVQIPLDDDEASFNQSFGSMPWLSLPFKDKKC-EKLV  60

Query  497  ALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSL  676
              F +  +P LVI+ + GK    +  + V EHG+ AYPFT E+  E+ + E+     Q+L
Sbjct  61   RYFKLSTLPTLVIIGQDGKTVHANVAETVEEHGITAYPFTPEKFAELAEIEKKREESQTL  120

Query  677  KTVLVSTSRDYVIA  718
            +++LVS   D+VI 
Sbjct  121  ESILVSGDLDFVIG  134



>ref|XP_010263377.1| PREDICTED: probable nucleoredoxin 3 [Nelumbo nucifera]
 ref|XP_010263378.1| PREDICTED: probable nucleoredoxin 3 [Nelumbo nucifera]
Length=387

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 102/178 (57%), Gaps = 5/178 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            F FSK + EE KA    ++ G    L  +L   +RDF++  SG ++ V  L GK IG+YF
Sbjct  152  FPFSKERREELKAMDNVKRQGGK--LEDLLVLGERDFVVSGSGEKIPVSSLVGKAIGLYF  209

Query  299  SASWCGPCHRFTPNLATVYNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSD  472
             A WC PC  FT  L   YNEL      N E++F+S D D+E F      MPW A+P+ D
Sbjct  210  GAHWCPPCRAFTAQLTEAYNELNTTQNKNLEIIFISTDRDQEEFDLNIRTMPWLAIPYGD  269

Query  473  SVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDA  646
              TR+ L  +F ++GIP LV+L   GK+   +G  ++  +G +A+PFT  R+ EI+ A
Sbjct  270  R-TRQDLCRIFDIKGIPALVLLGPDGKILNTNGRALISSYGAKAFPFTKTRIDEIEAA  326


 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 106/183 (58%), Gaps = 5/183 (3%)
 Frame = +2

Query  176  NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  355
            NG A+   SIL S   +FL+   G +V +  L+ K I + FSA+WC PC  F P L  +Y
Sbjct  12   NGSANT--SILASEGVEFLLSAEG-KVPLSSLEQKTIYLVFSANWCRPCRNFIPQLVQLY  68

Query  356  NELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLV  532
            N L       E++FVS D DE  F+E+F  MPW A+PF D   R RL   + V  IP L+
Sbjct  69   NTLRKTNVKLEIIFVSFDRDENGFREHFKCMPWLALPF-DVSLRRRLCDRYHVDRIPSLI  127

Query  533  ILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYV  712
             L   GK+  ED V+++ ++G++A+PF+ ER +E+K  +    +   L+ +LV   RD+V
Sbjct  128  PLCMEGKLVEEDAVELIEDYGIDAFPFSKERREELKAMDNVKRQGGKLEDLLVLGERDFV  187

Query  713  IAA  721
            ++ 
Sbjct  188  VSG  190



>ref|XP_006652793.1| PREDICTED: probable nucleoredoxin 3-like [Oryza brachyantha]
Length=394

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 109/178 (61%), Gaps = 5/178 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + F +++  E +    A + G   +L+ +L   +R+++I   G ++ + DL GK IG+YF
Sbjct  155  YPFGEKRRHELEGMDDARRQGG--NLQELLGCKERNYVISADGIKIPISDLNGKTIGLYF  212

Query  299  SASWCGPCHRFTPNLATVYNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSD  472
             A WC PC  FT  L  VYNEL  L  GNF+V+F+S D +EE F+    +MPW ++P+SD
Sbjct  213  GAHWCPPCRTFTKQLREVYNELKTLRPGNFQVIFISMDRNEEEFQASLTEMPWFSIPYSD  272

Query  473  SVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDA  646
             +T + L  +FT++GIP L+IL   GK    DG  ++ ++G  A+PFT  R  E++++
Sbjct  273  -ITMQELSRIFTIKGIPTLLILGPDGKAYKTDGRTVISKYGAMAFPFTESRTYEMEES  329


 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 100/168 (60%), Gaps = 5/168 (3%)
 Frame = +2

Query  230  LIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSAD  406
            L+ + G +V +  + GK+  ++FSA WC PC  FTP L  +Y +L   G N E++F+S D
Sbjct  27   LLSSGGKEVPLSSINGKRTCLFFSAHWCRPCRNFTPKLLQIYKKLRNTGKNIEIIFISLD  86

Query  407  EDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES---GKVTTEDGVD  577
             DE SF ++F  MPW A+PF+  + R++L   F +  IP L+ L      G    ED V 
Sbjct  87   HDEISFLDHFKCMPWLALPFNTGL-RQKLFKQFDIEHIPALIPLSTKIYDGFGIEEDAVK  145

Query  578  IVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            +V E+GV+AYPF  +R  E++  ++A  +  +L+ +L    R+YVI+A
Sbjct  146  LVEEYGVDAYPFGEKRRHELEGMDDARRQGGNLQELLGCKERNYVISA  193



>ref|XP_006386162.1| hypothetical protein POPTR_0002s01870g [Populus trichocarpa]
 gb|ERP63959.1| hypothetical protein POPTR_0002s01870g [Populus trichocarpa]
Length=427

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 120/198 (61%), Gaps = 11/198 (6%)
 Frame = +2

Query  158  SSMAEQNGD------AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGP  319
            +S  E NGD      +    S+L + DRD+L+   G QVKV DL+GK +G+YFSA+W  P
Sbjct  15   ASEDEVNGDHSQKISSSRFSSLLATKDRDYLLSQDGTQVKVSDLEGKVLGLYFSANWYVP  74

Query  320  CHRFTPN-LATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERL  493
            C  FT   L   Y  L  KG NFE+VF+S+DED ++F  Y   MPW ++PFSD  T+  L
Sbjct  75   CRSFTTQVLVGAYEHLKSKGSNFEIVFISSDEDLDAFNNYRANMPWLSIPFSDLETKRAL  134

Query  494  DALFTVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*R  664
            ++ F +  IP LVIL   D   + T  DGV+++   GV+A+PFT ER++E++  E+    
Sbjct  135  NSKFEIEAIPFLVILQPEDNKYEATIHDGVELLNRFGVQAFPFTKERLEELEMEEKEKRE  194

Query  665  EQSLKTVLVSTSRDYVIA  718
             Q+L  +L +  RDY++ 
Sbjct  195  SQTLINLLTNHDRDYLLG  212


 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 94/156 (60%), Gaps = 9/156 (6%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRN-SGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            +  L ++L + DRD+L+ + +  QV V  L GK +G+YFSA WC P  +FTP L ++Y +
Sbjct  195  SQTLINLLTNHDRDYLLGHPAAKQVPVASLVGKTLGLYFSAQWCLPGVKFTPKLISIYQK  254

Query  362  L----LPKGN---FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  520
            +    + KGN   FE+VFVS+D D+ +F  YF  MPW  +PF D   +  L   F V+GI
Sbjct  255  IKQMVVHKGNEDDFEIVFVSSDRDQAAFDSYFNSMPWLTLPFGDPANK-ILAKHFDVKGI  313

Query  521  PHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERV  628
            P LVIL   GK  T+ G +++  +   AYPFT  +V
Sbjct  314  PCLVILGPDGKTVTKHGRNLINLYKENAYPFTEAQV  349



>ref|XP_004976749.1| PREDICTED: probable nucleoredoxin 3-like [Setaria italica]
Length=389

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 103/179 (58%), Gaps = 7/179 (4%)
 Frame = +2

Query  119  FQFS-KRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIY  295
            + FS KR+GE         Q G    L+ +L   DRD+++   G +V + DL GK +G+Y
Sbjct  150  YPFSVKRRGELEAIDDARRQGGK---LQELLGCKDRDYVVSAYGTKVSIADLTGKTVGLY  206

Query  296  FSASWCGPCHRFTPNLATVYNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFS  469
            F A WC PC  FT  L  VYNEL  L   +FEV+F+S D  +E F+E     PW A+P+S
Sbjct  207  FGAHWCPPCRAFTKQLMEVYNELKILRPRSFEVIFISIDRSKEEFEESLSATPWLAIPYS  266

Query  470  DSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDA  646
            D+  R+ L  +F ++GIP L+IL   GKV   DG   +  +G  A+PFT  RV E+ +A
Sbjct  267  DT-ARQELTRIFAIKGIPALLILGLDGKVLKTDGRTAISTYGATAFPFTESRVSEVNEA  324


 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 103/168 (61%), Gaps = 5/168 (3%)
 Frame = +2

Query  230  LIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSAD  406
            L+ N G +V +  ++GK   ++FSA WC PC  FTP L  +Y  L   G N E++F+S D
Sbjct  22   LLSNGGKEVPLSSIEGKVTCLFFSAHWCRPCRNFTPKLVQIYTMLRNTGKNIEIIFISLD  81

Query  407  EDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD--ESGKVT-TEDGVD  577
             DE SF ++F  MPW A+PF+ S+ R +L + F +  IP L+ L    SG++   ED V 
Sbjct  82   HDETSFLDHFKSMPWLALPFNSSL-RRKLCSHFGIEHIPALIPLSVTPSGELGFEEDAVK  140

Query  578  IVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            +V E+G EAYPF+++R  E++  ++A  +   L+ +L    RDYV++A
Sbjct  141  LVEEYGAEAYPFSVKRRGELEAIDDARRQGGKLQELLGCKDRDYVVSA  188



>ref|XP_006435251.1| hypothetical protein CICLE_v10001187mg [Citrus clementina]
 gb|ESR48491.1| hypothetical protein CICLE_v10001187mg [Citrus clementina]
Length=410

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 119/195 (61%), Gaps = 6/195 (3%)
 Frame = +2

Query  152  KASSMAEQNGDAHDLR--SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCH  325
              SS++E    +   R  S+L S DRD+L+   G QVKV DL+GK   +YFSA+W  PC 
Sbjct  18   NGSSISEHQKISTSSRFSSLLASKDRDYLLNQHGTQVKVSDLEGKVTALYFSANWYPPCG  77

Query  326  RFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDAL  502
             FT  L  VY EL   G +FEVVFVS+DED  +F  Y   MPW AVP+SD  T++ L+  
Sbjct  78   NFTGVLVDVYEELRNNGSDFEVVFVSSDEDLNAFNNYRACMPWLAVPYSDLETKKALNRK  137

Query  503  FTVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQS  673
            F + GIP LV+L   D+    T  DGV+++ ++G+ A+PFT E+++E++  E+     Q+
Sbjct  138  FDIEGIPCLVVLQPYDDKDDATLHDGVELIYKYGIRAFPFTKEKLEELQKEEKEKHERQT  197

Query  674  LKTVLVSTSRDYVIA  718
            L  +L +  R Y++ 
Sbjct  198  LINLLTNHDRGYLLG  212


 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 82/142 (58%), Gaps = 16/142 (11%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGH----QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            L ++L + DR +L+   GH    +V V  L GK +G+YFSA WC PC +F P L ++Y +
Sbjct  198  LINLLTNHDRGYLL---GHPPDEKVPVSSLVGKTVGLYFSARWCIPCEKFMPKLLSIYQK  254

Query  362  ----LLPKGN----FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  517
                L+ KG+    FEVVFVS D D+ SF+ YFG MPW A+PF D   +E L   F V+G
Sbjct  255  IKQNLVEKGDALEDFEVVFVSTDRDQTSFESYFGTMPWLALPFGDPTIKE-LTKYFDVQG  313

Query  518  IPHLVILDESGKVTTEDGVDIV  583
               + +  E+    TE  ++ +
Sbjct  314  RNLINLYQENAYPFTEAKLEFL  335



>ref|XP_006435250.1| hypothetical protein CICLE_v10001187mg [Citrus clementina]
 ref|XP_006473711.1| PREDICTED: probable nucleoredoxin 2-like isoform X2 [Citrus sinensis]
 gb|ESR48490.1| hypothetical protein CICLE_v10001187mg [Citrus clementina]
 gb|KDO84953.1| hypothetical protein CISIN_1g013684mg [Citrus sinensis]
Length=428

 Score =   142 bits (357),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 119/195 (61%), Gaps = 6/195 (3%)
 Frame = +2

Query  152  KASSMAEQNGDAHDLR--SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCH  325
              SS++E    +   R  S+L S DRD+L+   G QVKV DL+GK   +YFSA+W  PC 
Sbjct  18   NGSSISEHQKISTSSRFSSLLASKDRDYLLNQHGTQVKVSDLEGKVTALYFSANWYPPCG  77

Query  326  RFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDAL  502
             FT  L  VY EL   G +FEVVFVS+DED  +F  Y   MPW AVP+SD  T++ L+  
Sbjct  78   NFTGVLVDVYEELRNNGSDFEVVFVSSDEDLNAFNNYRACMPWLAVPYSDLETKKALNRK  137

Query  503  FTVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQS  673
            F + GIP LV+L   D+    T  DGV+++ ++G+ A+PFT E+++E++  E+     Q+
Sbjct  138  FDIEGIPCLVVLQPYDDKDDATLHDGVELIYKYGIRAFPFTKEKLEELQKEEKEKHERQT  197

Query  674  LKTVLVSTSRDYVIA  718
            L  +L +  R Y++ 
Sbjct  198  LINLLTNHDRGYLLG  212


 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 99/165 (60%), Gaps = 16/165 (10%)
 Frame = +2

Query  194  LRSILCSSDRDFLIRNSGH----QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            L ++L + DR +L+   GH    +V V  L GK +G+YFSA WC PC +F P L ++Y +
Sbjct  198  LINLLTNHDRGYLL---GHPPDEKVPVSSLVGKTVGLYFSARWCIPCEKFMPKLLSIYQK  254

Query  362  ----LLPKGN----FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  517
                L+ KG+    FEVVFVS D D+ SF+ YFG MPW A+PF D   +E L   F V+G
Sbjct  255  IKQNLVEKGDALEDFEVVFVSTDRDQTSFESYFGTMPWLALPFGDPTIKE-LTKYFDVQG  313

Query  518  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
            IP LVI+   GK  T+ G +++  +   AYPFT  +++ ++   E
Sbjct  314  IPCLVIIGPEGKTVTKQGRNLINLYQENAYPFTEAKLEFLEKQME  358



>gb|AFW59396.1| hypothetical protein ZEAMMB73_974140 [Zea mays]
Length=432

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 105/178 (59%), Gaps = 5/178 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + FS ++   R+  SM +   +   L+ +L   +RD++I     ++ + DL GK +G+YF
Sbjct  193  YPFSAQR--RRELESMDDARREGGRLQELLGCEERDYVISADDIKIPIADLDGKTVGLYF  250

Query  299  SASWCGPCHRFTPNLATVYNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSD  472
             A WC PCH FT  L  VYNEL  L  G+FEV+FVS D  +  F+     MPW A+P+SD
Sbjct  251  GAHWCPPCHVFTKQLKEVYNELKILRPGSFEVIFVSIDRSKGEFQASMSSMPWLAIPYSD  310

Query  473  SVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDA  646
            +  R++L  +F V+GIP L+IL   GKV   DG   +  +G  A+PFT  RV E+ +A
Sbjct  311  A-ARKKLTRIFAVKGIPGLLILGLDGKVLKTDGRTAISTYGAAAFPFTESRVSEVGEA  367


 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 103/174 (59%), Gaps = 9/174 (5%)
 Frame = +2

Query  227  FLIRNSGHQVKVDDLKGKK--IGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFV  397
            FL+ N G +V +  ++ +   + ++FSA WC PC  FTP L   Y  L   G + E++FV
Sbjct  58   FLLSNEGKEVPLSSIEDRTACLCLFFSAHWCRPCRSFTPTLLQAYTALRSAGKSVEIIFV  117

Query  398  SADEDEESFKEYFGKMPWTAVPF-SDSVTRERLDALFTVRGIPHLVILD-----ESGKVT  559
            S D DE SF+++F  MPW AVPF +  + R++L A F V  IP L+ L       SG  +
Sbjct  118  SLDRDEASFRDHFQGMPWLAVPFDAAGLLRQKLCARFAVERIPALIPLSASATPSSGLGS  177

Query  560  TEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
             ED V +V E+GV+AYPF+ +R +E++  ++A      L+ +L    RDYVI+A
Sbjct  178  GEDAVRLVGEYGVDAYPFSAQRRRELESMDDARREGGRLQELLGCEERDYVISA  231



>ref|XP_008663577.1| PREDICTED: probable nucleoredoxin 3 [Zea mays]
Length=499

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 105/178 (59%), Gaps = 5/178 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + FS ++   R+  SM +   +   L+ +L   +RD++I     ++ + DL GK +G+YF
Sbjct  260  YPFSAQR--RRELESMDDARREGGRLQELLGCEERDYVISADDIKIPIADLDGKTVGLYF  317

Query  299  SASWCGPCHRFTPNLATVYNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSD  472
             A WC PCH FT  L  VYNEL  L  G+FEV+FVS D  +  F+     MPW A+P+SD
Sbjct  318  GAHWCPPCHVFTKQLKEVYNELKILRPGSFEVIFVSIDRSKGEFQASMSSMPWLAIPYSD  377

Query  473  SVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDA  646
            +  R++L  +F V+GIP L+IL   GKV   DG   +  +G  A+PFT  RV E+ +A
Sbjct  378  A-ARKKLTRIFAVKGIPGLLILGLDGKVLKTDGRTAISTYGAAAFPFTESRVSEVGEA  434


 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 103/175 (59%), Gaps = 9/175 (5%)
 Frame = +2

Query  224  DFLIRNSGHQVKVDDLKGKK--IGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVF  394
             FL+ N G +V +  ++ +   + ++FSA WC PC  FTP L   Y  L   G + E++F
Sbjct  124  QFLLSNEGKEVPLSSIEDRTACLCLFFSAHWCRPCRSFTPTLLQAYTALRSAGKSVEIIF  183

Query  395  VSADEDEESFKEYFGKMPWTAVPF-SDSVTRERLDALFTVRGIPHLVILD-----ESGKV  556
            VS D DE SF+++F  MPW AVPF +  + R++L A F V  IP L+ L       SG  
Sbjct  184  VSLDRDEASFRDHFQGMPWLAVPFDAAGLLRQKLCARFAVERIPALIPLSASATPSSGLG  243

Query  557  TTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            + ED V +V E+GV+AYPF+ +R +E++  ++A      L+ +L    RDYVI+A
Sbjct  244  SGEDAVRLVGEYGVDAYPFSAQRRRELESMDDARREGGRLQELLGCEERDYVISA  298



>ref|XP_010913793.1| PREDICTED: probable nucleoredoxin 3 [Elaeis guineensis]
Length=387

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 106/178 (60%), Gaps = 5/178 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            F F   + +E +A   A+++G    L  +L  + RD++I + G ++ + DL GK IG+YF
Sbjct  151  FPFGVERRKELEAVDEAKRHGGK--LEELLGCNGRDYVISSDGAKIPIADLVGKTIGLYF  208

Query  299  SASWCGPCHRFTPNLATVYNELLPKGN--FEVVFVSADEDEESFKEYFGKMPWTAVPFSD  472
             A WC PC  FT  LA  YNEL    N  F+++F+S D DE+ F+    +MPW A+P++D
Sbjct  209  GAHWCPPCRTFTSMLAEAYNELRDAKNESFQIIFISTDRDEDEFQSSLEEMPWLAIPYAD  268

Query  473  SVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDA  646
              TR  L  +F V+GIP LV+L   GKV   DG  ++  +G +A+PFT  R  E++ A
Sbjct  269  K-TRYDLSRIFDVKGIPRLVLLGADGKVLGTDGRAMISSYGAKAFPFTESRAAEVEAA  325


 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 106/186 (57%), Gaps = 6/186 (3%)
 Frame = +2

Query  170  EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  349
            +  G+ H  RSIL  +  +FL+     +V +  ++GK I +++SA+WC PC  FT +L  
Sbjct  8    DMEGEIH--RSILAEAGVEFLLSGE-EKVPLSCIEGKTICLFYSANWCRPCRNFTTHLVQ  64

Query  350  VYNELLPK--GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
            +Y  L  +     E+VFVS D DE SF ++F  MPW AVPF D   R++L     +  IP
Sbjct  65   LYTTLKTQLGKKLEIVFVSLDRDENSFLDHFKHMPWLAVPF-DVNIRKQLSGRLLIEHIP  123

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSR  703
             L+ L   G+   ED V +V + G +A+PF +ER KE++  +EA      L+ +L    R
Sbjct  124  SLIPLAPDGRTKKEDAVQLVEDFGPDAFPFGVERRKELEAVDEAKRHGGKLEELLGCNGR  183

Query  704  DYVIAA  721
            DYVI++
Sbjct  184  DYVISS  189



>gb|EEC77960.1| hypothetical protein OsI_17320 [Oryza sativa Indica Group]
 gb|EEE61648.1| hypothetical protein OsJ_16096 [Oryza sativa Japonica Group]
Length=448

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 102/174 (59%), Gaps = 6/174 (3%)
 Frame = +2

Query  128  SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  307
            +KR+ E         Q G+   L  +L   +R+++I   G +  + DL GK IG+YF A 
Sbjct  158  AKRRSELEGMDDARRQGGN---LLQLLGCKEREYVISADGIKTPISDLNGKTIGLYFGAH  214

Query  308  WCGPCHRFTPNLATVYNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVT  481
            WC PC  FT  L   Y+EL  L  GNF+V+F+S D +EE F+     MPW A+P+SD+  
Sbjct  215  WCPPCRAFTKQLREAYDELKALRPGNFQVIFISMDRNEEEFQASLSAMPWFAIPYSDTTV  274

Query  482  RERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKD  643
            +E L  +FT++GIP L+IL   GKV   DG  I+ ++G  A+PFT  R  E+++
Sbjct  275  QE-LSRIFTIKGIPTLLILGPDGKVFKTDGRRIISKYGAMAFPFTESRAYELEE  327


 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 101/168 (60%), Gaps = 5/168 (3%)
 Frame = +2

Query  230  LIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSAD  406
            L+ N G ++ +  ++GK+I ++FSA WC PC  FTP L  +Y +L     N E++F+S D
Sbjct  26   LLSNGGKEIPLSSIEGKRICLFFSAHWCRPCRNFTPKLLQIYRKLRNTCKNMEIIFISLD  85

Query  407  EDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES---GKVTTEDGVD  577
             DE SF +YF  MPW A+PF D+  R++L   F +  IP L+ L  +   G    ED V 
Sbjct  86   RDEISFLDYFKGMPWLALPF-DTGLRQKLCVQFDIEHIPALIPLSTTLSHGFRVEEDAVK  144

Query  578  IVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            +V E+GV+AYPF  +R  E++  ++A  +  +L  +L    R+YVI+A
Sbjct  145  LVEEYGVDAYPFGAKRRSELEGMDDARRQGGNLLQLLGCKEREYVISA  192



>sp|Q7XPE8.2|NRX3_ORYSJ RecName: Full=Probable nucleoredoxin 3; Short=OsNrx3 [Oryza sativa 
Japonica Group]
 emb|CAE03648.2| OSJNBa0060N03.13 [Oryza sativa Japonica Group]
Length=471

 Score =   140 bits (352),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 102/174 (59%), Gaps = 6/174 (3%)
 Frame = +2

Query  128  SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  307
            +KR+ E         Q G+   L  +L   +R+++I   G +  + DL GK IG+YF A 
Sbjct  158  AKRRSELEGMDDARRQGGN---LLQLLGCKEREYVISADGIKTPISDLNGKTIGLYFGAH  214

Query  308  WCGPCHRFTPNLATVYNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVT  481
            WC PC  FT  L   Y+EL  L  GNF+V+F+S D +EE F+     MPW A+P+SD+  
Sbjct  215  WCPPCRAFTKQLREAYDELKALRPGNFQVIFISMDRNEEEFQASLSAMPWFAIPYSDTTV  274

Query  482  RERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKD  643
            +E L  +FT++GIP L+IL   GKV   DG  I+ ++G  A+PFT  R  E+++
Sbjct  275  QE-LSRIFTIKGIPTLLILGPDGKVFKTDGRRIISKYGAMAFPFTESRAYELEE  327


 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 101/168 (60%), Gaps = 5/168 (3%)
 Frame = +2

Query  230  LIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSAD  406
            L+ N G ++ +  ++GK+I ++FSA WC PC  FTP L  +Y +L     N E++F+S D
Sbjct  26   LLSNGGKEIPLSSIEGKRICLFFSAHWCRPCRNFTPKLLQIYRKLRNTCKNMEIIFISLD  85

Query  407  EDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES---GKVTTEDGVD  577
             DE SF +YF  MPW A+PF D+  R++L   F +  IP L+ L  +   G    ED V 
Sbjct  86   RDEISFLDYFKGMPWLALPF-DTGLRQKLCVQFDIEHIPALIPLSTTLSHGFRVEEDAVK  144

Query  578  IVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
            +V E+GV+AYPF  +R  E++  ++A  +  +L  +L    R+YVI+A
Sbjct  145  LVEEYGVDAYPFGAKRRSELEGMDDARRQGGNLLQLLGCKEREYVISA  192



>ref|NP_001044503.1| Os01g0794400 [Oryza sativa Japonica Group]
 sp|Q0JIL1.1|NRX2_ORYSJ RecName: Full=Probable nucleoredoxin 2; Short=OsNrx2 [Oryza sativa 
Japonica Group]
 dbj|BAF06417.1| Os01g0794400 [Oryza sativa Japonica Group]
 dbj|BAH00765.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55518.1| hypothetical protein OsJ_03740 [Oryza sativa Japonica Group]
Length=394

 Score =   139 bits (349),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 101/162 (62%), Gaps = 1/162 (1%)
 Frame = +2

Query  230  LIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSAD  406
            LI  +G++V++ +L+GK IG+YF+A+W   C  FTP L   Y++L   G  FEV+FVS D
Sbjct  26   LISPTGNEVQISELEGKIIGLYFAANWYPKCEAFTPALTAAYHQLKEHGAGFEVIFVSCD  85

Query  407  EDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVL  586
            E+  SF+ +   MPW AVPF D   ++RL   F V GIP LV+L  +G+V   D V++V 
Sbjct  86   ENRPSFERFHRAMPWPAVPFGDIGCKKRLSERFQVEGIPRLVVLAPNGEVVQPDAVELVH  145

Query  587  EHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYV  712
             +G  A+PFT  RV E++  E+     Q+L+ +   + +DYV
Sbjct  146  RYGDRAFPFTSARVAELEADEQRKFASQTLEKIFSVSGKDYV  187


 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 90/157 (57%), Gaps = 2/157 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +  L  I   S +D+ +  S  QV +  L GK +G+YFSA  C PC +FT  LA +Y+ L
Sbjct  172  SQTLEKIFSVSGKDY-VNGSQEQVPISSLVGKTVGLYFSAHRCAPCIKFTAKLAAIYSNL  230

Query  365  LPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K  +FE++++  D++E+ +      MPW A+P+ D  +   L   F VR IP LV++ 
Sbjct  231  KGKAEDFEIIYIPMDKEEDGYLRSCSDMPWLALPYDDGASSGALARYFDVREIPTLVVVG  290

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
              GK  T +G ++V  +   A+PFT E+++ +++ E+
Sbjct  291  PDGKTVTREGRNLVNLYFDMAFPFTDEQIRLLQEMED  327



>ref|XP_002448495.1| hypothetical protein SORBIDRAFT_06g027950 [Sorghum bicolor]
 gb|EES12823.1| hypothetical protein SORBIDRAFT_06g027950 [Sorghum bicolor]
Length=389

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 105/178 (59%), Gaps = 5/178 (3%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  298
            + FS ++  E +A   A + G    L+ +L   +RD++I     ++ + DL GK +G+YF
Sbjct  150  YPFSAQRRRELEAMDDARRKGG--KLQELLGCKERDYVISADDIKIPIADLTGKTVGLYF  207

Query  299  SASWCGPCHRFTPNLATVYNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSD  472
             A WC PCH FT  L  VYNEL  L   +FEV+F+S D ++  F+     MPW A+P+SD
Sbjct  208  GAHWCPPCHVFTKQLKEVYNELKILRPESFEVIFISIDRNKGEFQASMSSMPWLAIPYSD  267

Query  473  SVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDA  646
            +  R++L  +F V+GIP L+IL   GKV   DG   +  +G  A+PFT  RV E+ +A
Sbjct  268  T-ARQKLTRIFAVKGIPGLLILGLDGKVLKTDGRTAISTYGATAFPFTESRVSEVDEA  324


 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 101/169 (60%), Gaps = 5/169 (3%)
 Frame = +2

Query  227  FLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSA  403
            FL+ N G +V +  ++GK   ++FSA WC PC  FTPNL  +Y  L   G N E++F+S 
Sbjct  21   FLLNNEGKEVPLSSIEGKTTCLFFSAHWCRPCRSFTPNLVQIYTALRNTGKNIEIIFISL  80

Query  404  DEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD---ESGKVTTEDGV  574
            D DE SF ++F  M W A+PF D+   ++L A F +  IP L+ L     SG    ED V
Sbjct  81   DHDEASFWDHFKGMSWLALPF-DTGLSQKLCAHFGIEHIPALIPLSATPSSGVGFEEDAV  139

Query  575  DIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIAA  721
             +V E+G +AYPF+ +R +E++  ++A  +   L+ +L    RDYVI+A
Sbjct  140  RLVDEYGEDAYPFSAQRRRELEAMDDARRKGGKLQELLGCKERDYVISA  188



>gb|EEC71628.1| hypothetical protein OsI_04055 [Oryza sativa Indica Group]
Length=388

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 100/162 (62%), Gaps = 1/162 (1%)
 Frame = +2

Query  230  LIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSAD  406
            LI  +G++V++ +L+GK IG+YF+A+W   C  FTP L   Y++L   G  FEV+FVS D
Sbjct  20   LISPTGNEVQISELEGKIIGLYFAANWYPKCEAFTPALTAAYHQLKEHGAGFEVIFVSCD  79

Query  407  EDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVL  586
            E+  SF+ +   MPW AVPF D   ++RL   F V GIP LV+L  +G+V   D V++V 
Sbjct  80   ENRPSFERFHRAMPWPAVPFGDIGCKKRLSERFQVEGIPRLVVLAPNGEVVQPDAVELVH  139

Query  587  EHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYV  712
             +G  A+PFT  RV E++  E+     Q+L+ +     +DYV
Sbjct  140  RYGDRAFPFTSARVAELEADEQRKFASQTLEKIFSVNGKDYV  181


 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 90/157 (57%), Gaps = 2/157 (1%)
 Frame = +2

Query  185  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            +  L  I   + +D+ +  S  QV +  L GK +G+YFSA  C PC +FT  LA +Y+ L
Sbjct  166  SQTLEKIFSVNGKDY-VNGSQEQVPISSLVGKTVGLYFSAHRCAPCIKFTAKLAAIYSNL  224

Query  365  LPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  541
              K  +FE++++  D++E+ +      MPW A+P+ D  +   L   F VR IP LV++ 
Sbjct  225  KGKAEDFEIIYIPMDKEEDGYLRSCSDMPWLALPYDDGASSGALARYFDVREIPTLVVVG  284

Query  542  ESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEE  652
              GK  T +G ++V  +   A+PFT E+++ +++ E+
Sbjct  285  PDGKTVTREGRNLVNLYFDMAFPFTDEQIRLLQEMED  321



>ref|XP_010061105.1| PREDICTED: probable nucleoredoxin 2 isoform X2 [Eucalyptus grandis]
Length=426

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 110/177 (62%), Gaps = 4/177 (2%)
 Frame = +2

Query  200  SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL-LPKG  376
            S+L S DRD+L+  +G QV V DL+G  +G+YFSA+W  PC  F   L+  Y +L   + 
Sbjct  34   SLLASKDRDYLLSPTGSQVTVSDLEGHVVGLYFSANWYSPCRNFNCVLSEAYEQLKTNQS  93

Query  377  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKV  556
             FEVVFVSADED  +F  Y   MPW A+PFSD  +++ L   F V GIP LVIL   G  
Sbjct  94   KFEVVFVSADEDLSAFNSYHSSMPWLAIPFSDLESKKALSRRFDVEGIPCLVILQPDGNK  153

Query  557  TTE---DGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
              E   +GV+++  +GVEA+PFT ER++E++  E+     Q+  ++L S  RD+++ 
Sbjct  154  EEEILRNGVELIHRYGVEAFPFTRERLEELEREEKEKHENQTFTSLLSSHDRDFLLG  210


 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 91/158 (58%), Gaps = 16/158 (10%)
 Frame = +2

Query  200  SILCSSDRDFLIRNSGH-----QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            S+L S DRDFL+   GH     QV V  L GK +G++FSA WC P  +FTP L ++Y ++
Sbjct  198  SLLSSHDRDFLL---GHHPVTGQVPVASLVGKTLGLFFSAQWCLPGMKFTPKLVSIYQKI  254

Query  365  ------LPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
                   P   +FE+V+VS+D D  SF  YF  +PW A+PF D   R  L   F V+ IP
Sbjct  255  KHAISERPGAEDFEIVYVSSDRDRASFDSYFALIPWLALPFGDPKIRT-LARHFDVQDIP  313

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEI  637
             LV+L   GK  T+ G  ++  +  +AYPFT  R++ +
Sbjct  314  CLVVLGPDGKTVTKHGRSLINLYQEQAYPFTEARLESL  351



>ref|XP_010648454.1| PREDICTED: probable nucleoredoxin 3 [Vitis vinifera]
Length=399

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 104/180 (58%), Gaps = 5/180 (3%)
 Frame = +2

Query  113  SIFQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGI  292
            S F F+ ++ EE KA   A++ G    L  +L +  R+ +I +SG ++ V +L GK IG+
Sbjct  150  SAFPFTSQRREELKAMDNAKRQGG--KLEELLANEGRNHVISSSGREILVSELVGKTIGL  207

Query  293  YFSASWCGPCHRFTPNLATVYNELLPKGN--FEVVFVSADEDEESFKEYFGKMPWTAVPF  466
            YF+A WC PC  FT  L   YN+L+   N  FE++FVS D D + F      MPW A+P+
Sbjct  208  YFAAHWCPPCRAFTAQLIEAYNKLVATRNQCFEIIFVSTDRDHQEFDLSLSNMPWLAIPY  267

Query  467  SDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDA  646
             D   R+ L  +F ++GIP LV+L   GK  + +G  I+  +G  A+PFT  R  EI+ A
Sbjct  268  EDK-ARQDLCRIFDIKGIPALVLLGSDGKTISTNGRAIISSYGAMAFPFTESRTTEIEAA  326


 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 108/181 (60%), Gaps = 3/181 (2%)
 Frame = +2

Query  182  DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  361
            D++D+ ++L S   +FL+   G +V +   +GK I ++FSA+WC PC  FTP L  +YN 
Sbjct  12   DSNDIITVLASEGIEFLLSGEG-KVSLSSTEGKMICLFFSANWCRPCRTFTPQLVQIYNS  70

Query  362  LLPKGNF-EVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  538
            L+  G   E++F+S D DE  F E+F  MPW AVPF+  + R RL   + V  IP  + L
Sbjct  71   LIKTGRMIEIIFISFDRDETGFGEHFKSMPWLAVPFNVDLHR-RLSDHYHVDHIPSFIPL  129

Query  539  DESGKVTTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
               GK   ED + ++ ++G  A+PFT +R +E+K  + A  +   L+ +L +  R++VI+
Sbjct  130  GLDGKSIEEDAIGLIEDYGASAFPFTSQRREELKAMDNAKRQGGKLEELLANEGRNHVIS  189

Query  719  A  721
            +
Sbjct  190  S  190



>gb|KJB58049.1| hypothetical protein B456_009G191800 [Gossypium raimondii]
Length=431

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 108/176 (61%), Gaps = 10/176 (6%)
 Frame = +2

Query  218  DRDFLIRNSG------HQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-  376
            DRD+L+ ++        QVK+ DL+GK IGIYFSA+W  PC  F   L  VY +L   G 
Sbjct  39   DRDYLLCSTAAAAETDQQVKISDLEGKVIGIYFSANWYPPCRNFNRVLIGVYEQLKSNGS  98

Query  377  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKV  556
            NFE+VFVS+DED ++F  Y   MPW ++PFSD  T++ L+  + V  IP LVIL      
Sbjct  99   NFEIVFVSSDEDLDAFNSYRENMPWLSIPFSDLETKKALNRKYDVESIPCLVILQPDNTK  158

Query  557  ---TTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
               T  DGV+++  +GV+A+PFT E++ E++  E+     Q++  +L +  RDY++
Sbjct  159  DDDTYYDGVELIYRYGVDAFPFTKEKLDELRREEKRKHDSQTVTNLLTNPERDYLL  214


 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 112/188 (60%), Gaps = 12/188 (6%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNS-GHQVKVDDLKGKKIGIY  295
            F F+K K +E +     ++  D+  + ++L + +RD+L+  +   +V VD LKGK +G+Y
Sbjct  178  FPFTKEKLDELRREE--KRKHDSQTVTNLLTNPERDYLLDQTITRKVPVDSLKGKTVGLY  235

Query  296  FSASWCGPCHRFTPNLATVYNE----LLPKG---NFEVVFVSADEDEESFKEYFGKMPWT  454
             SA WC PC  FTP L ++Y +    L  KG   +FE+VFVS D D+ SF+ YFG MPW 
Sbjct  236  LSAQWCMPCVEFTPKLISIYQKIKQALQEKGGGEDFEIVFVSNDRDQSSFESYFGTMPWL  295

Query  455  AVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKE  634
            A+PF D   R  L   F V+ IP L+I+   GK  T+ G +++  +   AYPFT  +V+ 
Sbjct  296  ALPFRDPTAR-TLAKYFDVQWIPCLIIIGPDGKTVTKQGRNLINLYQENAYPFTDAKVES  354

Query  635  I-KDAEEA  655
            + K+ EEA
Sbjct  355  LEKEMEEA  362



>gb|KJB58047.1| hypothetical protein B456_009G191800 [Gossypium raimondii]
Length=479

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 108/176 (61%), Gaps = 10/176 (6%)
 Frame = +2

Query  218  DRDFLIRNSG------HQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-  376
            DRD+L+ ++        QVK+ DL+GK IGIYFSA+W  PC  F   L  VY +L   G 
Sbjct  39   DRDYLLCSTAAAAETDQQVKISDLEGKVIGIYFSANWYPPCRNFNRVLIGVYEQLKSNGS  98

Query  377  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKV  556
            NFE+VFVS+DED ++F  Y   MPW ++PFSD  T++ L+  + V  IP LVIL      
Sbjct  99   NFEIVFVSSDEDLDAFNSYRENMPWLSIPFSDLETKKALNRKYDVESIPCLVILQPDNTK  158

Query  557  ---TTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
               T  DGV+++  +GV+A+PFT E++ E++  E+     Q++  +L +  RDY++
Sbjct  159  DDDTYYDGVELIYRYGVDAFPFTKEKLDELRREEKRKHDSQTVTNLLTNPERDYLL  214


 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 112/188 (60%), Gaps = 12/188 (6%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNS-GHQVKVDDLKGKKIGIY  295
            F F+K K +E +     ++  D+  + ++L + +RD+L+  +   +V VD LKGK +G+Y
Sbjct  178  FPFTKEKLDELRREE--KRKHDSQTVTNLLTNPERDYLLDQTITRKVPVDSLKGKTVGLY  235

Query  296  FSASWCGPCHRFTPNLATVYNE----LLPKG---NFEVVFVSADEDEESFKEYFGKMPWT  454
             SA WC PC  FTP L ++Y +    L  KG   +FE+VFVS D D+ SF+ YFG MPW 
Sbjct  236  LSAQWCMPCVEFTPKLISIYQKIKQALQEKGGGEDFEIVFVSNDRDQSSFESYFGTMPWL  295

Query  455  AVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKE  634
            A+PF D   R  L   F V+ IP L+I+   GK  T+ G +++  +   AYPFT  +V+ 
Sbjct  296  ALPFRDPTART-LAKYFDVQWIPCLIIIGPDGKTVTKQGRNLINLYQENAYPFTDAKVES  354

Query  635  I-KDAEEA  655
            + K+ EEA
Sbjct  355  LEKEMEEA  362



>gb|KCW68002.1| hypothetical protein EUGRSUZ_F01693 [Eucalyptus grandis]
Length=489

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 110/177 (62%), Gaps = 4/177 (2%)
 Frame = +2

Query  200  SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL-LPKG  376
            S+L S DRD+L+  +G QV V DL+G  +G+YFSA+W  PC  F   L+  Y +L   + 
Sbjct  97   SLLASKDRDYLLSPTGSQVTVSDLEGHVVGLYFSANWYSPCRNFNCVLSEAYEQLKTNQS  156

Query  377  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKV  556
             FEVVFVSADED  +F  Y   MPW A+PFSD  +++ L   F V GIP LVIL   G  
Sbjct  157  KFEVVFVSADEDLSAFNSYHSSMPWLAIPFSDLESKKALSRRFDVEGIPCLVILQPDGNK  216

Query  557  TTE---DGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVIA  718
              E   +GV+++  +GVEA+PFT ER++E++  E+     Q+  ++L S  RD+++ 
Sbjct  217  EEEILRNGVELIHRYGVEAFPFTRERLEELEREEKEKHENQTFTSLLSSHDRDFLLG  273


 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 91/158 (58%), Gaps = 16/158 (10%)
 Frame = +2

Query  200  SILCSSDRDFLIRNSGH-----QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  364
            S+L S DRDFL+   GH     QV V  L GK +G++FSA WC P  +FTP L ++Y ++
Sbjct  261  SLLSSHDRDFLL---GHHPVTGQVPVASLVGKTLGLFFSAQWCLPGMKFTPKLVSIYQKI  317

Query  365  ------LPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  523
                   P   +FE+V+VS+D D  SF  YF  +PW A+PF D   R  L   F V+ IP
Sbjct  318  KHAISERPGAEDFEIVYVSSDRDRASFDSYFALIPWLALPFGDPKIRT-LARHFDVQDIP  376

Query  524  HLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKEI  637
             LV+L   GK  T+ G  ++  +  +AYPFT  R++ +
Sbjct  377  CLVVLGPDGKTVTKHGRSLINLYQEQAYPFTEARLESL  414



>gb|KJB58048.1| hypothetical protein B456_009G191800 [Gossypium raimondii]
Length=430

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 108/175 (62%), Gaps = 9/175 (5%)
 Frame = +2

Query  218  DRDFLIRNSG-----HQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-N  379
            DRD+L+ ++       QVK+ DL+GK IGIYFSA+W  PC  F   L  VY +L   G N
Sbjct  39   DRDYLLCSTAAAAETDQVKISDLEGKVIGIYFSANWYPPCRNFNRVLIGVYEQLKSNGSN  98

Query  380  FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKV-  556
            FE+VFVS+DED ++F  Y   MPW ++PFSD  T++ L+  + V  IP LVIL       
Sbjct  99   FEIVFVSSDEDLDAFNSYRENMPWLSIPFSDLETKKALNRKYDVESIPCLVILQPDNTKD  158

Query  557  --TTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
              T  DGV+++  +GV+A+PFT E++ E++  E+     Q++  +L +  RDY++
Sbjct  159  DDTYYDGVELIYRYGVDAFPFTKEKLDELRREEKRKHDSQTVTNLLTNPERDYLL  213


 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 112/188 (60%), Gaps = 12/188 (6%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNS-GHQVKVDDLKGKKIGIY  295
            F F+K K +E +     ++  D+  + ++L + +RD+L+  +   +V VD LKGK +G+Y
Sbjct  177  FPFTKEKLDELRREE--KRKHDSQTVTNLLTNPERDYLLDQTITRKVPVDSLKGKTVGLY  234

Query  296  FSASWCGPCHRFTPNLATVYNE----LLPKG---NFEVVFVSADEDEESFKEYFGKMPWT  454
             SA WC PC  FTP L ++Y +    L  KG   +FE+VFVS D D+ SF+ YFG MPW 
Sbjct  235  LSAQWCMPCVEFTPKLISIYQKIKQALQEKGGGEDFEIVFVSNDRDQSSFESYFGTMPWL  294

Query  455  AVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKE  634
            A+PF D   R  L   F V+ IP L+I+   GK  T+ G +++  +   AYPFT  +V+ 
Sbjct  295  ALPFRDPTAR-TLAKYFDVQWIPCLIIIGPDGKTVTKQGRNLINLYQENAYPFTDAKVES  353

Query  635  I-KDAEEA  655
            + K+ EEA
Sbjct  354  LEKEMEEA  361



>gb|KJB58046.1| hypothetical protein B456_009G191800 [Gossypium raimondii]
Length=478

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 108/175 (62%), Gaps = 9/175 (5%)
 Frame = +2

Query  218  DRDFLIRNSG-----HQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-N  379
            DRD+L+ ++       QVK+ DL+GK IGIYFSA+W  PC  F   L  VY +L   G N
Sbjct  39   DRDYLLCSTAAAAETDQVKISDLEGKVIGIYFSANWYPPCRNFNRVLIGVYEQLKSNGSN  98

Query  380  FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKV-  556
            FE+VFVS+DED ++F  Y   MPW ++PFSD  T++ L+  + V  IP LVIL       
Sbjct  99   FEIVFVSSDEDLDAFNSYRENMPWLSIPFSDLETKKALNRKYDVESIPCLVILQPDNTKD  158

Query  557  --TTEDGVDIVLEHGVEAYPFTLERVKEIKDAEEAT*REQSLKTVLVSTSRDYVI  715
              T  DGV+++  +GV+A+PFT E++ E++  E+     Q++  +L +  RDY++
Sbjct  159  DDTYYDGVELIYRYGVDAFPFTKEKLDELRREEKRKHDSQTVTNLLTNPERDYLL  213


 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 112/188 (60%), Gaps = 12/188 (6%)
 Frame = +2

Query  119  FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNS-GHQVKVDDLKGKKIGIY  295
            F F+K K +E +     ++  D+  + ++L + +RD+L+  +   +V VD LKGK +G+Y
Sbjct  177  FPFTKEKLDELRREE--KRKHDSQTVTNLLTNPERDYLLDQTITRKVPVDSLKGKTVGLY  234

Query  296  FSASWCGPCHRFTPNLATVYNE----LLPKG---NFEVVFVSADEDEESFKEYFGKMPWT  454
             SA WC PC  FTP L ++Y +    L  KG   +FE+VFVS D D+ SF+ YFG MPW 
Sbjct  235  LSAQWCMPCVEFTPKLISIYQKIKQALQEKGGGEDFEIVFVSNDRDQSSFESYFGTMPWL  294

Query  455  AVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPFTLERVKE  634
            A+PF D   R  L   F V+ IP L+I+   GK  T+ G +++  +   AYPFT  +V+ 
Sbjct  295  ALPFRDPTART-LAKYFDVQWIPCLIIIGPDGKTVTKQGRNLINLYQENAYPFTDAKVES  353

Query  635  I-KDAEEA  655
            + K+ EEA
Sbjct  354  LEKEMEEA  361



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1323106870870