BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10039

Length=783
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009613006.1|  PREDICTED: uncharacterized protein LOC104106214    283   4e-86   Nicotiana tomentosiformis
ref|XP_004236786.1|  PREDICTED: uncharacterized protein LOC101247514    280   4e-85   Solanum lycopersicum
ref|XP_002309914.2|  SWIM zinc finger family protein                    280   7e-85   
ref|XP_010090843.1|  hypothetical protein L484_020702                   264   4e-84   
ref|XP_009781835.1|  PREDICTED: uncharacterized protein LOC104230671    277   6e-84   Nicotiana sylvestris
ref|XP_006361419.1|  PREDICTED: uncharacterized protein LOC102587868    276   2e-83   Solanum tuberosum [potatoes]
ref|XP_011022940.1|  PREDICTED: uncharacterized protein LOC105124571    276   2e-83   Populus euphratica
ref|XP_009348880.1|  PREDICTED: uncharacterized protein LOC103940490    271   6e-82   Pyrus x bretschneideri [bai li]
ref|XP_003552176.1|  PREDICTED: uncharacterized protein LOC100776331    271   1e-81   
ref|XP_006432214.1|  hypothetical protein CICLE_v10000430mg             270   2e-81   
ref|XP_008242047.1|  PREDICTED: uncharacterized protein LOC103340404    270   3e-81   Prunus mume [ume]
gb|KHN13990.1|  hypothetical protein glysoja_025007                     269   4e-81   Glycine soja [wild soybean]
ref|XP_007204630.1|  hypothetical protein PRUPE_ppa002073mg             269   4e-81   Prunus persica
gb|KHN17186.1|  hypothetical protein glysoja_010645                     269   4e-81   Glycine soja [wild soybean]
emb|CDP09645.1|  unnamed protein product                                268   1e-80   Coffea canephora [robusta coffee]
ref|XP_008351508.1|  PREDICTED: uncharacterized protein LOC103414930    268   2e-80   
ref|XP_008391981.1|  PREDICTED: uncharacterized protein LOC103454170    268   2e-80   
ref|XP_008360601.1|  PREDICTED: uncharacterized protein LOC103424292    268   2e-80   
ref|XP_006596000.1|  PREDICTED: uncharacterized protein LOC100809...    268   2e-80   Glycine max [soybeans]
gb|KDO50309.1|  hypothetical protein CISIN_1g005059mg                   266   1e-79   Citrus sinensis [apfelsine]
emb|CAN60858.1|  hypothetical protein VITISV_039453                     263   6e-79   Vitis vinifera
ref|XP_011099737.1|  PREDICTED: uncharacterized protein LOC105178078    263   6e-79   Sesamum indicum [beniseed]
emb|CAN76964.1|  hypothetical protein VITISV_043960                     263   6e-79   Vitis vinifera
ref|XP_007133525.1|  hypothetical protein PHAVU_011G186500g             263   6e-79   Phaseolus vulgaris [French bean]
ref|XP_002274170.1|  PREDICTED: uncharacterized protein LOC100247174    263   7e-79   Vitis vinifera
ref|XP_002518981.1|  conserved hypothetical protein                     262   3e-78   Ricinus communis
ref|XP_007040728.1|  SWIM zinc finger family protein                    259   3e-77   
gb|KDP32636.1|  hypothetical protein JCGZ_13186                         258   7e-77   Jatropha curcas
ref|XP_012078506.1|  PREDICTED: uncharacterized protein LOC105639150    258   7e-77   Jatropha curcas
ref|XP_010255617.1|  PREDICTED: uncharacterized protein LOC104596236    258   9e-77   Nelumbo nucifera [Indian lotus]
ref|XP_008441058.1|  PREDICTED: uncharacterized protein LOC103485285    257   2e-76   Cucumis melo [Oriental melon]
ref|XP_004148660.1|  PREDICTED: uncharacterized protein LOC101204643    256   7e-76   Cucumis sativus [cucumbers]
gb|KJB51581.1|  hypothetical protein B456_008G223400                    255   8e-76   Gossypium raimondii
gb|AET02590.2|  SWIM zinc finger protein                                254   2e-75   Medicago truncatula
ref|XP_003628114.1|  hypothetical protein MTR_8g043760                  254   3e-75   
ref|XP_003628100.1|  hypothetical protein MTR_8g043530                  254   5e-75   
ref|XP_004511186.1|  PREDICTED: uncharacterized protein LOC101498464    254   1e-74   
gb|EYU23749.1|  hypothetical protein MIMGU_mgv1a002058mg                249   1e-73   Erythranthe guttata [common monkey flower]
ref|XP_004287787.1|  PREDICTED: uncharacterized protein LOC101292541    249   2e-73   Fragaria vesca subsp. vesca
ref|XP_010027651.1|  PREDICTED: uncharacterized protein LOC104418118    247   9e-73   Eucalyptus grandis [rose gum]
ref|XP_010921228.1|  PREDICTED: uncharacterized protein LOC105044872    241   1e-70   Elaeis guineensis
ref|XP_008787735.1|  PREDICTED: uncharacterized protein LOC103705694    239   1e-69   Phoenix dactylifera
ref|XP_009383179.1|  PREDICTED: uncharacterized protein LOC103970968    239   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAB71951.1|  Hypothetical Protein                                    230   6e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010542310.1|  PREDICTED: uncharacterized protein LOC104815571    231   7e-67   Tarenaya hassleriana [spider flower]
ref|NP_176256.2|  SWIM zinc finger domain-containing protein            230   1e-66   Arabidopsis thaliana [mouse-ear cress]
gb|KJB21169.1|  hypothetical protein B456_003G185900                    227   2e-65   Gossypium raimondii
emb|CDY34123.1|  BnaC01g28630D                                          226   5e-65   Brassica napus [oilseed rape]
ref|XP_006300800.1|  hypothetical protein CARUB_v10019879mg             225   1e-64   Capsella rubella
ref|XP_002886608.1|  predicted protein                                  225   2e-64   Arabidopsis lyrata subsp. lyrata
ref|XP_010510937.1|  PREDICTED: uncharacterized protein LOC104787...    224   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010674758.1|  PREDICTED: uncharacterized protein LOC104890846    224   3e-64   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY24539.1|  BnaA01g22430D                                          224   3e-64   Brassica napus [oilseed rape]
ref|XP_009103823.1|  PREDICTED: uncharacterized protein LOC103829887    224   3e-64   Brassica rapa
ref|XP_006392152.1|  hypothetical protein EUTSA_v10023307mg             223   5e-64   Eutrema salsugineum [saltwater cress]
ref|XP_010473234.1|  PREDICTED: uncharacterized protein LOC104752724    223   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010417988.1|  PREDICTED: uncharacterized protein LOC104703...    222   2e-63   Camelina sativa [gold-of-pleasure]
gb|KFK40773.1|  hypothetical protein AALP_AA2G039200                    220   3e-63   Arabis alpina [alpine rockcress]
gb|KFK40774.1|  hypothetical protein AALP_AA2G039200                    221   4e-63   Arabis alpina [alpine rockcress]
ref|NP_001169995.1|  uncharacterized protein LOC100383900               209   3e-61   
ref|NP_001062830.1|  Os09g0309100                                       215   8e-61   
gb|EEC84321.1|  hypothetical protein OsI_30820                          215   1e-60   Oryza sativa Indica Group [Indian rice]
gb|AES96430.2|  zinc ion-binding protein                                213   3e-60   Medicago truncatula
ref|XP_003613472.1|  hypothetical protein MTR_5g037070                  213   4e-60   
ref|XP_002466103.1|  hypothetical protein SORBIDRAFT_01g001310          211   1e-59   Sorghum bicolor [broomcorn]
ref|XP_006840321.1|  PREDICTED: uncharacterized protein LOC184300...    211   3e-59   Amborella trichopoda
ref|XP_004968166.1|  PREDICTED: uncharacterized protein LOC101763681    211   3e-59   Setaria italica
ref|XP_008644121.1|  PREDICTED: uncharacterized protein LOC100383...    210   5e-59   
ref|XP_006660525.1|  PREDICTED: uncharacterized protein LOC102707611    208   4e-58   Oryza brachyantha
ref|XP_003576405.1|  PREDICTED: uncharacterized protein LOC100828723    202   3e-56   Brachypodium distachyon [annual false brome]
dbj|BAK04195.1|  predicted protein                                      196   5e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO50310.1|  hypothetical protein CISIN_1g005059mg                   187   5e-51   Citrus sinensis [apfelsine]
ref|XP_003628102.1|  Cellulose synthase                                 179   2e-49   
gb|EMT08273.1|  hypothetical protein F775_06016                         152   2e-38   
gb|EPS61942.1|  hypothetical protein M569_12851                         142   8e-35   Genlisea aurea
ref|XP_007013719.1|  SWIM zinc finger family protein isoform 3          134   2e-32   
ref|XP_010648578.1|  PREDICTED: uncharacterized protein LOC100245...    134   3e-32   Vitis vinifera
ref|XP_007013717.1|  SWIM zinc finger family protein isoform 1          134   5e-32   
ref|XP_007013718.1|  SWIM zinc finger family protein isoform 2          134   6e-32   
gb|KHG17737.1|  Arrestin-C                                              134   6e-32   Gossypium arboreum [tree cotton]
gb|KJB64570.1|  hypothetical protein B456_010G054400                    134   9e-32   Gossypium raimondii
ref|XP_002281999.2|  PREDICTED: uncharacterized protein LOC100245...    133   1e-31   Vitis vinifera
ref|XP_004292961.2|  PREDICTED: uncharacterized protein LOC101313282    133   1e-31   Fragaria vesca subsp. vesca
ref|XP_006578182.1|  PREDICTED: uncharacterized protein LOC100779025    133   1e-31   Glycine max [soybeans]
gb|KHN10289.1|  hypothetical protein glysoja_017893                     133   2e-31   Glycine soja [wild soybean]
ref|XP_006842250.2|  PREDICTED: uncharacterized protein LOC18432077     132   2e-31   
gb|ERN03925.1|  hypothetical protein AMTR_s00078p00196690               132   3e-31   Amborella trichopoda
ref|XP_011019706.1|  PREDICTED: uncharacterized protein LOC105122...    129   1e-30   Populus euphratica
ref|XP_011019704.1|  PREDICTED: uncharacterized protein LOC105122...    130   2e-30   Populus euphratica
ref|XP_011019705.1|  PREDICTED: uncharacterized protein LOC105122...    129   2e-30   Populus euphratica
ref|XP_007224640.1|  hypothetical protein PRUPE_ppa026389mg             128   6e-30   
ref|XP_010095498.1|  hypothetical protein L484_014926                   128   6e-30   
ref|XP_006476176.1|  PREDICTED: uncharacterized protein LOC102625...    128   1e-29   Citrus sinensis [apfelsine]
gb|KDO79654.1|  hypothetical protein CISIN_1g039513mg                   127   1e-29   Citrus sinensis [apfelsine]
ref|XP_006450581.1|  hypothetical protein CICLE_v10010703mg             127   1e-29   Citrus clementina [clementine]
ref|XP_012065273.1|  PREDICTED: uncharacterized protein LOC105628473    127   1e-29   
gb|KDP43797.1|  hypothetical protein JCGZ_23005                         127   1e-29   Jatropha curcas
ref|XP_010249825.1|  PREDICTED: uncharacterized protein LOC104592...    127   1e-29   Nelumbo nucifera [Indian lotus]
ref|XP_010249820.1|  PREDICTED: uncharacterized protein LOC104592...    127   2e-29   Nelumbo nucifera [Indian lotus]
ref|XP_008219841.1|  PREDICTED: uncharacterized protein LOC103320013    127   2e-29   Prunus mume [ume]
gb|EYU21901.1|  hypothetical protein MIMGU_mgv1a023458mg                126   4e-29   Erythranthe guttata [common monkey flower]
ref|XP_010049050.1|  PREDICTED: uncharacterized protein LOC104437...    124   2e-28   Eucalyptus grandis [rose gum]
ref|XP_010049049.1|  PREDICTED: uncharacterized protein LOC104437...    124   2e-28   Eucalyptus grandis [rose gum]
gb|EYU24925.1|  hypothetical protein MIMGU_mgv1a022371mg                121   2e-28   Erythranthe guttata [common monkey flower]
ref|XP_007137090.1|  hypothetical protein PHAVU_009G098900g             123   4e-28   Phaseolus vulgaris [French bean]
ref|XP_004501270.1|  PREDICTED: uncharacterized protein LOC101505...    123   5e-28   
ref|XP_011081862.1|  PREDICTED: uncharacterized protein LOC105164...    122   5e-28   Sesamum indicum [beniseed]
ref|XP_011081859.1|  PREDICTED: uncharacterized protein LOC105164...    122   1e-27   Sesamum indicum [beniseed]
ref|XP_009377375.1|  PREDICTED: uncharacterized protein LOC103965988    120   5e-27   Pyrus x bretschneideri [bai li]
ref|XP_002516601.1|  conserved hypothetical protein                     120   6e-27   
ref|XP_008378289.1|  PREDICTED: uncharacterized protein LOC103441391    119   8e-27   
ref|XP_002271166.1|  PREDICTED: uncharacterized protein LOC100264354    117   1e-25   Vitis vinifera
emb|CBI29086.3|  unnamed protein product                                117   1e-25   Vitis vinifera
gb|KHN38118.1|  hypothetical protein glysoja_007160                     111   4e-25   Glycine soja [wild soybean]
ref|XP_011652504.1|  PREDICTED: uncharacterized protein LOC101215653    112   3e-24   Cucumis sativus [cucumbers]
ref|XP_008466356.1|  PREDICTED: uncharacterized protein LOC103503...    112   4e-24   
ref|XP_008466358.1|  PREDICTED: uncharacterized protein LOC103503...    112   4e-24   
ref|XP_010269623.1|  PREDICTED: uncharacterized protein LOC104606193    111   1e-23   Nelumbo nucifera [Indian lotus]
ref|XP_006375222.1|  hypothetical protein POPTR_0014s05410g             109   6e-23   
ref|XP_006375216.1|  hypothetical protein POPTR_0014s05360g             108   8e-23   
ref|XP_011032909.1|  PREDICTED: uncharacterized protein LOC105131568    108   1e-22   Populus euphratica
ref|XP_002528170.1|  conserved hypothetical protein                     107   1e-22   Ricinus communis
ref|XP_008232361.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    105   1e-21   
ref|XP_010921093.1|  PREDICTED: uncharacterized protein LOC105044782    105   1e-21   Elaeis guineensis
ref|XP_007203395.1|  hypothetical protein PRUPE_ppa021037mg             104   2e-21   
ref|XP_008445298.1|  PREDICTED: uncharacterized protein LOC103488...    103   3e-21   Cucumis melo [Oriental melon]
ref|XP_008445258.1|  PREDICTED: uncharacterized protein LOC103488...    103   3e-21   
ref|XP_008445306.1|  PREDICTED: uncharacterized protein LOC103488...    103   3e-21   Cucumis melo [Oriental melon]
ref|XP_008782616.1|  PREDICTED: uncharacterized protein LOC103702098    103   4e-21   Phoenix dactylifera
gb|KHG00863.1|  CUE domain-containing 5                                 102   1e-20   Gossypium arboreum [tree cotton]
gb|KJB22894.1|  hypothetical protein B456_004G072100                    102   1e-20   Gossypium raimondii
ref|XP_004295012.1|  PREDICTED: uncharacterized protein LOC101310972    102   1e-20   Fragaria vesca subsp. vesca
ref|XP_004135549.1|  PREDICTED: uncharacterized protein LOC101211068    101   2e-20   Cucumis sativus [cucumbers]
ref|XP_009406639.1|  PREDICTED: uncharacterized protein LOC103989501    102   2e-20   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP15763.1|  unnamed protein product                                100   2e-20   Coffea canephora [robusta coffee]
ref|XP_002309581.2|  hypothetical protein POPTR_0006s26200g             100   3e-20   
ref|XP_006858725.1|  PREDICTED: uncharacterized protein LOC18448602     100   5e-20   Amborella trichopoda
ref|XP_009349923.1|  PREDICTED: uncharacterized protein LOC103941455  98.2    2e-19   Pyrus x bretschneideri [bai li]
ref|XP_010053257.1|  PREDICTED: uncharacterized protein LOC104441745  98.2    3e-19   Eucalyptus grandis [rose gum]
dbj|BAF01455.1|  hypothetical protein                                 97.1    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193133.3|  zinc ion binding protein                            97.1    5e-19   Arabidopsis thaliana [mouse-ear cress]
gb|EYU37722.1|  hypothetical protein MIMGU_mgv1a023319mg              96.7    6e-19   Erythranthe guttata [common monkey flower]
ref|XP_011088310.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  97.1    7e-19   
ref|XP_010108923.1|  hypothetical protein L484_027118                 94.4    1e-18   
ref|XP_004245794.1|  PREDICTED: uncharacterized protein LOC101264658  95.5    2e-18   Solanum lycopersicum
ref|XP_007146127.1|  hypothetical protein PHAVU_006G014600g           95.9    2e-18   Phaseolus vulgaris [French bean]
ref|XP_008670947.1|  PREDICTED: uncharacterized protein LOC103648233  95.5    2e-18   Zea mays [maize]
ref|XP_007052246.1|  Zinc ion binding protein isoform 1               95.9    2e-18   
ref|XP_007052247.1|  Zinc ion binding protein isoform 2               95.5    2e-18   
ref|XP_007138737.1|  hypothetical protein PHAVU_009G233100g           94.0    6e-18   Phaseolus vulgaris [French bean]
ref|XP_008381415.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  93.6    8e-18   
ref|XP_012083677.1|  PREDICTED: uncharacterized protein LOC105643205  92.8    2e-17   Jatropha curcas
ref|XP_010450143.1|  PREDICTED: uncharacterized protein LOC104732307  92.0    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002461610.1|  hypothetical protein SORBIDRAFT_02g005340        91.7    4e-17   Sorghum bicolor [broomcorn]
ref|XP_006359246.1|  PREDICTED: uncharacterized protein LOC102601...  91.3    4e-17   Solanum tuberosum [potatoes]
ref|XP_010540374.1|  PREDICTED: uncharacterized protein LOC104814172  91.3    4e-17   Tarenaya hassleriana [spider flower]
ref|XP_006414836.1|  hypothetical protein EUTSA_v10024472mg           90.5    8e-17   Eutrema salsugineum [saltwater cress]
ref|XP_009139573.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  89.7    1e-16   Brassica rapa
ref|XP_006283161.1|  hypothetical protein CARUB_v10004191mg           89.7    1e-16   Capsella rubella
emb|CDY01179.1|  BnaA04g06400D                                        89.7    1e-16   
ref|XP_002868324.1|  zinc ion binding protein                         89.0    2e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_006445380.1|  hypothetical protein CICLE_v10018658mg           89.0    3e-16   
ref|XP_004513230.1|  PREDICTED: uncharacterized protein LOC101502422  88.2    4e-16   Cicer arietinum [garbanzo]
dbj|BAK03605.1|  predicted protein                                    88.2    4e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003566605.1|  PREDICTED: uncharacterized protein LOC100828484  88.6    4e-16   Brachypodium distachyon [annual false brome]
ref|XP_010692100.1|  PREDICTED: uncharacterized protein LOC104905308  87.4    8e-16   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY50427.1|  BnaCnng19360D                                        86.7    1e-15   Brassica napus [oilseed rape]
ref|XP_010450122.1|  PREDICTED: uncharacterized protein LOC104732283  86.3    2e-15   Camelina sativa [gold-of-pleasure]
gb|EMT07282.1|  hypothetical protein F775_09518                       85.5    3e-15   
ref|XP_009790578.1|  PREDICTED: uncharacterized protein LOC104238021  85.1    5e-15   Nicotiana sylvestris
ref|XP_003528591.1|  PREDICTED: uncharacterized protein LOC100819...  84.7    7e-15   Glycine max [soybeans]
gb|EMS58193.1|  hypothetical protein TRIUR3_12822                     84.3    8e-15   Triticum urartu
ref|NP_001059218.1|  Os07g0227700                                     82.4    3e-14   
dbj|BAC84431.1|  hypothetical protein                                 82.0    4e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81754.1|  hypothetical protein OsI_25420                        82.0    4e-14   Oryza sativa Indica Group [Indian rice]
gb|AES89835.2|  zinc ion-binding protein                              81.3    7e-14   Medicago truncatula
ref|XP_003607638.1|  hypothetical protein MTR_4g080580                81.3    8e-14   
ref|XP_009605496.1|  PREDICTED: uncharacterized protein LOC104100042  80.1    2e-13   Nicotiana tomentosiformis
ref|XP_002301246.2|  hypothetical protein POPTR_0002s14170g           79.7    2e-13   
gb|KHN10140.1|  hypothetical protein glysoja_023721                   72.0    4e-12   Glycine soja [wild soybean]
gb|ERM94292.1|  hypothetical protein AMTR_s00010p00231990             66.6    4e-09   Amborella trichopoda
ref|XP_011622982.1|  PREDICTED: uncharacterized protein LOC18422177   66.6    4e-09   
emb|CAB10176.1|  hypothetical protein                                 65.1    1e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KHN16480.1|  hypothetical protein glysoja_036582                   57.4    4e-06   Glycine soja [wild soybean]
gb|EMS61136.1|  hypothetical protein TRIUR3_35179                     57.0    6e-06   Triticum urartu
ref|XP_003603488.1|  hypothetical protein MTR_3g108220                53.9    7e-05   
gb|AES73739.2|  zinc ion-binding protein                              53.9    7e-05   Medicago truncatula



>ref|XP_009613006.1| PREDICTED: uncharacterized protein LOC104106214 [Nicotiana tomentosiformis]
Length=718

 Score =   283 bits (723),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 172/199 (86%), Gaps = 4/199 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEYIA+TSW+RALQIPD AV+ +S+  S   FAKVLSQKD
Sbjct  511  HSSYWLDRYADESDSFQNVKEEYIATTSWHRALQIPDDAVTLDSKDNS---FAKVLSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            ++ T LVWNPGSEFAHCDCEWSMQGN+CKH+IKVNMICG++Q  R SMSFQSF E+L++L
Sbjct  568  SSKTHLVWNPGSEFAHCDCEWSMQGNMCKHIIKVNMICGNLQSCRPSMSFQSFNEVLVSL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KP+DDS+ALDLSTAWT QMLDQI+ LVELN S++IG IVNNMPLRW+++K RTS G+P
Sbjct  628  TRKPVDDSMALDLSTAWTHQMLDQIRKLVELNQSHDIGTIVNNMPLRWVAKKGRTSVGRP  687

Query  241  TSALTLPPSSQSGAINSTA  185
             SA+ LP S+ +  I STA
Sbjct  688  -SAIALPSSANNSLICSTA  705



>ref|XP_004236786.1| PREDICTED: uncharacterized protein LOC101247514 [Solanum lycopersicum]
Length=719

 Score =   280 bits (716),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 162/187 (87%), Gaps = 3/187 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVK EYIA+TSW RALQIPDAAV+ + +  S   FAKVLSQKD
Sbjct  511  HSSYWLDRYADESDSFQNVKAEYIATTSWNRALQIPDAAVTLDCKNNS---FAKVLSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            + + RLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICG++Q +R SMSFQSF EIL +L
Sbjct  568  STIARLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGNLQSYRPSMSFQSFNEILDSL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             KKP+DDS+ALDLSTAWT QMLDQI+ LVELN +NNIG IVNNMPLRW+++K RTS G+P
Sbjct  628  SKKPVDDSIALDLSTAWTHQMLDQIRKLVELNQANNIGTIVNNMPLRWVAKKGRTSVGRP  687

Query  241  TSALTLP  221
            ++   LP
Sbjct  688  STLALLP  694



>ref|XP_002309914.2| SWIM zinc finger family protein [Populus trichocarpa]
 gb|EEE90364.2| SWIM zinc finger family protein [Populus trichocarpa]
Length=727

 Score =   280 bits (715),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 169/199 (85%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEYIASTSW+RALQIP+++V+ + +    H FAKV SQKD
Sbjct  518  HSSYWLDRYADESDSFQNVKEEYIASTSWHRALQIPNSSVTVDDKD---HLFAKVSSQKD  574

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            NNVTR+VWNPGSEFA CDC WS+QGNLCKHVIKVNMIC + +G++ SMSF++F+E+L +L
Sbjct  575  NNVTRIVWNPGSEFAFCDCAWSLQGNLCKHVIKVNMICENREGYQPSMSFRAFKELLTSL  634

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             KKPMDDSV LDLS AW  QMLDQI++LVEL+SS  IG +VNNMPL+W+S+K RTS G P
Sbjct  635  WKKPMDDSVGLDLSIAWAHQMLDQIKHLVELDSSKTIGTVVNNMPLKWVSKKGRTSIGIP  694

Query  241  TSALTLPPSSQSGAINSTA  185
            +S L LP SS+SG+ N+ A
Sbjct  695  SSVLALPSSSKSGSNNAVA  713



>ref|XP_010090843.1| hypothetical protein L484_020702 [Morus notabilis]
 gb|EXB40968.1| hypothetical protein L484_020702 [Morus notabilis]
Length=263

 Score =   264 bits (675),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 159/190 (84%), Gaps = 3/190 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQN+KEEY+ASTSW+RALQIPD+AV+ +   ++   FAKVLSQKD
Sbjct  55   HSSYWLDRYADESDSFQNIKEEYVASTSWHRALQIPDSAVTLD---ENARLFAKVLSQKD  111

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            + +TRLVWNPGSEFA CDC WS+QGNLCKHVIKVNMIC + Q  + SMSFQSF+EILMNL
Sbjct  112  SGITRLVWNPGSEFAFCDCAWSLQGNLCKHVIKVNMICQNKQDSQPSMSFQSFKEILMNL  171

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KPM+DSV +DLS AWT QM+DQIQ LVELN S +IG IV+++PLRW+S+K RT  G+P
Sbjct  172  WRKPMEDSVGMDLSMAWTHQMVDQIQKLVELNGSKDIGKIVSDLPLRWVSKKGRTHVGRP  231

Query  241  TSALTLPPSS  212
            ++   L  SS
Sbjct  232  STIGVLSSSS  241



>ref|XP_009781835.1| PREDICTED: uncharacterized protein LOC104230671 [Nicotiana sylvestris]
Length=718

 Score =   277 bits (708),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 170/199 (85%), Gaps = 4/199 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEYIA+TSW+RALQIPD +V+ +++  S   FAKVLSQKD
Sbjct  511  HSSYWLDRYADESDSFQNVKEEYIATTSWHRALQIPDDSVTLDNKDNS---FAKVLSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            N+ T LVWNPGSEFAHCDCEWSMQGN+CKH+IKVNMI G +Q  R SMSFQSF E+L++L
Sbjct  568  NSKTHLVWNPGSEFAHCDCEWSMQGNMCKHIIKVNMISGKLQSCRPSMSFQSFNEVLVSL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KP+DDS+ALDLSTAWT QMLDQI+ LVELN S++IG IVNNMP+RW+++K RTS G+P
Sbjct  628  TRKPVDDSMALDLSTAWTHQMLDQIRKLVELNQSHDIGTIVNNMPVRWVAKKGRTSVGRP  687

Query  241  TSALTLPPSSQSGAINSTA  185
             SA+ LP S+ +  I STA
Sbjct  688  -SAIALPSSANNSLICSTA  705



>ref|XP_006361419.1| PREDICTED: uncharacterized protein LOC102587868 [Solanum tuberosum]
Length=719

 Score =   276 bits (705),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 161/187 (86%), Gaps = 3/187 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVK EYIA+TSW RALQIPDA+V+ + +  S   FAKVLSQKD
Sbjct  511  HSSYWLDRYADESDSFQNVKAEYIATTSWNRALQIPDASVTLDCKDSS---FAKVLSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            + + RLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICG++Q ++ SMSFQSF EIL +L
Sbjct  568  STIARLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGNLQSYQPSMSFQSFNEILDSL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             KKP DDS+ALDLSTAWT QMLDQI+ LVELN +NNIG IVNNMPLRW+++K RTS G+P
Sbjct  628  SKKPADDSIALDLSTAWTHQMLDQIRKLVELNQANNIGTIVNNMPLRWVAKKGRTSVGRP  687

Query  241  TSALTLP  221
            ++   LP
Sbjct  688  STLALLP  694



>ref|XP_011022940.1| PREDICTED: uncharacterized protein LOC105124571 [Populus euphratica]
Length=720

 Score =   276 bits (705),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 167/199 (84%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEYIASTSW+RALQIP+++V+ + +    H FA+V SQKD
Sbjct  511  HSSYWLDRYADESDSFQNVKEEYIASTSWHRALQIPNSSVTVDDKD---HLFARVSSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            NNVT +VWNPGSEFA CDC WS+QGNLCKHVIKVNMIC + +G++ SMSF++F+E+L +L
Sbjct  568  NNVTHIVWNPGSEFAFCDCAWSLQGNLCKHVIKVNMICENGEGYQPSMSFRAFKELLTSL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             KKPMDDSV LDLS AW  QMLDQI+ LVEL+SS  IG +VNNMPL+W+S+K RTS G P
Sbjct  628  WKKPMDDSVGLDLSIAWAHQMLDQIKQLVELDSSKTIGTVVNNMPLKWVSKKGRTSIGIP  687

Query  241  TSALTLPPSSQSGAINSTA  185
            +S L LP SS+SG+ N+ A
Sbjct  688  SSVLALPSSSKSGSNNAVA  706



>ref|XP_009348880.1| PREDICTED: uncharacterized protein LOC103940490 [Pyrus x bretschneideri]
Length=719

 Score =   271 bits (694),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 161/190 (85%), Gaps = 3/190 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADE D+FQNVKEEYIASTSW+RALQIPD+AVS   +    H FAKVLSQKD
Sbjct  511  HSSYWLDRYADECDAFQNVKEEYIASTSWHRALQIPDSAVSLGDKD---HLFAKVLSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +    LVWNPGSEF+ CDC WSMQGNLCKHVIKVNMIC S QG++ SMS QSF+++LMNL
Sbjct  568  SGTMHLVWNPGSEFSFCDCAWSMQGNLCKHVIKVNMICESRQGYKPSMSSQSFKDVLMNL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
            LKKPMDDS+ALD S AWT QMLDQI+NLVE++S+N+I  +VNN+PL+W+S+K RTS GKP
Sbjct  628  LKKPMDDSIALDHSMAWTMQMLDQIRNLVEVSSANDIRMVVNNLPLQWVSKKGRTSFGKP  687

Query  241  TSALTLPPSS  212
             + LTLP +S
Sbjct  688  LTNLTLPSAS  697



>ref|XP_003552176.1| PREDICTED: uncharacterized protein LOC100776331 [Glycine max]
Length=719

 Score =   271 bits (692),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 163/190 (86%), Gaps = 3/190 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKE+YIASTSW+RALQIPD AVS + +    H FAKV+SQKD
Sbjct  511  HSSYWLDRYADESDSFQNVKEKYIASTSWHRALQIPDYAVSLDDKD---HLFAKVVSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +++T +VWNPGSEFA CDC WSMQGNLCKHV+KVNMIC +++G++ SMSF+SFQE+LM+L
Sbjct  568  SSLTHIVWNPGSEFAFCDCSWSMQGNLCKHVVKVNMICENLKGYQPSMSFRSFQEVLMDL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             KKP+DDS ALDLS AWT QMLDQIQ  VELN+S +IG +VNNMPL+W+S+K RT  GKP
Sbjct  628  WKKPVDDSFALDLSLAWTHQMLDQIQKQVELNNSTDIGTVVNNMPLKWVSKKGRTYIGKP  687

Query  241  TSALTLPPSS  212
            +S+L LP  S
Sbjct  688  SSSLALPHGS  697



>ref|XP_006432214.1| hypothetical protein CICLE_v10000430mg [Citrus clementina]
 ref|XP_006464992.1| PREDICTED: uncharacterized protein LOC102609999 isoform X1 [Citrus 
sinensis]
 ref|XP_006464993.1| PREDICTED: uncharacterized protein LOC102609999 isoform X2 [Citrus 
sinensis]
 ref|XP_006464994.1| PREDICTED: uncharacterized protein LOC102609999 isoform X3 [Citrus 
sinensis]
 ref|XP_006464995.1| PREDICTED: uncharacterized protein LOC102609999 isoform X4 [Citrus 
sinensis]
 ref|XP_006464996.1| PREDICTED: uncharacterized protein LOC102609999 isoform X5 [Citrus 
sinensis]
 gb|ESR45454.1| hypothetical protein CICLE_v10000430mg [Citrus clementina]
Length=716

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 168/196 (86%), Gaps = 3/196 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVK+EYIASTSW+RA+QIP++AV+ + ++   H FA+V SQKD
Sbjct  511  HSSYWLDRYADESDSFQNVKDEYIASTSWHRAMQIPNSAVTLDDKE---HLFARVSSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +++T LVWNPGSEFA CDC WSMQGN+CKHV+KVNMICG+ +G++ SMSFQS +E+LMNL
Sbjct  568  SSLTHLVWNPGSEFAFCDCAWSMQGNICKHVVKVNMICGNNEGYQPSMSFQSLREVLMNL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KPMDDSV LDLS AWT  MLDQI+ LVEL+SS++IG +VNN+PL+W+S+K RTS G P
Sbjct  628  WRKPMDDSVELDLSVAWTHNMLDQIKQLVELSSSDDIGAVVNNLPLKWVSKKGRTSVGIP  687

Query  241  TSALTLPPSSQSGAIN  194
            +S L LP SS+S  ++
Sbjct  688  SSTLALPSSSKSSTVH  703



>ref|XP_008242047.1| PREDICTED: uncharacterized protein LOC103340404 [Prunus mume]
Length=720

 Score =   270 bits (690),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 166/197 (84%), Gaps = 7/197 (4%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADE DSFQNVKEEYIASTSW+RALQIPD+AVS + +    H +AKVLSQKD
Sbjct  511  HSSYWLDRYADECDSFQNVKEEYIASTSWHRALQIPDSAVSLDDKD---HLYAKVLSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            ++   LVWNPGSEF+ CDC WSMQGNLCKH+IKVNMIC S QG++ SMSFQSF+E+LM+L
Sbjct  568  SSTVHLVWNPGSEFSFCDCAWSMQGNLCKHIIKVNMICESRQGYQPSMSFQSFKELLMSL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
            LKKPMDDSVALD S AWT QM DQI+ LVE+ SSN+IG +VNN+PL+W+S+K RT  GKP
Sbjct  628  LKKPMDDSVALDQSMAWTMQMFDQIRKLVEVTSSNDIGTVVNNLPLQWVSKKGRTGVGKP  687

Query  241  TSALTLPPSSQSGAINS  191
            +++L LP    SG+I++
Sbjct  688  STSLALP----SGSIDT  700



>gb|KHN13990.1| hypothetical protein glysoja_025007 [Glycine soja]
Length=719

 Score =   269 bits (688),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 163/190 (86%), Gaps = 3/190 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKE+YIASTSW+RALQIPD AVS + +    H FAKV+SQKD
Sbjct  511  HSSYWLDRYADESDSFQNVKEKYIASTSWHRALQIPDYAVSLDDKD---HLFAKVVSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +++T +VWNPGSEFA CDC WSMQGNLCKHV+KVNMIC +++G++ SMSF+SF+E+LM+L
Sbjct  568  SSLTHIVWNPGSEFAFCDCSWSMQGNLCKHVVKVNMICENLKGYQPSMSFRSFEEVLMDL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             KKP+DDS ALDLS AWT QMLDQIQ  VELN+S +IG +VNNMPL+W+S+K RT  GKP
Sbjct  628  WKKPVDDSFALDLSLAWTHQMLDQIQKQVELNNSTDIGTVVNNMPLKWVSKKGRTYIGKP  687

Query  241  TSALTLPPSS  212
            +S+L LP  S
Sbjct  688  SSSLALPHGS  697



>ref|XP_007204630.1| hypothetical protein PRUPE_ppa002073mg [Prunus persica]
 gb|EMJ05829.1| hypothetical protein PRUPE_ppa002073mg [Prunus persica]
Length=720

 Score =   269 bits (688),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 166/197 (84%), Gaps = 7/197 (4%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADE DSFQNVKEEYIASTSW+RALQIPD+A+S + +    H +AKVLSQKD
Sbjct  511  HSSYWLDRYADECDSFQNVKEEYIASTSWHRALQIPDSAISLDDKD---HLYAKVLSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            ++   LVWNPGSEF+ CDC WSMQGNLCKH+IKVNMIC S QG++ SMSFQSF+E+LM+L
Sbjct  568  SSTVHLVWNPGSEFSFCDCAWSMQGNLCKHIIKVNMICESRQGYQPSMSFQSFKELLMSL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
            LKKPMDDSVALD S AWT QM DQI+ LVE+ SSN+IG +VNN+PL+W+S+K RT  GKP
Sbjct  628  LKKPMDDSVALDQSMAWTMQMFDQIRKLVEVTSSNDIGTVVNNLPLQWVSKKGRTGVGKP  687

Query  241  TSALTLPPSSQSGAINS  191
            +++L LP    SG+I++
Sbjct  688  STSLALP----SGSIDT  700



>gb|KHN17186.1| hypothetical protein glysoja_010645 [Glycine soja]
Length=720

 Score =   269 bits (688),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 163/190 (86%), Gaps = 3/190 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKE+YIASTSW+RALQIPD AVS + +    H FAKV+SQKD
Sbjct  511  HSSYWLDRYADESDSFQNVKEKYIASTSWHRALQIPDYAVSLDDKD---HLFAKVVSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +++T +VWNPGSEFA CDC WSMQGNLCKHV+KVNMIC +++G++ SMSF+SF+E+LM+L
Sbjct  568  SSLTHIVWNPGSEFAFCDCSWSMQGNLCKHVVKVNMICENLKGYQPSMSFRSFEEVLMDL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             KKP+DDS ALDLS AWT QMLDQIQ  VELN+S +IG +VNNMPL+W+S+K RT  GKP
Sbjct  628  WKKPVDDSFALDLSLAWTHQMLDQIQKQVELNNSTDIGTVVNNMPLKWVSKKGRTYIGKP  687

Query  241  TSALTLPPSS  212
            +S+L LP  S
Sbjct  688  SSSLALPHGS  697



>emb|CDP09645.1| unnamed protein product [Coffea canephora]
Length=728

 Score =   268 bits (686),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 164/192 (85%), Gaps = 3/192 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDR+ADESDSFQNVKEEY+ASTSW+RALQIPD AV+ + +    H FAKVLSQ++
Sbjct  522  HSSYWLDRFADESDSFQNVKEEYLASTSWHRALQIPDTAVTLDDKD---HPFAKVLSQRE  578

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +  TR+VWNPGSEF+ CDCEWSMQGNLCKHVIKVNMIC +++ ++ ++SFQSFQ+ILM+L
Sbjct  579  STRTRIVWNPGSEFSLCDCEWSMQGNLCKHVIKVNMICENLRSYQPTLSFQSFQDILMSL  638

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KP+DDS+ALDLSTAW  QMLDQIQ LVELNSS++I  +VNNMPLRW ++K RTS GKP
Sbjct  639  QEKPLDDSIALDLSTAWAHQMLDQIQKLVELNSSDDISTVVNNMPLRWTTKKGRTSCGKP  698

Query  241  TSALTLPPSSQS  206
             + L LP  S++
Sbjct  699  LTTLALPSCSKN  710



>ref|XP_008351508.1| PREDICTED: uncharacterized protein LOC103414930 [Malus domestica]
Length=719

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 160/190 (84%), Gaps = 3/190 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADE D+FQNVKEEYIASTSW+RALQIPD+ VS + +    H FAKVLSQKD
Sbjct  511  HSSYWLDRYADECDAFQNVKEEYIASTSWHRALQIPDSVVSLDDKD---HLFAKVLSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +    LVWNPGSEF+ CDC WS QGNLCKHVIKVNMIC S QG++ SMS QSF+++LMNL
Sbjct  568  SXTMHLVWNPGSEFSFCDCAWSXQGNLCKHVIKVNMICESRQGYQPSMSSQSFKDVLMNL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
            LKKPMDDS+ALD S AWT QMLDQI+NLVE++S+N+I  +VNN+PL+W+S+K RTS GKP
Sbjct  628  LKKPMDDSIALDRSMAWTMQMLDQIRNLVEVSSANDICTVVNNLPLQWVSKKGRTSFGKP  687

Query  241  TSALTLPPSS  212
             + LTLP +S
Sbjct  688  LTNLTLPSAS  697



>ref|XP_008391981.1| PREDICTED: uncharacterized protein LOC103454170 [Malus domestica]
Length=719

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 160/190 (84%), Gaps = 3/190 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADE D+FQNVKEEYIASTSW+RALQIPD+ VS + +    H FAKVLSQKD
Sbjct  511  HSSYWLDRYADECDAFQNVKEEYIASTSWHRALQIPDSVVSLDDKD---HLFAKVLSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +    LVWNPGSEF+ CDC WS QGNLCKHVIKVNMIC S QG++ SMS QSF+++LMNL
Sbjct  568  SXTMHLVWNPGSEFSFCDCAWSXQGNLCKHVIKVNMICESRQGYQPSMSSQSFKDVLMNL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
            LKKPMDDS+ALD S AWT QMLDQI+NLVE++S+N+I  +VNN+PL+W+S+K RTS GKP
Sbjct  628  LKKPMDDSIALDRSMAWTMQMLDQIRNLVEVSSANDICTVVNNLPLQWVSKKGRTSFGKP  687

Query  241  TSALTLPPSS  212
             + LTLP +S
Sbjct  688  LTNLTLPSAS  697



>ref|XP_008360601.1| PREDICTED: uncharacterized protein LOC103424292 [Malus domestica]
Length=719

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 160/190 (84%), Gaps = 3/190 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADE D+FQNVKEEYIASTSW+RALQIPD+ VS + +    H FAKVLSQKD
Sbjct  511  HSSYWLDRYADECDAFQNVKEEYIASTSWHRALQIPDSVVSLDDKD---HLFAKVLSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +    LVWNPGSEF+ CDC WS QGNLCKHVIKVNMIC S QG++ SMS QSF+++LMNL
Sbjct  568  SXTMHLVWNPGSEFSFCDCAWSXQGNLCKHVIKVNMICESRQGYQPSMSSQSFKDVLMNL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
            LKKPMDDS+ALD S AWT QMLDQI+NLVE++S+N+I  +VNN+PL+W+S+K RTS GKP
Sbjct  628  LKKPMDDSIALDRSMAWTMQMLDQIRNLVEVSSANDICTVVNNLPLQWVSKKGRTSFGKP  687

Query  241  TSALTLPPSS  212
             + LTLP +S
Sbjct  688  LTNLTLPSAS  697



>ref|XP_006596000.1| PREDICTED: uncharacterized protein LOC100809744 isoform X1 [Glycine 
max]
 ref|XP_006596001.1| PREDICTED: uncharacterized protein LOC100809744 isoform X2 [Glycine 
max]
 ref|XP_006596002.1| PREDICTED: uncharacterized protein LOC100809744 isoform X3 [Glycine 
max]
Length=720

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 162/190 (85%), Gaps = 3/190 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKE+YIASTSW+RALQIPD AVS + +    H FAKV+SQKD
Sbjct  511  HSSYWLDRYADESDSFQNVKEKYIASTSWHRALQIPDYAVSLDDKD---HLFAKVVSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +++T +VWNPGSEFA CDC WSMQGNLCKHV+KVNMIC +++G++ SMSF SF+E+LM+L
Sbjct  568  SSLTHIVWNPGSEFAFCDCSWSMQGNLCKHVVKVNMICENLKGYQPSMSFWSFEEVLMDL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             KKP+DDS ALDLS AWT QMLDQIQ  VELN+S +IG +VNNMPL+W+S+K RT  GKP
Sbjct  628  WKKPVDDSFALDLSLAWTHQMLDQIQKQVELNNSTDIGTVVNNMPLKWVSKKGRTYIGKP  687

Query  241  TSALTLPPSS  212
            +S+L LP  S
Sbjct  688  SSSLALPHGS  697



>gb|KDO50309.1| hypothetical protein CISIN_1g005059mg [Citrus sinensis]
Length=716

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 165/196 (84%), Gaps = 3/196 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVK+EYIASTSW+RA+QIP++AV+   ++   H FA+V SQKD
Sbjct  511  HSSYWLDRYADESDSFQNVKDEYIASTSWHRAMQIPNSAVTLGDKE---HLFARVSSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +++T LVWNPGSEFA CDC WSMQGN+CKHV+KVNMIC + +G++ SMSFQS +E+LMNL
Sbjct  568  SSLTHLVWNPGSEFAFCDCAWSMQGNICKHVVKVNMICANNEGYQPSMSFQSLREVLMNL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
              KPMDDSV LDLS AWT  MLDQI+ LVEL+SS++IG +VNN+PL+W+S+K RTS G P
Sbjct  628  WTKPMDDSVELDLSVAWTHNMLDQIKQLVELSSSDDIGAVVNNLPLKWVSKKGRTSVGIP  687

Query  241  TSALTLPPSSQSGAIN  194
            +S L LP SS+S  ++
Sbjct  688  SSTLALPSSSKSSTVH  703



>emb|CAN60858.1| hypothetical protein VITISV_039453 [Vitis vinifera]
Length=706

 Score =   263 bits (673),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 157/179 (88%), Gaps = 3/179 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEYIASTSW+RAL+IPD +V  E + Q    FAKVLSQKD
Sbjct  497  HSSYWLDRYADESDSFQNVKEEYIASTSWHRALRIPDTSVILEDKNQL---FAKVLSQKD  553

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +N+T LVWNPGSEFA CDCEW+MQGNLCKH+IKVNMIC + Q ++SSMSFQSF+EILMNL
Sbjct  554  SNLTHLVWNPGSEFAFCDCEWAMQGNLCKHIIKVNMICKNHQAYQSSMSFQSFREILMNL  613

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGK  245
             +KPMDDSVALD + AWT QMLDQIQ LVELNS+N+IG++VNN+PL+W+S+K RT  G+
Sbjct  614  WRKPMDDSVALDQAVAWTHQMLDQIQKLVELNSANDIGSVVNNLPLKWVSKKGRTFVGR  672



>ref|XP_011099737.1| PREDICTED: uncharacterized protein LOC105178078 [Sesamum indicum]
Length=716

 Score =   263 bits (673),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 159/179 (89%), Gaps = 3/179 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSF NVKEEYIASTSW+RALQIPD A+S + R    H FAKV+SQKD
Sbjct  511  HSSYWLDRYADESDSFVNVKEEYIASTSWHRALQIPDNAISLDDRD---HLFAKVVSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            + VTR+VWNPGSEFAHCDCEWS+QGNLCKH+IKVNM+C ++Q ++SS+SFQS + IL++L
Sbjct  568  SKVTRVVWNPGSEFAHCDCEWSLQGNLCKHIIKVNMVCENLQCYQSSLSFQSLKNILIDL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGK  245
             +KPMDDSVALD+STAWT QMLDQ+Q LVELNSS++IG +VNNMPL+W+++K RT+ G+
Sbjct  628  WEKPMDDSVALDISTAWTHQMLDQVQKLVELNSSDDIGLVVNNMPLKWVAKKVRTTSGR  686



>emb|CAN76964.1| hypothetical protein VITISV_043960 [Vitis vinifera]
Length=706

 Score =   263 bits (673),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 157/179 (88%), Gaps = 3/179 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEYIASTSW+RAL+IPD +V  E + Q    FAKVLSQKD
Sbjct  497  HSSYWLDRYADESDSFQNVKEEYIASTSWHRALRIPDTSVILEDKNQL---FAKVLSQKD  553

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +N+T LVWNPGSEFA CDCEW+MQGNLCKH+IKVNMIC + Q ++SSMSFQSF+EILMNL
Sbjct  554  SNLTHLVWNPGSEFAFCDCEWAMQGNLCKHIIKVNMICKNHQAYQSSMSFQSFREILMNL  613

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGK  245
             +KPMDDSVALD + AWT QMLDQIQ LVELNS+N+IG++VNN+PL+W+S+K RT  G+
Sbjct  614  WRKPMDDSVALDQAVAWTHQMLDQIQKLVELNSANDIGSVVNNLPLKWVSKKGRTFVGR  672



>ref|XP_007133525.1| hypothetical protein PHAVU_011G186500g [Phaseolus vulgaris]
 gb|ESW05519.1| hypothetical protein PHAVU_011G186500g [Phaseolus vulgaris]
Length=719

 Score =   263 bits (673),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 160/190 (84%), Gaps = 3/190 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKE+YI STSW+RALQIPD AV+ + R    H FAKV+SQKD
Sbjct  511  HSSYWLDRYADESDSFQNVKEKYILSTSWHRALQIPDYAVTLDDRD---HLFAKVVSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +++  LVWNPGSEFA CDC WSMQGNLCKHV+KVNMIC +++G++ SMSF+SF+E+LM+L
Sbjct  568  SSLLHLVWNPGSEFAFCDCSWSMQGNLCKHVVKVNMICENLKGYQPSMSFRSFEEVLMDL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KP+DDS ALDLS A T QMLDQIQ LVELN+S +IG +VNNMPL+W+S+K RT  GKP
Sbjct  628  WRKPVDDSFALDLSLACTHQMLDQIQKLVELNNSADIGTVVNNMPLKWVSKKSRTYIGKP  687

Query  241  TSALTLPPSS  212
            +S L LP  S
Sbjct  688  SSILALPHGS  697



>ref|XP_002274170.1| PREDICTED: uncharacterized protein LOC100247174 [Vitis vinifera]
 ref|XP_010649364.1| PREDICTED: uncharacterized protein LOC100247174 [Vitis vinifera]
 ref|XP_010649365.1| PREDICTED: uncharacterized protein LOC100247174 [Vitis vinifera]
 emb|CBI37532.3| unnamed protein product [Vitis vinifera]
Length=720

 Score =   263 bits (673),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 157/179 (88%), Gaps = 3/179 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEYIASTSW+RAL+IPD +V  E + Q    FAKVLSQKD
Sbjct  511  HSSYWLDRYADESDSFQNVKEEYIASTSWHRALRIPDTSVILEDKNQL---FAKVLSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +N+T LVWNPGSEFA CDCEW+MQGNLCKH+IKVNMIC + Q ++SSMSFQSF+EILMNL
Sbjct  568  SNLTHLVWNPGSEFAFCDCEWAMQGNLCKHIIKVNMICKNHQAYQSSMSFQSFREILMNL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGK  245
             +KPMDDSVALD + AWT QMLDQIQ LVELNS+N+IG++VNN+PL+W+S+K RT  G+
Sbjct  628  WRKPMDDSVALDQAVAWTHQMLDQIQKLVELNSANDIGSVVNNLPLKWVSKKGRTFVGR  686



>ref|XP_002518981.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43514.1| conserved hypothetical protein [Ricinus communis]
Length=719

 Score =   262 bits (669),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 163/199 (82%), Gaps = 4/199 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEY+ASTSW+RALQIP++AV+ + + +    FAKV SQKD
Sbjct  511  HSSYWLDRYADESDSFQNVKEEYVASTSWHRALQIPNSAVTLDDKDKL---FAKVSSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +N+T +VWNPGSEFA CDC WS+QGNLCKHVIKVNM+C + +G +SSMSFQS +EIL  L
Sbjct  568  SNLTHIVWNPGSEFAFCDCAWSLQGNLCKHVIKVNMLCKNSEG-QSSMSFQSLKEILTGL  626

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KPMDDSVALDLS AWT QML QI+ LVELN+SN+I  +V NMPL+W+SRK RTS G P
Sbjct  627  WRKPMDDSVALDLSMAWTHQMLGQIKQLVELNNSNSISTVVKNMPLKWVSRKARTSVGIP  686

Query  241  TSALTLPPSSQSGAINSTA  185
            +S   LP S++S A N  A
Sbjct  687  SSIPFLPSSTKSNAKNVVA  705



>ref|XP_007040728.1| SWIM zinc finger family protein [Theobroma cacao]
 gb|EOY25229.1| SWIM zinc finger family protein [Theobroma cacao]
Length=718

 Score =   259 bits (662),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 158/192 (82%), Gaps = 3/192 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS+YWLDRYADESDSF NVKEEYIASTSW+RALQIPD+ V+   +    + FAKV SQKD
Sbjct  511  HSTYWLDRYADESDSFLNVKEEYIASTSWHRALQIPDSFVTLGDKA---NLFAKVASQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             ++T LVWNPGS+FA CDC WSMQGN CKHVIKVNM+C + +G++ SMSFQSF+EILM+L
Sbjct  568  ISITHLVWNPGSDFAFCDCAWSMQGNFCKHVIKVNMMCENREGYKPSMSFQSFREILMDL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
            LKKPMDDS+ALD S AWT QMLDQI+ LVELNSSN+IG +V NMPL+W+S+K RT  G P
Sbjct  628  LKKPMDDSIALDESVAWTHQMLDQIKQLVELNSSNDIGIVVKNMPLKWVSKKGRTFVGIP  687

Query  241  TSALTLPPSSQS  206
             S   +P SS+S
Sbjct  688  ASLPAIPSSSKS  699



>gb|KDP32636.1| hypothetical protein JCGZ_13186 [Jatropha curcas]
Length=721

 Score =   258 bits (659),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 159/192 (83%), Gaps = 3/192 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEY+ASTSW+RALQIPD+AV+ + + Q    FAKV SQKD
Sbjct  511  HSSYWLDRYADESDSFQNVKEEYVASTSWHRALQIPDSAVTLDDKDQL---FAKVSSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +N+  +VWNPGSEFA CDC WS+QGNLCKHVIKVNMIC + QG++ SMSF+SF+EIL N+
Sbjct  568  SNLMHIVWNPGSEFAFCDCSWSLQGNLCKHVIKVNMICENRQGYQCSMSFRSFKEILTNI  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             KK  DDSV LDLS AWTQQML+QI+ LVELNSS+NI  +VNNMPL+W S+K RTS G P
Sbjct  628  WKKHSDDSVNLDLSMAWTQQMLNQIKQLVELNSSDNISTVVNNMPLKWFSKKGRTSVGIP  687

Query  241  TSALTLPPSSQS  206
            +S   LP +S S
Sbjct  688  SSLQALPSASMS  699



>ref|XP_012078506.1| PREDICTED: uncharacterized protein LOC105639150 [Jatropha curcas]
 ref|XP_012078508.1| PREDICTED: uncharacterized protein LOC105639150 [Jatropha curcas]
Length=722

 Score =   258 bits (659),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 159/192 (83%), Gaps = 3/192 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEY+ASTSW+RALQIPD+AV+ + + Q    FAKV SQKD
Sbjct  512  HSSYWLDRYADESDSFQNVKEEYVASTSWHRALQIPDSAVTLDDKDQL---FAKVSSQKD  568

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +N+  +VWNPGSEFA CDC WS+QGNLCKHVIKVNMIC + QG++ SMSF+SF+EIL N+
Sbjct  569  SNLMHIVWNPGSEFAFCDCSWSLQGNLCKHVIKVNMICENRQGYQCSMSFRSFKEILTNI  628

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             KK  DDSV LDLS AWTQQML+QI+ LVELNSS+NI  +VNNMPL+W S+K RTS G P
Sbjct  629  WKKHSDDSVNLDLSMAWTQQMLNQIKQLVELNSSDNISTVVNNMPLKWFSKKGRTSVGIP  688

Query  241  TSALTLPPSSQS  206
            +S   LP +S S
Sbjct  689  SSLQALPSASMS  700



>ref|XP_010255617.1| PREDICTED: uncharacterized protein LOC104596236 [Nelumbo nucifera]
 ref|XP_010255624.1| PREDICTED: uncharacterized protein LOC104596236 [Nelumbo nucifera]
 ref|XP_010255633.1| PREDICTED: uncharacterized protein LOC104596236 [Nelumbo nucifera]
 ref|XP_010255642.1| PREDICTED: uncharacterized protein LOC104596236 [Nelumbo nucifera]
Length=718

 Score =   258 bits (659),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 160/186 (86%), Gaps = 3/186 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEYIASTSW+RALQIPDAAV+ + ++   H FAKV+SQKD
Sbjct  511  HSSYWLDRYADESDSFQNVKEEYIASTSWHRALQIPDAAVTLDDKE---HLFAKVVSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            ++ + L+WNPGSEF+ CDCEWSMQGNLCKHVIKVNMIC + + ++ SMSFQSF+EIL+NL
Sbjct  568  SSQSHLIWNPGSEFSFCDCEWSMQGNLCKHVIKVNMICQNCKNYQPSMSFQSFREILLNL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             KKP+DDS+ALD S A T QMLDQIQ LVEL++S +IGN++NN+PL+W+S+K RT   KP
Sbjct  628  WKKPIDDSIALDQSIARTSQMLDQIQRLVELSNSKDIGNLINNLPLKWVSKKGRTVSRKP  687

Query  241  TSALTL  224
             S+L +
Sbjct  688  ASSLAI  693



>ref|XP_008441058.1| PREDICTED: uncharacterized protein LOC103485285 [Cucumis melo]
Length=718

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 159/192 (83%), Gaps = 3/192 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS+YWLDRYADESDSFQNVKEEYI+STSW+RALQIPD++V+ +   +  H FAKVLSQKD
Sbjct  511  HSTYWLDRYADESDSFQNVKEEYISSTSWHRALQIPDSSVTLD---EENHLFAKVLSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             +++ +VWNPGSEF+ CDC WSMQGNLCKHVIKVNM+C +   ++ SMSFQSF+EILMN+
Sbjct  568  TSISHVVWNPGSEFSFCDCSWSMQGNLCKHVIKVNMVCENCPSYKPSMSFQSFEEILMNM  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             K PMDDSVALD+S AWT Q+LD++Q LVELNSSN+I ++VN +PL+W S K RTS  KP
Sbjct  628  WKLPMDDSVALDVSMAWTHQILDEVQKLVELNSSNDISSVVNKLPLKWASGKGRTSFRKP  687

Query  241  TSALTLPPSSQS  206
            +S ++ P  S +
Sbjct  688  SSTVSFPSESNT  699



>ref|XP_004148660.1| PREDICTED: uncharacterized protein LOC101204643 [Cucumis sativus]
 gb|KGN48347.1| hypothetical protein Csa_6G483290 [Cucumis sativus]
Length=718

 Score =   256 bits (653),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 157/192 (82%), Gaps = 3/192 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS+YWLDRYADESDSFQNVKEEYI+STSW+RALQIPD++V+ +      H FAKVLSQKD
Sbjct  511  HSTYWLDRYADESDSFQNVKEEYISSTSWHRALQIPDSSVTLD---DENHLFAKVLSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             +++ +VWNPGSEF+ CDC WSMQGNLCKHVIKVNM+C +   ++ SMSFQSF+EILMN+
Sbjct  568  TSISHVVWNPGSEFSFCDCSWSMQGNLCKHVIKVNMVCENCPSYKPSMSFQSFEEILMNM  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             K PMDDSVALD+S AWT Q+LD++Q LVELNSSN+I ++VN +PL+W S K RTS  KP
Sbjct  628  WKLPMDDSVALDVSMAWTHQILDEVQKLVELNSSNDISSVVNKLPLKWASGKGRTSFRKP  687

Query  241  TSALTLPPSSQS  206
            +S +  P  S +
Sbjct  688  SSTIPFPSESNT  699



>gb|KJB51581.1| hypothetical protein B456_008G223400 [Gossypium raimondii]
 gb|KJB51582.1| hypothetical protein B456_008G223400 [Gossypium raimondii]
Length=717

 Score =   255 bits (652),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 157/192 (82%), Gaps = 3/192 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS+YWLDRYADESDSFQ+VKEEYIASTSW+RALQIPD+AV+ + +    H FAKV SQKD
Sbjct  511  HSAYWLDRYADESDSFQHVKEEYIASTSWHRALQIPDSAVTLDDKG---HLFAKVASQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            ++ T LVWNPGS+FA CDC WSMQGN CKHVIKVNMIC + +G R SMSF SF+EIL++L
Sbjct  568  SSRTHLVWNPGSDFAFCDCAWSMQGNFCKHVIKVNMICENAKGCRPSMSFWSFREILIDL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             K+PMDDS+ LD S AWT QMLDQI+ LVELNSSN+IG +VNNMPL+WIS+K RT  G P
Sbjct  628  CKRPMDDSIGLDESVAWTHQMLDQIKQLVELNSSNDIGIVVNNMPLKWISKKGRTFVGIP  687

Query  241  TSALTLPPSSQS  206
             S   LP  S++
Sbjct  688  ASLPALPSDSKT  699



>gb|AET02590.2| SWIM zinc finger protein [Medicago truncatula]
Length=721

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 162/192 (84%), Gaps = 3/192 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDR+ADESDSFQNVKE YIASTSW+RAL+IPD+AV+ + + +    FAKV S+KD
Sbjct  513  HSSYWLDRFADESDSFQNVKEGYIASTSWHRALEIPDSAVTLDDKNRL---FAKVASKKD  569

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +++T +VWNPGSEF+ CDC WS+ GNLCKHVIKVNMIC ++QG +SSMSF+SF+E+LM+L
Sbjct  570  SSLTHIVWNPGSEFSFCDCSWSLHGNLCKHVIKVNMICENLQGCQSSMSFRSFEEVLMDL  629

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KP+DDS ALDLS AWT QMLDQIQ LVELN+S +IG +VNNMPL+W+S+KRRT+ GK 
Sbjct  630  WRKPVDDSFALDLSLAWTHQMLDQIQKLVELNNSTDIGTVVNNMPLKWVSKKRRTNIGKR  689

Query  241  TSALTLPPSSQS  206
            +S    P  +++
Sbjct  690  SSISATPSGNRN  701



>ref|XP_003628114.1| hypothetical protein MTR_8g043760 [Medicago truncatula]
Length=732

 Score =   254 bits (649),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 162/192 (84%), Gaps = 3/192 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDR+ADESDSFQNVKE YIASTSW+RAL+IPD+AV+ + + +    FAKV S+KD
Sbjct  524  HSSYWLDRFADESDSFQNVKEGYIASTSWHRALEIPDSAVTLDDKNRL---FAKVASKKD  580

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +++T +VWNPGSEF+ CDC WS+ GNLCKHVIKVNMIC ++QG +SSMSF+SF+E+LM+L
Sbjct  581  SSLTHIVWNPGSEFSFCDCSWSLHGNLCKHVIKVNMICENLQGCQSSMSFRSFEEVLMDL  640

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KP+DDS ALDLS AWT QMLDQIQ LVELN+S +IG +VNNMPL+W+S+KRRT+ GK 
Sbjct  641  WRKPVDDSFALDLSLAWTHQMLDQIQKLVELNNSTDIGTVVNNMPLKWVSKKRRTNIGKR  700

Query  241  TSALTLPPSSQS  206
            +S    P  +++
Sbjct  701  SSISATPSGNRN  712



>ref|XP_003628100.1| hypothetical protein MTR_8g043530 [Medicago truncatula]
Length=792

 Score =   254 bits (650),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 162/192 (84%), Gaps = 3/192 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDR+ADESDSFQNVKE YIASTSW+RAL+IPD+AV+ + + +    FAKV S+KD
Sbjct  584  HSSYWLDRFADESDSFQNVKEGYIASTSWHRALEIPDSAVTLDDKNRL---FAKVASKKD  640

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +++T +VWNPGSEF+ CDC WS+ GNLCKHVIKVNMIC ++QG +SSMSF+SF+E+LM+L
Sbjct  641  SSLTHIVWNPGSEFSFCDCSWSLHGNLCKHVIKVNMICENLQGCQSSMSFRSFEEVLMDL  700

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KP+DDS ALDLS AWT QMLDQIQ LVELN+S +IG +VNNMPL+W+S+KRRT+ GK 
Sbjct  701  WRKPVDDSFALDLSLAWTHQMLDQIQKLVELNNSTDIGTVVNNMPLKWVSKKRRTNIGKR  760

Query  241  TSALTLPPSSQS  206
            +S    P  +++
Sbjct  761  SSISATPSGNRN  772



>ref|XP_004511186.1| PREDICTED: uncharacterized protein LOC101498464 [Cicer arietinum]
Length=790

 Score =   254 bits (648),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 160/195 (82%), Gaps = 3/195 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDR+ADESDSFQNVKE YIASTSW+RALQIPD+AVS + + +    FAKV SQKD
Sbjct  583  HSSYWLDRFADESDSFQNVKEGYIASTSWHRALQIPDSAVSLDDKDRL---FAKVASQKD  639

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             ++  +VWNPGSEF+ CDC WS+QGNLCKHV+KVNMIC ++QG + SMSF+SF+E+LM+L
Sbjct  640  RSLIHIVWNPGSEFSFCDCSWSLQGNLCKHVLKVNMICDNLQGCQRSMSFRSFEEVLMDL  699

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KP+DDS ALD+S AWT QMLDQIQ LVELN+S +IG +V NMPL+W+S+K RT  GK 
Sbjct  700  WRKPVDDSFALDVSLAWTHQMLDQIQKLVELNNSTDIGTVVTNMPLKWVSKKGRTYIGKR  759

Query  241  TSALTLPPSSQSGAI  197
            +S L+ P +  + ++
Sbjct  760  SSVLSTPGNRNTDSV  774



>gb|EYU23749.1| hypothetical protein MIMGU_mgv1a002058mg [Erythranthe guttata]
Length=720

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 159/200 (80%), Gaps = 5/200 (3%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSF NVKEEYIASTSW+RALQIP+ +VSF         FA+V+SQKD
Sbjct  511  HSSYWLDRYADESDSFLNVKEEYIASTSWHRALQIPEDSVSF----NRDPLFARVVSQKD  566

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
              ++R+VWNPGSEFAHCDCEWS+QGNLCKHVIKVNM C ++   +SSMSFQS + ILM+L
Sbjct  567  RCLSRVVWNPGSEFAHCDCEWSLQGNLCKHVIKVNMTCDNLDSHKSSMSFQSLKNILMDL  626

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             KKP+DDSV LD+S AWT QMLDQ++ LV LN  ++IG +V +MPL+W+++K RT+ G+ 
Sbjct  627  WKKPVDDSVGLDISMAWTHQMLDQVEKLVRLNKCDDIGLVVKDMPLKWVAKKHRTTCGRQ  686

Query  241  -TSALTLPPSSQSGAINSTA  185
             +S +T P  +++   NS+A
Sbjct  687  LSSVITSPSRTKNNRNNSSA  706



>ref|XP_004287787.1| PREDICTED: uncharacterized protein LOC101292541 [Fragaria vesca 
subsp. vesca]
Length=715

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 155/186 (83%), Gaps = 3/186 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS+YWLDRYADE DSFQNVKEEYIASTSW+RALQIPD+AV+ + + +    FAKV SQKD
Sbjct  511  HSAYWLDRYADECDSFQNVKEEYIASTSWHRALQIPDSAVTLDDKNRL---FAKVSSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +++  LVWNPGSEF+ CDC WSMQGN+CKHVIKVNMIC S +G++ SMSFQSF+E+L+++
Sbjct  568  SSIVHLVWNPGSEFSFCDCMWSMQGNICKHVIKVNMICESHKGYQPSMSFQSFKELLVSI  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             KKPM+DS++ DLS AWT QML+Q++NLVE+  + +IG +VNN+PL W +RK RT  GKP
Sbjct  628  SKKPMEDSISQDLSMAWTMQMLEQVRNLVEVTRAEDIGAVVNNLPLHWAARKGRTGVGKP  687

Query  241  TSALTL  224
            ++ L L
Sbjct  688  STNLAL  693



>ref|XP_010027651.1| PREDICTED: uncharacterized protein LOC104418118 [Eucalyptus grandis]
 gb|KCW54219.1| hypothetical protein EUGRSUZ_I00201 [Eucalyptus grandis]
Length=720

 Score =   247 bits (631),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNV+EEYI STSW+RALQIPD+A++F+ +    H +AKV  QKD
Sbjct  511  HSSYWLDRYADESDSFQNVREEYITSTSWHRALQIPDSAITFDEKD---HLYAKVQGQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            ++VT LVWNPGSEFA CDC WSMQ NLCKHV+KVNMIC + +G +SSMS  SF+E+L+N+
Sbjct  568  SSVTHLVWNPGSEFAFCDCPWSMQANLCKHVLKVNMICENRRGCQSSMSMHSFREVLLNI  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             + P+DDS+ALD S AWT QM+DQIQ LVELNS+N+IG +V  +P++W S+K RTS   P
Sbjct  628  WRMPLDDSLALDQSMAWTYQMVDQIQKLVELNSTNDIGTVVKRLPIQWSSKKTRTSVCVP  687

Query  241  TSALTLPPSSQ  209
            ++ L LP SS+
Sbjct  688  SATLGLPSSSK  698



>ref|XP_010921228.1| PREDICTED: uncharacterized protein LOC105044872 [Elaeis guineensis]
Length=725

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 153/200 (77%), Gaps = 4/200 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLD YADES SF  VKEEYI+STSW+RALQIPD AV F+ ++   H FAKV+SQKD
Sbjct  512  HSGYWLDLYADESGSFPAVKEEYISSTSWHRALQIPDDAVVFDDKE---HLFAKVVSQKD  568

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            ++ TR+VWNPGSEFA CDC WSMQGNLCKH+IKVNM+C   + +R ++S+QSF+ +L+NL
Sbjct  569  SSHTRIVWNPGSEFALCDCSWSMQGNLCKHIIKVNMMCRHRREYRPTLSYQSFEHVLLNL  628

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KPMDDS +LD S AW +QM D+IQ LVE+ +S +I  +  N+PL+WI ++ RT  G+P
Sbjct  629  WRKPMDDSFSLDQSMAWVRQMQDKIQRLVEITTSGDIAKVTKNLPLKWICKRGRTFFGRP  688

Query  241  T-SALTLPPSSQSGAINSTA  185
              S L LPP+S+  A  S A
Sbjct  689  ADSTLALPPTSKIDAQKSAA  708



>ref|XP_008787735.1| PREDICTED: uncharacterized protein LOC103705694 [Phoenix dactylifera]
Length=725

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 152/200 (76%), Gaps = 4/200 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLD YADES SF  VKEEYI+STSW+RALQIPD AV F+     +H FAKV+SQ+D
Sbjct  512  HSGYWLDLYADESGSFPAVKEEYISSTSWHRALQIPDDAVVFDD---EEHLFAKVVSQED  568

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             + T +VWNPGSEFA CDC WSMQGNLCKH+IKVNM+C   + ++ ++S+QSF+ +L+NL
Sbjct  569  GSHTHMVWNPGSEFALCDCSWSMQGNLCKHIIKVNMMCRHRKEYQPTLSYQSFEHVLLNL  628

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KPMDDS++LD S AW +QM D+IQ LVEL ++ +I  +  N+PL+W+ +K RT  G+P
Sbjct  629  WRKPMDDSLSLDQSMAWARQMQDKIQGLVELTTTGDIAKVTKNLPLKWVCKKGRTFVGRP  688

Query  241  T-SALTLPPSSQSGAINSTA  185
              S L LPP+S+S A  S A
Sbjct  689  PDSTLALPPTSKSDAHKSAA  708



>ref|XP_009383179.1| PREDICTED: uncharacterized protein LOC103970968 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009383259.1| PREDICTED: uncharacterized protein LOC103970968 [Musa acuminata 
subsp. malaccensis]
Length=727

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 143/186 (77%), Gaps = 3/186 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLD YADES SF +VKEEYI STSW+RALQIPD  V+F+ ++   H FAKVLSQKD
Sbjct  512  HSGYWLDLYADESGSFPSVKEEYILSTSWHRALQIPDDVVTFDDKE---HLFAKVLSQKD  568

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
                R+VWNPGSEFA CDC WSMQGNLCKH+IKVN++C   + F  S+S+ SFQE+L++L
Sbjct  569  GGQERMVWNPGSEFALCDCSWSMQGNLCKHIIKVNLLCQHKKEFLPSLSYLSFQEVLLDL  628

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KPMDDS++LDLS AW  QM D IQ LVEL +S +I  + N +PL+WI R+ RTS GKP
Sbjct  629  WRKPMDDSLSLDLSMAWVAQMQDNIQRLVELITSGDIAKVTNKLPLKWIGRRERTSVGKP  688

Query  241  TSALTL  224
            T + TL
Sbjct  689  TGSSTL  694



>gb|AAB71951.1| Hypothetical Protein [Arabidopsis thaliana]
Length=653

 Score =   230 bits (587),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 147/182 (81%), Gaps = 3/182 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEYIASTSWYRA++IPD+AV+ +   ++    AKV SQ+D
Sbjct  461  HSSYWLDRYADESDSFQNVKEEYIASTSWYRAMEIPDSAVTLD---ENNILLAKVQSQRD  517

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            ++VTR+VWNPGSEFA CDC WS+QGNLCKH+IKVN +C + +G+  SMS +SF+E L N+
Sbjct  518  SDVTRVVWNPGSEFAFCDCTWSLQGNLCKHIIKVNTMCENREGYGDSMSLRSFKEKLRNI  577

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
              KPMDDS+ALDLS A T QM DQI+ LV L+ +N+I NIVN++P++W  +K RT+ G P
Sbjct  578  KMKPMDDSIALDLSMALTLQMFDQIKQLVRLSGTNDISNIVNDLPVKWGCKKGRTTIGIP  637

Query  241  TS  236
             S
Sbjct  638  AS  639



>ref|XP_010542310.1| PREDICTED: uncharacterized protein LOC104815571 [Tarenaya hassleriana]
 ref|XP_010542311.1| PREDICTED: uncharacterized protein LOC104815571 [Tarenaya hassleriana]
Length=709

 Score =   231 bits (590),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 150/183 (82%), Gaps = 3/183 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADES+SF NVKEEY+ASTSW+RAL+I D+AV+F+ + +    FAKV S+KD
Sbjct  511  HSSYWLDRYADESNSFHNVKEEYLASTSWHRALEITDSAVTFDEKNRL---FAKVQSKKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             +V  +VWNPGSEFA CDC WS+QGNLCKH+IKVN +C + +G+  SMSF+S +EIL NL
Sbjct  568  TDVLHVVWNPGSEFAFCDCLWSLQGNLCKHIIKVNSMCENREGYSPSMSFRSLREILTNL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             K+PMDDS+ LDLS AWT QMLDQI+ LV+LNS+++I +IV+N+P++W  +K RT+ G P
Sbjct  628  RKQPMDDSIDLDLSMAWTLQMLDQIKQLVQLNSTDDISDIVHNLPVKWACKKSRTTIGIP  687

Query  241  TSA  233
            T+ 
Sbjct  688  TTT  690



>ref|NP_176256.2| SWIM zinc finger domain-containing protein [Arabidopsis thaliana]
 gb|AAL91647.1| At1g60560/F8A5_10 [Arabidopsis thaliana]
 gb|AAO11540.1| At1g60560/F8A5_10 [Arabidopsis thaliana]
 gb|AEE33698.1| SWIM zinc finger-like protein [Arabidopsis thaliana]
Length=703

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 147/182 (81%), Gaps = 3/182 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEYIASTSWYRA++IPD+AV+ +   ++    AKV SQ+D
Sbjct  511  HSSYWLDRYADESDSFQNVKEEYIASTSWYRAMEIPDSAVTLD---ENNILLAKVQSQRD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            ++VTR+VWNPGSEFA CDC WS+QGNLCKH+IKVN +C + +G+  SMS +SF+E L N+
Sbjct  568  SDVTRVVWNPGSEFAFCDCTWSLQGNLCKHIIKVNTMCENREGYGDSMSLRSFKEKLRNI  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
              KPMDDS+ALDLS A T QM DQI+ LV L+ +N+I NIVN++P++W  +K RT+ G P
Sbjct  628  KMKPMDDSIALDLSMALTLQMFDQIKQLVRLSGTNDISNIVNDLPVKWGCKKGRTTIGIP  687

Query  241  TS  236
             S
Sbjct  688  AS  689



>gb|KJB21169.1| hypothetical protein B456_003G185900 [Gossypium raimondii]
Length=677

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 151/192 (79%), Gaps = 3/192 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            +S+YWL+RYADES+SFQNVKEEYIASTSW+RALQIPD+AV+ + +    + FAKV S K 
Sbjct  473  YSTYWLNRYADESNSFQNVKEEYIASTSWHRALQIPDSAVTLDDKY---NLFAKVASLKG  529

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +++T +VWNPGS+FA CD  WSMQGN CKHVIKVNM+C + +    SMS +SF EI M+L
Sbjct  530  SSITHIVWNPGSDFAFCDSAWSMQGNFCKHVIKVNMMCDNDKACEPSMSSRSFGEIPMDL  589

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             KKPMDDS+ LD S AW+ QMLDQI+ LVELNSSN+IG +VNNMPL+WIS+K R   G P
Sbjct  590  WKKPMDDSILLDESVAWSHQMLDQIKQLVELNSSNDIGIVVNNMPLKWISKKGRKFVGIP  649

Query  241  TSALTLPPSSQS  206
             S   LP +S+S
Sbjct  650  ASFPALPSTSKS  661



>emb|CDY34123.1| BnaC01g28630D [Brassica napus]
Length=693

 Score =   226 bits (576),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 143/182 (79%), Gaps = 3/182 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEYIASTSW+RA +IPD+AV  +S        AKV SQ+D
Sbjct  501  HSSYWLDRYADESDSFQNVKEEYIASTSWHRASEIPDSAVILDSNNTV---VAKVRSQRD  557

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             NV R+VWNPGSEFA CDC WS+QGNLCKH+IKVN +C + +G+  SMS +SF+E L ++
Sbjct  558  TNVARVVWNPGSEFAFCDCAWSLQGNLCKHIIKVNTMCENREGYGDSMSLRSFKEKLTSI  617

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
              KPMDDS+ALDLS A T QM DQI+ LV+L+ +++I NIVN++P++W  RK RT+ G P
Sbjct  618  KMKPMDDSIALDLSMALTLQMFDQIKQLVKLSGTDDISNIVNDLPVKWGCRKGRTTVGIP  677

Query  241  TS  236
             S
Sbjct  678  AS  679



>ref|XP_006300800.1| hypothetical protein CARUB_v10019879mg [Capsella rubella]
 gb|EOA33698.1| hypothetical protein CARUB_v10019879mg [Capsella rubella]
Length=703

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 144/182 (79%), Gaps = 3/182 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEYIASTSW+RA +IPD+AV+ +   ++    AKV SQKD
Sbjct  511  HSSYWLDRYADESDSFQNVKEEYIASTSWHRATEIPDSAVTLD---ENNILVAKVQSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +NVTR+VWNPGSEFA CDC WS+QGNLCKH+IKVN IC + +G+  SMS +S +E +  +
Sbjct  568  SNVTRVVWNPGSEFAFCDCAWSLQGNLCKHIIKVNTICENREGYGDSMSLRSLKEKIRTI  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
               PMDDS+ALDLS A T QMLDQI+ LV+L+ +N+I  IVN++P++W  +K RT+ G P
Sbjct  628  KMTPMDDSIALDLSMALTLQMLDQIKQLVQLSGTNDISKIVNDLPVKWGCKKGRTTVGIP  687

Query  241  TS  236
             S
Sbjct  688  AS  689



>ref|XP_002886608.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62867.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=703

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 146/182 (80%), Gaps = 3/182 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEYIASTSW+RA +IP++AV+ +   +S    AKV SQ+D
Sbjct  511  HSSYWLDRYADESDSFQNVKEEYIASTSWHRASEIPESAVTLD---ESNVLVAKVQSQRD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            ++VTR+VWNPGSEFA CDC WS+QGNLCKH+IKVN +C + +G+  SMS +SF+E L N+
Sbjct  568  SDVTRVVWNPGSEFAFCDCAWSLQGNLCKHIIKVNTMCENRKGYGDSMSLRSFKEKLRNI  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
              KPMDDS+ALDLS A T QM DQI+ LV L+ +N+I NIVN++P++W  +K RT+ G P
Sbjct  628  KMKPMDDSIALDLSMALTLQMFDQIKQLVRLSGTNDISNIVNDLPVKWGCKKGRTTIGIP  687

Query  241  TS  236
             S
Sbjct  688  AS  689



>ref|XP_010510937.1| PREDICTED: uncharacterized protein LOC104787116 isoform X1 [Camelina 
sativa]
 ref|XP_010510938.1| PREDICTED: uncharacterized protein LOC104787116 isoform X2 [Camelina 
sativa]
Length=703

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 146/183 (80%), Gaps = 3/183 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEYIASTSW+RA +IPD+AV+ +   ++    AKV SQ+D
Sbjct  511  HSSYWLDRYADESDSFQNVKEEYIASTSWHRATEIPDSAVTLD---ENNILVAKVQSQRD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            ++VTR+VWNPGSEFA CDC WS+QGNLCKH+IKVN IC + +G+  SMS +S +E + N+
Sbjct  568  SDVTRVVWNPGSEFAFCDCAWSLQGNLCKHIIKVNTICENREGYGDSMSLRSLKEKIRNI  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
               PMDDS+ALDLS A T QMLDQI+ LV+L+ +N+I NIVN++P++W  +K RT+ G P
Sbjct  628  KMTPMDDSIALDLSMALTLQMLDQIKQLVQLSGTNDISNIVNDLPVKWGCKKGRTTIGIP  687

Query  241  TSA  233
             S 
Sbjct  688  ASV  690



>ref|XP_010674758.1| PREDICTED: uncharacterized protein LOC104890846 [Beta vulgaris 
subsp. vulgaris]
Length=719

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 152/192 (79%), Gaps = 5/192 (3%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRY+DE D+F++VKE Y+ASTSW+RALQI D AV F    ++   FA++ SQKD
Sbjct  511  HSSYWLDRYSDEHDTFKDVKEMYLASTSWHRALQISDTAVYF---HENHDFFAEIQSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            N V+ +VWNPGSEFA C+C W++QGNLCKHVIKVNM+  + QG  +SMSF SF+E+L +L
Sbjct  568  NTVSHIVWNPGSEFAFCNCAWALQGNLCKHVIKVNMMYETRQG-SASMSFHSFRELLTSL  626

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
            L+KPMDDS+ LD + AWT QML+Q+Q+LVEL S+NNIG +V ++PL+WIS+K RT+  +P
Sbjct  627  LRKPMDDSIELDKAMAWTHQMLNQVQSLVELTSANNIGTLVKSLPLKWISKKARTTAQRP  686

Query  241  TSALTLPPSSQS  206
              A + P SS +
Sbjct  687  L-ATSAPVSSSA  697



>emb|CDY24539.1| BnaA01g22430D [Brassica napus]
Length=708

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 143/182 (79%), Gaps = 3/182 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEYIASTSW+RA +IPD+AV  +S        AKV SQ+D
Sbjct  516  HSSYWLDRYADESDSFQNVKEEYIASTSWHRASEIPDSAVILDSNNTV---VAKVRSQRD  572

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             NV R+VWNPGSEFA CDC WS+QGNLCKHVIKVN +C + +G+  SMS +SF+E L ++
Sbjct  573  TNVARVVWNPGSEFAFCDCAWSLQGNLCKHVIKVNTMCENREGYGDSMSLRSFKEKLTSV  632

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
              KPMDDS+ALD+S A T QM DQI+ LV+L+ +++I NIVN++P++W  +K RT+ G P
Sbjct  633  KMKPMDDSIALDISMALTLQMFDQIKQLVKLSGTDDISNIVNDLPVKWGCKKGRTTVGIP  692

Query  241  TS  236
             S
Sbjct  693  AS  694



>ref|XP_009103823.1| PREDICTED: uncharacterized protein LOC103829887 [Brassica rapa]
Length=703

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 143/182 (79%), Gaps = 3/182 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEYIASTSW+RA +IPD+AV  +S        AKV SQ+D
Sbjct  511  HSSYWLDRYADESDSFQNVKEEYIASTSWHRASEIPDSAVILDSNNTV---VAKVRSQRD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             NV R+VWNPGSEFA CDC WS+QGNLCKHVIKVN +C + +G+  SMS +SF+E L ++
Sbjct  568  TNVARVVWNPGSEFAFCDCAWSLQGNLCKHVIKVNTMCENREGYGDSMSLRSFKEKLTSV  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
              KPMDDS+ALD+S A T QM DQI+ LV+L+ +++I NIVN++P++W  +K RT+ G P
Sbjct  628  KMKPMDDSIALDISMALTLQMFDQIKQLVKLSGTDDISNIVNDLPVKWGCKKGRTTVGIP  687

Query  241  TS  236
             S
Sbjct  688  AS  689



>ref|XP_006392152.1| hypothetical protein EUTSA_v10023307mg [Eutrema salsugineum]
 gb|ESQ29438.1| hypothetical protein EUTSA_v10023307mg [Eutrema salsugineum]
Length=710

 Score =   223 bits (569),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 144/182 (79%), Gaps = 3/182 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKE+YIASTSW+RA +I D+AV+ +S       FAKV SQ+D
Sbjct  518  HSSYWLDRYADESDSFQNVKEDYIASTSWHRASEIQDSAVTLDS---DNILFAKVQSQRD  574

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             +VTR+VWNPGSEFA CDC WS+QGNLCKH+IKVN +C + +G+  SMS +SF+E L N+
Sbjct  575  TDVTRVVWNPGSEFAFCDCAWSLQGNLCKHIIKVNTMCENREGYGDSMSLRSFKEKLRNI  634

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
              KPMDDS++LDLS A T QM DQI+ LV+L+ +N+I NIV ++P++W  +K RT+ G P
Sbjct  635  KMKPMDDSISLDLSMALTLQMFDQIKQLVQLSGTNDISNIVRDLPVKWACKKGRTTIGIP  694

Query  241  TS  236
             S
Sbjct  695  AS  696



>ref|XP_010473234.1| PREDICTED: uncharacterized protein LOC104752724 [Camelina sativa]
Length=703

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 145/182 (80%), Gaps = 3/182 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEYIASTSW+RA +IPD+AV+ +   ++    AKV SQ+D
Sbjct  511  HSSYWLDRYADESDSFQNVKEEYIASTSWHRATEIPDSAVTLD---ENNILVAKVQSQRD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            ++V R+VWNPGSEFA CDC WS+QGNLCKH+IKVN IC + +G+  SMS +S +E + N+
Sbjct  568  SDVARVVWNPGSEFAFCDCAWSLQGNLCKHIIKVNTICENREGYGDSMSLRSLKEKIRNI  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
               PMDDS+ALDLS A T QMLDQI+ LV+L+ +N+I +IVN++P++W  +K RT+ G P
Sbjct  628  KMTPMDDSIALDLSMALTLQMLDQIKQLVQLSGTNDISSIVNDLPVKWGCKKGRTTIGIP  687

Query  241  TS  236
             S
Sbjct  688  AS  689



>ref|XP_010417988.1| PREDICTED: uncharacterized protein LOC104703643 isoform X1 [Camelina 
sativa]
 ref|XP_010417989.1| PREDICTED: uncharacterized protein LOC104703643 isoform X2 [Camelina 
sativa]
 ref|XP_010417991.1| PREDICTED: uncharacterized protein LOC104703643 isoform X3 [Camelina 
sativa]
Length=703

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 145/182 (80%), Gaps = 3/182 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEYIASTSW+RA +IPD+AV+ +   ++    AKV SQ+D
Sbjct  511  HSSYWLDRYADESDSFQNVKEEYIASTSWHRATEIPDSAVTLD---ENNILVAKVQSQRD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            ++VTR+VWNPGSEFA CDC WS+QGNLCKH+IKVN IC + +G+  SMS +S +E + N+
Sbjct  568  SDVTRVVWNPGSEFAFCDCAWSLQGNLCKHIIKVNTICENREGYGDSMSLRSLKEKIRNI  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
               PMDDS+ALDLS A T QML+Q++ LV+L+ +N+I NIVN +P++W  +K RT+ G P
Sbjct  628  KMTPMDDSIALDLSMALTLQMLEQMKQLVQLSGTNDISNIVNALPVKWGCKKGRTTVGIP  687

Query  241  TS  236
             S
Sbjct  688  AS  689



>gb|KFK40773.1| hypothetical protein AALP_AA2G039200 [Arabis alpina]
Length=642

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 146/182 (80%), Gaps = 3/182 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEYIASTSW+RA +IPD+AV+ +   ++    AKV SQKD
Sbjct  450  HSSYWLDRYADESDSFQNVKEEYIASTSWHRASEIPDSAVTLD---ENNSLVAKVQSQKD  506

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             +VTR+VWNPGSEFA CDC WS+QGNLCKH+IKVN +C + +G+  SMS  SF+E L N+
Sbjct  507  IDVTRVVWNPGSEFAFCDCAWSLQGNLCKHIIKVNTMCENRKGYGDSMSLLSFKEKLRNI  566

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
              KP+D+S+ALDLS A T QM++QI+ LV+L+ +++I +IVN++P++W  +K RT+ G P
Sbjct  567  KMKPLDNSIALDLSMALTLQMVEQIKQLVQLSETDDISSIVNDLPVKWGCKKGRTTIGIP  626

Query  241  TS  236
             S
Sbjct  627  AS  628



>gb|KFK40774.1| hypothetical protein AALP_AA2G039200 [Arabis alpina]
Length=703

 Score =   221 bits (563),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 146/182 (80%), Gaps = 3/182 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDRYADESDSFQNVKEEYIASTSW+RA +IPD+AV+ +   ++    AKV SQKD
Sbjct  511  HSSYWLDRYADESDSFQNVKEEYIASTSWHRASEIPDSAVTLD---ENNSLVAKVQSQKD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             +VTR+VWNPGSEFA CDC WS+QGNLCKH+IKVN +C + +G+  SMS  SF+E L N+
Sbjct  568  IDVTRVVWNPGSEFAFCDCAWSLQGNLCKHIIKVNTMCENRKGYGDSMSLLSFKEKLRNI  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
              KP+D+S+ALDLS A T QM++QI+ LV+L+ +++I +IVN++P++W  +K RT+ G P
Sbjct  628  KMKPLDNSIALDLSMALTLQMVEQIKQLVQLSETDDISSIVNDLPVKWGCKKGRTTIGIP  687

Query  241  TS  236
             S
Sbjct  688  AS  689



>ref|NP_001169995.1| uncharacterized protein LOC100383900 [Zea mays]
 gb|ACN35472.1| unknown [Zea mays]
Length=395

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 142/192 (74%), Gaps = 3/192 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYW++ +ADES SF  VK +YIASTSW RALQIPD AV+F+ +       A+V+SQK+
Sbjct  186  HSSYWINLFADESGSFPEVKADYIASTSWQRALQIPDDAVTFDDKDP---LVARVVSQKE  242

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             + TR VW+PGSEF+ C+C WSMQGNLCKHV+KVNM+CG+ + F+ S+SFQSFQ +L++L
Sbjct  243  TSQTRTVWSPGSEFSLCNCSWSMQGNLCKHVLKVNMVCGARKDFQPSLSFQSFQHVLLDL  302

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KP+DDS +LDLS A   QM ++I+++ EL +S+ I  +   +P++W  ++ R    KP
Sbjct  303  WQKPLDDSFSLDLSVARVMQMQEKIKHVAELATSSGIAQVAGKLPMQWTKKRGRRVGVKP  362

Query  241  TSALTLPPSSQS  206
            TSAL LP S  S
Sbjct  363  TSALLLPRSKGS  374



>ref|NP_001062830.1| Os09g0309100 [Oryza sativa Japonica Group]
 dbj|BAD36226.1| SWIM zinc finger family protein-like [Oryza sativa Japonica Group]
 dbj|BAD36475.1| SWIM zinc finger family protein-like [Oryza sativa Japonica Group]
 dbj|BAF24744.1| Os09g0309100 [Oryza sativa Japonica Group]
 gb|EAZ44181.1| hypothetical protein OsJ_28802 [Oryza sativa Japonica Group]
 dbj|BAG95598.1| unnamed protein product [Oryza sativa Japonica Group]
Length=729

 Score =   215 bits (547),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 138/190 (73%), Gaps = 3/190 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWL+ YADES SF  VK EYIASTSW+RALQIPD AV F+ ++      AKV SQKD
Sbjct  519  HSSYWLNLYADESGSFPEVKAEYIASTSWHRALQIPDDAVIFDDKEPFS---AKVTSQKD  575

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             +    VWNPGSEF+ CDC WSMQGNLCKH+IKVNM+CG  + F+ S+SFQSFQ +L++L
Sbjct  576  TSQMWTVWNPGSEFSLCDCSWSMQGNLCKHIIKVNMMCGPRKDFQPSLSFQSFQRVLLDL  635

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KPMDDS +LDLS AW  QM ++IQ + EL +++ I  + N +P++W ++K R    K 
Sbjct  636  WQKPMDDSFSLDLSVAWVMQMQERIQKVTELATADGIAEVSNRLPIQWTNKKGRKVAAKR  695

Query  241  TSALTLPPSS  212
            TS L + P S
Sbjct  696  TSPLRVLPHS  705



>gb|EEC84321.1| hypothetical protein OsI_30820 [Oryza sativa Indica Group]
Length=733

 Score =   215 bits (547),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 138/190 (73%), Gaps = 3/190 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWL+ YADES SF  VK EYIASTSW+RALQIPD AV F+ ++      AKV SQKD
Sbjct  523  HSSYWLNLYADESGSFPEVKAEYIASTSWHRALQIPDDAVIFDDKEPFS---AKVTSQKD  579

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             +    VWNPGSEF+ CDC WSMQGNLCKH+IKVNM+CG  + F+ S+SFQSFQ +L++L
Sbjct  580  TSQMWTVWNPGSEFSLCDCSWSMQGNLCKHIIKVNMMCGPRKDFQPSLSFQSFQRVLLDL  639

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KPMDDS +LDLS AW  QM ++IQ + EL +++ I  + N +P++W ++K R    K 
Sbjct  640  WQKPMDDSFSLDLSVAWVMQMQERIQKVTELATADGIAEVSNRLPIQWTNKKGRKVAAKR  699

Query  241  TSALTLPPSS  212
            TS L + P S
Sbjct  700  TSPLRVLPHS  709



>gb|AES96430.2| zinc ion-binding protein [Medicago truncatula]
Length=676

 Score =   213 bits (542),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 120/140 (86%), Gaps = 3/140 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDR+ADESDSFQNVKE YIASTSW+RA QIPD+AV+ + + +    FAKV SQKD
Sbjct  500  HSSYWLDRFADESDSFQNVKEGYIASTSWHRAFQIPDSAVTMDGKDRL---FAKVASQKD  556

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            ++VTR+VWNPGSEF+ CDC WS+QGNLCKHVIKVN IC ++QG++ SMSF+SF+E+LM+L
Sbjct  557  SSVTRIVWNPGSEFSFCDCSWSLQGNLCKHVIKVNTICENLQGYQPSMSFRSFEEVLMDL  616

Query  421  LKKPMDDSVALDLSTAWTQQ  362
             +KP+DDS  LD+S AWT Q
Sbjct  617  WRKPVDDSFELDVSLAWTHQ  636



>ref|XP_003613472.1| hypothetical protein MTR_5g037070 [Medicago truncatula]
Length=705

 Score =   213 bits (542),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 120/140 (86%), Gaps = 3/140 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLDR+ADESDSFQNVKE YIASTSW+RA QIPD+AV+ + + +    FAKV SQKD
Sbjct  529  HSSYWLDRFADESDSFQNVKEGYIASTSWHRAFQIPDSAVTMDGKDRL---FAKVASQKD  585

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            ++VTR+VWNPGSEF+ CDC WS+QGNLCKHVIKVN IC ++QG++ SMSF+SF+E+LM+L
Sbjct  586  SSVTRIVWNPGSEFSFCDCSWSLQGNLCKHVIKVNTICENLQGYQPSMSFRSFEEVLMDL  645

Query  421  LKKPMDDSVALDLSTAWTQQ  362
             +KP+DDS  LD+S AWT Q
Sbjct  646  WRKPVDDSFELDVSLAWTHQ  665



>ref|XP_002466103.1| hypothetical protein SORBIDRAFT_01g001310 [Sorghum bicolor]
 gb|EER93101.1| hypothetical protein SORBIDRAFT_01g001310 [Sorghum bicolor]
Length=728

 Score =   211 bits (538),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 143/193 (74%), Gaps = 7/193 (4%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYW++ +ADES SF  VK +YIASTSW RALQIPDAAV+F+ ++      A+V+SQKD
Sbjct  521  HSSYWINLFADESGSFPEVKADYIASTSWQRALQIPDAAVTFDDKEPL---LARVVSQKD  577

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             + TR VWNPGSEF+ CDC WSMQGNLCKHV+KVNM+CG+ + F+ S+SFQS+Q +L++L
Sbjct  578  TSQTRTVWNPGSEFSLCDCSWSMQGNLCKHVLKVNMMCGARKDFQPSLSFQSYQHVLLDL  637

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWI-SRKRRTSRGK  245
             +KP+DDS +LDLS AW  QM ++I+++ EL +S  I  +   +P++W   R RR +  +
Sbjct  638  WQKPLDDSFSLDLSVAWVMQMQEKIKHVAELATSGGIVQVAGKLPIQWTKKRGRRVAAKR  697

Query  244  PTSALTLPPSSQS  206
            P   L LP S+ S
Sbjct  698  P---LLLPHSNGS  707



>ref|XP_006840321.1| PREDICTED: uncharacterized protein LOC18430096 isoform X1 [Amborella 
trichopoda]
 gb|ERN01996.1| hypothetical protein AMTR_s00045p00084300 [Amborella trichopoda]
Length=719

 Score =   211 bits (536),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 138/186 (74%), Gaps = 3/186 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLDRYAD+S  FQ VKEEY+ STSW+RAL IPD AV+F+ +    H FAKV+SQKD
Sbjct  512  HSIYWLDRYADDSGLFQTVKEEYMLSTSWHRALLIPDNAVNFDEKD---HLFAKVVSQKD  568

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            +  + +VWNPGSEFA CDCEWSM+GNLCKHVIKVNM+C +       MSFQSF++IL  L
Sbjct  569  STRSHVVWNPGSEFALCDCEWSMKGNLCKHVIKVNMVCRNSSKNELPMSFQSFRQILNTL  628

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             KKP DDS  LD S AW  Q+ ++IQ LVEL+SSN IG++V  +P++W+ ++ RT   KP
Sbjct  629  WKKPQDDSFELDQSMAWCTQLHEKIQGLVELDSSNGIGSLVGTLPVKWVCKRSRTVAAKP  688

Query  241  TSALTL  224
             +  +L
Sbjct  689  PNGQSL  694



>ref|XP_004968166.1| PREDICTED: uncharacterized protein LOC101763681 [Setaria italica]
Length=727

 Score =   211 bits (536),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 138/192 (72%), Gaps = 3/192 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYW++ ++DES SF  VK +YIASTSW RALQIPD AV F+ ++      AKV+SQKD
Sbjct  518  HSSYWINLFSDESGSFPEVKADYIASTSWQRALQIPDDAVIFDDKEPL---LAKVVSQKD  574

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             +  R VWNPGSEF+ C+C WSMQGNLCKHV+KVNM+CG+ + F+ S+SFQSFQ +L+ L
Sbjct  575  PSQMRTVWNPGSEFSLCNCSWSMQGNLCKHVLKVNMMCGTRKDFQPSLSFQSFQHVLLGL  634

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KP DDS +LDLS AW  QM ++IQ++ EL +S+ I  +   +P++W  R  R    K 
Sbjct  635  WQKPSDDSFSLDLSVAWVMQMQERIQHIAELATSDGIAQVAGKLPIQWTKRSGRRRAAKR  694

Query  241  TSALTLPPSSQS  206
            TS L LP S+ S
Sbjct  695  TSPLVLPHSNGS  706



>ref|XP_008644121.1| PREDICTED: uncharacterized protein LOC100383900 isoform X1 [Zea 
mays]
 gb|AFW66990.1| hypothetical protein ZEAMMB73_942101 [Zea mays]
Length=725

 Score =   210 bits (534),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 142/192 (74%), Gaps = 3/192 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYW++ +ADES SF  VK +YIASTSW RALQIPD AV+F+ +       A+V+SQK+
Sbjct  516  HSSYWINLFADESGSFPEVKADYIASTSWQRALQIPDDAVTFDDKDPL---VARVVSQKE  572

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             + TR VW+PGSEF+ C+C WSMQGNLCKHV+KVNM+CG+ + F+ S+SFQSFQ +L++L
Sbjct  573  TSQTRTVWSPGSEFSLCNCSWSMQGNLCKHVLKVNMVCGARKDFQPSLSFQSFQHVLLDL  632

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KP+DDS +LDLS A   QM ++I+++ EL +S+ I  +   +P++W  ++ R    KP
Sbjct  633  WQKPLDDSFSLDLSVARVMQMQEKIKHVAELATSSGIAQVAGKLPMQWTKKRGRRVGVKP  692

Query  241  TSALTLPPSSQS  206
            TSAL LP S  S
Sbjct  693  TSALLLPRSKGS  704



>ref|XP_006660525.1| PREDICTED: uncharacterized protein LOC102707611 [Oryza brachyantha]
Length=728

 Score =   208 bits (529),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 134/190 (71%), Gaps = 3/190 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWL+ YADES SF  VK EY+ASTSW RAL+IPD AV  + ++      AKV SQKD
Sbjct  518  HSSYWLNLYADESGSFPEVKAEYVASTSWQRALKIPDDAVIIDDKEP---FLAKVASQKD  574

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             N    VWNPGSEF+ C C WSMQGNLCKH+IKVNM+CG  + F+ S+SFQSFQ +L++L
Sbjct  575  TNQMWNVWNPGSEFSFCGCSWSMQGNLCKHIIKVNMMCGPRKDFQPSLSFQSFQRVLLDL  634

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KPMDDS +LDLS AW  QM ++IQ + EL +S+ I  +   +P++W ++K R    K 
Sbjct  635  WQKPMDDSFSLDLSVAWVMQMQERIQKVTELATSDGIAQVSGRLPVQWTNKKGRRIATKR  694

Query  241  TSALTLPPSS  212
            TS L + P S
Sbjct  695  TSPLRVLPHS  704



>ref|XP_003576405.1| PREDICTED: uncharacterized protein LOC100828723 [Brachypodium 
distachyon]
Length=726

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 136/190 (72%), Gaps = 3/190 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWL+ YADES SF  VK EYIASTSW RA+QIPD +V F+ ++      AKV SQKD
Sbjct  516  HSGYWLNLYADESGSFPQVKAEYIASTSWQRAVQIPDDSVVFDDKEPLS---AKVASQKD  572

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             +  R+VWN GSEF+ CDC WSMQGNLCKH+IKVNMIC   + F+ S+SFQSFQ +L++L
Sbjct  573  ASQMRIVWNAGSEFSLCDCSWSMQGNLCKHIIKVNMICAPRKDFQPSLSFQSFQHVLLDL  632

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KP+DDS +LDLS AW  QM ++IQ + EL +S+ I  +   +P++W +++ R +  + 
Sbjct  633  WQKPVDDSFSLDLSVAWVMQMQERIQKVSELATSDGIAQVAGKLPIQWSNKRGRRTALRR  692

Query  241  TSALTLPPSS  212
            TS + + P S
Sbjct  693  TSPMRVLPHS  702



>dbj|BAK04195.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=729

 Score =   196 bits (498),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 132/190 (69%), Gaps = 3/190 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWL+ YADES SF  VK EYIASTSW RAL IPD AV F+ ++      AKV SQKD
Sbjct  519  HSGYWLNLYADESGSFPEVKAEYIASTSWQRALHIPDEAVLFDDKEPVS---AKVASQKD  575

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             +  R VWN GSEF+ C C WSMQGNLCKHVIKVNM+    +  + S+SFQSFQ +L++L
Sbjct  576  ASQMRTVWNAGSEFSLCSCSWSMQGNLCKHVIKVNMMYAPRKDVQPSLSFQSFQRVLLDL  635

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KP+DDS +LDLS AW  QM ++IQ + EL +S+ I  +   +P++W++++ R +  + 
Sbjct  636  WQKPLDDSFSLDLSVAWVMQMQERIQKVAELAASDGIAQVAGKLPIQWVNKRGRGTAIRR  695

Query  241  TSALTLPPSS  212
            TS + + P S
Sbjct  696  TSPMHILPHS  705



>gb|KDO50310.1| hypothetical protein CISIN_1g005059mg [Citrus sinensis]
Length=656

 Score =   187 bits (475),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  619  VLSQKDNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQ  440
            V SQKD+++T LVWNPGSEFA CDC WSMQGN+CKHV+KVNMIC + +G++ SMSFQS +
Sbjct  502  VSSQKDSSLTHLVWNPGSEFAFCDCAWSMQGNICKHVVKVNMICANNEGYQPSMSFQSLR  561

Query  439  EILMNLLKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRR  260
            E+LMNL  KPMDDSV LDLS AWT  MLDQI+ LVEL+SS++IG +VNN+PL+W+S+K R
Sbjct  562  EVLMNLWTKPMDDSVELDLSVAWTHNMLDQIKQLVELSSSDDIGAVVNNLPLKWVSKKGR  621

Query  259  TSRGKPTSALTLPPSSQSGAIN  194
            TS G P+S L LP SS+S  ++
Sbjct  622  TSVGIPSSTLALPSSSKSSTVH  643



>ref|XP_003628102.1| Cellulose synthase [Medicago truncatula]
 gb|AET02578.1| cellulose synthase [Medicago truncatula]
Length=422

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 133/184 (72%), Gaps = 20/184 (11%)
 Frame = -3

Query  763  DRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKDNNVTRL  584
            D +    DSFQNVKE YIASTSW+RAL+IPD+AV+ +++ +    FAKV S+KD+++T +
Sbjct  104  DSHLGALDSFQNVKEGYIASTSWHRALEIPDSAVTLDNKNRL---FAKVASKKDSSLTHI  160

Query  583  VWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNLLKKPMD  404
            VWNPGSE + CDC WS+ GN+CKHVIKVNMIC ++QG +SSMSF+SF+E+LM+LL+KP+D
Sbjct  161  VWNPGSECSFCDCSWSLHGNVCKHVIKVNMICENLQGCQSSMSFRSFEEVLMDLLRKPVD  220

Query  403  DSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKPT--SAL  230
            DS                   L ELN+S +IG +VNNMPL+W+S+K R + GK +  S L
Sbjct  221  DS---------------SNSKLFELNNSTDIGTVVNNMPLKWVSKKPRNNIGKQSSISIL  265

Query  229  TLPP  218
             L P
Sbjct  266  ALLP  269



>gb|EMT08273.1| hypothetical protein F775_06016 [Aegilops tauschii]
Length=724

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 117/190 (62%), Gaps = 21/190 (11%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWL+ YADES SF  VK EYIASTSW RAL IPD AV F+ ++      AKV SQKD
Sbjct  532  HSGYWLNLYADESGSFPEVKAEYIASTSWQRALHIPDEAVLFDHKEPLS---AKVASQKD  588

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             +  R                   GNLCKHVIKVNM+    +  + S+SFQSFQ +L++L
Sbjct  589  ASQMR------------------TGNLCKHVIKVNMMYAPRKDVQPSLSFQSFQRVLLDL  630

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKP  242
             +KP+DDS +LDLS AW  QM ++IQ + EL +S+ I  +   +P++W +++ R +  + 
Sbjct  631  WQKPLDDSFSLDLSVAWVMQMQERIQKVAELAASDGIAQVAGKLPIQWANKRGRRTAIRR  690

Query  241  TSALTLPPSS  212
            TS + + P S
Sbjct  691  TSPMCILPHS  700



>gb|EPS61942.1| hypothetical protein M569_12851, partial [Genlisea aurea]
Length=691

 Score =   142 bits (358),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 119/182 (65%), Gaps = 17/182 (9%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLDRYADE+DSF++VK+EYI STSW+RALQIPD+ V  +S         +V SQK+
Sbjct  519  HSGYWLDRYADETDSFRDVKDEYIRSTSWHRALQIPDSCVLPDSDLS-----VRVTSQKE  573

Query  601  NN-----VTRLVWNPGSEFAHCDCE-WSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQ  440
            ++      + +VWNPGSEF+HC CE  S +GNLC+HV+KV M+          MSF+S +
Sbjct  574  DDGGGPAKSHVVWNPGSEFSHCTCESSSTKGNLCEHVLKVGMVSDE----DLPMSFRSLK  629

Query  439  EILMNLLK--KPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRK  266
             IL++  +  KP D S+ LD++ A T ++LD+++   +L    ++  +V+ M  +WI +K
Sbjct  630  AILIDAWRKMKPADGSMDLDVANAMTWRVLDRVRMFGDLYRHGDVSRVVDGMVPKWIGKK  689

Query  265  RR  260
             R
Sbjct  690  AR  691



>ref|XP_007013719.1| SWIM zinc finger family protein isoform 3 [Theobroma cacao]
 ref|XP_007013721.1| SWIM zinc finger family protein isoform 3 [Theobroma cacao]
 ref|XP_007013722.1| SWIM zinc finger family protein isoform 3 [Theobroma cacao]
 gb|EOY31338.1| SWIM zinc finger family protein isoform 3 [Theobroma cacao]
 gb|EOY31340.1| SWIM zinc finger family protein isoform 3 [Theobroma cacao]
 gb|EOY31341.1| SWIM zinc finger family protein isoform 3 [Theobroma cacao]
Length=577

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 94/151 (62%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWL++Y  E+  F N ++E  ++ +WY+AL IP+  V  + +       AKV+SQ D
Sbjct  402  HSLYWLEQYTRETGYFPNFRDESFSTNAWYQALHIPNVDVILDEQNLQ---LAKVISQTD  458

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             N+   +WNPGSEF+ CDC+WS  GNLCKHVIKV MIC + Q  R  +S Q +++ L++L
Sbjct  459  RNLAYAIWNPGSEFSLCDCDWSSLGNLCKHVIKVAMICKNRQVARPLLSAQIYRQTLLSL  518

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L  P DD V LD +     ++   I+ L +L
Sbjct  519  LHNPPDDPVILDHAILCATRLQQDIKGLEDL  549



>ref|XP_010648578.1| PREDICTED: uncharacterized protein LOC100245761 isoform X2 [Vitis 
vinifera]
 ref|XP_010648579.1| PREDICTED: uncharacterized protein LOC100245761 isoform X2 [Vitis 
vinifera]
 ref|XP_010648580.1| PREDICTED: uncharacterized protein LOC100245761 isoform X2 [Vitis 
vinifera]
Length=562

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 91/151 (60%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWL++Y  E+  F+N+++    + SWYRAL IPDA V  + +       AKV+SQ D
Sbjct  387  HSFYWLEQYIIETGYFENLRDVSFTTNSWYRALHIPDADVLLDEQNLQ---LAKVISQTD  443

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
              +   +WNPGSEF  CDC WS  GNLCKH IKV ++C S Q  R  +S Q +++ L+ L
Sbjct  444  RTLAYTIWNPGSEFCICDCPWSRLGNLCKHAIKVAILCKSRQVARPLLSAQVYRQALLTL  503

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+ P DD + LD +     ++   I+ L EL
Sbjct  504  LQNPPDDPLVLDHAILHVTRLQQDIKGLEEL  534



>ref|XP_007013717.1| SWIM zinc finger family protein isoform 1 [Theobroma cacao]
 gb|EOY31336.1| SWIM zinc finger family protein isoform 1 [Theobroma cacao]
Length=701

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 94/151 (62%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWL++Y  E+  F N ++E  ++ +WY+AL IP+  V  + +       AKV+SQ D
Sbjct  526  HSLYWLEQYTRETGYFPNFRDESFSTNAWYQALHIPNVDVILDEQNL---QLAKVISQTD  582

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             N+   +WNPGSEF+ CDC+WS  GNLCKHVIKV MIC + Q  R  +S Q +++ L++L
Sbjct  583  RNLAYAIWNPGSEFSLCDCDWSSLGNLCKHVIKVAMICKNRQVARPLLSAQIYRQTLLSL  642

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L  P DD V LD +     ++   I+ L +L
Sbjct  643  LHNPPDDPVILDHAILCATRLQQDIKGLEDL  673



>ref|XP_007013718.1| SWIM zinc finger family protein isoform 2 [Theobroma cacao]
 ref|XP_007013720.1| SWIM zinc finger family protein isoform 2 [Theobroma cacao]
 gb|EOY31337.1| SWIM zinc finger family protein isoform 2 [Theobroma cacao]
 gb|EOY31339.1| SWIM zinc finger family protein isoform 2 [Theobroma cacao]
Length=697

 Score =   134 bits (337),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 94/151 (62%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWL++Y  E+  F N ++E  ++ +WY+AL IP+  V  + +       AKV+SQ D
Sbjct  522  HSLYWLEQYTRETGYFPNFRDESFSTNAWYQALHIPNVDVILDEQNLQ---LAKVISQTD  578

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             N+   +WNPGSEF+ CDC+WS  GNLCKHVIKV MIC + Q  R  +S Q +++ L++L
Sbjct  579  RNLAYAIWNPGSEFSLCDCDWSSLGNLCKHVIKVAMICKNRQVARPLLSAQIYRQTLLSL  638

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L  P DD V LD +     ++   I+ L +L
Sbjct  639  LHNPPDDPVILDHAILCATRLQQDIKGLEDL  669



>gb|KHG17737.1| Arrestin-C [Gossypium arboreum]
Length=690

 Score =   134 bits (337),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 94/151 (62%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLD+Y  E+  F N+++E  ++ +WY+AL IPD  V  + +       AKV+SQ D
Sbjct  515  HSLYWLDQYTVETGYFSNLRDESFSTNAWYQALHIPDIDVILDEQNL---QVAKVISQTD  571

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             N+   +WNPGSEF+ CDC WS  GNLCKHVIKV M+C + Q  R  ++ Q +++ L++L
Sbjct  572  RNLAYTIWNPGSEFSLCDCHWSNLGNLCKHVIKVAMMCKNRQVARPLLAAQIYRQTLLSL  631

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L  P DD V LD +   T ++   I+   +L
Sbjct  632  LHNPPDDPVVLDHAILCTTRLQQDIKGWEDL  662



>gb|KJB64570.1| hypothetical protein B456_010G054400 [Gossypium raimondii]
 gb|KJB64571.1| hypothetical protein B456_010G054400 [Gossypium raimondii]
Length=697

 Score =   134 bits (336),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 94/151 (62%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLD+Y  E+  F N+++E  ++ +WY+AL IPD  V  + +       AKV+SQ D
Sbjct  522  HSLYWLDQYIVETGYFSNLRDESFSTNAWYQALHIPDIDVILDEQNL---QVAKVISQTD  578

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             N+   +WNPGSEF+ CDC WS  GNLCKHVIKV M+C + Q  R  ++ Q +++ L++L
Sbjct  579  RNLAYTIWNPGSEFSLCDCHWSNLGNLCKHVIKVAMMCKNRQVARPLLAAQIYRQTLLSL  638

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L  P DD V LD +   T ++   I+   +L
Sbjct  639  LHNPPDDPVVLDHAILCTTRLQQDIKGWEDL  669



>ref|XP_002281999.2| PREDICTED: uncharacterized protein LOC100245761 isoform X1 [Vitis 
vinifera]
 ref|XP_010648575.1| PREDICTED: uncharacterized protein LOC100245761 isoform X1 [Vitis 
vinifera]
 ref|XP_010648576.1| PREDICTED: uncharacterized protein LOC100245761 isoform X1 [Vitis 
vinifera]
 ref|XP_010648577.1| PREDICTED: uncharacterized protein LOC100245761 isoform X1 [Vitis 
vinifera]
 emb|CBI20949.3| unnamed protein product [Vitis vinifera]
Length=697

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 91/151 (60%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWL++Y  E+  F+N+++    + SWYRAL IPDA V  +   +     AKV+SQ D
Sbjct  522  HSFYWLEQYIIETGYFENLRDVSFTTNSWYRALHIPDADVLLD---EQNLQLAKVISQTD  578

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
              +   +WNPGSEF  CDC WS  GNLCKH IKV ++C S Q  R  +S Q +++ L+ L
Sbjct  579  RTLAYTIWNPGSEFCICDCPWSRLGNLCKHAIKVAILCKSRQVARPLLSAQVYRQALLTL  638

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+ P DD + LD +     ++   I+ L EL
Sbjct  639  LQNPPDDPLVLDHAILHVTRLQQDIKGLEEL  669



>ref|XP_004292961.2| PREDICTED: uncharacterized protein LOC101313282 [Fragaria vesca 
subsp. vesca]
Length=697

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 95/150 (63%), Gaps = 3/150 (2%)
 Frame = -3

Query  778  SSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKDN  599
            SSYWLD+Y+ E+  F+N+++    +  WY+ALQI D  V  +   +    +AKV+SQ D 
Sbjct  524  SSYWLDQYSVETGYFENLRDRSFLTNCWYQALQILDVDVIID---EQNLQYAKVISQSDR  580

Query  598  NVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNLL  419
            +V   +WNPGSEF+ CDC WSM GNLCKH+IKV ++C S Q  R  ++ Q +++ L+ LL
Sbjct  581  SVVYTIWNPGSEFSLCDCPWSMLGNLCKHIIKVAILCKSRQVARPLLAAQVYRQALLTLL  640

Query  418  KKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            + P DD V LD +     ++   I+ L +L
Sbjct  641  QNPPDDPVVLDHAILHATRLQQDIKGLEDL  670



>ref|XP_006578182.1| PREDICTED: uncharacterized protein LOC100779025 [Glycine max]
Length=690

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 93/151 (62%), Gaps = 6/151 (4%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLD+Y+ E+  F+N+++   +S +WY AL IPD  V  + +     H AKVLSQ D
Sbjct  515  HSLYWLDQYSLETGYFENLRDNSFSSNAWYHALHIPDVDVILDEQNL---HLAKVLSQTD  571

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             ++   V NPGSEF+ CDC WS  GNLCKHVIKV   C S Q  R S+S Q +++ L+ L
Sbjct  572  RSLVYTVSNPGSEFSLCDCSWSRLGNLCKHVIKVATFCRSRQVARPSLSAQVYKQALLTL  631

Query  421  LKKPMDDSVALD---LSTAWTQQMLDQIQNL  338
            L  P DD + LD   L  A  QQ +  +++L
Sbjct  632  LHNPPDDPLVLDHTILHVAHLQQDIKALEDL  662



>gb|KHN10289.1| hypothetical protein glysoja_017893 [Glycine soja]
Length=723

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 93/151 (62%), Gaps = 6/151 (4%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLD+Y+ E+  F+N+++   +S +WY AL IPD  V  + +     H AKVLSQ D
Sbjct  548  HSLYWLDQYSLETGYFENLRDNSFSSNAWYHALHIPDVDVILDEQNL---HLAKVLSQTD  604

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             ++   V NPGSEF+ CDC WS  GNLCKHVIKV   C S Q  R S+S Q +++ L+ L
Sbjct  605  RSLVYTVSNPGSEFSLCDCSWSRLGNLCKHVIKVATFCRSRQVARPSLSAQVYKQALLTL  664

Query  421  LKKPMDDSVALD---LSTAWTQQMLDQIQNL  338
            L  P DD + LD   L  A  QQ +  +++L
Sbjct  665  LHNPPDDPLVLDHTILHVAHLQQDIKALEDL  695



>ref|XP_006842250.2| PREDICTED: uncharacterized protein LOC18432077, partial [Amborella 
trichopoda]
Length=690

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 94/151 (62%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS  W D+YA+ES  F+N++E+  +  SW RAL I D  V  +   +    F KV+SQ D
Sbjct  522  HSLCWFDQYAEESAFFRNMREQSFSMNSWRRALHISDDDVILD---EEDLLFVKVISQSD  578

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             +    +WNPGSEF+ CDC WS  GN+CKH+IKV ++C   Q  R S++ Q+++EIL++L
Sbjct  579  RSHAYTIWNPGSEFSLCDCPWSRHGNVCKHIIKVGVLCRHRQVARPSLALQAYREILLSL  638

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+ P DD + LD +     +M   ++ L EL
Sbjct  639  LQNPPDDPIVLDHAMVHATRMQQDLKGLEEL  669



>gb|ERN03925.1| hypothetical protein AMTR_s00078p00196690 [Amborella trichopoda]
Length=786

 Score =   132 bits (333),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 94/151 (62%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS  W D+YA+ES  F+N++E+  +  SW RAL I D  V  +   +    F KV+SQ D
Sbjct  537  HSLCWFDQYAEESAFFRNMREQSFSMNSWRRALHISDDDVILD---EEDLLFVKVISQSD  593

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             +    +WNPGSEF+ CDC WS  GN+CKH+IKV ++C   Q  R S++ Q+++EIL++L
Sbjct  594  RSHAYTIWNPGSEFSLCDCPWSRHGNVCKHIIKVGVLCRHRQVARPSLALQAYREILLSL  653

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+ P DD + LD +     +M   ++ L EL
Sbjct  654  LQNPPDDPIVLDHAMVHATRMQQDLKGLEEL  684



>ref|XP_011019706.1| PREDICTED: uncharacterized protein LOC105122342 isoform X3 [Populus 
euphratica]
Length=583

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 94/151 (62%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLD+Y+ E+  F   +++  ++ +WY+AL IPD  V  + +       AKV+SQ D
Sbjct  408  HSLYWLDQYSAETGYFTYARDKSFSTNAWYQALHIPDVDVILDEQNL---QLAKVISQTD  464

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             ++   +WNPGSEFA CDC WS QGNLCKHVIKV ++C + Q  R  ++ Q +++ L+ L
Sbjct  465  RSLAYTIWNPGSEFALCDCPWSRQGNLCKHVIKVAILCKNRQVARPLLASQVYRQALLTL  524

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+ P DD + L+ +     ++   I+ L +L
Sbjct  525  LQNPPDDPLVLEHAILRVSRLQQDIKGLEDL  555



>ref|XP_011019704.1| PREDICTED: uncharacterized protein LOC105122342 isoform X1 [Populus 
euphratica]
Length=697

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 94/151 (62%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLD+Y+ E+  F   +++  ++ +WY+AL IPD  V  +   +     AKV+SQ D
Sbjct  522  HSLYWLDQYSAETGYFTYARDKSFSTNAWYQALHIPDVDVILD---EQNLQLAKVISQTD  578

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             ++   +WNPGSEFA CDC WS QGNLCKHVIKV ++C + Q  R  ++ Q +++ L+ L
Sbjct  579  RSLAYTIWNPGSEFALCDCPWSRQGNLCKHVIKVAILCKNRQVARPLLASQVYRQALLTL  638

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+ P DD + L+ +     ++   I+ L +L
Sbjct  639  LQNPPDDPLVLEHAILRVSRLQQDIKGLEDL  669



>ref|XP_011019705.1| PREDICTED: uncharacterized protein LOC105122342 isoform X2 [Populus 
euphratica]
Length=690

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 94/151 (62%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLD+Y+ E+  F   +++  ++ +WY+AL IPD  V  +   +     AKV+SQ D
Sbjct  515  HSLYWLDQYSAETGYFTYARDKSFSTNAWYQALHIPDVDVILD---EQNLQLAKVISQTD  571

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             ++   +WNPGSEFA CDC WS QGNLCKHVIKV ++C + Q  R  ++ Q +++ L+ L
Sbjct  572  RSLAYTIWNPGSEFALCDCPWSRQGNLCKHVIKVAILCKNRQVARPLLASQVYRQALLTL  631

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+ P DD + L+ +     ++   I+ L +L
Sbjct  632  LQNPPDDPLVLEHAILRVSRLQQDIKGLEDL  662



>ref|XP_007224640.1| hypothetical protein PRUPE_ppa026389mg, partial [Prunus persica]
 gb|EMJ25839.1| hypothetical protein PRUPE_ppa026389mg, partial [Prunus persica]
Length=688

 Score =   128 bits (322),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = -3

Query  778  SSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKDN  599
            SSYWLD+Y+ E+  F+N++++  ++ +WY+ALQI +  V  +   +    +AKV+SQ D 
Sbjct  515  SSYWLDQYSIETGYFENLRDKSFSTNAWYQALQILNVDVILD---EQNLQYAKVISQTDR  571

Query  598  NVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNLL  419
            ++   +WNPGSEF+ CDC WS  GNLCKHVIKV + C S Q  R  +S Q +++ L+ LL
Sbjct  572  SLAYTIWNPGSEFSLCDCPWSRLGNLCKHVIKVAITCKSRQVARPLLSAQVYRQALLTLL  631

Query  418  KKPMDDSVALDLSTAWTQQMLDQIQNL  338
            + P DD V LD +     ++   I+ L
Sbjct  632  QNPPDDPVVLDHAILHATRLQQDIKGL  658



>ref|XP_010095498.1| hypothetical protein L484_014926 [Morus notabilis]
 gb|EXB60472.1| hypothetical protein L484_014926 [Morus notabilis]
Length=690

 Score =   128 bits (322),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 95/151 (63%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLD+Y+ E+  F N++++  ++ +W +ALQIPD  V  +   +     AKV+SQ D
Sbjct  512  HSLYWLDQYSSETGYFDNLRDKAFSTNAWCQALQIPDVDVILD---EHNLQLAKVISQTD  568

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             ++   + NPGSEF+ CDC WS  GNLCKHVIKV M+C S Q  R  ++ Q +++ L+ L
Sbjct  569  RSLAYTILNPGSEFSLCDCPWSGVGNLCKHVIKVAMLCKSRQVARPLLAAQVYRQTLLAL  628

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            ++ P DD + LD +     ++  +I+ L EL
Sbjct  629  MQNPPDDPLVLDHAILHATRLQQEIKGLEEL  659



>ref|XP_006476176.1| PREDICTED: uncharacterized protein LOC102625159 isoform X1 [Citrus 
sinensis]
Length=697

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 95/151 (63%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLD+Y+ E+  F+N++++  ++ +W +AL IPD  V  + +       AK++SQ D
Sbjct  522  HSLYWLDQYSMETGYFENLRDDSFSTNAWSQALHIPDVNVMLDEQNL---QLAKIISQAD  578

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
              +   +WNPGSEF+ CDC WS  GN+C+HVIK+ M+C S Q  R  ++ Q +++ L++L
Sbjct  579  RTLAYTIWNPGSEFSLCDCPWSRLGNVCEHVIKLAMVCKSRQVARPLLAAQVYRQALLSL  638

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+ P DD + L+ +     ++   I+ L EL
Sbjct  639  LQNPPDDPLVLEYAIVHATRLQQDIKGLEEL  669



>gb|KDO79654.1| hypothetical protein CISIN_1g039513mg [Citrus sinensis]
Length=690

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 95/151 (63%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLD+Y+ E+  F+N++++  ++ +W +AL IPD  V  + +       AK++SQ D
Sbjct  515  HSLYWLDQYSMETGYFENLRDDSFSTNAWSQALHIPDVNVMLDEQNL---QLAKIISQAD  571

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
              +   +WNPGSEF+ CDC WS  GN+C+HVIK+ M+C S Q  R  ++ Q +++ L++L
Sbjct  572  RTLAYTIWNPGSEFSLCDCPWSRLGNVCEHVIKLAMVCKSRQVARPLLAAQVYRQALLSL  631

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+ P DD + L+ +     ++   I+ L EL
Sbjct  632  LQNPPDDPLVLEYAIVHATRLQQDIKGLEEL  662



>ref|XP_006450581.1| hypothetical protein CICLE_v10010703mg [Citrus clementina]
 gb|ESR63821.1| hypothetical protein CICLE_v10010703mg [Citrus clementina]
Length=697

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 95/151 (63%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLD+Y+ E+  F+N++++  ++ +W +AL IPD  V  + +       AK++SQ D
Sbjct  522  HSLYWLDQYSMETGYFENLRDDSFSTNAWSQALHIPDVNVMLDEQNL---QLAKIISQAD  578

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
              +   +WNPGSEF+ CDC WS  GN+C+HVIK+ M+C S Q  R  ++ Q +++ L++L
Sbjct  579  RTLAYTIWNPGSEFSLCDCPWSRLGNVCEHVIKLAMVCKSRQVARPLLAAQVYRQALLSL  638

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+ P DD + L+ +     ++   I+ L EL
Sbjct  639  LQNPPDDPLVLEYAIVHATRLQQDIKGLEEL  669



>ref|XP_012065273.1| PREDICTED: uncharacterized protein LOC105628473 [Jatropha curcas]
Length=702

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 93/151 (62%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLD+Y+ ES  F ++++E   S +WY+AL I D  V  +   +     AKV+SQ D
Sbjct  525  HSLYWLDQYSLESGYFASLRDESFLSNAWYQALHISDVDVMLD---EQNLQLAKVISQTD  581

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             ++   +WNPG+EF+ CDC WS  GNLCKHVIKV +IC + Q  R  ++ Q +++ L+ L
Sbjct  582  RSLAYTIWNPGTEFSLCDCPWSRLGNLCKHVIKVAVICKNRQVARPLLATQVYRQALLTL  641

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+ P DD V L+ +     ++   I+ L +L
Sbjct  642  LQNPTDDPVVLEHAILLATRLQQDIKGLEDL  672



>gb|KDP43797.1| hypothetical protein JCGZ_23005 [Jatropha curcas]
Length=694

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 93/151 (62%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLD+Y+ ES  F ++++E   S +WY+AL I D  V  +   +     AKV+SQ D
Sbjct  517  HSLYWLDQYSLESGYFASLRDESFLSNAWYQALHISDVDVMLD---EQNLQLAKVISQTD  573

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             ++   +WNPG+EF+ CDC WS  GNLCKHVIKV +IC + Q  R  ++ Q +++ L+ L
Sbjct  574  RSLAYTIWNPGTEFSLCDCPWSRLGNLCKHVIKVAVICKNRQVARPLLATQVYRQALLTL  633

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+ P DD V L+ +     ++   I+ L +L
Sbjct  634  LQNPTDDPVVLEHAILLATRLQQDIKGLEDL  664



>ref|XP_010249825.1| PREDICTED: uncharacterized protein LOC104592258 isoform X2 [Nelumbo 
nucifera]
Length=681

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 91/151 (60%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YW ++Y +E+  F+N++E   ++ SWYRAL IPD  V  +   +      KV S  D
Sbjct  505  HSLYWFEQYTEETGYFRNLREGSFSNNSWYRALLIPDDDVIMD---EEDLRIVKVFSLSD  561

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
              +   +WNPGSEFA CDC WS  GNLCKHVIKV ++C +    R S++ Q++++ L++L
Sbjct  562  RGLAYTIWNPGSEFALCDCPWSRLGNLCKHVIKVGILCRNRHVARPSLAAQTYRQALLSL  621

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+   DD + LD +     +M   I+ L +L
Sbjct  622  LQNLPDDPIVLDHAILHVTRMQQDIKGLEDL  652



>ref|XP_010249820.1| PREDICTED: uncharacterized protein LOC104592258 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010249821.1| PREDICTED: uncharacterized protein LOC104592258 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010249822.1| PREDICTED: uncharacterized protein LOC104592258 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010249823.1| PREDICTED: uncharacterized protein LOC104592258 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010249824.1| PREDICTED: uncharacterized protein LOC104592258 isoform X1 [Nelumbo 
nucifera]
Length=694

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 91/151 (60%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YW ++Y +E+  F+N++E   ++ SWYRAL IPD  V  +   +      KV S  D
Sbjct  518  HSLYWFEQYTEETGYFRNLREGSFSNNSWYRALLIPDDDVIMD---EEDLRIVKVFSLSD  574

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
              +   +WNPGSEFA CDC WS  GNLCKHVIKV ++C +    R S++ Q++++ L++L
Sbjct  575  RGLAYTIWNPGSEFALCDCPWSRLGNLCKHVIKVGILCRNRHVARPSLAAQTYRQALLSL  634

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+   DD + LD +     +M   I+ L +L
Sbjct  635  LQNLPDDPIVLDHAILHVTRMQQDIKGLEDL  665



>ref|XP_008219841.1| PREDICTED: uncharacterized protein LOC103320013 [Prunus mume]
Length=695

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = -3

Query  778  SSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKDN  599
            SSYWLD+Y+ E+  F+N++++  ++ +WY+ALQI +  V  +   +    +AKV+SQ D 
Sbjct  522  SSYWLDQYSIETGYFENLRDKSFSTNAWYQALQILNVDVILD---EQNLQYAKVISQTDR  578

Query  598  NVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNLL  419
            ++   +WNPGSEF+ CDC WS  GNLCKHVIKV + C S Q  R  +S Q +++ L+ LL
Sbjct  579  SLAYTIWNPGSEFSLCDCPWSRLGNLCKHVIKVAITCKSQQVARPLLSAQVYRQALLTLL  638

Query  418  KKPMDDSVALDLSTAWTQQMLDQIQNL  338
            + P DD + LD +     ++   I+ L
Sbjct  639  QNPPDDPLVLDHAILHATRLQQDIKGL  665



>gb|EYU21901.1| hypothetical protein MIMGU_mgv1a023458mg [Erythranthe guttata]
Length=679

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 93/151 (62%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YW ++Y  E+  F+N+++ +  +  W +A  IPD  V  +   +     AKV+SQ D
Sbjct  511  HSFYWFEQYTVETGYFENLRDRFSITNPWNQATHIPDIDVLLD---EENLQLAKVVSQAD  567

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            NNV   +WNPGSEFA CDC WSM GN+CKHVIKV + C S Q  R  +S Q +++ L+NL
Sbjct  568  NNVAYTIWNPGSEFALCDCSWSMVGNMCKHVIKVAIFCRSRQIARPLLSAQVYRQTLVNL  627

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+   +D + L+ + +   ++   I++L +L
Sbjct  628  LQNLPEDPLVLEHAISHVTRLEQDIKSLEDL  658



>ref|XP_010049050.1| PREDICTED: uncharacterized protein LOC104437738 isoform X2 [Eucalyptus 
grandis]
Length=640

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 93/151 (62%), Gaps = 4/151 (3%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSS+WLD+Y+  +  F+NV++    S +W+RAL I D  V  E +       AKVLS+ D
Sbjct  464  HSSFWLDQYSLGTGCFENVRDPSFTSNAWHRALNILDVNVILEEQNLL---LAKVLSE-D  519

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             N    VWNPGSEF+ CDC WS  GNLC+HVIKV  +C + Q   +S+  Q +++ +++L
Sbjct  520  RNSVYTVWNPGSEFSLCDCAWSKCGNLCEHVIKVAFLCRTRQVAGTSLGSQGYRQAMLSL  579

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+KP  D + LD +     Q+ + + +L EL
Sbjct  580  LQKPPGDPIVLDHANLRATQLHEDVNSLEEL  610



>ref|XP_010049049.1| PREDICTED: uncharacterized protein LOC104437738 isoform X1 [Eucalyptus 
grandis]
 gb|KCW81512.1| hypothetical protein EUGRSUZ_C02873 [Eucalyptus grandis]
Length=693

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 93/151 (62%), Gaps = 4/151 (3%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSS+WLD+Y+  +  F+NV++    S +W+RAL I D  V  E +       AKVLS+ D
Sbjct  517  HSSFWLDQYSLGTGCFENVRDPSFTSNAWHRALNILDVNVILEEQNLL---LAKVLSE-D  572

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             N    VWNPGSEF+ CDC WS  GNLC+HVIKV  +C + Q   +S+  Q +++ +++L
Sbjct  573  RNSVYTVWNPGSEFSLCDCAWSKCGNLCEHVIKVAFLCRTRQVAGTSLGSQGYRQAMLSL  632

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+KP  D + LD +     Q+ + + +L EL
Sbjct  633  LQKPPGDPIVLDHANLRATQLHEDVNSLEEL  663



>gb|EYU24925.1| hypothetical protein MIMGU_mgv1a022371mg, partial [Erythranthe 
guttata]
Length=337

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 83/132 (63%), Gaps = 3/132 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YW ++Y  E+  F+N+++ +  +  W +A  IPD  V  +   +     AKV+SQ D
Sbjct  201  HSFYWFEQYTVETGYFENLRDRFSITNPWNQATHIPDIDVLLD---EENLQLAKVVSQAD  257

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            N+V   +WNPGSEFA CDC WSM GN+CKHVIKV + C S Q  R  +S Q +++ L+NL
Sbjct  258  NSVAYTIWNPGSEFALCDCSWSMVGNMCKHVIKVAIFCRSRQIARPLLSAQVYRQTLVNL  317

Query  421  LKKPMDDSVALD  386
            L+   +D + L+
Sbjct  318  LQNLPEDPLVLE  329



>ref|XP_007137090.1| hypothetical protein PHAVU_009G098900g [Phaseolus vulgaris]
 gb|ESW09084.1| hypothetical protein PHAVU_009G098900g [Phaseolus vulgaris]
Length=744

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 89/150 (59%), Gaps = 6/150 (4%)
 Frame = -3

Query  778  SSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKDN  599
            S YWLD+Y+ E+  F+N++     S +W+ AL IPD  V  +   +   H AKVLSQ D 
Sbjct  570  SLYWLDQYSLETGYFENLQGNSYTSNAWHHALHIPDVDVMLD---EQNLHLAKVLSQTDR  626

Query  598  NVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNLL  419
            ++   VWNPGSEF+ CDC WS  GNLCKHVIKV   C   Q  + S+S Q +++ L+ L 
Sbjct  627  SLVYTVWNPGSEFSLCDCSWSRLGNLCKHVIKVANFCRHRQVVKPSLSAQVYKQALLTLF  686

Query  418  KKPMDDSVALD---LSTAWTQQMLDQIQNL  338
            + P +D + LD   L  A  QQ +  +++ 
Sbjct  687  ENPPNDPLVLDHTMLHVARLQQDIKALEDF  716



>ref|XP_004501270.1| PREDICTED: uncharacterized protein LOC101505233 isoform X1 [Cicer 
arietinum]
 ref|XP_004501271.1| PREDICTED: uncharacterized protein LOC101505233 isoform X2 [Cicer 
arietinum]
 ref|XP_004501272.1| PREDICTED: uncharacterized protein LOC101505233 isoform X3 [Cicer 
arietinum]
Length=690

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 92/151 (61%), Gaps = 6/151 (4%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLD+Y+ ++  F+N+++   ++ +WY AL+IPD  V  +   +   H AKV SQ D
Sbjct  515  HSLYWLDQYSSQTGYFENLRDNSFSTNAWYCALRIPDVDVVLD---EQNLHLAKVSSQTD  571

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             ++   +WNPGSEF+ CDC  S  GNLCKHV+K+   C + Q  R  +S Q +++ L+ L
Sbjct  572  RDLVYTIWNPGSEFSLCDCSCSRLGNLCKHVVKMATFCRNRQVARPLLSSQIYKQALLTL  631

Query  421  LKKPMDDSVALD---LSTAWTQQMLDQIQNL  338
            L  P DD + LD   L  A  QQ +  +++L
Sbjct  632  LNNPPDDPLVLDHTNLHVARLQQEIKAMEDL  662



>ref|XP_011081862.1| PREDICTED: uncharacterized protein LOC105164788 isoform X2 [Sesamum 
indicum]
Length=562

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 93/151 (62%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YW D Y  E+  F+N+++ +  +  WY+A+ IPD  V  +   +   HFAKV+SQ D
Sbjct  387  HSFYWFDHYIAETGYFENLRDRFSLTNPWYQAMHIPDIDVLLD---EENLHFAKVVSQAD  443

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            ++V   VWNPGSEF  CDC WSM GN+CKH IKV + C   Q  R  +S Q +++ L+NL
Sbjct  444  SSVAYTVWNPGSEFGFCDCSWSMLGNMCKHTIKVVIFCRCRQIARPLLSAQVYRQTLLNL  503

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+   DD + L+ + A   ++   I++L +L
Sbjct  504  LQNLPDDPLVLEHAIAHVTRLQQDIKSLEDL  534



>ref|XP_011081859.1| PREDICTED: uncharacterized protein LOC105164788 isoform X1 [Sesamum 
indicum]
 ref|XP_011081860.1| PREDICTED: uncharacterized protein LOC105164788 isoform X1 [Sesamum 
indicum]
 ref|XP_011081861.1| PREDICTED: uncharacterized protein LOC105164788 isoform X1 [Sesamum 
indicum]
Length=697

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 93/151 (62%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YW D Y  E+  F+N+++ +  +  WY+A+ IPD  V  +   +   HFAKV+SQ D
Sbjct  522  HSFYWFDHYIAETGYFENLRDRFSLTNPWYQAMHIPDIDVLLD---EENLHFAKVVSQAD  578

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            ++V   VWNPGSEF  CDC WSM GN+CKH IKV + C   Q  R  +S Q +++ L+NL
Sbjct  579  SSVAYTVWNPGSEFGFCDCSWSMLGNMCKHTIKVVIFCRCRQIARPLLSAQVYRQTLLNL  638

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+   DD + L+ + A   ++   I++L +L
Sbjct  639  LQNLPDDPLVLEHAIAHVTRLQQDIKSLEDL  669



>ref|XP_009377375.1| PREDICTED: uncharacterized protein LOC103965988 [Pyrus x bretschneideri]
Length=696

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 92/148 (62%), Gaps = 3/148 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLD+Y+ E+  F+N++++  ++ +WY+ALQI D  V  +   +    +AKV+SQ D
Sbjct  522  HSSYWLDQYSTETGYFENLRDKSFSTNAWYQALQILDVDVILD---EQNLQYAKVISQTD  578

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             ++   +WNPGSEF+ CDC  S  GNLCKHVIKV + C   Q  R  ++ Q +++ L+ L
Sbjct  579  RSLAYTIWNPGSEFSFCDCPSSRLGNLCKHVIKVAISCKDRQVARPLLAAQVYRQALLTL  638

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNL  338
            L+   DD + LD +     ++   I+ L
Sbjct  639  LQNIPDDPLVLDHAILHATRLQQDIKAL  666



>ref|XP_002516601.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45942.1| conserved hypothetical protein [Ricinus communis]
Length=686

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 93/151 (62%), Gaps = 3/151 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLD+Y+ E+  F +V+++     +WY+AL I D  V  +   +     AKV+SQ D
Sbjct  512  HSSYWLDQYSVETGYFADVRDKSSLENAWYQALHISDVDVMLD---EQNLQLAKVISQTD  568

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             ++  ++WNPG+EF+ CDC WS  GNLCKH++KV ++C + Q  R  +  Q +++ L+ L
Sbjct  569  RSLAYIIWNPGTEFSLCDCPWSRLGNLCKHIVKVAILCKNRQVARPLLVAQVYRQALLAL  628

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+ P D+ + L+ +     ++   I+ L +L
Sbjct  629  LQDPPDNPLVLEHAIFHATRLQQDIKGLEDL  659



>ref|XP_008378289.1| PREDICTED: uncharacterized protein LOC103441391 [Malus domestica]
Length=696

 Score =   119 bits (299),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 92/148 (62%), Gaps = 3/148 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLD+Y+ E+  F+N++++  ++ +WY+ALQI D  V  +   +    +AKV+SQ D
Sbjct  522  HSSYWLDQYSMETGYFENLRDKSFSTNAWYQALQILDVDVILD---EQNLQYAKVISQTD  578

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             ++   +WNPGSEF+ CDC  S  GNLCKHVIKV + C   Q  R  ++ Q +++ L+ L
Sbjct  579  RSLAYTIWNPGSEFSFCDCPSSRLGNLCKHVIKVAISCKDRQVARPLLAAQVYRQTLLTL  638

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNL  338
            L+   DD + LD +     ++   I+ L
Sbjct  639  LQNIPDDPLVLDHAILHATRLQQDIKAL  666



>ref|XP_002271166.1| PREDICTED: uncharacterized protein LOC100264354 [Vitis vinifera]
 ref|XP_010658922.1| PREDICTED: uncharacterized protein LOC100264354 [Vitis vinifera]
Length=965

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 93/151 (62%), Gaps = 7/151 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + D  +  ++E+++  TSW +AL+IPD+ V  E R      FAKV+ Q+
Sbjct  512  HSYFWLDEYSGKDDFSRYWRDEWVSGLTSWRKALKIPDSDVVLERR------FAKVIDQQ  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +VWNPGSE+A CDC W+  GNLC+HV KV  +C +     SS+S   +++ L+N
Sbjct  566  DQDRAHIVWNPGSEYAICDCGWAEMGNLCEHVFKVISVCRNNGSSMSSISLFQYKQALIN  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVE  332
            +L  P +DS+  D + +    +  Q+  LV+
Sbjct  626  MLNCPPNDSLIRDHAVSLAVHVQIQLNTLVD  656



>emb|CBI29086.3| unnamed protein product [Vitis vinifera]
Length=962

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 93/151 (62%), Gaps = 7/151 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + D  +  ++E+++  TSW +AL+IPD+ V  E R      FAKV+ Q+
Sbjct  566  HSYFWLDEYSGKDDFSRYWRDEWVSGLTSWRKALKIPDSDVVLERR------FAKVIDQQ  619

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +VWNPGSE+A CDC W+  GNLC+HV KV  +C +     SS+S   +++ L+N
Sbjct  620  DQDRAHIVWNPGSEYAICDCGWAEMGNLCEHVFKVISVCRNNGSSMSSISLFQYKQALIN  679

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVE  332
            +L  P +DS+  D + +    +  Q+  LV+
Sbjct  680  MLNCPPNDSLIRDHAVSLAVHVQIQLNTLVD  710



>gb|KHN38118.1| hypothetical protein glysoja_007160 [Glycine soja]
Length=299

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 64/75 (85%), Gaps = 3/75 (4%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSS WLD YADESDSFQNVKE+YIASTSW+RALQIPD AVS + +    H FAKV+SQKD
Sbjct  222  HSSCWLDWYADESDSFQNVKEKYIASTSWHRALQIPDYAVSLDDK---AHLFAKVVSQKD  278

Query  601  NNVTRLVWNPGSEFA  557
            +++T +VWNPGSEFA
Sbjct  279  SSLTHIVWNPGSEFA  293



>ref|XP_011652504.1| PREDICTED: uncharacterized protein LOC101215653 [Cucumis sativus]
 ref|XP_011652505.1| PREDICTED: uncharacterized protein LOC101215653 [Cucumis sativus]
 ref|XP_011652506.1| PREDICTED: uncharacterized protein LOC101215653 [Cucumis sativus]
 gb|KGN60133.1| hypothetical protein Csa_3G879510 [Cucumis sativus]
Length=685

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 80/125 (64%), Gaps = 3/125 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLD+Y+ ++  F + +++ I + +W +AL IPD  V  +   +S   FAKV+SQ  
Sbjct  515  HSSYWLDQYSLDTGYFGSFRDKSILTNAWNKALHIPDVDVIVD---ESNLQFAKVISQSK  571

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             N+   +W+PGSEF+ CDC WS  GNLC+HVIKV+++C   Q  R  ++ Q +Q+ + N 
Sbjct  572  RNLEYTIWDPGSEFSLCDCPWSRMGNLCEHVIKVSLLCKRQQAARPLVAAQVYQDRVPNF  631

Query  421  LKKPM  407
               P+
Sbjct  632  QLNPV  636



>ref|XP_008466356.1| PREDICTED: uncharacterized protein LOC103503790 isoform X1 [Cucumis 
melo]
 ref|XP_008466357.1| PREDICTED: uncharacterized protein LOC103503790 isoform X1 [Cucumis 
melo]
Length=678

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 79/125 (63%), Gaps = 3/125 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLD+Y+ ++    + +++ I + +W +AL IPD  V  +   +S   FAKV+SQ  
Sbjct  516  HSSYWLDQYSLDTGYLGSFRDKSILTNAWNKALHIPDVDVMLD---ESNLQFAKVISQSK  572

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             N+   +W+PGSEF+ CDC WS  GNLCKHVIKV+++C   Q  R  ++ Q +Q+ + N 
Sbjct  573  RNLEYTIWDPGSEFSLCDCPWSRMGNLCKHVIKVSLLCKRQQAARPLVAAQVYQDRVPNF  632

Query  421  LKKPM  407
               P+
Sbjct  633  QLNPV  637



>ref|XP_008466358.1| PREDICTED: uncharacterized protein LOC103503790 isoform X2 [Cucumis 
melo]
Length=677

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 79/125 (63%), Gaps = 3/125 (2%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HSSYWLD+Y+ ++    + +++ I + +W +AL IPD  V  +   +S   FAKV+SQ  
Sbjct  515  HSSYWLDQYSLDTGYLGSFRDKSILTNAWNKALHIPDVDVMLD---ESNLQFAKVISQSK  571

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             N+   +W+PGSEF+ CDC WS  GNLCKHVIKV+++C   Q  R  ++ Q +Q+ + N 
Sbjct  572  RNLEYTIWDPGSEFSLCDCPWSRMGNLCKHVIKVSLLCKRQQAARPLVAAQVYQDRVPNF  631

Query  421  LKKPM  407
               P+
Sbjct  632  QLNPV  636



>ref|XP_010269623.1| PREDICTED: uncharacterized protein LOC104606193 [Nelumbo nucifera]
Length=1107

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 88/151 (58%), Gaps = 7/151 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + D  +  K E+++  TSW +AL+I DA V  E R       AKVLSQ 
Sbjct  512  HSYFWLDEYSGKDDFGRYRKNEWMSGLTSWRQALEITDADVVLEGR------CAKVLSQH  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            +  +  +V NPGSEFA CDC WS  GNLCKHVIKV+ +C       SS+S   + + L+N
Sbjct  566  NKGMAHVVHNPGSEFAICDCNWSQMGNLCKHVIKVSKVCRDRSSAVSSISLFEYNQTLIN  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVE  332
            +L  P  DS+  D + +    +  Q+  LV+
Sbjct  626  ILHCPPHDSLIRDHAVSLAIFVQMQLNALVQ  656



>ref|XP_006375222.1| hypothetical protein POPTR_0014s05410g [Populus trichocarpa]
 gb|ERP53019.1| hypothetical protein POPTR_0014s05410g [Populus trichocarpa]
Length=1067

 Score =   109 bits (272),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 89/152 (59%), Gaps = 10/152 (7%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y++  D  +  K+E+I+  TSW +AL+IPD+ V  E R       AKV  Q 
Sbjct  512  HSYFWLDEYSERDDFARYWKDEWISGLTSWRKALKIPDSDVVVEYR------CAKVTDQL  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +VWNPGSEFA CDC+W+  GNLC+HV KV  +       +SS+S   + + L+N
Sbjct  566  DRDRVHVVWNPGSEFAICDCKWAEMGNLCEHVFKVIKLYRDKGSRKSSISLFQYNQALIN  625

Query  424  LLKKPMDDSVALDLSTAW---TQQMLDQIQNL  338
            +L+ P  D +  D + +     Q+ LD I NL
Sbjct  626  MLRCPPYDCLIRDHAASLAVAVQKQLDGIVNL  657



>ref|XP_006375216.1| hypothetical protein POPTR_0014s05360g [Populus trichocarpa]
 gb|ERP53013.1| hypothetical protein POPTR_0014s05360g [Populus trichocarpa]
Length=1059

 Score =   108 bits (271),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 89/152 (59%), Gaps = 10/152 (7%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y++  D  +  K+E+++  TSW +AL+IPD+ V  E R       AKV  Q 
Sbjct  512  HSYFWLDEYSERDDFARYWKDEWVSGLTSWRKALKIPDSDVVVEYR------CAKVTDQL  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +VWNPGSEFA CDC+W+  GNLC+HV KV  +       +SS+S   + + L+N
Sbjct  566  DRDRVHVVWNPGSEFAICDCKWAEMGNLCEHVFKVIKLYRDKGSRKSSISLFQYNQALIN  625

Query  424  LLKKPMDDSVALDLSTAW---TQQMLDQIQNL  338
            +L+ P  D +  D + +     Q+ LD I NL
Sbjct  626  MLRCPPYDCLIRDHAASLAVAVQKQLDGIVNL  657



>ref|XP_011032909.1| PREDICTED: uncharacterized protein LOC105131568 [Populus euphratica]
 ref|XP_011012198.1| PREDICTED: uncharacterized protein LOC105116502 [Populus euphratica]
Length=1080

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 89/152 (59%), Gaps = 10/152 (7%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y++  D  +  K+E+++  TSW +AL+IPD+ V  E R       AKV  Q 
Sbjct  512  HSYFWLDEYSERDDFARYWKDEWVSGLTSWRKALKIPDSDVVVEYR------CAKVTDQL  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +VWNPGSEFA CDC+W+  GNLC+HV K+  +       +SS+S   + + L+N
Sbjct  566  DRDRVHVVWNPGSEFAICDCKWAEMGNLCEHVFKIIKLYRDKGSRKSSISLFQYNQALIN  625

Query  424  LLKKPMDDSVALDLSTAW---TQQMLDQIQNL  338
            +L+ P  D +  D + +     Q+ LD I NL
Sbjct  626  MLRCPPYDCLIRDHAASLAVAVQKQLDGIVNL  657



>ref|XP_002528170.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34221.1| conserved hypothetical protein [Ricinus communis]
Length=681

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 84/152 (55%), Gaps = 7/152 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+++ D  +  K+E+    T+W RAL +PD  V  E R       AKV  Q 
Sbjct  512  HSYFWLDEYSEKDDFVRYWKDEWATGLTAWRRALNVPDVDVVMEGR------CAKVYDQL  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +VWNPGS+FA CDC  +  GNLC+HVIKV  IC      R S+S   +   L++
Sbjct  566  DRDKVHVVWNPGSDFAICDCSLAEMGNLCEHVIKVRRICHEKGYRRPSISLLQYNHALID  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            +L  P  DS+  D + +    +  ++  LV+L
Sbjct  626  MLYCPPHDSLIHDHAVSLAVAVNKELDALVDL  657



>ref|XP_008232361.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103331512 
[Prunus mume]
Length=1089

 Score =   105 bits (262),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 89/152 (59%), Gaps = 8/152 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+++ D  +  K+E+++  TSW +AL+IPD+ V  E         AKV+SQ 
Sbjct  526  HSYFWLDEYSEKDDFARYWKDEWVSGLTSWRKALKIPDSNVVMEGT------CAKVISQL  579

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   LVWNPGS+F  C+C W+  GNLC+HV+KV  +C        S+S   + + L++
Sbjct  580  DQDRAYLVWNPGSQFGICNCSWAEMGNLCEHVLKVISVCRKKSAM-PSISLLQYHQALID  638

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            +L  P  DS+  D + +    + +Q+  LV L
Sbjct  639  MLHCPPHDSLIRDHAVSLAVFVQNQLNGLVNL  670



>ref|XP_010921093.1| PREDICTED: uncharacterized protein LOC105044782 [Elaeis guineensis]
Length=1104

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 83/151 (55%), Gaps = 7/151 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS YWLD Y+ + +  +  K+E+ +  TSW +ALQIPD+ V  + +       AKV+SQK
Sbjct  512  HSYYWLDEYSGKDNFSRYWKDEWKSGLTSWRQALQIPDSDVVLDGK------CAKVVSQK  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D      V NPGSEFA CDC WSM GNLCKHVIK   I        SS S   +   LM+
Sbjct  566  DREKMHTVLNPGSEFAICDCGWSMMGNLCKHVIKSTKIYRDRGLAASSTSLFEYNRTLMS  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVE  332
            +L  P  DSV  D + A    +  Q+  L +
Sbjct  626  ILNCPPHDSVIRDHAVALAVCVQTQLNALFD  656



>ref|XP_007203395.1| hypothetical protein PRUPE_ppa021037mg [Prunus persica]
 gb|EMJ04594.1| hypothetical protein PRUPE_ppa021037mg [Prunus persica]
Length=1053

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 89/152 (59%), Gaps = 8/152 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+++ D  +  K+E+++  TSW +AL+IPD+ V  E         AKV++Q 
Sbjct  512  HSYFWLDEYSEKDDFARYWKDEWVSGLTSWRKALKIPDSNVVMEGT------CAKVINQL  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   LVWNPGS+F  C+C W+  GNLC+HV+KV  +C        S+S   + + L++
Sbjct  566  DQDKAYLVWNPGSQFGICNCSWAEMGNLCEHVLKVISVCRKKSAM-PSISLLQYHQALID  624

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            +L  P  DS+  D + +    + +Q+  LV L
Sbjct  625  MLHCPPHDSLIRDHAVSLAVFVQNQLNGLVNL  656



>ref|XP_008445298.1| PREDICTED: uncharacterized protein LOC103488340 isoform X2 [Cucumis 
melo]
Length=855

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 88/152 (58%), Gaps = 7/152 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y ++++  +  K+E+++  T W RAL IPD+ V  E         AKV +Q 
Sbjct  512  HSYFWLDEYPEKNNFCRYWKDEWMSGLTYWRRALGIPDSDVIIEG------GIAKVTNQI  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
              +   +VWNPGS+F  CDC+W+  GNLC+H+ KV  IC      R S+S   +Q+ L++
Sbjct  566  TRDRKFVVWNPGSQFGICDCQWAEMGNLCEHMCKVINICRKKGTTRPSVSLLQYQKTLID  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            +L +P  DS+  D + ++   +  Q+  L+ +
Sbjct  626  MLHRPPHDSLIRDHAVSFAMSVQKQLNALISM  657



>ref|XP_008445258.1| PREDICTED: uncharacterized protein LOC103488340 isoform X1 [Cucumis 
melo]
 ref|XP_008445266.1| PREDICTED: uncharacterized protein LOC103488340 isoform X1 [Cucumis 
melo]
 ref|XP_008445273.1| PREDICTED: uncharacterized protein LOC103488340 isoform X1 [Cucumis 
melo]
 ref|XP_008445282.1| PREDICTED: uncharacterized protein LOC103488340 isoform X1 [Cucumis 
melo]
 ref|XP_008445289.1| PREDICTED: uncharacterized protein LOC103488340 isoform X1 [Cucumis 
melo]
Length=874

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 88/152 (58%), Gaps = 7/152 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y ++++  +  K+E+++  T W RAL IPD+ V  E         AKV +Q 
Sbjct  531  HSYFWLDEYPEKNNFCRYWKDEWMSGLTYWRRALGIPDSDVIIEG------GIAKVTNQI  584

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
              +   +VWNPGS+F  CDC+W+  GNLC+H+ KV  IC      R S+S   +Q+ L++
Sbjct  585  TRDRKFVVWNPGSQFGICDCQWAEMGNLCEHMCKVINICRKKGTTRPSVSLLQYQKTLID  644

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            +L +P  DS+  D + ++   +  Q+  L+ +
Sbjct  645  MLHRPPHDSLIRDHAVSFAMSVQKQLNALISM  676



>ref|XP_008445306.1| PREDICTED: uncharacterized protein LOC103488340 isoform X3 [Cucumis 
melo]
Length=801

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 88/152 (58%), Gaps = 7/152 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y ++++  +  K+E+++  T W RAL IPD+ V  E         AKV +Q 
Sbjct  458  HSYFWLDEYPEKNNFCRYWKDEWMSGLTYWRRALGIPDSDVIIEG------GIAKVTNQI  511

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
              +   +VWNPGS+F  CDC+W+  GNLC+H+ KV  IC      R S+S   +Q+ L++
Sbjct  512  TRDRKFVVWNPGSQFGICDCQWAEMGNLCEHMCKVINICRKKGTTRPSVSLLQYQKTLID  571

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            +L +P  DS+  D + ++   +  Q+  L+ +
Sbjct  572  MLHRPPHDSLIRDHAVSFAMSVQKQLNALISM  603



>ref|XP_008782616.1| PREDICTED: uncharacterized protein LOC103702098 [Phoenix dactylifera]
Length=1107

 Score =   103 bits (258),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 83/152 (55%), Gaps = 7/152 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS YWLD Y+ +    +  K+E+ +  TSW +ALQIPD+ V  +       + AKV+SQK
Sbjct  512  HSYYWLDEYSGKDIFSRYWKDEWKSGLTSWRQALQIPDSDVVLDG------NCAKVVSQK  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D      V NPGSEFA CDC WSM GNLCKHVIK   I        SS     +   LM+
Sbjct  566  DREKVHTVLNPGSEFAICDCSWSMMGNLCKHVIKSTKIYRDRGLAVSSTCLFEYNRTLMS  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            +L  P  DSV  D + A    +  Q+ +L +L
Sbjct  626  ILNCPPHDSVIRDHAVALAVCVQTQLNSLFDL  657



>gb|KHG00863.1| CUE domain-containing 5 [Gossypium arboreum]
 gb|KHG00916.1| CUE domain-containing 5 [Gossypium arboreum]
Length=997

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 86/150 (57%), Gaps = 7/150 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + D  +  K+E+++  TSW +AL+IPD+ V+ E R      FAKV  Q 
Sbjct  512  HSYFWLDEYSGKDDFARYWKDEWVSGLTSWRKALKIPDSDVASERR------FAKVTDQL  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +VWNPGS+F  CDC W+  G LC+HV+KV  +         S+S   + + L++
Sbjct  566  DRDTVYVVWNPGSQFGICDCSWAEMGYLCEHVLKVIKVYREKGSISPSVSIFQYNKALID  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLV  335
            +L  P  DS+  D + +    +  Q+ +LV
Sbjct  626  MLHCPPHDSLIRDHAVSLAIFVQKQLNSLV  655



>gb|KJB22894.1| hypothetical protein B456_004G072100 [Gossypium raimondii]
Length=1015

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 86/150 (57%), Gaps = 7/150 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + D  +  K+E+++  TSW +AL+IPD+ V+ E R      FAKV  Q 
Sbjct  512  HSYFWLDEYSGKDDFARYWKDEWVSGLTSWRKALKIPDSDVASERR------FAKVTDQI  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +VWNPGS+F  CDC W+  G LC+HV+KV  +         S+S   + + L++
Sbjct  566  DRDTVYVVWNPGSQFGICDCSWAEMGYLCEHVLKVIKVYREKGSISPSVSIFQYNKALID  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLV  335
            +L  P  DS+  D + +    +  Q+ +LV
Sbjct  626  MLHCPPHDSLIRDHAVSLAIFVQKQLNSLV  655



>ref|XP_004295012.1| PREDICTED: uncharacterized protein LOC101310972 [Fragaria vesca 
subsp. vesca]
Length=1030

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 84/146 (58%), Gaps = 7/146 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+++ D  +  K+E+++  TSW  AL+IPD+ V  E         AKV  Q 
Sbjct  512  HSYFWLDEYSEKDDFARYWKDEWVSGLTSWRTALEIPDSNVVIEGT------CAKVTDQL  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            DN  T +VWNPGS+F  C+C W+  GNLC+H++KV  +C        S++   F + L++
Sbjct  566  DNEKTYVVWNPGSQFGICNCSWAEMGNLCEHILKVISVCRKRSHPMPSVNLLQFHQALLD  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQI  347
            +L  P  DS+  D + +    + +Q+
Sbjct  626  MLHMPPHDSLIRDHAVSLAAFVHNQL  651



>ref|XP_004135549.1| PREDICTED: uncharacterized protein LOC101211068 [Cucumis sativus]
 gb|KGN65922.1| hypothetical protein Csa_1G538200 [Cucumis sativus]
Length=855

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 87/152 (57%), Gaps = 7/152 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+++++  +  K+E+++  T W RAL+IPD+ V  E         AKV  Q 
Sbjct  512  HSYFWLDEYSEKNNFSRYWKDEWMSGLTYWRRALRIPDSDVIIEG------GIAKVTDQI  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
              +   +VWNPGS F  CDC+W+  GNLC+H+ KV  +C      R S+S   +Q+ L +
Sbjct  566  TRDRKFVVWNPGSHFGICDCQWAEMGNLCEHMCKVINMCRKKGTTRPSVSLLQYQKALTD  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            +L +P  DS+  D + ++   +  Q+  L+ +
Sbjct  626  MLHRPPHDSLIRDHAVSFAMSVQKQLNALISM  657



>ref|XP_009406639.1| PREDICTED: uncharacterized protein LOC103989501 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406640.1| PREDICTED: uncharacterized protein LOC103989501 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406641.1| PREDICTED: uncharacterized protein LOC103989501 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406642.1| PREDICTED: uncharacterized protein LOC103989501 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406643.1| PREDICTED: uncharacterized protein LOC103989501 [Musa acuminata 
subsp. malaccensis]
Length=970

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 86/152 (57%), Gaps = 7/152 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEY-IASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS YWLD Y+++ +  +  ++E+    TSW +A+QIPD+ V+ +         AKV++QK
Sbjct  512  HSYYWLDEYSEKDNFARYWRDEWRCGFTSWRQAIQIPDSDVAIDGT------CAKVVNQK  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            + N   +V NPGS+FA CDC WS  GNLC+HVIK   +        SS S   F  +L +
Sbjct  566  ERNKVHVVSNPGSDFAICDCHWSRMGNLCEHVIKSTKVYRDRGLAASSTSLIQFNRMLTS  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            +   P  DSV  D + A    +  Q++ LV+L
Sbjct  626  IFNCPPHDSVIRDHAIALAVSVQTQLKTLVDL  657



>emb|CDP15763.1| unnamed protein product [Coffea canephora]
Length=750

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 85/144 (59%), Gaps = 9/144 (6%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + D  +  K+E+++  T W ++++IPDA ++ + +       AKV+  +
Sbjct  512  HSYFWLDEYSCKDDFARYWKDEWLSGLTKWRKSMKIPDADIAIDGK------CAKVIDLE  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +VWNPGSE+A CDC WS  GNLC+HV+K    C   +    S+S   + + L+N
Sbjct  566  DRDSVHVVWNPGSEYALCDCNWSSTGNLCEHVVKTIKFCRDKKYVVPSVSMLQYTQALIN  625

Query  424  LLKKPMDDSVALD--LSTAWTQQM  359
            +L  P  DS+  D  +S A + QM
Sbjct  626  MLHCPPYDSLVRDHAVSLAVSVQM  649



>ref|XP_002309581.2| hypothetical protein POPTR_0006s26200g [Populus trichocarpa]
 gb|EEE93104.2| hypothetical protein POPTR_0006s26200g [Populus trichocarpa]
Length=667

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 79/151 (52%), Gaps = 33/151 (22%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLD+Y+ E+  F N+                                 AKV+SQ +
Sbjct  522  HSLYWLDQYSAETGYFTNL---------------------------------AKVISQTN  548

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             ++   +WNPGSEFA CDC WS QGNLCKHVIKV ++C + Q  R  ++ Q +++ L+ L
Sbjct  549  RSLAYTIWNPGSEFALCDCPWSRQGNLCKHVIKVAILCKNRQVARPLLASQVYRQALLTL  608

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            L+ P DD + L+ +     ++   I+ L +L
Sbjct  609  LQNPPDDPLVLEHAILRVSRLQQDIKGLEDL  639



>ref|XP_006858725.1| PREDICTED: uncharacterized protein LOC18448602 [Amborella trichopoda]
 gb|ERN20192.1| hypothetical protein AMTR_s00066p00115970 [Amborella trichopoda]
Length=1173

 Score =   100 bits (249),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 57/153 (37%), Positives = 83/153 (54%), Gaps = 8/153 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYI--ASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQ  608
            HS +WLD + + +   +  K+E++    TSW RA +IPD+ ++ E R       A V+SQ
Sbjct  513  HSYFWLDEFQERNKFSRYRKDEWVEMGITSWSRASEIPDSNITLEGRD------ALVMSQ  566

Query  607  KDNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILM  428
             D     +V NPG EFA CDCEWS  G LCKHVIK + +C +      S+S   +   L 
Sbjct  567  SDPEHVHIVRNPGFEFAICDCEWSALGYLCKHVIKASWVCRNRGLVGPSISLFQYNRTLG  626

Query  427  NLLKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
              L  P  DS+ LD +T+   ++  Q++   EL
Sbjct  627  QTLNCPPYDSLVLDHATSMAIEVQGQLKKAAEL  659



>ref|XP_009349923.1| PREDICTED: uncharacterized protein LOC103941455 [Pyrus x bretschneideri]
Length=974

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 87/152 (57%), Gaps = 8/152 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+++ D  +  K+E+ +  TSW +AL+IPD  +  E  +      AKV+ + 
Sbjct  511  HSYFWLDEYSEKDDFARYWKDEWASGLTSWRKALKIPDRNIVIEGTR------AKVIDEL  564

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +VWNPGS+F  C+C W+  GNLC+H++KV  +C   +    S+S   + + L++
Sbjct  565  DQDRVYVVWNPGSQFGICNCRWAEMGNLCEHILKVINVCRK-RSSTPSISLLQYHKALID  623

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            +L  P  DS+  D + +    +  Q+  LV L
Sbjct  624  MLHCPPHDSLIRDHAVSLAVFVQKQLSGLVNL  655



>ref|XP_010053257.1| PREDICTED: uncharacterized protein LOC104441745 [Eucalyptus grandis]
 ref|XP_010053258.1| PREDICTED: uncharacterized protein LOC104441745 [Eucalyptus grandis]
 gb|KCW77515.1| hypothetical protein EUGRSUZ_D01843 [Eucalyptus grandis]
 gb|KCW77516.1| hypothetical protein EUGRSUZ_D01843 [Eucalyptus grandis]
Length=797

 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 84/151 (56%), Gaps = 7/151 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            H+ +WLD Y+++ D  +  K+E+ +  TSW  AL+IPD+ V+ E         AKV SQ 
Sbjct  512  HAFFWLDEYSEKEDFSRYRKDEWASGLTSWRNALKIPDSDVTLEG------ECAKVTSQT  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
              +   +VWNPGS F+ CDC+W+  G LC+HV KV  +C        S+S   ++  L+ 
Sbjct  566  LRDKVHIVWNPGSVFSLCDCKWADMGYLCEHVFKVIKVCRERGSALPSISLFQYKRALLE  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVE  332
            +L+ P  DSV  D + +    +  Q+  L++
Sbjct  626  MLRCPPHDSVIRDHAISLAVFVQKQLSTLID  656



>dbj|BAF01455.1| hypothetical protein [Arabidopsis thaliana]
Length=551

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 82/149 (55%), Gaps = 7/149 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + +  +  KEE+++  TS+ +AL IPD+ V            AK+  + 
Sbjct  285  HSYFWLDEYSGKDNFARYWKEEWVSGLTSFRKALSIPDSDVVISGMS------AKITDEC  338

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D N   +VWNPGS+F  C C W+ +G +CKH+IK+  +C   +  R S S   + + L++
Sbjct  339  DGNEIHVVWNPGSQFGVCSCSWAEKGYICKHMIKLTQLCLGNRAARQSASLLQYYQTLID  398

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNL  338
            LL+ P  DS+  D + +    +  QI  L
Sbjct  399  LLRCPPHDSLFRDYAVSLAVSVEKQINAL  427



>ref|NP_193133.3| zinc ion binding protein [Arabidopsis thaliana]
 gb|AEE83354.1| zinc ion binding protein [Arabidopsis thaliana]
Length=778

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 83/152 (55%), Gaps = 7/152 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + +  +  KEE+++  TS+ +AL IPD+ V            AK+  + 
Sbjct  512  HSYFWLDEYSGKDNFARYWKEEWVSGLTSFRKALSIPDSDVVISGMS------AKITDEC  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D N   +VWNPGS+F  C C W+ +G +CKH+IK+  +C   +  R S S   + + L++
Sbjct  566  DGNEIHVVWNPGSQFGVCSCSWAEKGYICKHMIKLTQLCLGNRAARQSASLLQYYQTLID  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            LL+ P  DS+  D + +    +  QI  L  L
Sbjct  626  LLRCPPHDSLFRDYAVSLAVSVEKQINALGYL  657



>gb|EYU37722.1| hypothetical protein MIMGU_mgv1a023319mg, partial [Erythranthe 
guttata]
Length=672

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 81/147 (55%), Gaps = 10/147 (7%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ ++D  +  K E+++  T+W ++L+IPD+ V+ E +       AKV+  K
Sbjct  509  HSYFWLDEYSGKADFARYSKGEWLSGPTAWRKSLRIPDSHVNIEGQ------CAKVIGLK  562

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   LV NPGSE+A CDC WS  GNLC+HV K    C        SMS   + + L+ 
Sbjct  563  DQDKAHLVLNPGSEYAICDCGWSKMGNLCEHVFKAIKFCRDKGSVTPSMSMFQYSKALIK  622

Query  424  LLKKPMDDSVALDLSTA---WTQQMLD  353
            +L     DS+  D + +   W Q  L+
Sbjct  623  ILNCSPFDSLVRDHAASLAVWVQMQLN  649



>ref|XP_011088310.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105169583 
[Sesamum indicum]
Length=914

 Score = 97.1 bits (240),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 83/147 (56%), Gaps = 10/147 (7%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + D  +  K+E+++  T+W ++L+IPDA V  E +       AKV+  +
Sbjct  493  HSYFWLDEYSGKEDFARYWKDEWMSGPTAWRKSLRIPDANVVMEGK------CAKVIELE  546

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   L+WNPGSE+A CDC W+  GN+C+H+ K+            S+S   + + L+N
Sbjct  547  DQDSAHLIWNPGSEYAICDCSWAKLGNMCEHIFKIIKFFRDKGSICPSVSMFQYSQALIN  606

Query  424  LLKKPMDDSVALDLSTA---WTQQMLD  353
            +L  P  DS+  D + +   W Q  L+
Sbjct  607  MLHCPPFDSLVRDHAVSLAIWVQMQLN  633



>ref|XP_010108923.1| hypothetical protein L484_027118 [Morus notabilis]
 gb|EXC20563.1| hypothetical protein L484_027118 [Morus notabilis]
Length=464

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 92/184 (50%), Gaps = 27/184 (15%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + D  +  KEE+++  TSW +AL+I D  V  E         AKV  Q 
Sbjct  95   HSYFWLDEYSGKDDFARYRKEEWVSGLTSWRKALEISDTDVVMEGGS------AKVTDQL  148

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +VWN GS+F  C+C W+  GNLC+H++KV  +    +    S+S   +Q++ M+
Sbjct  149  DRDRLHVVWNSGSQFGICECNWAEMGNLCEHMLKVISVWRKKKSATPSISLLQYQKVFMD  208

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGK  245
            +L+    DS+  D + +    +  QI  LV                    S  R +S+G+
Sbjct  209  MLQCAPHDSLIRDHAVSLAVFVQKQINGLV--------------------SESRNSSKGQ  248

Query  244  PTSA  233
            P+S 
Sbjct  249  PSSG  252



>ref|XP_004245794.1| PREDICTED: uncharacterized protein LOC101264658 [Solanum lycopersicum]
 ref|XP_010325505.1| PREDICTED: uncharacterized protein LOC101264658 [Solanum lycopersicum]
 ref|XP_010325506.1| PREDICTED: uncharacterized protein LOC101264658 [Solanum lycopersicum]
Length=788

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 90/148 (61%), Gaps = 12/148 (8%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + D  +  K+E+++  T+W ++LQIPD+ V  E        ++KV+ Q+
Sbjct  512  HSYFWLDEYSGKDDFARYWKDEWMSGLTAWQKSLQIPDSDVLIEG------DYSKVVDQE  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRS-SMSFQSFQEILM  428
            D +   +VWNP SE+A CDC W+  GNLC+H++K ++ C   +G  + S+S   + + L+
Sbjct  566  DRHKVHVVWNPASEYALCDCNWAKMGNLCEHILK-SIKCLRDKGSNTPSVSMFQYMQALV  624

Query  427  NLLKKPMDDSVALD--LSTA-WTQQMLD  353
            ++L  P  DS+  D  LS A W Q  L+
Sbjct  625  DMLHCPPHDSLIRDHALSLAVWVQTQLN  652



>ref|XP_007146127.1| hypothetical protein PHAVU_006G014600g [Phaseolus vulgaris]
 ref|XP_007146128.1| hypothetical protein PHAVU_006G014600g [Phaseolus vulgaris]
 ref|XP_007146129.1| hypothetical protein PHAVU_006G014600g [Phaseolus vulgaris]
 gb|ESW18121.1| hypothetical protein PHAVU_006G014600g [Phaseolus vulgaris]
 gb|ESW18122.1| hypothetical protein PHAVU_006G014600g [Phaseolus vulgaris]
 gb|ESW18123.1| hypothetical protein PHAVU_006G014600g [Phaseolus vulgaris]
Length=861

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 82/151 (54%), Gaps = 7/151 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + D  +  K E+++  TSW +AL+IPD+ VS E         AKV  Q 
Sbjct  511  HSYFWLDEYSGKDDFARYWKNEWMSGLTSWRKALKIPDSDVSIED------GCAKVTDQD  564

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +VWN GS  + CDC W+  GNLC+H++KV  IC        S++   + + L N
Sbjct  565  DRDKAFVVWNTGSMLSICDCSWAQDGNLCEHILKVLSICRKRGSVLPSVTLFQYHQALNN  624

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVE  332
            +L  P  DS+  D + +    +  Q+  L++
Sbjct  625  MLHCPPFDSLIRDHAVSLAVSVQKQLNTLLD  655



>ref|XP_008670947.1| PREDICTED: uncharacterized protein LOC103648233 [Zea mays]
Length=828

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 84/150 (56%), Gaps = 7/150 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTS-WYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS YWLD ++ ++   +  + E+ +  + W + +QIPD+ V  E       ++A V+SQK
Sbjct  512  HSYYWLDEFSGKNSFSRYWRSEWSSGPNPWCQGMQIPDSDVVIEG------NYASVVSQK  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            +   + +V NPGSEFA CDC WSM+GNLCKHVIK   +C        S++   + + L N
Sbjct  566  NKEKSHVVLNPGSEFALCDCSWSMKGNLCKHVIKSAKVCRDRGLALPSLAMFHYYQALAN  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLV  335
            L+  P  D++  D + A    +  Q+  ++
Sbjct  626  LVHCPPSDTLISDHAMALAVSVKTQLDAVL  655



>ref|XP_007052246.1| Zinc ion binding protein isoform 1 [Theobroma cacao]
 gb|EOX96403.1| Zinc ion binding protein isoform 1 [Theobroma cacao]
Length=1030

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 85/151 (56%), Gaps = 7/151 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + D  +  K+E+++  TSW +AL+IPD+ V+ E +       AKV  Q 
Sbjct  512  HSYFWLDEYSGKDDFARYWKDEWMSGLTSWRKALKIPDSDVAIEGQ------CAKVTDQL  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +VWNPGS++  CDC W+  G LC+HV KV  +         S+S   + + L++
Sbjct  566  DRDRVYVVWNPGSQYGICDCTWAEMGYLCEHVFKVIKVFHEKGSILPSVSLFQYNKALID  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVE  332
            +L  P  DS+  D + +    +  Q+ +LV+
Sbjct  626  MLHCPPHDSLIRDHAVSLAIYVQKQLNSLVD  656



>ref|XP_007052247.1| Zinc ion binding protein isoform 2 [Theobroma cacao]
 gb|EOX96404.1| Zinc ion binding protein isoform 2 [Theobroma cacao]
Length=973

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 85/151 (56%), Gaps = 7/151 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + D  +  K+E+++  TSW +AL+IPD+ V+ E +       AKV  Q 
Sbjct  455  HSYFWLDEYSGKDDFARYWKDEWMSGLTSWRKALKIPDSDVAIEGQ------CAKVTDQL  508

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +VWNPGS++  CDC W+  G LC+HV KV  +         S+S   + + L++
Sbjct  509  DRDRVYVVWNPGSQYGICDCTWAEMGYLCEHVFKVIKVFHEKGSILPSVSLFQYNKALID  568

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVE  332
            +L  P  DS+  D + +    +  Q+ +LV+
Sbjct  569  MLHCPPHDSLIRDHAVSLAIYVQKQLNSLVD  599



>ref|XP_007138737.1| hypothetical protein PHAVU_009G233100g [Phaseolus vulgaris]
 ref|XP_007138738.1| hypothetical protein PHAVU_009G233100g [Phaseolus vulgaris]
 ref|XP_007138739.1| hypothetical protein PHAVU_009G233100g [Phaseolus vulgaris]
 gb|ESW10731.1| hypothetical protein PHAVU_009G233100g [Phaseolus vulgaris]
 gb|ESW10732.1| hypothetical protein PHAVU_009G233100g [Phaseolus vulgaris]
 gb|ESW10733.1| hypothetical protein PHAVU_009G233100g [Phaseolus vulgaris]
Length=810

 Score = 94.0 bits (232),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 81/151 (54%), Gaps = 7/151 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + D  +  K E+++  TSW +AL+IPD+ VS E         AKV  Q 
Sbjct  511  HSYFWLDEYSGKDDFARYWKNEWMSGLTSWRKALKIPDSDVSIED------GCAKVTDQD  564

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +VWN GS  + CDC W+  GNLC+H++K   IC        S++   + + L N
Sbjct  565  DRDKAFVVWNTGSMLSICDCSWAQDGNLCEHILKALSICRKRGSVLPSVTLFQYHQALNN  624

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVE  332
            +L  P  DS+  D + +    +  Q+  L++
Sbjct  625  MLHCPPFDSLIRDHAVSLAVSVQKQLNTLLD  655



>ref|XP_008381415.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103444267 
[Malus domestica]
Length=972

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 88/151 (58%), Gaps = 11/151 (7%)
 Frame = -3

Query  778  SSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            S++WLD Y+++ D  +  K+E+ +  TSW +AL+IPD  +  E  +      AKV+ + D
Sbjct  512  SNFWLDEYSEKDDFARYWKDEWASGLTSWRKALKIPDRNIVIEGTR------AKVIDELD  565

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
             +   +VWNPGS+F+ C+C W+  GNLC+H++KV  +C   +    S+S   + + L++ 
Sbjct  566  QDRVYVVWNPGSQFSICNCRWAEMGNLCEHILKVINVCRK-RSSTPSISLLQYHKALIDX  624

Query  421  LKKPMDDSVALDLSTA---WTQQMLDQIQNL  338
            L  P  DS+  D + +   + Q+ L  + NL
Sbjct  625  LHCPPHDSLIRDHAVSLAVFVQKQLSGLNNL  655



>ref|XP_012083677.1| PREDICTED: uncharacterized protein LOC105643205 [Jatropha curcas]
 gb|KDP28838.1| hypothetical protein JCGZ_14609 [Jatropha curcas]
Length=979

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 89/153 (58%), Gaps = 12/153 (8%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+++ +  +  K+E+ +  T+W +AL+IPD  V  E R       A+V  Q 
Sbjct  512  HSYFWLDEYSEKDEFARYWKDEWDSGLTAWRKALKIPDLDVVMEGR------CARVADQL  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRS-SMSFQSFQEILM  428
            D +   +VWNP S FA CDC W+  GNLC+HV KV +   S +G+R  S+S   + + L+
Sbjct  566  DRDRFHVVWNPRSNFALCDCSWAEMGNLCEHVFKV-IRMSSNKGYRKPSISLSQYNQALI  624

Query  427  NLLKKPMDDSVALD--LSTAWT-QQMLDQIQNL  338
            ++L  P  DS+  D  +S A T Q+ LD +  L
Sbjct  625  DMLHCPPHDSLIRDHAVSLAVTVQKQLDAMAVL  657



>ref|XP_010450143.1| PREDICTED: uncharacterized protein LOC104732307 [Camelina sativa]
Length=777

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 79/146 (54%), Gaps = 7/146 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + +  +  KEE+++  TS+ +AL IPD+ V            AK+  + 
Sbjct  512  HSYFWLDEYSGKDNFARYWKEEWVSGLTSFRKALSIPDSDVVMSGMS------AKIRDEC  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            + N   +VWNPGS+F  C C W+ +G +CKH+IK+   C   +  R S S   + + L+N
Sbjct  566  EGNEIHVVWNPGSQFGVCSCSWAEKGYICKHMIKLTQQCLGNRASRQSASLLQYYQTLIN  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQI  347
            LL  P  DS+  D + +    +  QI
Sbjct  626  LLHCPPRDSLFRDYAVSLAVSVEKQI  651



>ref|XP_002461610.1| hypothetical protein SORBIDRAFT_02g005340 [Sorghum bicolor]
 gb|EER98131.1| hypothetical protein SORBIDRAFT_02g005340 [Sorghum bicolor]
Length=831

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 78/137 (57%), Gaps = 7/137 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTS-WYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS YWLD ++ ++   +  K E+ +  + W + +QIPD+ V  E       ++A V+SQK
Sbjct  512  HSYYWLDEFSGKNSFSRYWKSEWSSGPNPWCQGMQIPDSDVVIEG------NYASVVSQK  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            +   + +V NPGSEFA CDC WS +GN+CKHV+K   +C        S++   + + L N
Sbjct  566  NKENSHVVLNPGSEFALCDCSWSRKGNICKHVVKSAKVCRDRGLALPSLAMFHYYQALAN  625

Query  424  LLKKPMDDSVALDLSTA  374
            L+  P  D++  D + A
Sbjct  626  LVHCPPSDTLISDHAMA  642



>ref|XP_006359246.1| PREDICTED: uncharacterized protein LOC102601875 isoform X1 [Solanum 
tuberosum]
 ref|XP_006359247.1| PREDICTED: uncharacterized protein LOC102601875 isoform X2 [Solanum 
tuberosum]
Length=788

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 88/148 (59%), Gaps = 12/148 (8%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + D  +  K+E+++  T+W ++LQIPD+ V  E        ++KV+ Q+
Sbjct  512  HSYFWLDEYSGKDDFARYWKDEWMSGLTAWQKSLQIPDSDVLIEG------DYSKVVDQE  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQG-FRSSMSFQSFQEILM  428
            D +   +V NP SE+A CDC W+  GNLC+H++K ++ C   +G    S+S   + + L+
Sbjct  566  DRHKVHVVRNPASEYALCDCNWAKMGNLCEHILK-SIKCLRDKGSITPSLSMFQYMQALV  624

Query  427  NLLKKPMDDSVALD--LSTA-WTQQMLD  353
            ++L  P  DS+  D  LS A W Q  L+
Sbjct  625  DMLHCPPHDSLIRDHALSLAVWVQTQLN  652



>ref|XP_010540374.1| PREDICTED: uncharacterized protein LOC104814172 [Tarenaya hassleriana]
 ref|XP_010540375.1| PREDICTED: uncharacterized protein LOC104814172 [Tarenaya hassleriana]
Length=825

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 79/149 (53%), Gaps = 7/149 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + +  +  KEE+++  TS+ +AL IPD+ V    +       AK+  + 
Sbjct  512  HSYFWLDEYSGKENFARYWKEEWVSGLTSFRKALSIPDSDVVITDKS------AKITDEN  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +VWNPGS+   C C W+ +G +C+H+IKV   C        S SF  + + L++
Sbjct  566  DRDKAYIVWNPGSQIGICTCSWAERGYMCEHIIKVMKFCRRNGSTVPSASFLQYCQTLID  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNL  338
            LL  P  DS+  D S +    +  QI  L
Sbjct  626  LLHCPPRDSLFRDYSVSLAVSVEKQINTL  654



>ref|XP_006414836.1| hypothetical protein EUTSA_v10024472mg [Eutrema salsugineum]
 gb|ESQ56289.1| hypothetical protein EUTSA_v10024472mg [Eutrema salsugineum]
Length=772

 Score = 90.5 bits (223),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 81/153 (53%), Gaps = 8/153 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + D  +  KEE+++  TS+ +AL IPD+ V            AK+  + 
Sbjct  512  HSYFWLDEYSGKDDFARYWKEEWVSGLTSFRKALSIPDSDVVISGMS------AKITDEC  565

Query  604  DN-NVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILM  428
            D  N   +VWNPGS+F  C C W+ +G +CKH+IK+  +    +  R S S   + + L+
Sbjct  566  DGGNEVHVVWNPGSQFGVCSCSWAEKGYICKHMIKLTQVSLGNRAARQSASLLQYYQTLI  625

Query  427  NLLKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            +LL  P  DS+  D + +       QI  L +L
Sbjct  626  DLLHCPPRDSLFRDYAVSLAVSAEKQINALGDL  658



>ref|XP_009139573.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103863577 
[Brassica rapa]
Length=770

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 80/152 (53%), Gaps = 7/152 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y  + D  +  +EE+++  TS+ +AL IPD+ V            AKV  + 
Sbjct  512  HSYFWLDEYTGKDDFARYWREEWVSGLTSFRKALSIPDSDVVISGMS------AKVTDKC  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D N   +VW+P S F  C C W+ +G +C+H+IK+  +C   +  + S+S   + + L++
Sbjct  566  DANEVHVVWSPSSHFGVCSCSWAQKGYICQHMIKLAQVCRGNRTAKESVSLLQYYQALVD  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            LL  P  DS+  D + +    +  QI  L  L
Sbjct  626  LLHLPPGDSLFRDYAASLAVSVEKQINALGNL  657



>ref|XP_006283161.1| hypothetical protein CARUB_v10004191mg [Capsella rubella]
 gb|EOA16059.1| hypothetical protein CARUB_v10004191mg [Capsella rubella]
Length=777

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 81/152 (53%), Gaps = 7/152 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + +  +  KEE+++  TS+ +A+ IPD+ V            AK+  + 
Sbjct  512  HSYFWLDEYSGKDNFARYWKEEWVSGLTSFRKAMSIPDSDVVLSGMS------AKITDEC  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            + N   +VWNPGS+F  C C W+ +G +CKH+IK+   C   +    S S   + + L++
Sbjct  566  EGNKIHVVWNPGSQFGVCSCSWAEKGYICKHMIKLTQQCLGNRASMQSASLLQYYQTLID  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            LL+ P  DS+  D + +    +  QI   V L
Sbjct  626  LLRCPPRDSLFRDYAISLAVSVEKQINAPVNL  657



>emb|CDY01179.1| BnaA04g06400D [Brassica napus]
Length=756

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 80/152 (53%), Gaps = 7/152 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y  + D  +  +EE+++  TS+ +AL IPD+ V            AKV  + 
Sbjct  512  HSYFWLDEYTGKDDFARYWREEWVSGLTSFRKALSIPDSDVVISGMS------AKVTDKC  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D N   +VW+P S F  C C W+ +G +C+H+IK+  +C   +  + S+S   + + L++
Sbjct  566  DANEVHVVWSPSSHFGVCSCSWAQKGYICQHMIKLAQVCRGNRTAKESVSLLQYYQALVD  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            LL  P  DS+  D + +    +  QI  L  L
Sbjct  626  LLHLPPGDSLFRDYAASLAVSVEKQINALGNL  657



>ref|XP_002868324.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44583.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata]
Length=776

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 79/146 (54%), Gaps = 8/146 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + +  +  K+E+++  TS+ +AL IPD+ V            AK+  + 
Sbjct  512  HSYFWLDEYSGKDNFARYWKDEWVSGLTSFRKALSIPDSDVVISGMS------AKITDEC  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D N    VWNPGS+F  C C W+ +G LCKH+IK+  +C   +  R S S   + + L++
Sbjct  566  DGNEIH-VWNPGSQFGVCSCSWAEKGYLCKHMIKLTQLCLGNRAARQSASLLQYYQTLID  624

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQI  347
            LL  P  DS+  D + +    +  QI
Sbjct  625  LLHCPPHDSLFRDYAISLAVSVEKQI  650



>ref|XP_006445380.1| hypothetical protein CICLE_v10018658mg [Citrus clementina]
 ref|XP_006464455.1| PREDICTED: uncharacterized protein LOC102610616 isoform X1 [Citrus 
sinensis]
 ref|XP_006464456.1| PREDICTED: uncharacterized protein LOC102610616 isoform X2 [Citrus 
sinensis]
 gb|ESR58620.1| hypothetical protein CICLE_v10018658mg [Citrus clementina]
 gb|KDO85575.1| hypothetical protein CISIN_1g001712mg [Citrus sinensis]
 gb|KDO85576.1| hypothetical protein CISIN_1g001712mg [Citrus sinensis]
 gb|KDO85577.1| hypothetical protein CISIN_1g001712mg [Citrus sinensis]
Length=1021

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 80/152 (53%), Gaps = 7/152 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y  + D  +  K+E+++  T W +AL+I D+ V  E R        KV  Q 
Sbjct  512  HSYFWLDEYTGKDDFARYWKDEWVSGLTCWRKALKILDSDVVIEGR------CGKVTDQL  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D N   +V NPGS+F  C+C W+  G LC+H++KV ++C      + S+S   + + LM+
Sbjct  566  DGNKVYVVRNPGSQFGICNCSWAEMGYLCEHLLKVIIVCRKKGSVKPSISLFQYNKALMD  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            +L     DS+  D + +    +  Q+   V+ 
Sbjct  626  MLHCTPHDSLIRDHAISLAVSIQKQLNASVDF  657



>ref|XP_004513230.1| PREDICTED: uncharacterized protein LOC101502422 [Cicer arietinum]
Length=803

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 73/133 (55%), Gaps = 7/133 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+D+ D  +  K E+ +  T W +AL+IPD  V  E         AKV  + 
Sbjct  511  HSYFWLDEYSDKDDFARYWKNEWTSGLTPWRKALKIPDINVLMED------GCAKVTDEH  564

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +V NPGS  + CDC W+  GNLC+H++KV  IC S    + S+S   +  +L +
Sbjct  565  DQDKAYIVCNPGSMLSICDCCWAKDGNLCEHMLKVLSICRSQGSVQPSVSLFQYHRVLNS  624

Query  424  LLKKPMDDSVALD  386
            +L  P  DS+  D
Sbjct  625  MLHCPPFDSLIRD  637



>dbj|BAK03605.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=814

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 76/151 (50%), Gaps = 9/151 (6%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNV-KEEY-IASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQ  608
            HS YWLD ++ + DSF    K E+      W + LQIPD+ +  E       + A+V+ Q
Sbjct  512  HSYYWLDEFSGK-DSFSRYWKSEWKTGPNPWQQGLQIPDSDIVIEG------NCARVVCQ  564

Query  607  KDNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILM  428
            K    +  V NPGSE A CDC WS +GNLCKH +K   +C        S++   + + L 
Sbjct  565  KHKEKSHAVLNPGSELALCDCSWSRKGNLCKHAMKSAKVCRDRGLAPPSLALLRYYQALA  624

Query  427  NLLKKPMDDSVALDLSTAWTQQMLDQIQNLV  335
            N++  P  DSV  D + A       Q+  L+
Sbjct  625  NVVHCPPSDSVICDHAIAVAVSTRTQLDALL  655



>ref|XP_003566605.1| PREDICTED: uncharacterized protein LOC100828484 [Brachypodium 
distachyon]
Length=896

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 75/150 (50%), Gaps = 9/150 (6%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNV--KEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQ  608
            HS YWLD ++ + DSF      E       W + +QIPD+ +  E       + A+V+ Q
Sbjct  512  HSYYWLDEFSGK-DSFSRYWRSEWKNGPNQWQQGMQIPDSDIVIEG------NCARVICQ  564

Query  607  KDNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILM  428
            KD   +  + NPGSE A CDC WS +GNLCKH +K   +C        S++   + + L 
Sbjct  565  KDKEKSHAILNPGSELALCDCSWSRKGNLCKHAMKSAKVCRDRGLAPPSLALLRYYQALA  624

Query  427  NLLKKPMDDSVALDLSTAWTQQMLDQIQNL  338
            N++  P  DSV  D + A    +  Q+  L
Sbjct  625  NVVHCPPSDSVVSDHAIAVAVSVRTQLDAL  654



>ref|XP_010692100.1| PREDICTED: uncharacterized protein LOC104905308 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692101.1| PREDICTED: uncharacterized protein LOC104905308 [Beta vulgaris 
subsp. vulgaris]
Length=864

 Score = 87.4 bits (215),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 82/152 (54%), Gaps = 7/152 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y  + D  +  ++E++   TSW  +L+IPD+ V  E  +      AKV+  +
Sbjct  512  HSFFWLDEYPAKHDFARYWRDEWMDGLTSWRSSLEIPDSDVILEGPR------AKVIDPQ  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +V NPGSEF+ CDC  S  GNLC+HV KV+ +C   +  + S+S   ++  L+ 
Sbjct  566  DRDKFYVVSNPGSEFSICDCTLSEGGNLCEHVCKVSFVCRKKESSKPSVSLYQYKRALIK  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            +L     DS+  D + +    +  Q+  L + 
Sbjct  626  MLCCMSHDSLIRDHAVSLMASLQTQLNALADF  657



>emb|CDY50427.1| BnaCnng19360D [Brassica napus]
Length=760

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 80/152 (53%), Gaps = 7/152 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + D  +  +EE+++  TS+ +A  IPD+ V            AKV  + 
Sbjct  512  HSYFWLDEYSGKDDFARYWREEWVSGLTSFRKASSIPDSHVVISGMS------AKVTDKC  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D N   +VW+P S F  C C W+ +G +C+H+IK+  +C   +  + S S   + + L++
Sbjct  566  DVNEVHVVWSPSSHFGVCSCSWAQKGYICQHMIKLAQVCRGNRTAKESASLLQYYQALVD  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVEL  329
            LL  P  DS+  D + +    +  QI  L +L
Sbjct  626  LLHLPPGDSLFRDYAASLAVSVEKQINALGDL  657



>ref|XP_010450122.1| PREDICTED: uncharacterized protein LOC104732283 [Camelina sativa]
Length=777

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 79/146 (54%), Gaps = 7/146 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + +  +  KEE+++  TS+ +AL IPD+ V            AK+  + 
Sbjct  512  HSYFWLDEYSGKDNFARYWKEEWVSGLTSFRKALSIPDSDVVMSGIS------AKITDEC  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            + N   +VWNPGS+F  C C W+ +G +CKH++K+  +    +  R S S   + + L++
Sbjct  566  EGNEIHVVWNPGSQFGVCSCSWAEKGYICKHMVKLTQLSLGNRVSRQSASLLQYYQTLID  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQI  347
            LL  P  DS+  D + +    +  QI
Sbjct  626  LLHCPPRDSLFRDYAVSLAVSVEKQI  651



>gb|EMT07282.1| hypothetical protein F775_09518 [Aegilops tauschii]
Length=947

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 76/151 (50%), Gaps = 9/151 (6%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNV--KEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQ  608
            HS  WLD ++ + DSF      E       W + LQIPD+ +  E       + A+V+ Q
Sbjct  644  HSYCWLDEFSGK-DSFSRYWRSEWKTGPNPWQQGLQIPDSDIVIEG------NCARVVCQ  696

Query  607  KDNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILM  428
            K  + +  + NPGSE A CDC WS +GNLCKH +K   +C        S++   + + L 
Sbjct  697  KHKDKSHAILNPGSELALCDCSWSRKGNLCKHAMKSAKVCRDRGLAPPSLALLRYYQALA  756

Query  427  NLLKKPMDDSVALDLSTAWTQQMLDQIQNLV  335
            N++  P +DSV  D + A    +  Q+  L+
Sbjct  757  NVVHCPPNDSVICDHAIAVAVSVRTQLDALL  787



>ref|XP_009790578.1| PREDICTED: uncharacterized protein LOC104238021 [Nicotiana sylvestris]
 ref|XP_009790580.1| PREDICTED: uncharacterized protein LOC104238021 [Nicotiana sylvestris]
Length=898

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 81/147 (55%), Gaps = 10/147 (7%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + +  +  K E+++  T+W ++LQIPD+ V  E        ++KV+ Q+
Sbjct  512  HSYFWLDEYSGKDEFARYWKNEWMSGLTAWQKSLQIPDSDVLVEG------DYSKVVDQE  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +V +P SE+A CDC W+  GNLC+H +K             S S   + + L++
Sbjct  566  DRHQLHVVRSPASEYAICDCNWAKMGNLCEHTLKSIKYLRDKGSITPSTSMFQYMQALVD  625

Query  424  LLKKPMDDSVALD--LSTA-WTQQMLD  353
            +L+ P  DS+  D  LS A W Q  LD
Sbjct  626  MLRCPPYDSLIRDHALSLAVWVQTQLD  652



>ref|XP_003528591.1| PREDICTED: uncharacterized protein LOC100819719 isoform X1 [Glycine 
max]
 ref|XP_006583971.1| PREDICTED: uncharacterized protein LOC100819719 isoform X2 [Glycine 
max]
 gb|KHN28159.1| hypothetical protein glysoja_023977 [Glycine soja]
Length=893

 Score = 84.7 bits (208),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 79/151 (52%), Gaps = 10/151 (7%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+++ D  +  K E+++  TSW +AL+IPD  V  E         AKV    
Sbjct  511  HSYFWLDEYSEKDDFARYWKNEWMSGLTSWRKALKIPDTDVIMED------GCAKV---T  561

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +VWN GS  + C+C W+  GNLC+H++KV  IC        S++   + + L N
Sbjct  562  DQDKAFVVWNTGSMLSICNCSWAQDGNLCEHILKVLSICRKRGSILPSVTLFQYHQALNN  621

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVE  332
            +L  P  DS   D + +    +  Q+  L++
Sbjct  622  MLHCPPFDSFIRDHAVSLAVSVQKQLNTLLD  652



>gb|EMS58193.1| hypothetical protein TRIUR3_12822 [Triticum urartu]
Length=869

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 74/151 (49%), Gaps = 9/151 (6%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNV--KEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQ  608
            HS  WLD ++ + DSF      E       W + LQIPD+ +  E       + A+V+ Q
Sbjct  537  HSYCWLDEFSGK-DSFSRYWRSEWKTGPNPWQQGLQIPDSDIVIEG------NCARVVCQ  589

Query  607  KDNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILM  428
            K    +  + NPGSE A CDC WS +GNLCKH +K   +C        S++   + + L 
Sbjct  590  KHKEKSHAILNPGSELALCDCSWSRKGNLCKHAMKSAKVCRDRGLAPPSLALLRYYQALA  649

Query  427  NLLKKPMDDSVALDLSTAWTQQMLDQIQNLV  335
            N++  P  DSV  D + A    +  Q+  L+
Sbjct  650  NVVHCPPSDSVICDHAIAVAVSVRTQLDALL  680



>ref|NP_001059218.1| Os07g0227700 [Oryza sativa Japonica Group]
 dbj|BAF21132.1| Os07g0227700 [Oryza sativa Japonica Group]
 gb|EEE66828.1| hypothetical protein OsJ_23599 [Oryza sativa Japonica Group]
Length=835

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 81/151 (54%), Gaps = 7/151 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTS-WYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS YWLD Y+ + +  +  + E+ +  + W + LQIPD+ V  E       + A+V+ QK
Sbjct  512  HSYYWLDEYSGKDNFSRYWRSEWKSGPNPWQQGLQIPDSDVVVEG------NCARVVCQK  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            +   + ++ NPGS+ A CDC WS +GN+CKH IK   +         S++   + + L N
Sbjct  566  NKERSHVIVNPGSDLALCDCSWSRKGNICKHAIKSTKVFRQRGLAPPSLALFRYYQALAN  625

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVE  332
            ++  P  D++  D + A    +  Q+ +L++
Sbjct  626  VVHCPPSDTLISDHAVAVAIFVRTQLDSLLD  656



>dbj|BAC84431.1| hypothetical protein [Oryza sativa Japonica Group]
Length=814

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 81/151 (54%), Gaps = 7/151 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTS-WYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS YWLD Y+ + +  +  + E+ +  + W + LQIPD+ V  E       + A+V+ QK
Sbjct  491  HSYYWLDEYSGKDNFSRYWRSEWKSGPNPWQQGLQIPDSDVVVEG------NCARVVCQK  544

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            +   + ++ NPGS+ A CDC WS +GN+CKH IK   +         S++   + + L N
Sbjct  545  NKERSHVIVNPGSDLALCDCSWSRKGNICKHAIKSTKVFRQRGLAPPSLALFRYYQALAN  604

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVE  332
            ++  P  D++  D + A    +  Q+ +L++
Sbjct  605  VVHCPPSDTLISDHAVAVAIFVRTQLDSLLD  635



>gb|EEC81754.1| hypothetical protein OsI_25420 [Oryza sativa Indica Group]
Length=900

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 81/151 (54%), Gaps = 7/151 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTS-WYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS YWLD Y+ + +  +  + E+ +  + W + LQIPD+ V  E       + A+V+ QK
Sbjct  581  HSYYWLDEYSGKDNFSRYWRSEWKSGPNPWQQGLQIPDSDVVVEG------NCARVVCQK  634

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            +   + ++ NPGS+ A CDC WS +GN+CKH IK   +         S++   + + L N
Sbjct  635  NKERSHVIVNPGSDLALCDCSWSRKGNICKHAIKSTKVFRQRGLAPPSLALFRYYQALAN  694

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVE  332
            ++  P  D++  D + A    +  Q+ +L++
Sbjct  695  VVHCPPSDTLISDHAVAVAIFVRTQLDSLLD  725



>gb|AES89835.2| zinc ion-binding protein [Medicago truncatula]
Length=761

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 79/151 (52%), Gaps = 7/151 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD  +D+    +  K E+ +   SW +AL+IPD  V  E  +      AKV  + 
Sbjct  510  HSYFWLDECSDKDGFARYWKNEWTSGLASWRKALKIPDTNVLMEDGR------AKVKDED  563

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D + T +V NPGS  + CDC W+  GNLC+H++KV  +  S      S+S   + + L +
Sbjct  564  DQDKTYIVSNPGSMLSICDCCWAKDGNLCEHILKVLSVFRSRGSVLPSISLLQYHQALKS  623

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVE  332
            +L  P  DS+  D + +    +  Q+  L++
Sbjct  624  MLHCPPFDSLIRDHAVSLAVSVQRQLNTLLD  654



>ref|XP_003607638.1| hypothetical protein MTR_4g080580 [Medicago truncatula]
Length=797

 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 79/151 (52%), Gaps = 7/151 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD  +D+    +  K E+ +   SW +AL+IPD  V  E  +      AKV  + 
Sbjct  546  HSYFWLDECSDKDGFARYWKNEWTSGLASWRKALKIPDTNVLMEDGR------AKVKDED  599

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D + T +V NPGS  + CDC W+  GNLC+H++KV  +  S      S+S   + + L +
Sbjct  600  DQDKTYIVSNPGSMLSICDCCWAKDGNLCEHILKVLSVFRSRGSVLPSISLLQYHQALKS  659

Query  424  LLKKPMDDSVALDLSTAWTQQMLDQIQNLVE  332
            +L  P  DS+  D + +    +  Q+  L++
Sbjct  660  MLHCPPFDSLIRDHAVSLAVSVQRQLNTLLD  690



>ref|XP_009605496.1| PREDICTED: uncharacterized protein LOC104100042 [Nicotiana tomentosiformis]
Length=895

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 79/147 (54%), Gaps = 10/147 (7%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + +  +  K E+++  T+W ++LQIPD+ V  E        ++ V+ Q+
Sbjct  512  HSYFWLDEYSGKDEFARYWKNEWMSGLTAWQKSLQIPDSDVLVEG------DYSNVVDQE  565

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMN  425
            D +   +V +P SE+A CDC W+  GNLC+H +K             S S   + + L++
Sbjct  566  DRHQLHVVRSPASEYAICDCNWAKMGNLCEHTLKSIKYLRDKGSITPSTSMFQYMQALVD  625

Query  424  LLKKPMDDSVALD--LSTA-WTQQMLD  353
            +L  P  DS+  D  LS A W Q  L+
Sbjct  626  MLHCPPYDSLIRDHALSLAVWVQTQLN  652



>ref|XP_002301246.2| hypothetical protein POPTR_0002s14170g [Populus trichocarpa]
 gb|EEE80519.2| hypothetical protein POPTR_0002s14170g [Populus trichocarpa]
Length=873

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 56/89 (63%), Gaps = 7/89 (8%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+++ D  +  K+E+++  TSW +AL+IPD+ V  + R       AKV  Q 
Sbjct  484  HSYFWLDEYSEKDDFARYWKDEWVSGLTSWRKALKIPDSDVVMDGR------CAKVTDQL  537

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLC  518
              +   +VWNPGS+FA CDC W+  GNLC
Sbjct  538  YRDRVYVVWNPGSQFAICDCRWAEMGNLC  566



>gb|KHN10140.1| hypothetical protein glysoja_023721 [Glycine soja]
Length=165

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = -3

Query  412  PMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRTSRGKPTSA  233
            P+DDS ALDLS AWT QMLDQIQ  VELN+S +I  +VNNMPL+W+S+K RT  GKP+S 
Sbjct  89   PVDDSFALDLSLAWTHQMLDQIQKQVELNNSTDIDTVVNNMPLKWVSKKGRTYIGKPSS-  147

Query  232  LTLPPSS  212
            L LP  S
Sbjct  148  LALPHGS  154



>gb|ERM94292.1| hypothetical protein AMTR_s00010p00231990 [Amborella trichopoda]
Length=797

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 56/98 (57%), Gaps = 4/98 (4%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YW  +YA ++   + V  E++ + +W  AL+IPD  V ++S      H AKV +Q  
Sbjct  517  HSYYWYGQYAKKNGLCRTVATEHLQNNAWQNALKIPDGDVVWDSL---CFHIAKVHNQLG  573

Query  601  NNVTRL-VWNPGSEFAHCDCEWSMQGNLCKHVIKVNMI  491
             +     +WNPGSE++ CDC   +  + C+H+ K+ M+
Sbjct  574  GHPEYFTLWNPGSEYSLCDCGVPICASTCEHIAKLYMV  611



>ref|XP_011622982.1| PREDICTED: uncharacterized protein LOC18422177 [Amborella trichopoda]
Length=759

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 56/98 (57%), Gaps = 4/98 (4%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YW  +YA ++   + V  E++ + +W  AL+IPD  V ++S      H AKV +Q  
Sbjct  479  HSYYWYGQYAKKNGLCRTVATEHLQNNAWQNALKIPDGDVVWDSL---CFHIAKVHNQLG  535

Query  601  NNVTRL-VWNPGSEFAHCDCEWSMQGNLCKHVIKVNMI  491
             +     +WNPGSE++ CDC   +  + C+H+ K+ M+
Sbjct  536  GHPEYFTLWNPGSEYSLCDCGVPICASTCEHIAKLYMV  573



>emb|CAB10176.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78439.1| hypothetical protein [Arabidopsis thaliana]
Length=675

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 52/95 (55%), Gaps = 7/95 (7%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIAS-TSWYRALQIPDAAVSFESRQQSQHHFAKVLSQK  605
            HS +WLD Y+ + +  +  KEE+++  TS+ +AL IPD+ V            AK+  + 
Sbjct  456  HSYFWLDEYSGKDNFARYWKEEWVSGLTSFRKALSIPDSDVVISGMS------AKITDEC  509

Query  604  DNNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKV  500
            D N   +VWNPGS+F  C C W+ +G +    + V
Sbjct  510  DGNEIHVVWNPGSQFGVCSCSWAEKGYIFSLAVSV  544



>gb|KHN16480.1| hypothetical protein glysoja_036582 [Glycine soja]
Length=430

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 59/148 (40%), Gaps = 54/148 (36%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQKD  602
            HS YWLD+Y+ E+  F+N++                                       D
Sbjct  317  HSLYWLDQYSLETGYFENLR---------------------------------------D  337

Query  601  NNVTRLVWNPGSEFAHCDCEWSMQGNLCKHVIKVNMICGSIQGFRSSMSFQSFQEILMNL  422
            N+ +  VW                GNLCKHVIKV   C S Q  R S+S Q +++ L+ L
Sbjct  338  NSFSSNVW---------------LGNLCKHVIKVATFCRSQQVARPSLSTQGYKQALLTL  382

Query  421  LKKPMDDSVALDLSTAWTQQMLDQIQNL  338
            L  P DD + LDL+      +   I+ L
Sbjct  383  LHNPPDDPLVLDLTILHVTHLQQDIKAL  410



>gb|EMS61136.1| hypothetical protein TRIUR3_35179 [Triticum urartu]
Length=654

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  436  ILMNLLKKPMDDSVALDLSTAWTQQMLDQIQNLVELnssnnignivnNMPLRWISRKRRT  257
            +L++L +KP+DDS +LDLS AW  QM ++IQ + EL +S+ I  +   +P++W +++ R 
Sbjct  556  VLLDLWQKPLDDSFSLDLSVAWVMQMQERIQKVAELAASDGIAQVAGKLPIQWANKRGRR  615

Query  256  SRGKPTSALTLPPSSQS  206
            +  + TS +   P S  
Sbjct  616  TAIRRTSPMRFLPHSNG  632



>ref|XP_003603488.1| hypothetical protein MTR_3g108220 [Medicago truncatula]
Length=552

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 3/58 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQ  608
            HS YWLD+Y+ E+  F+N+++   ++ +WY AL IPD  V      +   H AK+LSQ
Sbjct  485  HSLYWLDQYSLETGYFENLRDNSFSTNAWYHALHIPDVDVVL---NEQNLHLAKILSQ  539



>gb|AES73739.2| zinc ion-binding protein [Medicago truncatula]
Length=540

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 3/58 (5%)
 Frame = -3

Query  781  HSSYWLDRYADESDSFQNVKEEYIASTSWYRALQIPDAAVSFESRQQSQHHFAKVLSQ  608
            HS YWLD+Y+ E+  F+N+++   ++ +WY AL IPD  V      +   H AK+LSQ
Sbjct  473  HSLYWLDQYSLETGYFENLRDNSFSTNAWYHALHIPDVDVVL---NEQNLHLAKILSQ  527



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1572839714856