BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9969

Length=809
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010094777.1|  hypothetical protein L484_019987                   377   1e-123   
gb|KDO41976.1|  hypothetical protein CISIN_1g007863mg                   364   4e-122   Citrus sinensis [apfelsine]
ref|XP_006440946.1|  hypothetical protein CICLE_v100194172mg            364   1e-121   
gb|KDO41975.1|  hypothetical protein CISIN_1g007863mg                   365   2e-121   Citrus sinensis [apfelsine]
gb|KJB39318.1|  hypothetical protein B456_007G006100                    363   9e-121   Gossypium raimondii
ref|XP_002511958.1|  serine/threonine protein phosphatase 2a regu...    369   1e-120   Ricinus communis
ref|XP_010681587.1|  PREDICTED: serine/threonine-protein phosphat...    369   2e-120   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010102837.1|  Serine/threonine-protein phosphatase 2A 65 k...    357   2e-120   
ref|XP_012092991.1|  PREDICTED: serine/threonine-protein phosphat...    368   3e-120   Jatropha curcas
ref|XP_010263329.1|  PREDICTED: serine/threonine-protein phosphat...    367   6e-120   Nelumbo nucifera [Indian lotus]
gb|AAM94368.1|  protein phosphatase 2A regulatory A subunit             357   6e-120   Lolium perenne [perennial ryegrass]
gb|KDP20104.1|  hypothetical protein JCGZ_05873                         367   7e-120   Jatropha curcas
ref|XP_006485775.1|  PREDICTED: serine/threonine-protein phosphat...    367   1e-119   Citrus sinensis [apfelsine]
ref|XP_002276180.1|  PREDICTED: serine/threonine-protein phosphat...    366   2e-119   Vitis vinifera
ref|XP_011006221.1|  PREDICTED: serine/threonine-protein phosphat...    365   4e-119   Populus euphratica
gb|KDO41972.1|  hypothetical protein CISIN_1g007863mg                   365   4e-119   Citrus sinensis [apfelsine]
gb|EYU29958.1|  hypothetical protein MIMGU_mgv1a005777mg                361   6e-119   Erythranthe guttata [common monkey flower]
gb|KHG03474.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    364   1e-118   Gossypium arboreum [tree cotton]
emb|CBI15438.3|  unnamed protein product                                365   1e-118   Vitis vinifera
gb|KJB39317.1|  hypothetical protein B456_007G006100                    363   1e-118   Gossypium raimondii
gb|KJB39313.1|  hypothetical protein B456_007G006100                    363   1e-118   Gossypium raimondii
ref|XP_008374745.1|  PREDICTED: serine/threonine-protein phosphat...    363   2e-118   Malus domestica [apple tree]
gb|AFY06655.1|  protein phosphatase 2A regulatory subunit               355   2e-118   Carica papaya [mamon]
emb|CDO98444.1|  unnamed protein product                                363   3e-118   Coffea canephora [robusta coffee]
emb|CAA10285.1|  protein phosphatase                                    361   3e-118   Cicer arietinum [garbanzo]
ref|XP_002876929.1|  hypothetical protein ARALYDRAFT_904748             362   4e-118   Arabidopsis lyrata subsp. lyrata
ref|XP_012082057.1|  PREDICTED: serine/threonine-protein phosphat...    362   4e-118   Jatropha curcas
ref|XP_007036502.1|  Phosphatase 2A subunit A2, 65,PP2AA2 isoform 1     362   5e-118   Theobroma cacao [chocolate]
gb|KJB52972.1|  hypothetical protein B456_008G286100                    362   5e-118   Gossypium raimondii
ref|NP_189208.1|  protein phosphatase 2A subunit A2                     362   5e-118   Arabidopsis thaliana [mouse-ear cress]
emb|CAA57528.1|  protein phosphatase 2A 65 kDa regulatory subunit       362   6e-118   Arabidopsis thaliana [mouse-ear cress]
gb|AFW75384.1|  hypothetical protein ZEAMMB73_324274                    356   8e-118   
gb|AEQ75494.1|  serine/threonine protein phosphatase 2a regulator...    362   8e-118   Rosa multiflora [Japanese rose]
ref|XP_006395624.1|  hypothetical protein EUTSA_v10003886mg             361   1e-117   Eutrema salsugineum [saltwater cress]
ref|XP_004512939.1|  PREDICTED: serine/threonine-protein phosphat...    361   1e-117   Cicer arietinum [garbanzo]
ref|XP_007225550.1|  hypothetical protein PRUPE_ppa003299m2g            361   2e-117   Prunus persica
ref|XP_011077133.1|  PREDICTED: serine/threonine-protein phosphat...    360   2e-117   Sesamum indicum [beniseed]
ref|XP_006437703.1|  hypothetical protein CICLE_v10031047mg             360   2e-117   Citrus clementina [clementine]
ref|XP_009347000.1|  PREDICTED: serine/threonine-protein phosphat...    360   2e-117   Pyrus x bretschneideri [bai li]
gb|AFW86036.1|  hypothetical protein ZEAMMB73_179225                    354   4e-117   
ref|XP_010528048.1|  PREDICTED: serine/threonine-protein phosphat...    360   5e-117   Tarenaya hassleriana [spider flower]
ref|XP_009152111.1|  PREDICTED: serine/threonine-protein phosphat...    359   6e-117   Brassica rapa
ref|XP_008243199.1|  PREDICTED: serine/threonine-protein phosphat...    359   8e-117   Prunus mume [ume]
ref|XP_006484434.1|  PREDICTED: serine/threonine-protein phosphat...    359   8e-117   Citrus sinensis [apfelsine]
ref|XP_009621929.1|  PREDICTED: serine/threonine-protein phosphat...    358   1e-116   
ref|XP_008446576.1|  PREDICTED: serine/threonine-protein phosphat...    358   1e-116   Cucumis melo [Oriental melon]
ref|XP_002529138.1|  serine/threonine protein phosphatase 2a regu...    358   2e-116   Ricinus communis
ref|XP_007046273.1|  Phosphatase 2A subunit A2, 65,PP2AA2               358   2e-116   
ref|XP_010495219.1|  PREDICTED: serine/threonine-protein phosphat...    358   2e-116   Camelina sativa [gold-of-pleasure]
ref|XP_010458784.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    358   2e-116   Camelina sativa [gold-of-pleasure]
ref|XP_006307029.1|  hypothetical protein CARUB_v10008615mg             358   2e-116   
ref|XP_010476330.1|  PREDICTED: serine/threonine-protein phosphat...    358   2e-116   Camelina sativa [gold-of-pleasure]
ref|XP_010476329.1|  PREDICTED: serine/threonine-protein phosphat...    358   3e-116   Camelina sativa [gold-of-pleasure]
ref|XP_007210261.1|  hypothetical protein PRUPE_ppa003291mg             358   3e-116   Prunus persica
ref|XP_008339694.1|  PREDICTED: serine/threonine-protein phosphat...    357   3e-116   
ref|XP_008361732.1|  PREDICTED: serine/threonine-protein phosphat...    357   4e-116   
ref|XP_009606530.1|  PREDICTED: serine/threonine-protein phosphat...    357   5e-116   Nicotiana tomentosiformis
ref|XP_002892742.1|  hypothetical protein ARALYDRAFT_888699             357   5e-116   Arabidopsis lyrata subsp. lyrata
ref|XP_009766514.1|  PREDICTED: serine/threonine-protein phosphat...    357   5e-116   Nicotiana sylvestris
gb|AFW75383.1|  hypothetical protein ZEAMMB73_324274                    355   6e-116   
gb|ACN41352.2|  protein phosphatase 2A regulatory subunit A             354   6e-116   Betula pendula [white birch]
emb|CDP00596.1|  unnamed protein product                                358   6e-116   Coffea canephora [robusta coffee]
ref|XP_010458785.1|  PREDICTED: serine/threonine-protein phosphat...    357   7e-116   Camelina sativa [gold-of-pleasure]
ref|XP_006583401.1|  PREDICTED: serine/threonine-protein phosphat...    357   7e-116   Glycine max [soybeans]
ref|XP_008240282.1|  PREDICTED: serine/threonine-protein phosphat...    357   8e-116   Prunus mume [ume]
ref|XP_009356482.1|  PREDICTED: serine/threonine-protein phosphat...    357   8e-116   Pyrus x bretschneideri [bai li]
ref|XP_011070821.1|  PREDICTED: serine/threonine-protein phosphat...    356   9e-116   Sesamum indicum [beniseed]
emb|CAA57529.1|  protein phosphatase 2A 65 kDa regulatory subunit       354   9e-116   Arabidopsis thaliana [mouse-ear cress]
gb|KEH27050.1|  serine/threonine protein phosphatase 2A regulator...    356   1e-115   Medicago truncatula
ref|XP_004297127.1|  PREDICTED: serine/threonine-protein phosphat...    356   1e-115   Fragaria vesca subsp. vesca
ref|XP_004956389.1|  PREDICTED: serine/threonine-protein phosphat...    356   1e-115   Setaria italica
ref|XP_011021847.1|  PREDICTED: serine/threonine-protein phosphat...    356   1e-115   Populus euphratica
gb|AAG29594.1|AF196287_1  Ser/Thr specific protein phosphatase 2A...    356   1e-115   Medicago sativa subsp. x varia
ref|XP_004300534.1|  PREDICTED: serine/threonine-protein phosphat...    356   1e-115   Fragaria vesca subsp. vesca
ref|XP_010495228.1|  PREDICTED: serine/threonine-protein phosphat...    356   1e-115   Camelina sativa [gold-of-pleasure]
gb|KHN20717.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    354   1e-115   Glycine soja [wild soybean]
ref|XP_006417131.1|  hypothetical protein EUTSA_v10007164mg             356   1e-115   Eutrema salsugineum [saltwater cress]
ref|XP_002314877.1|  hypothetical protein POPTR_0010s13760g             356   2e-115   
gb|KJB23732.1|  hypothetical protein B456_004G112500                    355   2e-115   Gossypium raimondii
ref|XP_009776620.1|  PREDICTED: serine/threonine-protein phosphat...    355   2e-115   Nicotiana sylvestris
ref|XP_004241625.1|  PREDICTED: serine/threonine-protein phosphat...    355   2e-115   
ref|XP_008648330.1|  PREDICTED: LOC732740 isoform X1                    355   2e-115   Zea mays [maize]
gb|AEB40165.1|  protein phosphatase 2A structural subunit               355   2e-115   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006354729.1|  PREDICTED: serine/threonine-protein phosphat...    355   2e-115   Solanum tuberosum [potatoes]
sp|P36875.1|2AAA_PEA  RecName: Full=Protein phosphatase PP2A regu...    349   3e-115   Pisum sativum [garden pea]
emb|CAA66487.1|  protein phosphatase 2A                                 355   3e-115   Nicotiana tabacum [American tobacco]
ref|XP_003577041.1|  PREDICTED: serine/threonine-protein phosphat...    355   3e-115   Brachypodium distachyon [annual false brome]
ref|XP_010942275.1|  PREDICTED: serine/threonine-protein phosphat...    355   4e-115   Elaeis guineensis
ref|XP_007152779.1|  hypothetical protein PHAVU_004G159000g             355   4e-115   Phaseolus vulgaris [French bean]
ref|XP_004497109.1|  PREDICTED: serine/threonine-protein phosphat...    355   4e-115   Cicer arietinum [garbanzo]
ref|XP_009336593.1|  PREDICTED: serine/threonine-protein phosphat...    354   5e-115   Pyrus x bretschneideri [bai li]
ref|NP_172790.2|  protein phosphatase 2A subunit A3                     354   7e-115   Arabidopsis thaliana [mouse-ear cress]
gb|KEH44250.1|  serine/threonine protein phosphatase 2A regulator...    354   9e-115   Medicago truncatula
ref|NP_001062674.1|  Os09g0249700                                       354   9e-115   
ref|XP_010265183.1|  PREDICTED: serine/threonine-protein phosphat...    353   1e-114   Nelumbo nucifera [Indian lotus]
gb|AAG29593.1|AF196286_1  Ser/Thr specific protein phosphatase 2A...    353   1e-114   Medicago sativa subsp. x varia
gb|ACL54598.1|  unknown                                                 353   1e-114   Zea mays [maize]
ref|XP_008350866.1|  PREDICTED: serine/threonine-protein phosphat...    353   1e-114   
ref|XP_008659343.1|  PREDICTED: serine/threonine-protein phosphat...    353   1e-114   
ref|XP_011008279.1|  PREDICTED: serine/threonine-protein phosphat...    353   1e-114   Populus euphratica
ref|XP_007142893.1|  hypothetical protein PHAVU_007G0258001g            351   1e-114   Phaseolus vulgaris [French bean]
ref|XP_010554238.1|  PREDICTED: serine/threonine-protein phosphat...    353   2e-114   Tarenaya hassleriana [spider flower]
gb|KHN32028.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    350   3e-114   Glycine soja [wild soybean]
ref|XP_008393303.1|  PREDICTED: serine/threonine-protein phosphat...    353   3e-114   
ref|XP_007142892.1|  hypothetical protein PHAVU_007G0258001g            351   3e-114   Phaseolus vulgaris [French bean]
gb|EYU40874.1|  hypothetical protein MIMGU_mgv1a003588mg                352   3e-114   Erythranthe guttata [common monkey flower]
ref|XP_006660451.1|  PREDICTED: serine/threonine-protein phosphat...    352   4e-114   Oryza brachyantha
ref|XP_010044277.1|  PREDICTED: serine/threonine-protein phosphat...    352   4e-114   Eucalyptus grandis [rose gum]
ref|XP_004238945.1|  PREDICTED: serine/threonine-protein phosphat...    352   4e-114   Solanum lycopersicum
gb|KGN52064.1|  hypothetical protein Csa_5G608520                       358   5e-114   
ref|XP_003577085.1|  PREDICTED: serine/threonine-protein phosphat...    352   5e-114   Brachypodium distachyon [annual false brome]
ref|XP_007153361.1|  hypothetical protein PHAVU_003G029000g             352   7e-114   Phaseolus vulgaris [French bean]
emb|CDY13586.1|  BnaA06g33370D                                          352   7e-114   Brassica napus [oilseed rape]
ref|XP_006362557.1|  PREDICTED: serine/threonine-protein phosphat...    351   1e-113   Solanum tuberosum [potatoes]
ref|XP_003534171.1|  PREDICTED: serine/threonine-protein phosphat...    351   1e-113   Glycine max [soybeans]
ref|XP_008797605.1|  PREDICTED: serine/threonine-protein phosphat...    350   2e-113   Phoenix dactylifera
ref|XP_010677978.1|  PREDICTED: serine/threonine-protein phosphat...    350   2e-113   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010929062.1|  PREDICTED: serine/threonine-protein phosphat...    350   2e-113   Elaeis guineensis
ref|XP_003536691.1|  PREDICTED: serine/threonine-protein phosphat...    350   2e-113   Glycine max [soybeans]
gb|EPS62738.1|  hypothetical protein M569_12049                         349   6e-113   Genlisea aurea
gb|KJB23731.1|  hypothetical protein B456_004G112500                    348   1e-112   Gossypium raimondii
ref|XP_009396282.1|  PREDICTED: serine/threonine-protein phosphat...    347   4e-112   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB23730.1|  hypothetical protein B456_004G112500                    347   4e-112   Gossypium raimondii
gb|KHN27183.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    347   5e-112   Glycine soja [wild soybean]
ref|XP_003518674.1|  PREDICTED: serine/threonine-protein phosphat...    347   5e-112   Glycine max [soybeans]
ref|XP_003555890.1|  PREDICTED: serine/threonine-protein phosphat...    347   6e-112   Glycine max [soybeans]
ref|XP_002312385.1|  hypothetical protein POPTR_0008s11730g             346   9e-112   
ref|XP_010036877.1|  PREDICTED: serine/threonine-protein phosphat...    346   9e-112   Eucalyptus grandis [rose gum]
ref|XP_009415447.1|  PREDICTED: serine/threonine-protein phosphat...    345   2e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004972370.1|  PREDICTED: serine/threonine-protein phosphat...    345   3e-111   Setaria italica
ref|XP_004956390.1|  PREDICTED: serine/threonine-protein phosphat...    344   6e-111   Setaria italica
gb|KJB80118.1|  hypothetical protein B456_013G081300                    342   6e-111   Gossypium raimondii
ref|XP_010237331.1|  PREDICTED: serine/threonine-protein phosphat...    343   7e-111   
ref|XP_006367043.1|  PREDICTED: serine/threonine-protein phosphat...    343   1e-110   Solanum tuberosum [potatoes]
ref|NP_001105839.1|  LOC732740                                          342   2e-110   Zea mays [maize]
gb|KJB80114.1|  hypothetical protein B456_013G081300                    342   3e-110   Gossypium raimondii
gb|KJB80117.1|  hypothetical protein B456_013G081300                    342   3e-110   Gossypium raimondii
ref|XP_002282096.2|  PREDICTED: serine/threonine-protein phosphat...    342   3e-110   Vitis vinifera
gb|KHG15336.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    342   4e-110   Gossypium arboreum [tree cotton]
ref|XP_006854054.1|  PREDICTED: serine/threonine-protein phosphat...    342   5e-110   Amborella trichopoda
dbj|BAD94840.1|  phosphoprotein phosphatase 2A regulatory subunit A     333   6e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010237336.1|  PREDICTED: serine/threonine-protein phosphat...    341   1e-109   Brachypodium distachyon [annual false brome]
emb|CBI27044.3|  unnamed protein product                                342   1e-109   Vitis vinifera
ref|XP_008659344.1|  PREDICTED: serine/threonine-protein phosphat...    340   1e-109   Zea mays [maize]
ref|XP_009396657.1|  PREDICTED: serine/threonine-protein phosphat...    350   2e-109   
ref|XP_009391301.1|  PREDICTED: serine/threonine-protein phosphat...    340   2e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010551283.1|  PREDICTED: serine/threonine-protein phosphat...    340   2e-109   Tarenaya hassleriana [spider flower]
ref|XP_006660452.1|  PREDICTED: serine/threonine-protein phosphat...    340   2e-109   Oryza brachyantha
ref|NP_001150156.1|  LOC100283785                                       339   4e-109   Zea mays [maize]
ref|XP_008783038.1|  PREDICTED: serine/threonine-protein phosphat...    338   9e-109   Phoenix dactylifera
gb|AAG09551.1|AC011810_10  Putative protein phosphotase 2a 65kd r...    337   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415878.1|  hypothetical protein EUTSA_v10007162mg             336   6e-108   Eutrema salsugineum [saltwater cress]
ref|XP_010460344.1|  PREDICTED: serine/threonine-protein phosphat...    334   6e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010499103.1|  PREDICTED: serine/threonine-protein phosphat...    333   6e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010477897.1|  PREDICTED: serine/threonine-protein phosphat...    333   6e-107   Camelina sativa [gold-of-pleasure]
gb|AFW75382.1|  hypothetical protein ZEAMMB73_324274                    335   7e-107   
ref|XP_002893420.1|  serine/threonine protein phosphatase type 2A...    333   7e-107   
emb|CDY24397.1|  BnaCnng04640D                                          328   7e-107   Brassica napus [oilseed rape]
ref|NP_173920.1|  serine/threonine-protein phosphatase 2A regulat...    333   7e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307078.1|  hypothetical protein CARUB_v10008664mg             333   7e-107   Capsella rubella
ref|XP_001777048.1|  predicted protein                                  333   1e-106   
ref|XP_004236962.1|  PREDICTED: serine/threonine-protein phosphat...    333   1e-106   Solanum lycopersicum
emb|CDY42101.1|  BnaA09g28590D                                          332   4e-106   Brassica napus [oilseed rape]
ref|XP_009115632.1|  PREDICTED: serine/threonine-protein phosphat...    324   5e-106   
emb|CDY39185.1|  BnaC09g21590D                                          326   2e-105   Brassica napus [oilseed rape]
emb|CDY36104.1|  BnaA08g19440D                                          329   4e-105   Brassica napus [oilseed rape]
gb|AAB60713.1|  serine/threonine protein phosphatase type 2A regu...    329   5e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109883.1|  PREDICTED: serine/threonine-protein phosphat...    328   6e-105   Brassica rapa
emb|CDY51132.1|  BnaA07g37150D                                          328   7e-105   Brassica napus [oilseed rape]
gb|KJB50734.1|  hypothetical protein B456_008G184500                    328   7e-105   Gossypium raimondii
ref|XP_001775815.1|  predicted protein                                  326   8e-104   
ref|XP_009103071.1|  PREDICTED: serine/threonine-protein phosphat...    325   9e-104   Brassica rapa
emb|CAA57527.1|  65 kDa regulatory subunit of protein phosphatase 2A    325   2e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001769725.1|  predicted protein                                  324   3e-103   
ref|XP_002988290.1|  hypothetical protein SELMODRAFT_447252             317   1e-100   
ref|XP_002963887.1|  hypothetical protein SELMODRAFT_166330             317   1e-100   Selaginella moellendorffii
ref|XP_007036503.1|  Serine/threonine-protein phosphatase 2A 65 k...    307   1e-98    
ref|XP_002973833.1|  hypothetical protein SELMODRAFT_232183             311   3e-98    
ref|XP_011623847.1|  PREDICTED: serine/threonine-protein phosphat...    310   7e-98    Amborella trichopoda
gb|ERN07361.1|  hypothetical protein AMTR_s00019p00236090               310   9e-98    Amborella trichopoda
emb|CAN68660.1|  hypothetical protein VITISV_002162                     299   1e-93    Vitis vinifera
gb|KHG29905.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    288   6e-91    Gossypium arboreum [tree cotton]
ref|XP_006297363.1|  hypothetical protein CARUB_v10013383mg             290   2e-90    
gb|KHG29904.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    287   6e-90    Gossypium arboreum [tree cotton]
ref|XP_008659342.1|  PREDICTED: serine/threonine-protein phosphat...    286   2e-88    Zea mays [maize]
ref|XP_010319425.1|  PREDICTED: serine/threonine-protein phosphat...    275   8e-85    Solanum lycopersicum
ref|XP_006279159.1|  hypothetical protein CARUB_v100079671mg            256   2e-82    
ref|XP_009616233.1|  PREDICTED: serine/threonine-protein phosphat...    268   7e-82    Nicotiana tomentosiformis
ref|XP_009419803.1|  PREDICTED: serine/threonine-protein phosphat...    254   1e-81    
gb|ABR14732.1|  protein phosphatase                                     254   2e-80    Gossypium hirsutum [American cotton]
emb|CDY03849.1|  BnaC07g10740D                                          263   4e-80    
gb|AFB74194.1|  protein phosphatase 2A                                  252   2e-78    Halocnemum strobilaceum
gb|KJB39314.1|  hypothetical protein B456_007G006100                    255   2e-77    Gossypium raimondii
ref|NP_001030769.1|  protein phosphatase 2A subunit A2                  254   1e-76    Arabidopsis thaliana [mouse-ear cress]
emb|CDY04181.1|  BnaA09g19590D                                          247   3e-76    
gb|KDO41973.1|  hypothetical protein CISIN_1g007863mg                   253   3e-76    Citrus sinensis [apfelsine]
ref|NP_001031035.1|  protein phosphatase 2A subunit A3                  249   6e-75    Arabidopsis thaliana [mouse-ear cress]
emb|CDY69424.1|  BnaAnng30450D                                          249   7e-75    Brassica napus [oilseed rape]
ref|XP_009764796.1|  PREDICTED: serine/threonine-protein phosphat...    250   9e-75    Nicotiana sylvestris
ref|XP_005644559.1|  ARM repeat-containing protein                      248   9e-74    Coccomyxa subellipsoidea C-169
ref|XP_002954993.1|  hypothetical protein VOLCADRAFT_83018              236   1e-69    Volvox carteri f. nagariensis
ref|XP_004363241.1|  protein phosphatase 2A scaffold subunit            236   2e-69    Cavenderia fasciculata
ref|XP_001697300.1|  protein phosphatase 2A regulatory subunit          236   3e-69    Chlamydomonas reinhardtii
emb|CDX84995.1|  BnaC05g20600D                                          224   3e-69    
gb|EFA85153.1|  protein phosphatase 2A scaffold subunit                 236   5e-69    Heterostelium album PN500
ref|XP_638954.1|  protein phosphatase 2A scaffold subunit               229   7e-67    Dictyostelium discoideum AX4
ref|XP_004358064.1|  HEAT repeat containing protein                     228   1e-66    Acanthamoeba castellanii str. Neff
ref|XP_004671588.1|  PREDICTED: serine/threonine-protein phosphat...    219   2e-66    
dbj|GAM25934.1|  hypothetical protein SAMD00019534_091090               229   3e-66    Acytostelium subglobosum LB1
gb|AAB03670.1|  phosphoprotein phosphatase A                            227   5e-66    Dictyostelium discoideum
pdb|3C5W|A  Chain A, Complex Between Pp2a-Specific Methylesterase...    217   5e-66    Homo sapiens [man]
ref|XP_006746607.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-65    
dbj|GAM23034.1|  hypothetical protein SAMD00019534_062090               226   2e-65    Acytostelium subglobosum LB1
ref|XP_006376761.1|  hypothetical protein POPTR_0012s06200g             211   2e-65    
ref|XP_001625764.1|  predicted protein                                  223   1e-64    Nematostella vectensis
ref|XP_003290313.1|  phosphoprotein phosphatase A                       223   1e-64    Dictyostelium purpureum
gb|KFM75065.1|  Serine/threonine-protein phosphatase 2A regulator...    219   1e-64    Stegodyphus mimosarum
emb|CDX87453.1|  BnaA07g34200D                                          210   2e-64    
gb|ETE63053.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    223   2e-64    Ophiophagus hannah
gb|ACN58639.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    214   2e-64    Salmo salar
ref|XP_007441284.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-64    Python bivittatus
pdb|4LAC|A  Chain A, Crystal Structure Of Protein Phosphatase 2a ...    213   3e-64    Homo sapiens [man]
ref|XP_005404518.1|  PREDICTED: serine/threonine-protein phosphat...    219   4e-64    
gb|KFO36119.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    222   4e-64    Fukomys damarensis [Damara mole rat]
emb|CDY70440.1|  BnaAnng33670D                                          209   6e-64    Brassica napus [oilseed rape]
ref|XP_004316880.1|  PREDICTED: serine/threonine-protein phosphat...    217   9e-64    
dbj|BAG52168.1|  unnamed protein product                                217   9e-64    Homo sapiens [man]
ref|XP_008969519.1|  PREDICTED: serine/threonine-protein phosphat...    215   9e-64    Pan paniscus [bonobo]
ref|NP_001272048.1|  uncharacterized protein LOC101865435               217   1e-63    
ref|XP_008174129.1|  PREDICTED: serine/threonine-protein phosphat...    219   1e-63    Chrysemys picta bellii
ref|XP_008969515.1|  PREDICTED: serine/threonine-protein phosphat...    216   2e-63    Pan paniscus [bonobo]
ref|XP_002162841.2|  PREDICTED: serine/threonine-protein phosphat...    220   3e-63    Hydra vulgaris
ref|XP_007173032.1|  PREDICTED: serine/threonine-protein phosphat...    217   3e-63    Balaenoptera acutorostrata scammoni
ref|XP_005404517.1|  PREDICTED: serine/threonine-protein phosphat...    219   3e-63    
ref|XP_007054025.1|  PREDICTED: serine/threonine-protein phosphat...    220   4e-63    
ref|NP_001171792.1|  protein phosphatase 2, regulatory subunit A,...    219   4e-63    Saccoglossus kowalevskii
ref|XP_006114916.1|  PREDICTED: serine/threonine-protein phosphat...    214   4e-63    
ref|XP_003225135.2|  PREDICTED: serine/threonine-protein phosphat...    219   5e-63    
ref|XP_001418916.1|  predicted protein                                  219   6e-63    Ostreococcus lucimarinus CCE9901
ref|XP_006190431.1|  PREDICTED: serine/threonine-protein phosphat...    215   6e-63    
ref|XP_005987322.1|  PREDICTED: serine/threonine-protein phosphat...    219   6e-63    
ref|XP_005404516.1|  PREDICTED: serine/threonine-protein phosphat...    219   6e-63    
ref|XP_004709032.1|  PREDICTED: serine/threonine-protein phosphat...    214   7e-63    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004273471.1|  PREDICTED: serine/threonine-protein phosphat...    216   7e-63    
gb|ELT97469.1|  hypothetical protein CAPTEDRAFT_152474                  219   7e-63    Capitella teleta
ref|NP_998541.1|  serine/threonine-protein phosphatase 2A 65 kDa ...    216   8e-63    
ref|XP_004689333.1|  PREDICTED: serine/threonine-protein phosphat...    214   9e-63    Condylura cristata
ref|XP_004413638.1|  PREDICTED: serine/threonine-protein phosphat...    216   9e-63    
ref|XP_006868186.1|  PREDICTED: serine/threonine-protein phosphat...    217   9e-63    Chrysochloris asiatica
ref|XP_004382552.1|  PREDICTED: serine/threonine-protein phosphat...    216   9e-63    
ref|XP_005347390.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-62    
ref|XP_009005022.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-62    Callithrix jacchus [common marmoset]
dbj|BAH11499.1|  unnamed protein product                                215   1e-62    Homo sapiens [man]
ref|NP_001080135.1|  protein phosphatase 2, regulatory subunit A,...    218   1e-62    Xenopus laevis [clawed frog]
ref|XP_004326180.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-62    
ref|XP_005334305.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-62    
ref|XP_003253172.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-62    
ref|NP_001171034.1|  serine/threonine-protein phosphatase 2A 65 k...    216   1e-62    Homo sapiens [man]
gb|KFH64368.1|  protein phosphatase PP2A regulatory subunit A           218   1e-62    Mortierella verticillata NRRL 6337
ref|XP_002682119.1|  phosphoprotein phosphatase A                       218   1e-62    Naegleria gruberi strain NEG-M
gb|KDR23265.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    218   1e-62    Zootermopsis nevadensis
ref|XP_004671593.1|  PREDICTED: serine/threonine-protein phosphat...    217   1e-62    
ref|XP_004427401.1|  PREDICTED: serine/threonine-protein phosphat...    215   1e-62    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_011921816.1|  PREDICTED: serine/threonine-protein phosphat...    215   1e-62    Cercocebus atys
ref|XP_006868185.1|  PREDICTED: serine/threonine-protein phosphat...    218   2e-62    Chrysochloris asiatica
ref|XP_003055021.1|  protein phosphatase 2A regulatory subunit          218   2e-62    Micromonas pusilla CCMP1545
ref|XP_006034569.1|  PREDICTED: serine/threonine-protein phosphat...    218   2e-62    Alligator sinensis
ref|NP_989405.1|  serine/threonine-protein phosphatase 2A 65 kDa ...    218   2e-62    Xenopus tropicalis [western clawed frog]
ref|XP_011950091.1|  PREDICTED: serine/threonine-protein phosphat...    217   2e-62    
ref|XP_005984733.1|  PREDICTED: serine/threonine-protein phosphat...    216   2e-62    
dbj|BAG61093.1|  unnamed protein product                                216   2e-62    Homo sapiens [man]
ref|XP_011921811.1|  PREDICTED: serine/threonine-protein phosphat...    218   3e-62    Cercocebus atys
ref|XP_004715719.1|  PREDICTED: serine/threonine-protein phosphat...    216   3e-62    
ref|XP_004381784.1|  PREDICTED: serine/threonine-protein phosphat...    216   3e-62    
ref|XP_007955412.1|  PREDICTED: serine/threonine-protein phosphat...    217   3e-62    Orycteropus afer afer
ref|XP_007455955.1|  PREDICTED: serine/threonine-protein phosphat...    216   3e-62    Lipotes vexillifer [baiji]
dbj|BAG56980.1|  unnamed protein product                                216   3e-62    Homo sapiens [man]
ref|XP_004061384.1|  PREDICTED: serine/threonine-protein phosphat...    216   3e-62    
ref|XP_004413635.1|  PREDICTED: serine/threonine-protein phosphat...    217   3e-62    Odobenus rosmarus divergens
gb|KFH64334.1|  protein phosphatase PP2A regulatory subunit A           217   3e-62    
dbj|BAC03652.1|  unnamed protein product                                215   3e-62    
ref|XP_004286527.1|  PREDICTED: serine/threonine-protein phosphat...    216   3e-62    
gb|EFB14368.1|  hypothetical protein PANDA_009987                       217   3e-62    
ref|XP_007538017.1|  PREDICTED: serine/threonine-protein phosphat...    213   3e-62    
ref|XP_004439076.1|  PREDICTED: serine/threonine-protein phosphat...    216   3e-62    
ref|XP_010829830.1|  PREDICTED: serine/threonine-protein phosphat...    217   3e-62    
ref|XP_001371292.1|  PREDICTED: serine/threonine-protein phosphat...    217   4e-62    
gb|AAA35531.1|  medium tumor antigen-associated 61-kD protein           217   4e-62    
ref|NP_001032554.1|  serine/threonine-protein phosphatase 2A 65 k...    217   4e-62    
ref|XP_005984732.1|  PREDICTED: serine/threonine-protein phosphat...    217   4e-62    
ref|XP_006157809.1|  PREDICTED: serine/threonine-protein phosphat...    217   4e-62    
pdb|2PKG|A  Chain A, Structure Of A Complex Between The A Subunit...    216   4e-62    
ref|NP_001126285.1|  serine/threonine-protein phosphatase 2A 65 k...    217   4e-62    
ref|XP_005069578.1|  PREDICTED: serine/threonine-protein phosphat...    218   4e-62    
dbj|BAE87562.1|  unnamed protein product                                217   4e-62    
ref|XP_005069580.1|  PREDICTED: serine/threonine-protein phosphat...    216   4e-62    
pdb|3DW8|A  Chain A, Structure Of A Protein Phosphatase 2a Holoen...    216   4e-62    
pdb|4I5L|A  Chain A, Structural Mechanism Of Trimeric Pp2a Holoen...    216   4e-62    
ref|XP_005689486.1|  PREDICTED: serine/threonine-protein phosphat...    218   4e-62    
ref|XP_006772968.1|  PREDICTED: serine/threonine-protein phosphat...    217   4e-62    
ref|XP_005165604.1|  PREDICTED: serine/threonine-protein phosphat...    217   4e-62    
ref|NP_055040.2|  serine/threonine-protein phosphatase 2A 65 kDa ...    217   4e-62    
gb|AAP36766.1|  Homo sapiens protein phosphatase 2 (formerly 2A),...    217   4e-62    
gb|EHH59859.1|  hypothetical protein EGM_10070                          216   4e-62    
ref|XP_005341840.1|  PREDICTED: serine/threonine-protein phosphat...    216   4e-62    
ref|XP_008683000.1|  PREDICTED: serine/threonine-protein phosphat...    216   4e-62    
ref|XP_008845654.1|  PREDICTED: serine/threonine-protein phosphat...    216   5e-62    
ref|XP_007173031.1|  PREDICTED: serine/threonine-protein phosphat...    217   5e-62    
dbj|BAG56718.1|  unnamed protein product                                216   5e-62    
ref|XP_004381783.1|  PREDICTED: serine/threonine-protein phosphat...    216   5e-62    
ref|NP_058587.1|  serine/threonine-protein phosphatase 2A 65 kDa ...    216   5e-62    
ref|XP_004415541.1|  PREDICTED: serine/threonine-protein phosphat...    216   5e-62    
dbj|BAC40565.1|  unnamed protein product                                216   5e-62    
ref|XP_008148378.1|  PREDICTED: serine/threonine-protein phosphat...    216   5e-62    
ref|XP_007179922.1|  PREDICTED: serine/threonine-protein phosphat...    216   5e-62    
pdb|3FGA|A  Chain A, Structural Basis Of Pp2a And Sgo Interaction       216   5e-62    
ref|XP_005616279.1|  PREDICTED: serine/threonine-protein phosphat...    216   5e-62    
ref|XP_003269757.1|  PREDICTED: serine/threonine-protein phosphat...    216   5e-62    
gb|EFB14807.1|  hypothetical protein PANDA_017429                       216   5e-62    
gb|AAA36399.1|  phosphatase 2A regulatory subunit                       216   5e-62    
pdb|1B3U|A  Chain A, Crystal Structure Of Constant Regulatory Dom...    216   5e-62    
ref|XP_005901601.1|  PREDICTED: serine/threonine-protein phosphat...    217   5e-62    
ref|XP_004597182.1|  PREDICTED: serine/threonine-protein phosphat...    216   6e-62    
ref|XP_006093582.1|  PREDICTED: serine/threonine-protein phosphat...    215   6e-62    
dbj|BAF83282.1|  unnamed protein product                                216   6e-62    
ref|NP_001082552.1|  serine/threonine-protein phosphatase 2A 65 k...    216   6e-62    
ref|XP_005069579.1|  PREDICTED: serine/threonine-protein phosphat...    216   6e-62    
ref|XP_004273470.1|  PREDICTED: serine/threonine-protein phosphat...    216   6e-62    
ref|XP_004413634.1|  PREDICTED: serine/threonine-protein phosphat...    218   6e-62    
ref|XP_007905484.1|  PREDICTED: serine/threonine-protein phosphat...    216   6e-62    
ref|XP_005901603.1|  PREDICTED: serine/threonine-protein phosphat...    215   6e-62    
ref|XP_005804169.1|  PREDICTED: serine/threonine-protein phosphat...    216   7e-62    
ref|NP_001006775.1|  platelet-derived growth factor subunit B           216   7e-62    
ref|XP_010615283.1|  PREDICTED: serine/threonine-protein phosphat...    216   7e-62    
ref|XP_004413637.1|  PREDICTED: serine/threonine-protein phosphat...    215   7e-62    
ref|XP_005856968.1|  PREDICTED: serine/threonine-protein phosphat...    216   7e-62    
ref|XP_004619940.1|  PREDICTED: serine/threonine-protein phosphat...    216   7e-62    
ref|XP_008148377.1|  PREDICTED: serine/threonine-protein phosphat...    216   7e-62    
ref|XP_011950827.1|  PREDICTED: serine/threonine-protein phosphat...    217   7e-62    
ref|NP_001080408.1|  protein phosphatase 2, regulatory subunit A,...    216   7e-62    
ref|XP_006510705.1|  PREDICTED: serine/threonine-protein phosphat...    218   8e-62    
gb|ELR52221.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    217   8e-62    
ref|XP_004382551.1|  PREDICTED: serine/threonine-protein phosphat...    215   8e-62    
gb|AAH44120.1|  LOC398563 protein                                       216   9e-62    
ref|NP_001171033.1|  serine/threonine-protein phosphatase 2A 65 k...    215   9e-62    
ref|XP_005667374.1|  PREDICTED: serine/threonine-protein phosphat...    216   9e-62    
ref|XP_011921815.1|  PREDICTED: serine/threonine-protein phosphat...    215   9e-62    
ref|XP_004791695.1|  PREDICTED: serine/threonine-protein phosphat...    218   9e-62    
ref|XP_004543776.1|  PREDICTED: serine/threonine-protein phosphat...    215   9e-62    
ref|XP_005347387.1|  PREDICTED: serine/threonine-protein phosphat...    216   9e-62    
ref|XP_004623246.1|  PREDICTED: serine/threonine-protein phosphat...    216   9e-62    
ref|XP_010967202.1|  PREDICTED: serine/threonine-protein phosphat...    216   9e-62    
ref|XP_004604739.1|  PREDICTED: serine/threonine-protein phosphat...    211   9e-62    
ref|XP_006151035.1|  PREDICTED: serine/threonine-protein phosphat...    217   9e-62    
ref|XP_004481189.1|  PREDICTED: serine/threonine-protein phosphat...    216   9e-62    
ref|XP_010584891.1|  PREDICTED: serine/threonine-protein phosphat...    216   9e-62    
ref|XP_005334304.1|  PREDICTED: serine/threonine-protein phosphat...    215   9e-62    
ref|XP_003253170.1|  PREDICTED: serine/threonine-protein phosphat...    215   9e-62    
ref|XP_004273468.1|  PREDICTED: serine/threonine-protein phosphat...    216   9e-62    
ref|XP_004326179.1|  PREDICTED: serine/threonine-protein phosphat...    215   9e-62    
ref|XP_005967560.1|  PREDICTED: serine/threonine-protein phosphat...    218   9e-62    
ref|XP_006151036.1|  PREDICTED: serine/threonine-protein phosphat...    217   1e-61    
ref|XP_006194472.1|  PREDICTED: serine/threonine-protein phosphat...    214   1e-61    
gb|AAA59983.1|  protein phosphatase-2A regulatory subunit-beta          215   1e-61    
ref|XP_003357333.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-61    
ref|XP_007934752.1|  PREDICTED: serine/threonine-protein phosphat...    215   1e-61    
ref|XP_005347389.1|  PREDICTED: serine/threonine-protein phosphat...    215   1e-61    
ref|XP_006151040.1|  PREDICTED: serine/threonine-protein phosphat...    217   1e-61    
ref|XP_004382550.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-61    
sp|P54613.1|2AAB_PIG  RecName: Full=Serine/threonine-protein phos...    216   1e-61    
ref|XP_006761636.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-61    
ref|XP_004273469.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-61    
ref|XP_002754423.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-61    
ref|XP_003764291.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-61    
ref|XP_005901600.1|  PREDICTED: serine/threonine-protein phosphat...    217   1e-61    
ref|XP_004481188.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-61    
ref|XP_011950826.1|  PREDICTED: serine/threonine-protein phosphat...    217   1e-61    
ref|XP_005901599.1|  PREDICTED: serine/threonine-protein phosphat...    217   1e-61    
ref|XP_005619845.1|  PREDICTED: serine/threonine-protein phosphat...    217   1e-61    
ref|XP_005901602.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-61    
ref|XP_004413636.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-61    
ref|XP_011921812.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-61    
ref|XP_004326177.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-61    
ref|XP_004481190.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-61    
ref|XP_007491798.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-61    
ref|XP_010869843.1|  PREDICTED: serine/threonine-protein phosphat...    215   1e-61    
ref|XP_008248017.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    215   1e-61    
ref|XP_005619844.1|  PREDICTED: serine/threonine-protein phosphat...    217   1e-61    
ref|XP_010984268.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-61    
ref|XP_007173033.1|  PREDICTED: serine/threonine-protein phosphat...    217   1e-61    
ref|XP_004016062.1|  PREDICTED: serine/threonine-protein phosphat...    217   1e-61    
ref|XP_005579656.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-61    
ref|XP_003253169.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-61    
ref|XP_010380630.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-61    
emb|CAH92879.1|  hypothetical protein                                   215   1e-61    
ref|XP_005194631.1|  PREDICTED: serine/threonine-protein phosphat...    216   1e-61    
ref|XP_005579657.1|  PREDICTED: serine/threonine-protein phosphat...    215   1e-61    
ref|XP_004543775.1|  PREDICTED: serine/threonine-protein phosphat...    215   1e-61    
ref|XP_004439075.1|  PREDICTED: serine/threonine-protein phosphat...    216   2e-61    
ref|XP_005347388.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
ref|XP_004326178.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
ref|XP_010821052.1|  PREDICTED: serine/threonine-protein phosphat...    217   2e-61    
ref|XP_004016059.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
ref|XP_003357337.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
ref|NP_002707.3|  serine/threonine-protein phosphatase 2A 65 kDa ...    215   2e-61    
ref|XP_005880804.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
ref|XP_005692958.1|  PREDICTED: serine/threonine-protein phosphat...    216   2e-61    
gb|AAC63525.1|  protein phosphatase 2A regulatory subunit A, beta...    215   2e-61    
ref|XP_003583134.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
ref|XP_006194471.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
ref|XP_010861232.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
ref|XP_008259779.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
gb|AAH56218.1|  Protein phosphatase 2 (formerly 2A), regulatory s...    215   2e-61    
ref|XP_009005020.1|  PREDICTED: serine/threonine-protein phosphat...    216   2e-61    
ref|XP_006833878.1|  PREDICTED: serine/threonine-protein phosphat...    214   2e-61    
ref|NP_001020589.1|  serine/threonine-protein phosphatase 2A 65 k...    215   2e-61    
ref|NP_859051.1|  serine/threonine-protein phosphatase 2A 65 kDa ...    215   2e-61    
ref|XP_010380631.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
ref|XP_005347385.1|  PREDICTED: serine/threonine-protein phosphat...    216   2e-61    
ref|XP_005334303.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
gb|EGW03807.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    215   2e-61    
ref|XP_007934750.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
ref|XP_004382549.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
ref|XP_006151037.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
ref|XP_002613476.1|  hypothetical protein BRAFLDRAFT_119854             215   2e-61    
ref|XP_004585107.1|  PREDICTED: serine/threonine-protein phosphat...    214   2e-61    
ref|XP_005347386.1|  PREDICTED: serine/threonine-protein phosphat...    216   2e-61    
ref|XP_008307967.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
ref|XP_008538780.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    216   2e-61    
ref|NP_082890.2|  serine/threonine-protein phosphatase 2A 65 kDa ...    215   2e-61    
ref|XP_006151039.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
ref|XP_006151038.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
gb|EPQ16739.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    221   2e-61    
ref|XP_011832363.1|  PREDICTED: serine/threonine-protein phosphat...    214   2e-61    
emb|CAG29336.1|  PPP2R1A                                                215   2e-61    
ref|XP_003478333.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
ref|XP_001496310.2|  PREDICTED: serine/threonine-protein phosphat...    216   2e-61    
ref|XP_007934749.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
ref|XP_005579658.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
ref|XP_005334302.1|  PREDICTED: serine/threonine-protein phosphat...    215   3e-61    
ref|XP_004273467.1|  PREDICTED: serine/threonine-protein phosphat...    216   3e-61    
ref|XP_009005019.1|  PREDICTED: serine/threonine-protein phosphat...    216   3e-61    
ref|XP_008259765.1|  PREDICTED: serine/threonine-protein phosphat...    216   3e-61    
ref|XP_010793348.1|  PREDICTED: serine/threonine-protein phosphat...    214   3e-61    
ref|XP_008831023.1|  PREDICTED: serine/threonine-protein phosphat...    215   3e-61    
ref|XP_862393.2|  PREDICTED: serine/threonine-protein phosphatase...    215   3e-61    
ref|XP_004585105.1|  PREDICTED: serine/threonine-protein phosphat...    216   3e-61    
ref|XP_007538537.1|  PREDICTED: serine/threonine-protein phosphat...    214   3e-61    
ref|XP_004075717.1|  PREDICTED: serine/threonine-protein phosphat...    214   3e-61    
ref|XP_006833877.1|  PREDICTED: serine/threonine-protein phosphat...    214   3e-61    
ref|XP_004481186.1|  PREDICTED: serine/threonine-protein phosphat...    216   3e-61    
ref|XP_011225641.1|  PREDICTED: serine/threonine-protein phosphat...    216   3e-61    
ref|XP_004481187.1|  PREDICTED: serine/threonine-protein phosphat...    216   3e-61    
ref|XP_003794777.1|  PREDICTED: serine/threonine-protein phosphat...    214   3e-61    
ref|XP_008259769.1|  PREDICTED: serine/threonine-protein phosphat...    216   3e-61    
ref|XP_004326176.1|  PREDICTED: serine/threonine-protein phosphat...    216   3e-61    
ref|XP_010380629.1|  PREDICTED: serine/threonine-protein phosphat...    215   3e-61    
ref|XP_007229440.1|  PREDICTED: serine/threonine-protein phosphat...    214   3e-61    
ref|XP_009005018.1|  PREDICTED: serine/threonine-protein phosphat...    216   3e-61    
ref|XP_011921810.1|  PREDICTED: serine/threonine-protein phosphat...    215   3e-61    
ref|XP_004585106.1|  PREDICTED: serine/threonine-protein phosphat...    214   4e-61    
ref|XP_004749849.1|  PREDICTED: serine/threonine-protein phosphat...    216   4e-61    
ref|XP_003357336.1|  PREDICTED: serine/threonine-protein phosphat...    216   4e-61    
ref|NP_859050.1|  serine/threonine-protein phosphatase 2A 65 kDa ...    216   4e-61    
ref|XP_004382548.1|  PREDICTED: serine/threonine-protein phosphat...    216   4e-61    
ref|NP_001267102.1|  serine/threonine-protein phosphatase 2A 65 k...    216   4e-61    
dbj|BAF84964.1|  unnamed protein product                                216   4e-61    
ref|XP_009005023.1|  PREDICTED: serine/threonine-protein phosphat...    215   4e-61    
ref|XP_008688435.1|  PREDICTED: serine/threonine-protein phosphat...    217   4e-61    
ref|XP_006739271.1|  PREDICTED: serine/threonine-protein phosphat...    216   4e-61    
gb|EHB03786.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    216   4e-61    
ref|XP_005667373.1|  PREDICTED: serine/threonine-protein phosphat...    216   4e-61    
gb|AAH52678.1|  Protein phosphatase 2 (formerly 2A), regulatory s...    214   4e-61    
ref|XP_008285219.1|  PREDICTED: serine/threonine-protein phosphat...    214   4e-61    
ref|XP_005334299.1|  PREDICTED: serine/threonine-protein phosphat...    215   4e-61    
ref|XP_007934748.1|  PREDICTED: serine/threonine-protein phosphat...    215   4e-61    
ref|NP_001081031.1|  protein phosphatase 2, regulatory subunit A,...    214   4e-61    
emb|CAA56713.1|  phosphorylase phosphatase                              214   5e-61    
ref|XP_002708504.1|  PREDICTED: serine/threonine-protein phosphat...    215   5e-61    
dbj|BAC36649.1|  unnamed protein product                                216   5e-61    
dbj|BAG57867.1|  unnamed protein product                                213   5e-61    
ref|XP_007245296.1|  PREDICTED: serine/threonine-protein phosphat...    214   5e-61    
gb|EDL95488.1|  protein phosphatase 2 (formerly 2A), regulatory s...    215   5e-61    
ref|NP_001029257.1|  serine/threonine-protein phosphatase 2A 65 k...    215   5e-61    
ref|NP_001273482.1|  serine/threonine-protein phosphatase 2A 65 k...    216   5e-61    
ref|XP_010593755.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-61    
ref|XP_006972393.1|  PREDICTED: serine/threonine-protein phosphat...    215   5e-61    
ref|XP_011541195.1|  PREDICTED: serine/threonine-protein phosphat...    215   5e-61    
gb|EDL25768.1|  protein phosphatase 2 (formerly 2A), regulatory s...    215   5e-61    
gb|EMC88826.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    211   5e-61    
ref|XP_005334301.1|  PREDICTED: serine/threonine-protein phosphat...    215   5e-61    
ref|XP_006972392.1|  PREDICTED: serine/threonine-protein phosphat...    215   5e-61    
ref|XP_003794778.1|  PREDICTED: serine/threonine-protein phosphat...    214   5e-61    
ref|XP_011541194.1|  PREDICTED: serine/threonine-protein phosphat...    215   5e-61    
ref|XP_004749845.1|  PREDICTED: serine/threonine-protein phosphat...    216   5e-61    
ref|XP_010380628.1|  PREDICTED: serine/threonine-protein phosphat...    215   5e-61    
ref|XP_007538479.1|  PREDICTED: serine/threonine-protein phosphat...    214   5e-61    
gb|ERE77081.1|  serine/threonine-protein phosphatase 2A regulator...    215   5e-61    
ref|XP_003923772.2|  PREDICTED: serine/threonine-protein phosphat...    215   5e-61    
ref|XP_003794775.1|  PREDICTED: serine/threonine-protein phosphat...    214   5e-61    



>ref|XP_010094777.1| hypothetical protein L484_019987 [Morus notabilis]
 gb|EXB56942.1| hypothetical protein L484_019987 [Morus notabilis]
Length=579

 Score =   377 bits (967),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/188 (95%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  392  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  451

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHIIPQVLEMIN+PHYLYRMTILHAVSLLAPV+GSEITC+KLLPV+
Sbjct  452  VKRLAEEFGPDWAMQHIIPQVLEMINNPHYLYRMTILHAVSLLAPVIGSEITCSKLLPVV  511

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVRFFANQALQ+
Sbjct  512  VTASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRFFANQALQS  571

Query  268  ADQVMMSS  245
            +DQVMMSS
Sbjct  572  SDQVMMSS  579


 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  236  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDLVPAYVRLLRDNEAEVRIAAAGK  295

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  296  VTKFCRILSPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  355

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  356  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  407



>gb|KDO41976.1| hypothetical protein CISIN_1g007863mg [Citrus sinensis]
Length=337

 Score =   364 bits (935),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  150  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  209

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVLEMIN+PHYLYRMTIL A+SLLAPVMGSEITC++LLPV+
Sbjct  210  VKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVV  269

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD SVVEK+IRPCLVELSEDPDVDVRFFA QALQ+
Sbjct  270  INASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDVDVRFFATQALQS  329

Query  268  ADQVMMSS  245
             DQVMMS 
Sbjct  330  KDQVMMSG  337


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 84/164 (51%), Gaps = 0/164 (0%)
 Frame = -2

Query  784  DRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEF  605
            D+ WRVR  +   +  L   +G       +    ++ L+D    +R AAA  V ++    
Sbjct  2    DKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRIL  61

Query  604  GPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASKDRV  425
             PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ ++  KD  
Sbjct  62   NPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEF  121

Query  424  PNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  122  PDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  165


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/187 (25%), Positives = 86/187 (46%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  72   PCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  131

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  132  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  191

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +   KD+V +I+   A  ++ L          + I P ++E+  +P    R    QA+  
Sbjct  192  MQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISL  251

Query  268  ADQVMMS  248
               VM S
Sbjct  252  LAPVMGS  258



>ref|XP_006440946.1| hypothetical protein CICLE_v100194172mg, partial [Citrus clementina]
 gb|ESR54186.1| hypothetical protein CICLE_v100194172mg, partial [Citrus clementina]
Length=386

 Score =   364 bits (935),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  199  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  258

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVLEMIN+PHYLYRMTIL A+SLLAPVMGSEITC++LLPV+
Sbjct  259  VKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVV  318

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD SVVEK+IRPCLVELSEDPDVDVRFFA QALQ+
Sbjct  319  INASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDVDVRFFATQALQS  378

Query  268  ADQVMMSS  245
             DQVMMS 
Sbjct  379  KDQVMMSG  386


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       +    ++ L+D    +R AAA  
Sbjct  43   PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGK  102

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++     PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ 
Sbjct  103  ITKICRILNPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIF  162

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  163  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  214


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/187 (25%), Positives = 86/187 (46%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  121  PCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  180

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  181  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  240

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +   KD+V +I+   A  ++ L          + I P ++E+  +P    R    QA+  
Sbjct  241  MQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISL  300

Query  268  ADQVMMS  248
               VM S
Sbjct  301  LAPVMGS  307



>gb|KDO41975.1| hypothetical protein CISIN_1g007863mg [Citrus sinensis]
Length=412

 Score =   365 bits (936),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  225  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  284

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVLEMIN+PHYLYRMTIL A+SLLAPVMGSEITC++LLPV+
Sbjct  285  VKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVV  344

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD SVVEK+IRPCLVELSEDPDVDVRFFA QALQ+
Sbjct  345  INASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDVDVRFFATQALQS  404

Query  268  ADQVMMSS  245
             DQVMMS 
Sbjct  405  KDQVMMSG  412


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       +    ++ L+D    +R AAA  
Sbjct  69   PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGK  128

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V ++     PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ 
Sbjct  129  VTKICRILNPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIF  188

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  189  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  240


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 46/187 (25%), Positives = 86/187 (46%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  147  PCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  206

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  207  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  266

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +   KD+V +I+   A  ++ L          + I P ++E+  +P    R    QA+  
Sbjct  267  MQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISL  326

Query  268  ADQVMMS  248
               VM S
Sbjct  327  LAPVMGS  333



>gb|KJB39318.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
Length=411

 Score =   363 bits (932),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  225  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  284

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPVMGS+ITC+KLLPV+
Sbjct  285  VKRLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVMGSDITCSKLLPVV  344

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVRFFA QAL++
Sbjct  345  INASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRFFATQALES  404

Query  268  ADQVMMS  248
             +QVMMS
Sbjct  405  CNQVMMS  411


 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  69   PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSELVPAYVRLLRDNEAEVRIAAAGK  128

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  129  VTKFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  188

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  189  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  240



>ref|XP_002511958.1| serine/threonine protein phosphatase 2a regulatory subunit A, 
putative [Ricinus communis]
 gb|EEF50627.1| serine/threonine protein phosphatase 2a regulatory subunit A, 
putative [Ricinus communis]
Length=587

 Score =   369 bits (947),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPV+GSEITC+ LLPV+
Sbjct  460  VKRLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVVGSEITCSSLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TASKDRVPNIKFNVAKVLQ LIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFA QALQ+
Sbjct  520  VTASKDRVPNIKFNVAKVLQLLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFATQALQS  579

Query  268  ADQVMMSS  245
            +DQVMMSS
Sbjct  580  SDQVMMSS  587


 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 84/172 (49%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P I   ++D+ WRVR  +   +  L   +G       L    ++ L D    +R AAA  
Sbjct  244  PVIANFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDLVPAYVRLLCDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+Q I+P V ++  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELAIQRILPCVKDLSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010681587.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Beta vulgaris subsp. vulgaris]
 ref|XP_010681588.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Beta vulgaris subsp. vulgaris]
Length=587

 Score =   369 bits (946),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGPEWAMQHI+PQVLEM+N+PHYLYRMTILHA+SLLAPV+GSEITC+KLLPV+
Sbjct  460  VKRLAEEFGPEWAMQHIVPQVLEMMNNPHYLYRMTILHAISLLAPVLGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAKVLQSL+PIVD SVVEKTIRPCLVEL+EDPDVDVRFFANQALQ+
Sbjct  520  ITASKDRVPNIKFNVAKVLQSLVPIVDQSVVEKTIRPCLVELNEDPDVDVRFFANQALQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDHVMMSS  587


 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V ++ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPELAIQHILPCVKDLSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/181 (21%), Positives = 76/181 (42%), Gaps = 0/181 (0%)
 Frame = -2

Query  796  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  617
            +L +D    VRL  +E    L   L        +  + + + +DK + +R   AN +  L
Sbjct  209  DLTQDDQDSVRLLAVEGCAALGKLLEPQDCVAHILPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  616  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  437
             E  GP+     ++P  + ++ D     R+     V+    ++  E+    +LP +   S
Sbjct  269  CEAVGPDPTRTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRILSPELAIQHILPCVKDLS  328

Query  436  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  257
             D   +++  +A V+  + P++      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  256  M  254
            +
Sbjct  389  I  389



>ref|XP_010102837.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Morus notabilis]
 gb|EXB94197.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Morus notabilis]
Length=254

 Score =   357 bits (915),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  67   PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANN  126

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQ+I+PQVLEMIN+PHYLYRMT+L A++LLAPV+GSEITC+KLLPV+
Sbjct  127  LKRLAEEFGPDWAMQNIVPQVLEMINNPHYLYRMTVLRAIALLAPVVGSEITCSKLLPVV  186

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVRFFANQALQA
Sbjct  187  INASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  246

Query  268  ADQVMMSS  245
             +QVMMSS
Sbjct  247  IEQVMMSS  254



>ref|XP_012092991.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Jatropha curcas]
 ref|XP_012092992.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Jatropha curcas]
Length=587

 Score =   368 bits (945),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHAVSLLAPVMGSEITC+ LLPV+
Sbjct  460  VKRLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAVSLLAPVMGSEITCSTLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAKVLQSL+PIVD SVVEKTIRPCLVELSEDPDVDVRFFA QALQ+
Sbjct  520  VNASKDRVPNIKFNVAKVLQSLVPIVDQSVVEKTIRPCLVELSEDPDVDVRFFATQALQS  579

Query  268  ADQVMMSS  245
            +DQVMMS+
Sbjct  580  SDQVMMST  587


 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 85/172 (49%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDLVPAYVRLLCDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+Q I+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPELAIQRILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010263329.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Nelumbo nucifera]
Length=587

 Score =   367 bits (942),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQHIIPQVLEMIN+PHYLYRMTILHA+SLLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPDWAMQHIIPQVLEMINNPHYLYRMTILHAISLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQSLIPIVD SVVE+TIRPCLVELSEDPDVDVRFFA+QALQ 
Sbjct  520  INSSKDRVPNIKFNVAKVLQSLIPIVDQSVVEQTIRPCLVELSEDPDVDVRFFASQALQT  579

Query  268  ADQVMMSS  245
            +DQVMMSS
Sbjct  580  SDQVMMSS  587


 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|AAM94368.1| protein phosphatase 2A regulatory A subunit [Lolium perenne]
Length=292

 Score =   357 bits (915),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIR+AAANN
Sbjct  105  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVYSIREAAANN  164

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+S LAPVMG+EITC KLLPV+
Sbjct  165  LKRLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISFLAPVMGAEITCQKLLPVV  224

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQSL+PI+D SVVEKT++PCLVELSEDPDVDVR++ANQALQA
Sbjct  225  INSSKDRVPNIKFNVAKVLQSLVPILDQSVVEKTVKPCLVELSEDPDVDVRYYANQALQA  284

Query  268  ADQVMMSS  245
             DQ+MMSS
Sbjct  285  CDQIMMSS  292


 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 65/119 (55%), Gaps = 0/119 (0%)
 Frame = -2

Query  649  RDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITC  470
            R AAA  V +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T 
Sbjct  2    RRAAAGKVTKFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATI  61

Query  469  NKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
             +LLP+ ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  62   EQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  120



>gb|KDP20104.1| hypothetical protein JCGZ_05873 [Jatropha curcas]
Length=587

 Score =   367 bits (942),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHAVSLLAPVMGSEITC+ LLPV+
Sbjct  460  VKRLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAVSLLAPVMGSEITCSTLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAKVLQSL+PIVD SV+EKTIRPCLVELSEDPDVDVRFFA QALQ+
Sbjct  520  VNASKDRVPNIKFNVAKVLQSLVPIVDQSVMEKTIRPCLVELSEDPDVDVRFFATQALQS  579

Query  268  ADQVMMSS  245
            +DQVMMS+
Sbjct  580  SDQVMMST  587


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 85/172 (49%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDLVPAYVRLLCDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+Q I+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPELAIQRILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006485775.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Citrus sinensis]
Length=587

 Score =   367 bits (941),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVLEMIN+PHYLYRMTIL A+SLLAPVMGSEITC++LLPV+
Sbjct  460  VKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD SVVEK+IRPCLVELSEDPDVDVRFFA QALQ+
Sbjct  520  INASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDVDVRFFATQALQS  579

Query  268  ADQVMMSS  245
             DQVMMSS
Sbjct  580  KDQVMMSS  587


 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       +    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V ++     PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ 
Sbjct  304  VTKICRILNPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/187 (25%), Positives = 86/187 (46%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  441

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +   KD+V +I+   A  ++ L          + I P ++E+  +P    R    QA+  
Sbjct  442  MQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISL  501

Query  268  ADQVMMS  248
               VM S
Sbjct  502  LAPVMGS  508



>ref|XP_002276180.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Vitis vinifera]
 ref|XP_010663586.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Vitis vinifera]
Length=587

 Score =   366 bits (939),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHIIPQVL+MIN+PHYLYRMTILHA+SLLAPVMG EITC+KLLPV+
Sbjct  460  VKRLAEEFGPDWAMQHIIPQVLDMINNPHYLYRMTILHAISLLAPVMGPEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I A+KDRVPNIKFNVAKVLQSL PIVD SVV+KTIRPCLVELSEDPDVDVRFFA+QALQA
Sbjct  520  INAAKDRVPNIKFNVAKVLQSLTPIVDQSVVDKTIRPCLVELSEDPDVDVRFFASQALQA  579

Query  268  ADQVMMSS  245
            +DQ+MMSS
Sbjct  580  SDQIMMSS  587


 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T ++LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIDQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 70/142 (49%), Gaps = 0/142 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     D+L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIDQLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  441

Query  448  ITASKDRVPNIKFNVAKVLQSL  383
            +   KD+V +I+   A  ++ L
Sbjct  442  MQWLKDKVYSIRDAAANNVKRL  463



>ref|XP_011006221.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Populus euphratica]
Length=587

 Score =   365 bits (937),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVL++IN+PHYLYRMTILHAVSLL+PVMGSEITC++LLP++
Sbjct  460  VKRLAEEFGPDWAMQHIVPQVLDLINNPHYLYRMTILHAVSLLSPVMGSEITCSQLLPIV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVRFFA QALQ+
Sbjct  520  INASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRFFATQALQS  579

Query  268  ADQVMMSS  245
            +D VMMSS
Sbjct  580  SDHVMMSS  587


 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V ++  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKDLSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KDO41972.1| hypothetical protein CISIN_1g007863mg [Citrus sinensis]
Length=587

 Score =   365 bits (937),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVLEMIN+PHYLYRMTIL A+SLLAPVMGSEITC++LLPV+
Sbjct  460  VKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD SVVEK+IRPCLVELSEDPDVDVRFFA QALQ+
Sbjct  520  INASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDVDVRFFATQALQS  579

Query  268  ADQVMMSS  245
             DQVMMS 
Sbjct  580  KDQVMMSG  587


 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       +    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V ++     PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ 
Sbjct  304  VTKICRILNPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/187 (25%), Positives = 86/187 (46%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  441

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +   KD+V +I+   A  ++ L          + I P ++E+  +P    R    QA+  
Sbjct  442  MQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISL  501

Query  268  ADQVMMS  248
               VM S
Sbjct  502  LAPVMGS  508



>gb|EYU29958.1| hypothetical protein MIMGU_mgv1a005777mg [Erythranthe guttata]
Length=471

 Score =   361 bits (926),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  284  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  343

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVL+MIN+PHYLYRMT+L A+SLLAPVMGSEITC+KLLPVI
Sbjct  344  LKRLAEEFGPEWAMQHIVPQVLDMINNPHYLYRMTVLRAISLLAPVMGSEITCSKLLPVI  403

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TASKDRVPNIKFNVAKVLQS+IPIVD SVVEKTIRP LVELSEDPDVDVRFFAN+ALQ+
Sbjct  404  VTASKDRVPNIKFNVAKVLQSMIPIVDQSVVEKTIRPSLVELSEDPDVDVRFFANEALQS  463

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  464  IDNVMMSS  471


 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  128  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  187

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  188  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  247

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  248  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  299



>gb|KHG03474.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta-like protein [Gossypium arboreum]
Length=586

 Score =   364 bits (934),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPVMGS+ITC+KLLPV+
Sbjct  460  VKRLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVMGSDITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVRFFA QAL++
Sbjct  520  INASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRFFATQALES  579

Query  268  ADQVMMS  248
             +QVMMS
Sbjct  580  CNQVMMS  586


 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSELVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>emb|CBI15438.3| unnamed protein product [Vitis vinifera]
Length=642

 Score =   365 bits (938),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  455  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  514

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHIIPQVL+MIN+PHYLYRMTILHA+SLLAPVMG EITC+KLLPV+
Sbjct  515  VKRLAEEFGPDWAMQHIIPQVLDMINNPHYLYRMTILHAISLLAPVMGPEITCSKLLPVV  574

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I A+KDRVPNIKFNVAKVLQSL PIVD SVV+KTIRPCLVELSEDPDVDVRFFA+QALQA
Sbjct  575  INAAKDRVPNIKFNVAKVLQSLTPIVDQSVVDKTIRPCLVELSEDPDVDVRFFASQALQA  634

Query  268  ADQVMMSS  245
            +DQ+MMSS
Sbjct  635  SDQIMMSS  642


 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  299  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDLVPAYVRLLRDNEAEVRIAAAGK  358

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T ++LLP+ 
Sbjct  359  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIDQLLPIF  418

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  419  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  470


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 70/142 (49%), Gaps = 0/142 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     D+L  + +  LKD+   +R    + 
Sbjct  377  PCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIDQLLPIFLSLLKDEFPDVRLNIISK  436

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  437  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  496

Query  448  ITASKDRVPNIKFNVAKVLQSL  383
            +   KD+V +I+   A  ++ L
Sbjct  497  MQWLKDKVYSIRDAAANNVKRL  518



>gb|KJB39317.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
Length=584

 Score =   363 bits (933),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  398  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  457

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPVMGS+ITC+KLLPV+
Sbjct  458  VKRLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVMGSDITCSKLLPVV  517

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVRFFA QAL++
Sbjct  518  INASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRFFATQALES  577

Query  268  ADQVMMS  248
             +QVMMS
Sbjct  578  CNQVMMS  584


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 86/172 (50%), Gaps = 2/172 (1%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++   WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQS--WRVRYMVANQLYELCEAVGPEPTRSELVPAYVRLLRDNEAEVRIAAAGK  301

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  302  VTKFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  361

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  362  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  413



>gb|KJB39313.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
Length=586

 Score =   363 bits (933),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPVMGS+ITC+KLLPV+
Sbjct  460  VKRLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVMGSDITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVRFFA QAL++
Sbjct  520  INASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRFFATQALES  579

Query  268  ADQVMMS  248
             +QVMMS
Sbjct  580  CNQVMMS  586


 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSELVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_008374745.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Malus domestica]
Length=587

 Score =   363 bits (932),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG+LCMQWL DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGSLCMQWLNDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGPEWAMQHI+PQVLEMI++PHYLYRMTILHA+SLLAPV+GSEITC+KLLPV+
Sbjct  460  VKRLAEEFGPEWAMQHIVPQVLEMISNPHYLYRMTILHAISLLAPVLGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TASKDRVPNIKFNVAKVLQS+IPIVD SVVEKTIRPCLVELSEDPDVDVR FA+QALQ+
Sbjct  520  VTASKDRVPNIKFNVAKVLQSIIPIVDQSVVEKTIRPCLVELSEDPDVDVRSFASQALQS  579

Query  268  ADQVMMSS  245
            ++QVMM+S
Sbjct  580  SEQVMMTS  587


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 86/172 (50%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEATRSDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+Q I+P V ++  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELAIQQILPFVKDLSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|AFY06655.1| protein phosphatase 2A regulatory subunit, partial [Carica papaya]
Length=367

 Score =   355 bits (912),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  180  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  239

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAM HIIPQVLEM  +PHYLYRMTIL A+SLLAPVMG EITC KLLPV+
Sbjct  240  LKRLAEEFGPEWAMHHIIPQVLEMTTNPHYLYRMTILRAISLLAPVMGLEITCCKLLPVV  299

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I+ASKDRVPNIKFNVAKVLQSL+PIVD SVVEKTIRPCLVELSEDPDVDVRFFANQA QA
Sbjct  300  ISASKDRVPNIKFNVAKVLQSLVPIVDQSVVEKTIRPCLVELSEDPDVDVRFFANQAFQA  359

Query  268  ADQVMMSS  245
             D +MMSS
Sbjct  360  IDHMMMSS  367


 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  24   PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  83

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G E T  +LLP+ 
Sbjct  84   VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLPIF  143

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  144  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  195



>emb|CDO98444.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   363 bits (931),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKV+SIRDAAA N
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVFSIRDAAATN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGPEWAMQHIIPQVL+MINDPHYLYRMTILHA+SLLAPVMGSE+TC+KLLPVI
Sbjct  460  VKRLAEEFGPEWAMQHIIPQVLDMINDPHYLYRMTILHAISLLAPVMGSEVTCSKLLPVI  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +  +KDRVPNIKFNVAKVLQSL+PIVD  VVEKTIRPCLVELSEDPDVDVR+FANQ LQA
Sbjct  520  VETAKDRVPNIKFNVAKVLQSLVPIVDQPVVEKTIRPCLVELSEDPDVDVRYFANQGLQA  579

Query  268  ADQVMMSS  245
             +QVMMSS
Sbjct  580  IEQVMMSS  587


 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEATRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QH++P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPELAVQHVLPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>emb|CAA10285.1| protein phosphatase [Cicer arietinum]
Length=538

 Score =   361 bits (927),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  351  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  410

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGPEWAMQHIIPQVL+MINDPHYLYRMTILHA+SLLAPV+GSEIT + LLP++
Sbjct  411  VKRLAEEFGPEWAMQHIIPQVLDMINDPHYLYRMTILHAISLLAPVLGSEITSSNLLPLV  470

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + A+KDRVPNIKFNVAKVLQSLIPIVD SVVE TIRPCLVELSEDPDVDVRFFA+QALQ+
Sbjct  471  VNAAKDRVPNIKFNVAKVLQSLIPIVDESVVESTIRPCLVELSEDPDVDVRFFASQALQS  530

Query  268  ADQVMMSS  245
            +DQV MSS
Sbjct  531  SDQVKMSS  538


 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  195  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDSTRAELVPAYVRLLRDNEAEVRIAAAGK  254

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V + +    PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  255  VTKFSRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  314

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  315  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  366



>ref|XP_002876929.1| hypothetical protein ARALYDRAFT_904748 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53188.1| hypothetical protein ARALYDRAFT_904748 [Arabidopsis lyrata subsp. 
lyrata]
Length=587

 Score =   362 bits (930),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFANQALQ+
Sbjct  520  MTASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPGLVELSEDPDVDVRFFANQALQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDNVMMSS  587


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILNPEIAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_012082057.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Jatropha curcas]
 gb|KDP29385.1| hypothetical protein JCGZ_18306 [Jatropha curcas]
Length=587

 Score =   362 bits (930),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQ LEMIN+PHYLYRMTIL A+SLLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIVPQALEMINNPHYLYRMTILRAISLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFANQALQA
Sbjct  520  INASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPALVELSEDPDVDVRFFANQALQA  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDNVMMSS  587


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_007036502.1| Phosphatase 2A subunit A2, 65,PP2AA2 isoform 1 [Theobroma cacao]
 gb|EOY21003.1| Phosphatase 2A subunit A2, 65,PP2AA2 isoform 1 [Theobroma cacao]
Length=587

 Score =   362 bits (929),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPVMG EI C+ LLP++
Sbjct  460  VKRLAEEFGPQWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVMGPEIICSNLLPLV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVRFFA QAL++
Sbjct  520  INASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRFFAGQALES  579

Query  268  ADQVMMSS  245
            +DQVMMSS
Sbjct  580  SDQVMMSS  587


 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KJB52972.1| hypothetical protein B456_008G286100 [Gossypium raimondii]
 gb|KJB52973.1| hypothetical protein B456_008G286100 [Gossypium raimondii]
 gb|KJB52974.1| hypothetical protein B456_008G286100 [Gossypium raimondii]
Length=588

 Score =   362 bits (929),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHAVSLLAPVMG +ITC+KLLPV+
Sbjct  460  VKRLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAVSLLAPVMGKDITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVR+FA QALQ+
Sbjct  520  INASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRYFATQALQS  579

Query  268  ADQVMMSS  245
            +DQ MM S
Sbjct  580  SDQQMMMS  587


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 86/172 (50%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +       E A+Q+I+P V E+  D     R  +   +  +AP++G + T  +LLP+ 
Sbjct  304  VTKFCRILNSELAIQNILPCVKELSTDSSQHVRSALASVIMGMAPILGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|NP_189208.1| protein phosphatase 2A subunit A2 [Arabidopsis thaliana]
 sp|Q38950.2|2AAB_ARATH RecName: Full=Serine/threonine-protein phosphatase 2A 65 kDa 
regulatory subunit A beta isoform; Short=AtA beta; Short=PP2A, 
subunit A, beta isoform [Arabidopsis thaliana]
 dbj|BAA95767.1| protein phosphotase 2a 65kd regulatory subunit [Arabidopsis thaliana]
 gb|AAO00848.1| protein phosphatase 2A 65 kDa regulatory subunit [Arabidopsis 
thaliana]
 gb|AAP37715.1| At3g25800 [Arabidopsis thaliana]
 gb|AEE77069.1| protein phosphatase 2A subunit A2 [Arabidopsis thaliana]
Length=587

 Score =   362 bits (929),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEM+N+PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMVNNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFANQALQ+
Sbjct  520  MTASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPGLVELSEDPDVDVRFFANQALQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDNVMMSS  587


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILNPEIAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>emb|CAA57528.1| protein phosphatase 2A 65 kDa regulatory subunit [Arabidopsis 
thaliana]
Length=587

 Score =   362 bits (929),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEM+N+PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMVNNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFANQALQ+
Sbjct  520  MTASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPGLVELSEDPDVDVRFFANQALQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDNVMMSS  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+Q I+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILNPEIAIQDILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|AFW75384.1| hypothetical protein ZEAMMB73_324274 [Zea mays]
Length=412

 Score =   356 bits (913),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  225  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANN  284

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+
Sbjct  285  LKRLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVV  344

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQSL+PI+D SVVEKT++PCLVELSEDPDVDVR++ANQALQA
Sbjct  345  INSSKDRVPNIKFNVAKVLQSLVPILDQSVVEKTVKPCLVELSEDPDVDVRYYANQALQA  404

Query  268  ADQVMMSS  245
             DQ+M+SS
Sbjct  405  CDQMMVSS  412


 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  69   PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGK  128

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +L+P+ 
Sbjct  129  VTKFCRILNPQLSVQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLVPIF  188

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  189  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  240



>gb|AEQ75494.1| serine/threonine protein phosphatase 2a regulatory subunit A 
[Rosa multiflora]
Length=587

 Score =   362 bits (928),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG+LCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGSLCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEMI++PHYLYRMTIL A+ LLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMIDNPHYLYRMTILRAICLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRP LVELSEDPDVDVRFFA QALQA
Sbjct  520  VTASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPTLVELSEDPDVDVRFFATQALQA  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDHVMMSS  587


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +A V+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMALVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006395624.1| hypothetical protein EUTSA_v10003886mg [Eutrema salsugineum]
 gb|ESQ32910.1| hypothetical protein EUTSA_v10003886mg [Eutrema salsugineum]
Length=587

 Score =   361 bits (927),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TASKDRVPNIKFNVAKVLQSLIPIVD SVVE+TIRP LVELSEDPDVDVRFFANQALQ+
Sbjct  520  MTASKDRVPNIKFNVAKVLQSLIPIVDQSVVEQTIRPGLVELSEDPDVDVRFFANQALQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDNVMMSS  587


 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVSFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_004512939.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Cicer arietinum]
Length=587

 Score =   361 bits (926),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGPEWAMQHIIPQVL+MINDPHYLYRMTILHA+SLLAPV+GSEIT + LLP++
Sbjct  460  VKRLAEEFGPEWAMQHIIPQVLDMINDPHYLYRMTILHAISLLAPVLGSEITSSNLLPLV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + A+KDRVPNIKFNVAKVLQSLIPIVD SVVE TIRPCLVELSEDPDVDVRFFA+QALQ+
Sbjct  520  VNAAKDRVPNIKFNVAKVLQSLIPIVDESVVESTIRPCLVELSEDPDVDVRFFASQALQS  579

Query  268  ADQVMMSS  245
            +DQV MSS
Sbjct  580  SDQVKMSS  587


 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDSTRAELVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V + +    PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFSRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_007225550.1| hypothetical protein PRUPE_ppa003299m2g [Prunus persica]
 ref|XP_007225551.1| hypothetical protein PRUPE_ppa003299m2g [Prunus persica]
 gb|EMJ26749.1| hypothetical protein PRUPE_ppa003299m2g [Prunus persica]
 gb|EMJ26750.1| hypothetical protein PRUPE_ppa003299m2g [Prunus persica]
Length=587

 Score =   361 bits (926),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLEMI++PHYLYRMTIL AV LLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEMIDNPHYLYRMTILRAVCLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFANQALQA
Sbjct  520  VNASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPSLVELSEDPDVDVRFFANQALQA  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDHVMMSS  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +A V+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMALVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_011077133.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Sesamum indicum]
Length=587

 Score =   360 bits (925),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVL+M+ +PHYLYRMT+L A+SLLAPVMGSEITC+KLLPVI
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLDMVTNPHYLYRMTVLQAISLLAPVMGSEITCSKLLPVI  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TASKDRVPNIKFNVAKVLQS+IPIVD SVVEKTIRP LVELSEDPDVDVRFFANQALQ+
Sbjct  520  VTASKDRVPNIKFNVAKVLQSMIPIVDQSVVEKTIRPSLVELSEDPDVDVRFFANQALQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDNVMMSS  587


 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 86/187 (46%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  441

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +   +D+V +I+   A  L+ L          + I P ++++  +P    R    QA+  
Sbjct  442  MQWLQDKVYSIRDAAANNLKRLAEEFGPEWAMQHIVPQVLDMVTNPHYLYRMTVLQAISL  501

Query  268  ADQVMMS  248
               VM S
Sbjct  502  LAPVMGS  508



>ref|XP_006437703.1| hypothetical protein CICLE_v10031047mg [Citrus clementina]
 ref|XP_006437704.1| hypothetical protein CICLE_v10031047mg [Citrus clementina]
 gb|ESR50943.1| hypothetical protein CICLE_v10031047mg [Citrus clementina]
 gb|ESR50944.1| hypothetical protein CICLE_v10031047mg [Citrus clementina]
Length=587

 Score =   360 bits (925),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLEMIN+PHYLYRMTIL A+SLLAPVMGSEITC++LLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEMINNPHYLYRMTILRAISLLAPVMGSEITCSRLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD S+VEKTIRPCLVEL+EDPDVDVRFFA QA+Q+
Sbjct  520  INASKDRVPNIKFNVAKVLQSLIPIVDQSMVEKTIRPCLVELTEDPDVDVRFFATQAIQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDHVMMSS  587


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_009347000.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Pyrus x bretschneideri]
Length=587

 Score =   360 bits (925),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG+LCMQWL DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGSLCMQWLNDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQHI+PQVLEMI++PHYLYRMTILHA+SLLAPV+GSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPDWAMQHIVPQVLEMISNPHYLYRMTILHAISLLAPVLGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TASKDRVPNIKFNVAKVLQS+IPIVD SVVEKTIRPCLVELSEDPDVDVR FA+QALQ+
Sbjct  520  VTASKDRVPNIKFNVAKVLQSIIPIVDQSVVEKTIRPCLVELSEDPDVDVRSFASQALQS  579

Query  268  ADQVMMSS  245
            ++QVMM+S
Sbjct  580  SEQVMMTS  587


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 86/172 (50%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEATRSDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+Q I+P V ++  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELAIQQILPFVKDLSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|AFW86036.1| hypothetical protein ZEAMMB73_179225 [Zea mays]
Length=412

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  225  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANN  284

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+
Sbjct  285  LKRLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVV  344

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVL+SL+PI+D SVVEKT++PCLVELSEDPDVDVR++ANQALQA
Sbjct  345  INSSKDRVPNIKFNVAKVLKSLVPILDQSVVEKTVKPCLVELSEDPDVDVRYYANQALQA  404

Query  268  ADQVMMSS  245
             DQ+M+SS
Sbjct  405  CDQMMVSS  412


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  69   PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGK  128

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  129  VTKFCRILNPQLSIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATMEQLLPIF  188

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++    + +T+ P +VEL+ED    VR 
Sbjct  189  LSLLKDEFPDVRLNIISKLDQVNQVIGIDFLSQTLLPAIVELAEDRHWRVRL  240



>ref|XP_010528048.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Tarenaya hassleriana]
 ref|XP_010528049.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Tarenaya hassleriana]
 ref|XP_010528050.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Tarenaya hassleriana]
 ref|XP_010528051.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Tarenaya hassleriana]
Length=587

 Score =   360 bits (923),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+P VLEMIN+PHYLYRMTIL A+SLLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIVPLVLEMINNPHYLYRMTILRAISLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAKVLQSLIPIVD S VEKT+RPCLVELSEDPDVDVRF+ANQA+Q+
Sbjct  520  ITASKDRVPNIKFNVAKVLQSLIPIVDQSAVEKTVRPCLVELSEDPDVDVRFYANQAIQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  VDNVMMSS  587


 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVSFSQDKSWRVRYMVANQLYELCEAVGPEPTRIDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_009152111.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Brassica rapa]
Length=587

 Score =   359 bits (922),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV+
Sbjct  460  VKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TA+KDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFAN+ALQ+
Sbjct  520  MTAAKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPGLVELSEDPDVDVRFFANEALQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDNVMMSS  587


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_008243199.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Prunus mume]
Length=587

 Score =   359 bits (921),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLEMI++PHYLYRMTIL AV LLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEMIDNPHYLYRMTILRAVCLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +  SKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFANQALQA
Sbjct  520  VNVSKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPSLVELSEDPDVDVRFFANQALQA  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDHVMMSS  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +A V+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMALVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006484434.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Citrus sinensis]
 ref|XP_006484435.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Citrus sinensis]
Length=587

 Score =   359 bits (921),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI PQVLEMIN+PHYLYRMTIL A+SLLAPVMGSEITC++LLPV+
Sbjct  460  LKRLAEEFGPEWAMQHITPQVLEMINNPHYLYRMTILRAISLLAPVMGSEITCSRLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD S+VEKTIRPCLVEL+EDPDVDVRFFA QA+Q+
Sbjct  520  INASKDRVPNIKFNVAKVLQSLIPIVDQSMVEKTIRPCLVELTEDPDVDVRFFATQAIQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDHVMMSS  587


 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPLLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 86/187 (46%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSSDSSQHVRSALASVIMGMAPLLGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  441

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +   +D+V +I+   A  L+ L          + I P ++E+  +P    R    +A+  
Sbjct  442  MQWLQDKVYSIRDAAANNLKRLAEEFGPEWAMQHITPQVLEMINNPHYLYRMTILRAISL  501

Query  268  ADQVMMS  248
               VM S
Sbjct  502  LAPVMGS  508



>ref|XP_009621929.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana tomentosiformis]
 ref|XP_009621930.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana tomentosiformis]
Length=581

 Score =   358 bits (920),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP WAM+HI+PQVL+MINDPHYLYRMTILHA+SLLAPVMGSEITC+KLLPVI
Sbjct  460  VKRLAEEFGPTWAMEHIVPQVLDMINDPHYLYRMTILHAISLLAPVMGSEITCSKLLPVI  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAKVLQSLIPIV+ SVVE TIRPCLVELSEDPDVDVRFFANQALQA
Sbjct  520  ITASKDRVPNIKFNVAKVLQSLIPIVEQSVVETTIRPCLVELSEDPDVDVRFFANQALQA  579

Query  268  A  266
             
Sbjct  580  T  580


 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  A+D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFAQDKSWRVRYMVANQLYELCEAVGPEATRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ 
Sbjct  304  VTKFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_008446576.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Cucumis melo]
 ref|XP_011655767.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Cucumis sativus]
Length=587

 Score =   358 bits (920),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVL+MIN+PHYLYRMT+L AVSLLAPVMGSEITC KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLDMINNPHYLYRMTVLRAVSLLAPVMGSEITCTKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I++SKDRVPNIKFNVAKVLQSLIPIVD  VVEKTIRP LVELSEDPDVDVRFFANQALQ+
Sbjct  520  ISSSKDRVPNIKFNVAKVLQSLIPIVDQPVVEKTIRPSLVELSEDPDVDVRFFANQALQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDHVMMSS  587


 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_002529138.1| serine/threonine protein phosphatase 2a regulatory subunit A, 
putative [Ricinus communis]
 gb|EEF33251.1| serine/threonine protein phosphatase 2a regulatory subunit A, 
putative [Ricinus communis]
Length=587

 Score =   358 bits (919),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAM+HIIPQVLEM+ +PHYLYRMTIL A+SLLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMRHIIPQVLEMVTNPHYLYRMTILRAISLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
             TASKDRVPNIKFNVAKVLQSLI IVD SVVEKTIRPCL ELSEDPDVDVRFFANQALQ+
Sbjct  520  ATASKDRVPNIKFNVAKVLQSLISIVDQSVVEKTIRPCLAELSEDPDVDVRFFANQALQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDNVMMSS  587


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_007046273.1| Phosphatase 2A subunit A2, 65,PP2AA2 [Theobroma cacao]
 gb|EOY02105.1| Phosphatase 2A subunit A2, 65,PP2AA2 [Theobroma cacao]
Length=587

 Score =   358 bits (919),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQW++DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWMQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLEM+N+ HYLYRMTIL A+SLLAP+M SEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEMVNNSHYLYRMTILRAISLLAPIMESEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVR+FANQALQ+
Sbjct  520  INASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRYFANQALQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDHVMMSS  587


 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V ++ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPELAIQHILPCVKDLSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010495219.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
Length=587

 Score =   358 bits (919),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAK++QSLIPIVD SVVE  IRPCLVELSEDPDVDVRFFANQALQ+
Sbjct  520  ITASKDRVPNIKFNVAKMMQSLIPIVDQSVVENMIRPCLVELSEDPDVDVRFFANQALQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDNVMMSS  587


 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V ++     PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKVCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010458784.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
2A 65 kDa regulatory subunit A gamma isoform-like [Camelina 
sativa]
Length=587

 Score =   358 bits (919),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAK++QSLIPIVD SVVE  IRPCLVELSEDPDVDVRFFANQALQ+
Sbjct  520  ITASKDRVPNIKFNVAKMMQSLIPIVDQSVVENMIRPCLVELSEDPDVDVRFFANQALQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDNVMMSS  587


 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 86/172 (50%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+Q ++P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILNPELAIQRVLPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006307029.1| hypothetical protein CARUB_v10008615mg [Capsella rubella]
 gb|EOA39927.1| hypothetical protein CARUB_v10008615mg [Capsella rubella]
Length=610

 Score =   358 bits (920),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  423  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANN  482

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +
Sbjct  483  LKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAV  542

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAK++QSLIPIVD SVVE  IRPCLVELSEDPDVDVRFFANQALQ+
Sbjct  543  ITASKDRVPNIKFNVAKMMQSLIPIVDQSVVESMIRPCLVELSEDPDVDVRFFANQALQS  602

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  603  IDTVMMSS  610


 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  267  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  326

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  327  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  386

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  387  LSLLKDEFPDVRLNIISKLDEVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  438



>ref|XP_010476330.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
Length=587

 Score =   358 bits (918),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAK++QSLIPIVD SVVE  IRPCLVELSEDPDVDVRFFANQALQ+
Sbjct  520  ITASKDRVPNIKFNVAKMMQSLIPIVDQSVVENMIRPCLVELSEDPDVDVRFFANQALQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDNVMMSS  587


 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010476329.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
Length=587

 Score =   358 bits (918),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAK++QSLIPIVD SVVE  IRPCLVELSEDPDVDVRFFANQALQ+
Sbjct  520  ITASKDRVPNIKFNVAKMMQSLIPIVDQSVVENMIRPCLVELSEDPDVDVRFFANQALQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDNVMMSS  587


 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVSFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_007210261.1| hypothetical protein PRUPE_ppa003291mg [Prunus persica]
 gb|EMJ11460.1| hypothetical protein PRUPE_ppa003291mg [Prunus persica]
Length=587

 Score =   358 bits (918),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG+LCMQWL DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGSLCMQWLNDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPV+GSEITC+KLLPV+
Sbjct  460  VKRLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVLGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQS+IPIVD SVVEK IRPCLVELSEDPDVDVR FA+QALQ+
Sbjct  520  INASKDRVPNIKFNVAKVLQSVIPIVDQSVVEKMIRPCLVELSEDPDVDVRSFASQALQS  579

Query  268  ADQVMMSS  245
             +QVMMSS
Sbjct  580  IEQVMMSS  587


 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 85/172 (49%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEATRSDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A Q I+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELATQQILPFVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_008339694.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Malus domestica]
Length=587

 Score =   357 bits (917),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL A+ LLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAICLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + A+KDRVPNIKFNVAKVLQSLI IVD SVVEKTIRP LVELSEDPDVDVRFFANQALQA
Sbjct  520  VNAAKDRVPNIKFNVAKVLQSLISIVDQSVVEKTIRPSLVELSEDPDVDVRFFANQALQA  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDHVMMSS  587


 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEHTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +A V+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMALVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_008361732.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Malus domestica]
Length=587

 Score =   357 bits (917),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL A+ LLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAICLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + A+KDRVPNIKFNVAKVLQSLI IVD SVVEKTIRP LVELSEDPDVDVRFFANQALQA
Sbjct  520  VNAAKDRVPNIKFNVAKVLQSLISIVDQSVVEKTIRPSLVELSEDPDVDVRFFANQALQA  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDHVMMSS  587


 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEHTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +A V+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMALVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_009606530.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Nicotiana tomentosiformis]
 ref|XP_009606531.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Nicotiana tomentosiformis]
Length=587

 Score =   357 bits (916),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLG+GFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGIGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVL+M   PHYLYRMTIL A+SLLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLDMTTSPHYLYRMTILRAISLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITA+KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRP LVEL+EDPDVDVRF+ANQALQ+
Sbjct  520  ITATKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPSLVELAEDPDVDVRFYANQALQS  579

Query  268  ADQVMMSS  245
             D VMMS 
Sbjct  580  IDNVMMSG  587


 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_002892742.1| hypothetical protein ARALYDRAFT_888699 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69001.1| hypothetical protein ARALYDRAFT_888699 [Arabidopsis lyrata subsp. 
lyrata]
Length=587

 Score =   357 bits (916),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAK++QSLIPIVD +VVE  IRPCLVELSEDPDVDVRFFANQALQ+
Sbjct  520  ITASKDRVPNIKFNVAKMMQSLIPIVDQAVVENMIRPCLVELSEDPDVDVRFFANQALQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDNVMMSS  587


 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 86/172 (50%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L     + L+D    +R AAA  
Sbjct  244  PVIVTFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYARLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_009766514.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Nicotiana sylvestris]
Length=587

 Score =   357 bits (916),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLG+GFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGIGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVL+M   PHYLYRMTIL A+SLLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLDMTTSPHYLYRMTILRAISLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITA+KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRP LVEL+EDPDVDVRF+ANQALQ+
Sbjct  520  ITATKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPSLVELAEDPDVDVRFYANQALQS  579

Query  268  ADQVMMSS  245
             D VMMS 
Sbjct  580  IDNVMMSG  587


 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|AFW75383.1| hypothetical protein ZEAMMB73_324274 [Zea mays]
Length=521

 Score =   355 bits (910),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  334  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANN  393

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+
Sbjct  394  LKRLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVV  453

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQSL+PI+D SVVEKT++PCLVELSEDPDVDVR++ANQALQA
Sbjct  454  INSSKDRVPNIKFNVAKVLQSLVPILDQSVVEKTVKPCLVELSEDPDVDVRYYANQALQA  513

Query  268  ADQVMMSS  245
             DQ+M+SS
Sbjct  514  CDQMMVSS  521


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  178  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGK  237

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +L+P+ 
Sbjct  238  VTKFCRILNPQLSVQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLVPIF  297

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  298  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  349



>gb|ACN41352.2| protein phosphatase 2A regulatory subunit A [Betula pendula]
Length=511

 Score =   354 bits (909),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  324  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  383

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLEM+N+ HYLYRMTIL A+SLLAPVMGSEIT + LLPV+
Sbjct  384  LKRLAEEFGPEWAMQHIIPQVLEMVNNQHYLYRMTILRAISLLAPVMGSEITNSNLLPVV  443

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFN AKV QSLIPIVDHSVVEKTIRPCLVEL EDPDVDVRFFANQAL++
Sbjct  444  INASKDRVPNIKFNEAKVFQSLIPIVDHSVVEKTIRPCLVELGEDPDVDVRFFANQALES  503

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  504  IDHVMMSS  511


 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  168  PVIVSFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGK  227

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  228  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  287

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  288  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  339


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 70/142 (49%), Gaps = 0/142 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  246  PCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  305

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  306  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  365

Query  448  ITASKDRVPNIKFNVAKVLQSL  383
            +   KD+V +I+   A  L+ L
Sbjct  366  MQWLKDKVYSIRDAAANNLKRL  387



>emb|CDP00596.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   358 bits (919),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  447  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  506

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVL+M N+PHYLYRMTIL A+SLLAPVMGSEITC+KLLPV+
Sbjct  507  LKRLAEEFGPEWAMQHIIPQVLDMTNNPHYLYRMTILRAISLLAPVMGSEITCSKLLPVV  566

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TASKDRVPNIKFNVAKVLQSLI IVD SVVEKTIRPCLVEL+EDPDVDVR++ANQALQ+
Sbjct  567  VTASKDRVPNIKFNVAKVLQSLIHIVDQSVVEKTIRPCLVELAEDPDVDVRYYANQALQS  626

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  627  IDSVMMSS  634


 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  291  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  350

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  351  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  410

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  411  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  462



>ref|XP_010458785.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
 ref|XP_010458786.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
Length=587

 Score =   357 bits (915),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAE+FGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +
Sbjct  460  LKRLAEDFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAK++QSLIPIVD SVVE  IRPCLVELSEDPDVDVRFFANQALQ+
Sbjct  520  ITASKDRVPNIKFNVAKMMQSLIPIVDQSVVENMIRPCLVELSEDPDVDVRFFANQALQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDNVMMSS  587


 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 86/172 (50%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +       E A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILNLELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006583401.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Glycine max]
 ref|XP_006583402.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Glycine max]
Length=587

 Score =   357 bits (915),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQHIIPQVL+M+ DPHYLYRMTIL A+SLLAPV+GSEIT +KLLP++
Sbjct  460  IKRLAEEFGPDWAMQHIIPQVLDMVTDPHYLYRMTILQAISLLAPVLGSEITSSKLLPLV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD SVVE TIRPCLVELSEDPDVDVRFFA+QALQ+
Sbjct  520  INASKDRVPNIKFNVAKVLQSLIPIVDQSVVESTIRPCLVELSEDPDVDVRFFASQALQS  579

Query  268  ADQVMMSS  245
            +DQV MSS
Sbjct  580  SDQVKMSS  587


 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDPTRSELVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V + +    P+ A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFSRILNPDLAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 83/178 (47%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  441

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +   KD+V +I+   A  ++ L          + I P ++++  DP    R    QA+
Sbjct  442  MQWLKDKVYSIRDAAANNIKRLAEEFGPDWAMQHIIPQVLDMVTDPHYLYRMTILQAI  499



>ref|XP_008240282.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Prunus mume]
Length=587

 Score =   357 bits (915),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG+LCMQWL DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGSLCMQWLNDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPV+GSEITC+KLLPV+
Sbjct  460  VKRLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVLGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQS+IPIVD SVVEK IRPCLVELSEDPDVDVR FA+QA Q+
Sbjct  520  INASKDRVPNIKFNVAKVLQSVIPIVDQSVVEKMIRPCLVELSEDPDVDVRSFASQAFQS  579

Query  268  ADQVMMSS  245
             +QVMMSS
Sbjct  580  IEQVMMSS  587


 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 86/172 (50%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEATRSDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+Q I+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELAIQQILPFVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_009356482.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Pyrus x bretschneideri]
Length=587

 Score =   357 bits (915),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL A+ LLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAICLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + A+KDRVPNIKFNVAKVLQSLI +VD SVVEKTIRP LVELSEDPDVDVRFFANQALQA
Sbjct  520  VNAAKDRVPNIKFNVAKVLQSLISLVDQSVVEKTIRPSLVELSEDPDVDVRFFANQALQA  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDHVMMSS  587


 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEHTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +A V+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMALVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_011070821.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Sesamum indicum]
Length=587

 Score =   356 bits (914),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQHI+PQVL+M+N+PHYLYRMT+L A+SLLAPVMG+EITC+ LLPVI
Sbjct  460  LKRLAEEFGPDWAMQHIVPQVLDMVNNPHYLYRMTVLRAISLLAPVMGAEITCSNLLPVI  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TASKDRVPNIKFNVAKVLQS+IPIVD SVVEKTIRP LVEL+EDPDVDVRFFANQALQ+
Sbjct  520  VTASKDRVPNIKFNVAKVLQSMIPIVDQSVVEKTIRPTLVELTEDPDVDVRFFANQALQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDHVMMSS  587


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELAVQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>emb|CAA57529.1| protein phosphatase 2A 65 kDa regulatory subunit [Arabidopsis 
thaliana]
Length=508

 Score =   354 bits (908),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFD+KLGALCMQWL+DKV+SIR+AAANN
Sbjct  321  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDEKLGALCMQWLQDKVHSIREAAANN  380

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +
Sbjct  381  LKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAV  440

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAK++QSLIPIVD +VVE  IRPCLVELSEDPDVDVR+FANQALQ+
Sbjct  441  ITASKDRVPNIKFNVAKMMQSLIPIVDQAVVENMIRPCLVELSEDPDVDVRYFANQALQS  500

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  501  IDNVMMSS  508


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 86/172 (50%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L     + L+D    +R AAA  
Sbjct  165  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYARLLRDNEAEVRIAAAGK  224

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  225  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  284

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  285  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  336



>gb|KEH27050.1| serine/threonine protein phosphatase 2A regulatory subunit A 
[Medicago truncatula]
Length=587

 Score =   356 bits (914),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAA N
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAATN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVL+M+NDPHYLYRMTILHA+SLLAPV+GSEIT   LLP++
Sbjct  460  IKRLAEEFGPEWAMQHIIPQVLDMVNDPHYLYRMTILHAISLLAPVLGSEITTTNLLPLV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + A+KDRVPNIKFNVAKVLQSLIPIVD SVVE TI+PCLVELSEDPDVDVRFFA+QALQ+
Sbjct  520  VNAAKDRVPNIKFNVAKVLQSLIPIVDESVVESTIKPCLVELSEDPDVDVRFFASQALQS  579

Query  268  ADQVMMSS  245
            +DQV MSS
Sbjct  580  SDQVKMSS  587


 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDSTKTELVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V + +    PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFSRILSPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_004297127.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Fragaria vesca subsp. vesca]
Length=587

 Score =   356 bits (914),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG+LCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGSLCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEMI++PHYLYRMTIL A+ LLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMIDNPHYLYRMTILRAICLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFA QALQA
Sbjct  520  VNASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPSLVELSEDPDVDVRFFATQALQA  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDHVMMSS  587


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +A V+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMALVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_004956389.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Setaria italica]
Length=587

 Score =   356 bits (914),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPVI
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVI  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQSLIPI+D SVVEKT++PCLVELSEDPDVDVR++ANQALQA
Sbjct  520  INSSKDRVPNIKFNVAKVLQSLIPILDQSVVEKTVKPCLVELSEDPDVDVRYYANQALQA  579

Query  268  ADQVMMSS  245
             DQ+M+SS
Sbjct  580  CDQMMVSS  587


 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_011021847.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Populus euphratica]
 ref|XP_011021855.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Populus euphratica]
 ref|XP_011021865.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Populus euphratica]
Length=587

 Score =   356 bits (914),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWA+QHIIPQVLEM  +PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAVQHIIPQVLEMSTNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFN AKVLQSLIPIVD SV EKTIRPCLVELSEDPDVDVR+FANQALQ 
Sbjct  520  INASKDRVPNIKFNAAKVLQSLIPIVDQSVAEKTIRPCLVELSEDPDVDVRYFANQALQT  579

Query  268  ADQVMMSS  245
             D VMMS+
Sbjct  580  IDSVMMST  587


 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRMDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/187 (25%), Positives = 87/187 (47%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  441

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +   +D+V +I+   A  L+ L          + I P ++E+S +P    R    +A+  
Sbjct  442  MQWLQDKVYSIRDAAANNLKRLAEEFGPEWAVQHIIPQVLEMSTNPHYLYRMTILRAVSL  501

Query  268  ADQVMMS  248
               VM S
Sbjct  502  LAPVMGS  508



>gb|AAG29594.1|AF196287_1 Ser/Thr specific protein phosphatase 2A A regulatory subunit 
beta isoform [Medicago sativa subsp. x varia]
Length=587

 Score =   356 bits (914),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAA N
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAATN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVL+M+NDPHYLYRMTILHA+SLLAPV+GSEIT   LLP++
Sbjct  460  IKRLAEEFGPEWAMQHIIPQVLDMVNDPHYLYRMTILHAISLLAPVLGSEITTTNLLPLV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + A+KDRVPNIKFNVAKVLQSLIPIVD SVVE TI+PCLVELSEDPDVDVRFFA+QALQ+
Sbjct  520  VNAAKDRVPNIKFNVAKVLQSLIPIVDESVVESTIKPCLVELSEDPDVDVRFFASQALQS  579

Query  268  ADQVMMSS  245
            +DQV MSS
Sbjct  580  SDQVKMSS  587


 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDSTKTELVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V + +    PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFSRILSPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_004300534.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Fragaria vesca subsp. vesca]
 ref|XP_011465404.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Fragaria vesca subsp. vesca]
Length=586

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG+LCMQWL DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGSLCMQWLNDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGPEWAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPV+GSEITC+KLLPV+
Sbjct  460  VKRLAEEFGPEWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVLGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAKVLQSLIPIVD SVVEK IRPCLVELSEDPDVDVR FA QALQ+
Sbjct  520  ITASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKMIRPCLVELSEDPDVDVRSFATQALQS  579

Query  268  ADQVM  254
            +D +M
Sbjct  580  SDAMM  584


 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 86/172 (50%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEATRSDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+Q I+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILDPELAIQQILPFVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010495228.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
Length=587

 Score =   356 bits (914),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC++LLP +
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSRLLPAV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAK++QSLIPIVD SVVE  IRPCLVELSEDPDVDVRFFANQALQ+
Sbjct  520  ITASKDRVPNIKFNVAKMMQSLIPIVDQSVVENMIRPCLVELSEDPDVDVRFFANQALQS  579

Query  268  ADQVMMSS  245
             D +MMSS
Sbjct  580  IDNLMMSS  587


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KHN20717.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Glycine soja]
Length=521

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGV FFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  334  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVSFFDDKLGALCMQWLKDKVYSIRDAAANN  393

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQHIIPQVL+M+ DPHYLYRMTIL A+SLLAPV+GSEIT +KLLP++
Sbjct  394  IKRLAEEFGPDWAMQHIIPQVLDMVTDPHYLYRMTILQAISLLAPVLGSEITSSKLLPLV  453

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD SVVE TIRPCLVELSEDPDVDVRFFA+QALQ+
Sbjct  454  INASKDRVPNIKFNVAKVLQSLIPIVDQSVVESTIRPCLVELSEDPDVDVRFFASQALQS  513

Query  268  ADQVMMSS  245
            +DQV MSS
Sbjct  514  SDQVKMSS  521


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R A A  
Sbjct  178  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDPTRSELVPAYVRLLRDNEAEVRIAVAGK  237

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V + +    P+ A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  238  VTKFSRILNPDLAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  297

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  298  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  349


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 83/178 (47%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  256  PCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  315

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  316  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVSFFDDKLGALC  375

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +   KD+V +I+   A  ++ L          + I P ++++  DP    R    QA+
Sbjct  376  MQWLKDKVYSIRDAAANNIKRLAEEFGPDWAMQHIIPQVLDMVTDPHYLYRMTILQAI  433



>ref|XP_006417131.1| hypothetical protein EUTSA_v10007164mg [Eutrema salsugineum]
 ref|XP_006417132.1| hypothetical protein EUTSA_v10007164mg [Eutrema salsugineum]
 gb|ESQ35484.1| hypothetical protein EUTSA_v10007164mg [Eutrema salsugineum]
 gb|ESQ35485.1| hypothetical protein EUTSA_v10007164mg [Eutrema salsugineum]
Length=587

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLE+I++PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLELIDNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAK++QSLIP VD SVVEK IRPCL+ELSEDPDVDVRFFANQALQ+
Sbjct  520  ITASKDRVPNIKFNVAKMMQSLIPTVDQSVVEKMIRPCLMELSEDPDVDVRFFANQALQS  579

Query  268  ADQVMMSS  245
             D V+MSS
Sbjct  580  IDNVIMSS  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P I + ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIGKFSQDKSWRVRYMVANQLYELCEAVGPEPSRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRIVNPELAIQHILPCVKELSSDSSQHVRSALASIIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 41/166 (25%), Positives = 79/166 (48%), Gaps = 0/166 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     + L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSSDSSQHVRSALASIIMGMAPVLGKDATIEHLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  441

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDP  311
            +   +D+V +I+   A  L+ L          + I P ++EL ++P
Sbjct  442  MQWLQDKVHSIRDAAANNLKRLAEEFGPEWAMQHIVPQVLELIDNP  487



>ref|XP_002314877.1| hypothetical protein POPTR_0010s13760g [Populus trichocarpa]
 ref|XP_006378496.1| Ser/Thr specific protein phosphatase 2A A regulatory subunit 
alpha isoform [Populus trichocarpa]
 gb|ABK94060.1| unknown [Populus trichocarpa]
 gb|EEF01048.1| hypothetical protein POPTR_0010s13760g [Populus trichocarpa]
 gb|ERP56293.1| Ser/Thr specific protein phosphatase 2A A regulatory subunit 
alpha isoform [Populus trichocarpa]
Length=587

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAM+HIIPQVLEM  +PHYLYRMTI+ AVSLLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMEHIIPQVLEMSTNPHYLYRMTIIRAVSLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRV NIKFNVAKVLQSLIPIVD SV EKTIRPCLVELSEDPDVDVRFFANQALQ 
Sbjct  520  VNASKDRVSNIKFNVAKVLQSLIPIVDQSVAEKTIRPCLVELSEDPDVDVRFFANQALQT  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDSVMMSS  587


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPEHAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/187 (25%), Positives = 87/187 (47%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  441

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +   +D+V +I+   A  L+ L          + I P ++E+S +P    R    +A+  
Sbjct  442  MQWLQDKVYSIRDAAANNLKRLAEEFGPEWAMEHIIPQVLEMSTNPHYLYRMTIIRAVSL  501

Query  268  ADQVMMS  248
               VM S
Sbjct  502  LAPVMGS  508



>gb|KJB23732.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
 gb|KJB23734.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
 gb|KJB23735.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
Length=586

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVL+MIN+PHYL+RMTILH++SLLAPVMGS+ITC+KLLPV+
Sbjct  460  VKRLAEEFGPDWAMQHIVPQVLDMINNPHYLHRMTILHSISLLAPVMGSDITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLI IVD SVVEK IRPCLVELSEDPDVDVRFFA+QAL++
Sbjct  520  INASKDRVPNIKFNVAKVLQSLILIVDQSVVEKKIRPCLVELSEDPDVDVRFFASQALES  579

Query  268  ADQVMMS  248
            ++QVMMS
Sbjct  580  SNQVMMS  586


 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 86/172 (50%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  +   +G       L    +  L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYEVCEAVGPEPTRSDLVPAYVCLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_009776620.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana sylvestris]
 ref|XP_009776621.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana sylvestris]
Length=581

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP WAM+HIIPQVL+MINDPHYLYRMTILHA+SLLA VMGSEITC+KLLPVI
Sbjct  460  VKRLAEEFGPTWAMEHIIPQVLDMINDPHYLYRMTILHAISLLAHVMGSEITCSKLLPVI  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAKVLQSLIPIV+ SVVE TIRPCLVELSEDPDVDVRFFANQALQA
Sbjct  520  ITASKDRVPNIKFNVAKVLQSLIPIVEQSVVETTIRPCLVELSEDPDVDVRFFANQALQA  579

Query  268  A  266
             
Sbjct  580  T  580


 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  A+D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFAQDKSWRVRYMVANQLYELCEAVGPEATRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ 
Sbjct  304  VTKFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 86/187 (46%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  441

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +   KD+V +I+   A  ++ L      +   + I P ++++  DP    R     A+  
Sbjct  442  MQWLKDKVYSIRDAAANNVKRLAEEFGPTWAMEHIIPQVLDMINDPHYLYRMTILHAISL  501

Query  268  ADQVMMS  248
               VM S
Sbjct  502  LAHVMGS  508



>ref|XP_004241625.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Solanum lycopersicum]
Length=581

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAM+HIIPQVL+MINDPHYLYRMTILHA+SLLAPV+GSEI C+KLLPVI
Sbjct  460  VKRLAEEFGPKWAMEHIIPQVLDMINDPHYLYRMTILHAISLLAPVLGSEIACSKLLPVI  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAKVLQS+IPIV+ SVVE TIRPCLVELSEDPDVDVRFFANQALQA
Sbjct  520  ITASKDRVPNIKFNVAKVLQSVIPIVEQSVVESTIRPCLVELSEDPDVDVRFFANQALQA  579

Query  268  A  266
             
Sbjct  580  T  580


 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -2

Query  802  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  623
            IV  A+D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFAQDKSWRVRYMVANQLYDLCEAVGPEATRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  622  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  443
            +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIFLS  365

Query  442  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_008648330.1| PREDICTED: LOC732740 isoform X1 [Zea mays]
 gb|AFW75380.1| hypothetical protein ZEAMMB73_324274 [Zea mays]
Length=587

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQSL+PI+D SVVEKT++PCLVELSEDPDVDVR++ANQALQA
Sbjct  520  INSSKDRVPNIKFNVAKVLQSLVPILDQSVVEKTVKPCLVELSEDPDVDVRYYANQALQA  579

Query  268  ADQVMMSS  245
             DQ+M+SS
Sbjct  580  CDQMMVSS  587


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +L+P+ 
Sbjct  304  VTKFCRILNPQLSVQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLVPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|AEB40165.1| protein phosphatase 2A structural subunit [Triticum aestivum]
 gb|AEB40166.1| protein phosphatase 2A structural subunit [Triticum aestivum]
 gb|AEB40167.1| protein phosphatase 2A structural subunit [Triticum aestivum]
 gb|EMT17513.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Aegilops tauschii]
Length=587

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQSL+PI+D SV EKT++PCLVELSEDPDVDVR++ANQALQA
Sbjct  520  INSSKDRVPNIKFNVAKVLQSLVPILDQSVAEKTVKPCLVELSEDPDVDVRYYANQALQA  579

Query  268  ADQVMMSS  245
             DQ+MMSS
Sbjct  580  CDQIMMSS  587


 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006354729.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Solanum tuberosum]
Length=581

 Score =   355 bits (911),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP WAM+HIIPQVL+MINDPHYLYRMTILHA+SLLAPVMGSEITC+KLLPVI
Sbjct  460  VKRLAEEFGPTWAMEHIIPQVLDMINDPHYLYRMTILHAISLLAPVMGSEITCSKLLPVI  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQS+IPIV+ SVVE TIRPCLVELSEDPDVDVRFFANQALQA
Sbjct  520  IAASKDRVPNIKFNVAKVLQSVIPIVEQSVVENTIRPCLVELSEDPDVDVRFFANQALQA  579

Query  268  A  266
             
Sbjct  580  T  580


 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  A+D+ WRVR  +   +  L   +G       L    +Q L+D    +R AAA  
Sbjct  244  PVIVNFAQDKSWRVRYMVANQLYELCEAVGPEGTRTDLVPAYVQLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ 
Sbjct  304  VTKFCRILSPEIAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 86/187 (46%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  441

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +   KD+V +I+   A  ++ L      +   + I P ++++  DP    R     A+  
Sbjct  442  MQWLKDKVYSIRDAAANNVKRLAEEFGPTWAMEHIIPQVLDMINDPHYLYRMTILHAISL  501

Query  268  ADQVMMS  248
               VM S
Sbjct  502  LAPVMGS  508



>sp|P36875.1|2AAA_PEA RecName: Full=Protein phosphatase PP2A regulatory subunit A; 
AltName: Full=PR65, partial [Pisum sativum]
 emb|CAA81107.1| phosphoprotein phosphatase 2A 65kDa regulatory subunit [Pisum 
sativum]
Length=395

 Score =   349 bits (895),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 169/189 (89%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGAL MQWLKDK YSIR+AAANN
Sbjct  207  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALIMQWLKDKEYSIRNAAANN  266

Query  628  VKRLA-EEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPV  452
            VKRLA EEFGPEWAMQHIIPQVL+MINDPHYLYRMTILHA+SLLAPV+GSEIT   LLP+
Sbjct  267  VKRLAAEEFGPEWAMQHIIPQVLDMINDPHYLYRMTILHAISLLAPVLGSEITSTNLLPL  326

Query  451  IITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQ  272
            ++ ASKDRVPNIKFNVAKVLQSLIPIVD SVVE TIRPCLVELSEDPDVDVRFFA+QALQ
Sbjct  327  VVNASKDRVPNIKFNVAKVLQSLIPIVDESVVESTIRPCLVELSEDPDVDVRFFASQALQ  386

Query  271  AADQVMMSS  245
            ++DQV MSS
Sbjct  387  SSDQVKMSS  395


 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 90/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D V  +R AAA  
Sbjct  51   PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDSTKTELVPAYVRLLRDNVAEVRIAAAGK  110

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V + +    PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  111  VSKFSRILSPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  170

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  171  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  222



>emb|CAA66487.1| protein phosphatase 2A [Nicotiana tabacum]
Length=586

 Score =   355 bits (911),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLG+GFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  399  PAIVELAEDRHWRVRLAIIEYIPLLASQLGIGFFDDKLGALCMQWLQDKVYSIRDAAANN  458

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVL+M   PHYLYRMTIL A+SLLAPVMGSEITC+KLLPV+
Sbjct  459  LKRLAEEFGPEWAMQHIIPQVLDMTTSPHYLYRMTILRAISLLAPVMGSEITCSKLLPVV  518

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITA+KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRP LVEL+EDPDVDVRF+ANQALQ+
Sbjct  519  ITATKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPSLVELAEDPDVDVRFYANQALQS  578

Query  268  ADQVMMSS  245
             D  MMS 
Sbjct  579  IDNAMMSG  586


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  243  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  302

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  303  VTKFCRILSPELAIQHILPCVKELSSDSSQYVRSALASVIMGMAPVLGKDATIEHLLPIF  362

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  363  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  414



>ref|XP_003577041.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Brachypodium 
distachyon]
Length=587

 Score =   355 bits (911),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG EITC KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGVEITCQKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQSL+PI+D SV EKT++PCLVELSEDPDVDVR++ANQALQA
Sbjct  520  INSSKDRVPNIKFNVAKVLQSLVPIIDQSVAEKTVKPCLVELSEDPDVDVRYYANQALQA  579

Query  268  ADQVMMSS  245
             DQ+MMSS
Sbjct  580  CDQIMMSS  587


 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRVDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPQLAVQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010942275.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Elaeis guineensis]
Length=587

 Score =   355 bits (910),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVL+ IN+PHYLYRMTILHA+SLLAPVMG++ITC KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLDKINNPHYLYRMTILHAISLLAPVMGADITCQKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQSL+PI+D SVVE TIRPCLVELSEDPDVDVR+FA+QALQA
Sbjct  520  IASSKDRVPNIKFNVAKVLQSLVPILDQSVVESTIRPCLVELSEDPDVDVRYFASQALQA  579

Query  268  ADQVMMSS  245
             DQVMM S
Sbjct  580  CDQVMMPS  587


 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_007152779.1| hypothetical protein PHAVU_004G159000g [Phaseolus vulgaris]
 gb|ESW24773.1| hypothetical protein PHAVU_004G159000g [Phaseolus vulgaris]
Length=587

 Score =   355 bits (910),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQHIIPQVL+M+ DPHYLYRMTIL A+SLLAPV+GSEIT +KLLP++
Sbjct  460  IKRLAEEFGPDWAMQHIIPQVLDMVTDPHYLYRMTILQAISLLAPVLGSEITSSKLLPLV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPI+D SVVE +IRPCLVELSEDPDVDVRFFA+QALQ+
Sbjct  520  INASKDRVPNIKFNVAKVLQSLIPIIDQSVVESSIRPCLVELSEDPDVDVRFFASQALQS  579

Query  268  ADQVMMSS  245
            +DQV MSS
Sbjct  580  SDQVKMSS  587


 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 90/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDPTRSELVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V + +    PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFSRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 83/178 (47%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  441

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +   KD+V +I+   A  ++ L          + I P ++++  DP    R    QA+
Sbjct  442  MQWLKDKVYSIRDAAANNIKRLAEEFGPDWAMQHIIPQVLDMVTDPHYLYRMTILQAI  499



>ref|XP_004497109.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Cicer arietinum]
 ref|XP_004497110.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Cicer arietinum]
Length=587

 Score =   355 bits (910),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLEMIN+PHYLYRMTIL A+SLLAPVMG+EITC+KLLP +
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEMINNPHYLYRMTILRAISLLAPVMGAEITCSKLLPAV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAKVL+S+ PIVD SVVEKTIRPCLVELSEDPDVDVRFF+NQALQA
Sbjct  520  VAASKDRVPNIKFNVAKVLESIFPIVDQSVVEKTIRPCLVELSEDPDVDVRFFSNQALQA  579

Query  268  ADQVMMSS  245
             D VMM+S
Sbjct  580  IDYVMMAS  587


 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRAELVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G E T  +LLP+ 
Sbjct  304  VTKFCRILSPDLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_009336593.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Pyrus x bretschneideri]
 ref|XP_009336594.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Pyrus x bretschneideri]
Length=587

 Score =   354 bits (909),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVL+MI++PHYLYRMTIL A+ LLAPVMG EITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLQMIDNPHYLYRMTILRAICLLAPVMGPEITCSKLLPVL  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + A+KDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFANQALQA
Sbjct  520  VNATKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPSLVELSEDPDVDVRFFANQALQA  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDHVMMSS  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +A V+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMALVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|NP_172790.2| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
 ref|NP_001184981.1| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
 sp|Q38951.2|2AAG_ARATH RecName: Full=Serine/threonine-protein phosphatase 2A 65 kDa 
regulatory subunit A gamma isoform; Short=AtA gamma; Short=PP2A, 
subunit A, gamma isoform [Arabidopsis thaliana]
 gb|AAM20611.1| protein phosphatase 2A regulatory subunit, putative [Arabidopsis 
thaliana]
 gb|AAO00961.1| protein phosphatase 2A regulatory subunit, putative [Arabidopsis 
thaliana]
 gb|AEE28998.1| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
 gb|AEE29000.1| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
Length=587

 Score =   354 bits (909),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFD+KLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDEKLGALCMQWLQDKVHSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAK++QSLIPIVD +VVE  IRPCLVELSEDPDVDVR+FANQALQ+
Sbjct  520  ITASKDRVPNIKFNVAKMMQSLIPIVDQAVVENMIRPCLVELSEDPDVDVRYFANQALQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDNVMMSS  587


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 85/172 (49%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L     + L D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYARLLCDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KEH44250.1| serine/threonine protein phosphatase 2A regulatory subunit A 
[Medicago truncatula]
Length=587

 Score =   354 bits (908),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLEMI +PHYLYRMTIL A+SLLAPVMGSE+TC+KLLP +
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEMITNPHYLYRMTILRAISLLAPVMGSEVTCSKLLPAV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAKVL+S+ PIVD SVVEKTIRPCLVEL EDPDVDVRFF+NQALQA
Sbjct  520  VAASKDRVPNIKFNVAKVLESIFPIVDQSVVEKTIRPCLVELGEDPDVDVRFFSNQALQA  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDHVMMSS  587


 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRAELVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G E T  +LLP+ 
Sbjct  304  VTKFCRILSPDLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|NP_001062674.1| Os09g0249700 [Oryza sativa Japonica Group]
 emb|CAB51803.1| phosphatase 2A regulatory A subunit [Oryza sativa]
 emb|CAB51804.1| protein phosphatase 2A A subunit [Oryza sativa]
 dbj|BAD19910.1| phosphatase 2A regulatory A subunit [Oryza sativa Japonica Group]
 dbj|BAD22212.1| phosphatase 2A regulatory A subunit [Oryza sativa Japonica Group]
 dbj|BAF24588.1| Os09g0249700 [Oryza sativa Japonica Group]
 gb|EAZ43900.1| hypothetical protein OsJ_28521 [Oryza sativa Japonica Group]
 dbj|BAG91590.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84161.1| hypothetical protein OsI_30535 [Oryza sativa Indica Group]
Length=587

 Score =   354 bits (908),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC +LLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQQLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQ+LIPI+D SVVEK ++PCLVELSEDPDVDVR++ANQALQA
Sbjct  520  INSSKDRVPNIKFNVAKVLQALIPILDQSVVEKNVKPCLVELSEDPDVDVRYYANQALQA  579

Query  268  ADQVMMSS  245
             DQ+MMSS
Sbjct  580  CDQIMMSS  587


 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 90/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G     ++L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEHSREQLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G E T  +LLP+ 
Sbjct  304  VTKFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010265183.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nelumbo nucifera]
 ref|XP_010265184.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nelumbo nucifera]
Length=587

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+W MQHIIPQVLEM N+PHYLYRMTIL+A+SLLAPVMGS+ITC+KLL V+
Sbjct  460  LKRLAEEFGPDWTMQHIIPQVLEMANNPHYLYRMTILNAISLLAPVMGSDITCSKLLQVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
              ASKDRVPNIKFNVAKVLQSLIPIVD SVVE+TIRPCLVELSEDPDVDVRFFA QALQ 
Sbjct  520  TNASKDRVPNIKFNVAKVLQSLIPIVDQSVVEQTIRPCLVELSEDPDVDVRFFARQALQT  579

Query  268  ADQVMMSS  245
            ++QVMMSS
Sbjct  580  SEQVMMSS  587


 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ 
Sbjct  304  VTKFCRILNPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 80/166 (48%), Gaps = 0/166 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  441

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDP  311
            +   +D+V +I+   A  L+ L          + I P ++E++ +P
Sbjct  442  MQWLEDKVYSIRDAAANNLKRLAEEFGPDWTMQHIIPQVLEMANNP  487



>gb|AAG29593.1|AF196286_1 Ser/Thr specific protein phosphatase 2A A regulatory subunit 
alpha isoform [Medicago sativa subsp. x varia]
Length=585

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  398  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANN  457

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLEMI +PHYLYRMTIL A+SLLAPVMGSE+TC+KLLP +
Sbjct  458  LKRLAEEFGPEWAMQHIIPQVLEMITNPHYLYRMTILRAISLLAPVMGSEVTCSKLLPAV  517

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAKVL+S+ PIVD SVVEKTIRPCLVEL EDPDVDVRFF+NQALQA
Sbjct  518  VAASKDRVPNIKFNVAKVLESIFPIVDQSVVEKTIRPCLVELGEDPDVDVRFFSNQALQA  577

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  578  IDHVMMSS  585


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  242  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRAELVPAYVRLLRDNEAEVRIAAAGK  301

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G E T  +LL + 
Sbjct  302  VTKFCRILSPDLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLHIF  361

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  362  LSLLKDEFPDVRINIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  413



>gb|ACL54598.1| unknown [Zea mays]
Length=587

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVLSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQSL+PI+D SVVEKT++PCLVELSEDPDVDVR++ANQALQA
Sbjct  520  INSSKDRVPNIKFNVAKVLQSLVPILDQSVVEKTVKPCLVELSEDPDVDVRYYANQALQA  579

Query  268  ADQVMMSS  245
             DQ+M+SS
Sbjct  580  CDQMMVSS  587


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +L+P+ 
Sbjct  304  VTKFCRILNPQLSVQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLVPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_008350866.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Malus domestica]
Length=587

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI PQVL+MI++PHYLYRMTIL A+ LLAPVMG EITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIXPQVLQMIDNPHYLYRMTILRAICLLAPVMGPEITCSKLLPVL  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I A+KDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFANQALQA
Sbjct  520  INATKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPSLVELSEDPDVDVRFFANQALQA  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDHVMMSS  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +A V+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMALVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_008659343.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Zea mays]
 gb|AFW86039.1| hypothetical protein ZEAMMB73_179225 [Zea mays]
Length=587

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVL+SL+PI+D SVVEKT++PCLVELSEDPDVDVR++ANQALQA
Sbjct  520  INSSKDRVPNIKFNVAKVLKSLVPILDQSVVEKTVKPCLVELSEDPDVDVRYYANQALQA  579

Query  268  ADQVMMSS  245
             DQ+M+SS
Sbjct  580  CDQMMVSS  587


 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPQLSIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATMEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++    + +T+ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDFLSQTLLPAIVELAEDRHWRVRL  415



>ref|XP_011008279.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Populus euphratica]
 ref|XP_011008287.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Populus euphratica]
 ref|XP_011008294.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Populus euphratica]
Length=587

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAM+HIIPQVLEM  +PHYLYRMTI+ AVSLLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMEHIIPQVLEMSTNPHYLYRMTIIRAVSLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRV NIKFNVAKVLQSLIPIVD  V EKTIRPCLVELSEDPDVDVRFFANQALQ 
Sbjct  520  VNASKDRVSNIKFNVAKVLQSLIPIVDQPVAEKTIRPCLVELSEDPDVDVRFFANQALQT  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDSVMMSS  587


 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRMDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPEHAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/187 (25%), Positives = 87/187 (47%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  441

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +   +D+V +I+   A  L+ L          + I P ++E+S +P    R    +A+  
Sbjct  442  MQWLQDKVYSIRDAAANNLKRLAEEFGPEWAMEHIIPQVLEMSTNPHYLYRMTIIRAVSL  501

Query  268  ADQVMMS  248
               VM S
Sbjct  502  LAPVMGS  508



>ref|XP_007142893.1| hypothetical protein PHAVU_007G0258001g [Phaseolus vulgaris]
 gb|ESW14887.1| hypothetical protein PHAVU_007G0258001g [Phaseolus vulgaris]
Length=521

 Score =   351 bits (901),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  334  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANN  393

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVL+M ++PHYLYRMTIL A+SLLAPVMG EITC+ LLPV+
Sbjct  394  LKRLAEEFGPEWAMQHIIPQVLDMSSNPHYLYRMTILRAISLLAPVMGPEITCSNLLPVV  453

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TASKDRVPNIKFNVAKVL+S+ PIVD SVVEKTIRPCLVELSEDPDVDVRFF+NQALQA
Sbjct  454  VTASKDRVPNIKFNVAKVLESIFPIVDQSVVEKTIRPCLVELSEDPDVDVRFFSNQALQA  513

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  514  IDHVMMSS  521


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  178  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGK  237

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G E T  +LLP+ 
Sbjct  238  VTKFCRILNPDLSIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLPIF  297

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  298  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  349


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 80/166 (48%), Gaps = 0/166 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  256  PCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLPIFLSLLKDEFPDVRLNIISK  315

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  316  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  375

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDP  311
            +   +D+V +I+   A  L+ L          + I P ++++S +P
Sbjct  376  MQWLQDKVHSIREAAANNLKRLAEEFGPEWAMQHIIPQVLDMSSNP  421



>ref|XP_010554238.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Tarenaya hassleriana]
 ref|XP_010554239.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Tarenaya hassleriana]
Length=586

 Score =   353 bits (905),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLG+GFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGIGFFDDKLGALCMQWLQDKVHSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVL+MIN+PHYLYRMTIL A+SLLAPVMGSEIT +KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLDMINNPHYLYRMTILRAISLLAPVMGSEITSSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TASKDRVPNIKFNVAKVLQSLIPIV+ SVVEKTIRPCLVELSEDPDVDVRFFANQALQ+
Sbjct  520  MTASKDRVPNIKFNVAKVLQSLIPIVEQSVVEKTIRPCLVELSEDPDVDVRFFANQALQS  579

Query  268  ADQVMMS  248
             D +M S
Sbjct  580  IDNMMSS  586


 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 86/172 (50%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD   +++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFSDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KHN32028.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Glycine soja]
Length=521

 Score =   350 bits (899),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGV FFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  334  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVSFFDDKLGALCMQWLKDKVYSIRDAAANN  393

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQHIIPQVL+M+ DPHYLYRMTIL ++SLLAPV+GSEI+ +KLLP++
Sbjct  394  IKRLAEEFGPDWAMQHIIPQVLDMVTDPHYLYRMTILQSISLLAPVLGSEISSSKLLPLV  453

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD SVVE TIRPCLVELSEDPDVDVRFFA+QALQ+
Sbjct  454  INASKDRVPNIKFNVAKVLQSLIPIVDQSVVESTIRPCLVELSEDPDVDVRFFASQALQS  513

Query  268  ADQVMMSS  245
             DQV MSS
Sbjct  514  CDQVKMSS  521


 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  178  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDPTRSELVPAYVRLLRDNEAEVRIAAAGK  237

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V + +    P+ A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  238  VTKFSRILNPDLAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  297

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  298  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  349


 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 79/166 (48%), Gaps = 0/166 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  256  PCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  315

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  316  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVSFFDDKLGALC  375

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDP  311
            +   KD+V +I+   A  ++ L          + I P ++++  DP
Sbjct  376  MQWLKDKVYSIRDAAANNIKRLAEEFGPDWAMQHIIPQVLDMVTDP  421



>ref|XP_008393303.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Malus domestica]
Length=587

 Score =   353 bits (905),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGV FFDDKLG+LCMQWL DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVEFFDDKLGSLCMQWLNDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGPEWAMQHI+PQVLEMI++PHYLYRMTILHA+SLLAPV+GSE+TC++L+PVI
Sbjct  460  VKRLAEEFGPEWAMQHIVPQVLEMISNPHYLYRMTILHAISLLAPVLGSELTCSRLVPVI  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TASKDRVPNIKFNVAKVLQS+IPIVD SVVEKTI PCL+ELSEDPDVDVR FA+QALQ+
Sbjct  520  VTASKDRVPNIKFNVAKVLQSIIPIVDQSVVEKTIXPCLLELSEDPDVDVRSFASQALQS  579

Query  268  ADQVMMS  248
            ++QVMMS
Sbjct  580  SEQVMMS  586


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 85/172 (49%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEATRSDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+Q I+P V E+  D     R  +   +  +A V+G + T  +LLP+ 
Sbjct  304  VTKFCRIVNPELAIQQILPFVKELSTDSSQHVRSALASVIMGMAQVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNEVIGIDMLSQSLLPAIVELAEDRHWRVRL  415


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 41/166 (25%), Positives = 79/166 (48%), Gaps = 0/166 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  322  PFVKELSTDSSQHVRSALASVIMGMAQVLGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ E  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G E   +KL  + 
Sbjct  382  LDQVNEVIGIDMLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVEFFDDKLGSLC  441

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDP  311
            +    D+V +I+   A  ++ L          + I P ++E+  +P
Sbjct  442  MQWLNDKVYSIRDAAANNVKRLAEEFGPEWAMQHIVPQVLEMISNP  487



>ref|XP_007142892.1| hypothetical protein PHAVU_007G0258001g, partial [Phaseolus vulgaris]
 gb|ESW14886.1| hypothetical protein PHAVU_007G0258001g, partial [Phaseolus vulgaris]
Length=545

 Score =   351 bits (901),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  358  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANN  417

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVL+M ++PHYLYRMTIL A+SLLAPVMG EITC+ LLPV+
Sbjct  418  LKRLAEEFGPEWAMQHIIPQVLDMSSNPHYLYRMTILRAISLLAPVMGPEITCSNLLPVV  477

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TASKDRVPNIKFNVAKVL+S+ PIVD SVVEKTIRPCLVELSEDPDVDVRFF+NQALQA
Sbjct  478  VTASKDRVPNIKFNVAKVLESIFPIVDQSVVEKTIRPCLVELSEDPDVDVRFFSNQALQA  537

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  538  IDHVMMSS  545


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  202  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGK  261

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G E T  +LLP+ 
Sbjct  262  VTKFCRILNPDLSIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLPIF  321

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  322  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  373


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 80/166 (48%), Gaps = 0/166 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  280  PCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLPIFLSLLKDEFPDVRLNIISK  339

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  340  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  399

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDP  311
            +   +D+V +I+   A  L+ L          + I P ++++S +P
Sbjct  400  MQWLQDKVHSIREAAANNLKRLAEEFGPEWAMQHIIPQVLDMSSNP  445



>gb|EYU40874.1| hypothetical protein MIMGU_mgv1a003588mg [Erythranthe guttata]
Length=576

 Score =   352 bits (903),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  389  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  448

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVL+M+N+PHYLYRMT+L A+SLLAPVMGSEITC+KLLPVI
Sbjct  449  LKRLAEEFGPEWAMQHIVPQVLDMVNNPHYLYRMTVLQAISLLAPVMGSEITCSKLLPVI  508

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TASKDRVPNIKFNVAKVLQS+IPIVD SVVE +IRP LVELSED DVDVRFFANQALQ+
Sbjct  509  VTASKDRVPNIKFNVAKVLQSMIPIVDQSVVETSIRPSLVELSEDADVDVRFFANQALQS  568

Query  268  ADQVMMSS  245
             D  MMS+
Sbjct  569  IDHSMMST  576


 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  233  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  292

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V + +    PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  293  VTKFSRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  352

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  353  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  404


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 86/187 (46%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  311  PCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  370

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  371  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  430

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +   +D+V +I+   A  L+ L          + I P ++++  +P    R    QA+  
Sbjct  431  MQWLQDKVYSIRDAAANNLKRLAEEFGPEWAMQHIVPQVLDMVNNPHYLYRMTVLQAISL  490

Query  268  ADQVMMS  248
               VM S
Sbjct  491  LAPVMGS  497



>ref|XP_006660451.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Oryza brachyantha]
Length=587

 Score =   352 bits (904),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC +LLPV+
Sbjct  460  LKRLAEEFGPDWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQQLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQ+LIPI+D SVVEK ++PCLVELSEDPDVDVR++ANQALQA
Sbjct  520  INSSKDRVPNIKFNVAKVLQALIPILDQSVVEKNVKPCLVELSEDPDVDVRYYANQALQA  579

Query  268  ADQVMMSS  245
             DQ+MMSS
Sbjct  580  CDQIMMSS  587


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L    G     + L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAAGPEHSREHLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010044277.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Eucalyptus grandis]
 ref|XP_010044278.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Eucalyptus grandis]
 gb|KCW86343.1| hypothetical protein EUGRSUZ_B03031 [Eucalyptus grandis]
Length=587

 Score =   352 bits (903),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG+LCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGSLCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQHIIPQ LEMI++PHYLYRMTIL A+SLLAPV+G +ITC+KLLP +
Sbjct  460  LKRLAEEFGPDWAMQHIIPQTLEMISNPHYLYRMTILRAISLLAPVLGPDITCSKLLPAV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAKVLQSL+PIVD S VEK IRPCLVELSEDPDVDVRFFANQALQA
Sbjct  520  VNASKDRVPNIKFNVAKVLQSLMPIVDQSTVEKMIRPCLVELSEDPDVDVRFFANQALQA  579

Query  268  ADQVMMSS  245
             DQVMM+S
Sbjct  580  IDQVMMTS  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE ++ HI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELSILHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_004238945.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Solanum lycopersicum]
Length=587

 Score =   352 bits (903),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLG+GFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGIGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVL+M   PHYLYRMTIL ++SLLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLDMTTSPHYLYRMTILRSISLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TA+KDRVPNIKFNVAKVLQSL+PIVD+SVVEKTIRP LVEL+EDPDVDVRF+ANQALQ+
Sbjct  520  VTATKDRVPNIKFNVAKVLQSLVPIVDNSVVEKTIRPSLVELAEDPDVDVRFYANQALQS  579

Query  268  ADQVMMSS  245
             D VMMS 
Sbjct  580  IDNVMMSG  587


 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KGN52064.1| hypothetical protein Csa_5G608520 [Cucumis sativus]
Length=796

 Score =   358 bits (918),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  609  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  668

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVL+MIN+PHYLYRMT+L AVSLLAPVMGSEITC KLLPV+
Sbjct  669  LKRLAEEFGPEWAMQHIVPQVLDMINNPHYLYRMTVLRAVSLLAPVMGSEITCTKLLPVV  728

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I++SKDRVPNIKFNVAKVLQSLIPIVD  VVEKTIRP LVELSEDPDVDVRFFANQALQ+
Sbjct  729  ISSSKDRVPNIKFNVAKVLQSLIPIVDQPVVEKTIRPSLVELSEDPDVDVRFFANQALQS  788

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  789  IDHVMMSS  796


 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  453  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  512

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  513  VTKFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  572

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  573  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  624



>ref|XP_003577085.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform X1 [Brachypodium distachyon]
Length=587

 Score =   352 bits (903),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQ+IIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLP++
Sbjct  460  LKRLAEEFGPDWAMQYIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPIV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQSL+PI+D SV EKT++PCLVELSEDPDVDVR++ANQALQA
Sbjct  520  INSSKDRVPNIKFNVAKVLQSLVPIIDQSVAEKTVKPCLVELSEDPDVDVRYYANQALQA  579

Query  268  ADQVMMSS  245
             DQ+MMSS
Sbjct  580  CDQIMMSS  587


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVSFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_007153361.1| hypothetical protein PHAVU_003G029000g [Phaseolus vulgaris]
 ref|XP_007153362.1| hypothetical protein PHAVU_003G029000g [Phaseolus vulgaris]
 gb|ESW25355.1| hypothetical protein PHAVU_003G029000g [Phaseolus vulgaris]
 gb|ESW25356.1| hypothetical protein PHAVU_003G029000g [Phaseolus vulgaris]
Length=587

 Score =   352 bits (902),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQV++MI +PHYLYRMTILH++SLLAPVMG EITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVVDMITNPHYLYRMTILHSISLLAPVMGPEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAKVL+S+ PIVD SVVEK+IRP LVELSEDPDVDVRFF+NQALQA
Sbjct  520  ITASKDRVPNIKFNVAKVLESIFPIVDQSVVEKSIRPSLVELSEDPDVDVRFFSNQALQA  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDHVMMSS  587


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPSYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPDLSIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>emb|CDY13586.1| BnaA06g33370D [Brassica napus]
Length=595

 Score =   352 bits (902),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 183/196 (93%), Gaps = 8/196 (4%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV+
Sbjct  460  VKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKD--------RVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            +TA+KD        RVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRF
Sbjct  520  MTAAKDRQIIFYYHRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPGLVELSEDPDVDVRF  579

Query  292  FANQALQAADQVMMSS  245
            FAN+ALQ+ D VMMSS
Sbjct  580  FANEALQSIDNVMMSS  595


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006362557.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Solanum tuberosum]
Length=587

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLG+GFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGIGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVL+M   PHYLYRMTIL ++SLLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLDMTTSPHYLYRMTILRSISLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +TA+KDRVPNIKFNVAKVLQSLIPIVD+SVVEKTIRP LVEL+EDPDVDVRF+ANQALQ+
Sbjct  520  VTATKDRVPNIKFNVAKVLQSLIPIVDNSVVEKTIRPSLVELAEDPDVDVRFYANQALQS  579

Query  268  ADQVMMSS  245
             D  MMS 
Sbjct  580  IDNAMMSG  587


 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_003534171.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Glycine max]
Length=587

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGV FFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVSFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQHIIPQVL+M+ DPHYLYRMTIL ++SLLAPV+GSEI+ +KLLP++
Sbjct  460  IKRLAEEFGPDWAMQHIIPQVLDMVTDPHYLYRMTILQSISLLAPVLGSEISSSKLLPLV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLIPIVD SVVE TIRPCLVELSEDPDVDVRFFA+QALQ+
Sbjct  520  INASKDRVPNIKFNVAKVLQSLIPIVDQSVVESTIRPCLVELSEDPDVDVRFFASQALQS  579

Query  268  ADQVMMSS  245
             DQV MSS
Sbjct  580  CDQVKMSS  587


 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDPTRSELVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V + +    P+ A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFSRILNPDLAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 79/166 (48%), Gaps = 0/166 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVSFFDDKLGALC  441

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDP  311
            +   KD+V +I+   A  ++ L          + I P ++++  DP
Sbjct  442  MQWLKDKVYSIRDAAANNIKRLAEEFGPDWAMQHIIPQVLDMVTDP  487



>ref|XP_008797605.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Phoenix dactylifera]
Length=587

 Score =   350 bits (899),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVL+ IN+PHYLYRMTILHA+SLLAPVMG++ITC KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLDKINNPHYLYRMTILHAISLLAPVMGADITCQKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQSL+P +  SVVE TIRPCLVELSEDPDVDVR+FA+QALQA
Sbjct  520  IASSKDRVPNIKFNVAKVLQSLVPTLGQSVVEGTIRPCLVELSEDPDVDVRYFASQALQA  579

Query  268  ADQVMMSS  245
             DQVMM S
Sbjct  580  CDQVMMPS  587


 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010677978.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Beta vulgaris subsp. vulgaris]
Length=587

 Score =   350 bits (899),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLNDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHIIPQVLEM  +PHYLYRMTIL A+SLL PVMG+EITC+KLLPV+
Sbjct  460  VKRLAEEFGPDWAMQHIIPQVLEMATNPHYLYRMTILQAISLLGPVMGAEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRV NIKFNVAKVLQSLIPIVD SVVEKTIRPCL+ELSEDPDVDVRFFA QAL+ 
Sbjct  520  VDASKDRVANIKFNVAKVLQSLIPIVDQSVVEKTIRPCLIELSEDPDVDVRFFATQALKL  579

Query  268  ADQVMMSS  245
             DQ  MSS
Sbjct  580  TDQAAMSS  587


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTKTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ 
Sbjct  304  VTKFCCILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDEVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010929062.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Elaeis guineensis]
Length=587

 Score =   350 bits (899),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG LCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGTLCMQWLEDKVFSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVL+ I++PHYLYRMTIL A+SLLAPV+G +ITC KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLDKISNPHYLYRMTILQAISLLAPVLGVDITCQKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQSL+PI+D SVVE TIRPCL+ELSEDPDVDVR+FANQALQA
Sbjct  520  IASSKDRVPNIKFNVAKVLQSLVPILDQSVVENTIRPCLIELSEDPDVDVRYFANQALQA  579

Query  268  ADQVMMSS  245
            +DQVMMSS
Sbjct  580  SDQVMMSS  587


 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRVDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +     GP+  +QHI+P V E+ +D     R  +   +  +APV+G + T ++LLP+ 
Sbjct  304  VTKFCRILGPQLPIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIDQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 70/142 (49%), Gaps = 0/142 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     D+L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIDQLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGTLC  441

Query  448  ITASKDRVPNIKFNVAKVLQSL  383
            +   +D+V +I+   A  L+ L
Sbjct  442  MQWLEDKVFSIRDAAANNLKRL  463



>ref|XP_003536691.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Glycine max]
 ref|XP_006589702.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Glycine max]
 gb|KHN05580.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Glycine soja]
Length=585

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGV FFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  398  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVSFFDDKLGALCMQWLQDKVHSIREAAANN  457

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLEM N+PHYLYRMTIL A+SLLAPVMG EITC+ LLPV+
Sbjct  458  LKRLAEEFGPEWAMQHIIPQVLEMNNNPHYLYRMTILRAISLLAPVMGPEITCSNLLPVV  517

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAKVL+S+ PIVD SVVEKTIRPCLVELSEDPDVDVRFF+NQALQA
Sbjct  518  VAASKDRVPNIKFNVAKVLESIFPIVDQSVVEKTIRPCLVELSEDPDVDVRFFSNQALQA  577

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  578  IDHVMMSS  585


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  242  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGK  301

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ ++QHI+  V E+ +D     R  +   +  +APV+G E T  +LLP+ 
Sbjct  302  VTKFCRILNPDLSIQHILSCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLPIF  361

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  362  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  413



>gb|EPS62738.1| hypothetical protein M569_12049 [Genlisea aurea]
Length=587

 Score =   349 bits (895),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVL+MI++PHYLYRMT+L A+SLLAPVMG EITC+KLLPVI
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLDMISNPHYLYRMTVLQAISLLAPVMGPEITCSKLLPVI  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + +SKDRVPNIKFNVAKVLQS+I IVD SVVEKTIRP LV+L+EDPDVDVRFFANQALQ+
Sbjct  520  VNSSKDRVPNIKFNVAKVLQSIITIVDQSVVEKTIRPTLVDLAEDPDVDVRFFANQALQS  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDSVMMSS  587


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KJB23731.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
Length=600

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVL+MIN+PHYL+RMTILH++SLLAPVMGS+ITC+KLLPV+
Sbjct  460  VKRLAEEFGPDWAMQHIVPQVLDMINNPHYLHRMTILHSISLLAPVMGSDITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLI IVD SVVEK IRPCLVELSEDPDVDVRFFA+QAL++
Sbjct  520  INASKDRVPNIKFNVAKVLQSLILIVDQSVVEKKIRPCLVELSEDPDVDVRFFASQALES  579

Query  268  ADQVMM  251
            ++Q  M
Sbjct  580  SNQKKM  585


 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 86/172 (50%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  +   +G       L    +  L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYEVCEAVGPEPTRSDLVPAYVCLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_009396282.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Musa acuminata subsp. malaccensis]
Length=587

 Score =   347 bits (890),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAA N
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIREAAATN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+P+VLE IN+PHYLYRMT+L A+SLLAPVMG++ITC KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIVPEVLEKINNPHYLYRMTVLRAISLLAPVMGADITCQKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQSLI ++D SVV+KTIRPCLVELSEDPDVDVR+FA QALQA
Sbjct  520  IASSKDRVPNIKFNVAKVLQSLISVLDQSVVDKTIRPCLVELSEDPDVDVRYFAGQALQA  579

Query  268  ADQVMMSS  245
             DQVMMSS
Sbjct  580  CDQVMMSS  587


 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEATRADLMPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+  D     R  +   +  +AP++G + T  +LLP+ 
Sbjct  304  VTKFCRILSPQLAIQHILPCVKELSTDSSQHVRSALASVIMGMAPILGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KJB23730.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
Length=600

 Score =   347 bits (891),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVL+MIN+PHYL+RMTILH++SLLAPVMGS+ITC+KLLPV+
Sbjct  460  VKRLAEEFGPDWAMQHIVPQVLDMINNPHYLHRMTILHSISLLAPVMGSDITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFNVAKVLQSLI IVD SV+EK IRPCLVELSEDPDVDVRFFA+QAL++
Sbjct  520  INASKDRVPNIKFNVAKVLQSLILIVDQSVMEKKIRPCLVELSEDPDVDVRFFASQALES  579

Query  268  ADQVMM  251
            ++Q  M
Sbjct  580  SNQKKM  585


 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 86/172 (50%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  +   +G       L    +  L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYEVCEAVGPEPTRSDLVPAYVCLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KHN27183.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Glycine soja]
Length=587

 Score =   347 bits (889),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFF DKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFYDKLGALCMQWLQDKVHSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLEMI++PHYLYRMTILHA+SLLAPVMGSEIT ++LLP++
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEMISNPHYLYRMTILHAISLLAPVMGSEITRSELLPIV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAKVL+S+ PIVD SVVEKTIRP LVELSEDPDVDVRFF+NQAL A
Sbjct  520  ITASKDRVPNIKFNVAKVLESIFPIVDQSVVEKTIRPSLVELSEDPDVDVRFFSNQALHA  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  MDHVMMSS  587


 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ ++QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPDLSIQHILPCVKELSTDSLQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++  +++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGINLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_003518674.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Glycine max]
Length=587

 Score =   347 bits (889),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFF DKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFYDKLGALCMQWLQDKVHSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLEMI++PHYLYRMTILHA+SLLAPVMGSEIT ++LLP++
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEMISNPHYLYRMTILHAISLLAPVMGSEITRSELLPIV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAKVL+S+ PIVD SVVEKTIRP LVELSEDPDVDVRFF+NQAL A
Sbjct  520  ITASKDRVPNIKFNVAKVLESIFPIVDQSVVEKTIRPSLVELSEDPDVDVRFFSNQALHA  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  MDHVMMSS  587


 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ ++QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPDLSIQHILPCVKELSTDSLQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++  +++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGINLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_003555890.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Glycine max]
 gb|KHN11434.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Glycine soja]
Length=585

 Score =   347 bits (889),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGV FFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  398  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVRFFDDKLGALCMQWLQDKVHSIREAAANN  457

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLEM N+PHYLYRMTIL A+SLLAPVMG EITC+ LLPV+
Sbjct  458  LKRLAEEFGPEWAMQHIIPQVLEMNNNPHYLYRMTILRAISLLAPVMGPEITCSNLLPVV  517

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAKVL+S+ PIVD SVVEKTIRPCLVELSEDPDVDVRFF+NQALQA
Sbjct  518  LAASKDRVPNIKFNVAKVLESIFPIVDQSVVEKTIRPCLVELSEDPDVDVRFFSNQALQA  577

Query  268  ADQVMMS  248
             D VMMS
Sbjct  578  IDHVMMS  584


 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  242  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGK  301

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G E T  +LLP+ 
Sbjct  302  VTKFCRILNPDLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLPIF  361

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  362  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  413


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 80/166 (48%), Gaps = 0/166 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  320  PCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLPIFLSLLKDEFPDVRLNIISK  379

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  380  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVRFFDDKLGALC  439

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDP  311
            +   +D+V +I+   A  L+ L          + I P ++E++ +P
Sbjct  440  MQWLQDKVHSIREAAANNLKRLAEEFGPEWAMQHIIPQVLEMNNNP  485



>ref|XP_002312385.1| hypothetical protein POPTR_0008s11730g [Populus trichocarpa]
 ref|XP_002311444.2| phosphatase family protein [Populus trichocarpa]
 gb|EEE89752.1| hypothetical protein POPTR_0008s11730g [Populus trichocarpa]
 gb|EEE88811.2| phosphatase family protein [Populus trichocarpa]
Length=586

 Score =   346 bits (888),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFD+KLGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDEKLGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWA+QHIIPQVLEM  +PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAVQHIIPQVLEMSTNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I ASKDRVPNIKFN AKVLQSLIPIVD SVVEKTI PCL EL EDPDVDVRFFANQALQ 
Sbjct  520  INASKDRVPNIKFNAAKVLQSLIPIVDQSVVEKTICPCLFELGEDPDVDVRFFANQALQT  579

Query  268  ADQVMMS  248
               VMMS
Sbjct  580  IASVMMS  586


 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRMDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 46/187 (25%), Positives = 86/187 (46%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G      KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDEKLGALC  441

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +   +D+V +I+   A  L+ L          + I P ++E+S +P    R    +A+  
Sbjct  442  MQWLQDKVYSIRDAAANNLKRLAEEFGPEWAVQHIIPQVLEMSTNPHYLYRMTILRAVSL  501

Query  268  ADQVMMS  248
               VM S
Sbjct  502  LAPVMGS  508



>ref|XP_010036877.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Eucalyptus grandis]
 ref|XP_010036878.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Eucalyptus grandis]
 ref|XP_010036879.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Eucalyptus grandis]
 gb|KCW48540.1| hypothetical protein EUGRSUZ_K02214 [Eucalyptus grandis]
Length=588

 Score =   346 bits (888),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGV FFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  401  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVRFFDDKLGALCMQWLKDKVYSIRDAAANN  460

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V+ LAEEFGPEWAM+H++PQVL+MIN+PHYLYRMT+LH +SLLAPVMGS+ITC+KLLPV+
Sbjct  461  VRCLAEEFGPEWAMEHMVPQVLDMINNPHYLYRMTVLHVISLLAPVMGSDITCSKLLPVV  520

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I++SKDRVPNI+FN AKVLQS+IP+VDHSVVE+ IRPCLVEL+EDPDVDVRFF +QALQ+
Sbjct  521  ISSSKDRVPNIRFNAAKVLQSIIPLVDHSVVERIIRPCLVELNEDPDVDVRFFGSQALQS  580

Query  268  ADQVMMSS  245
            +DQVM+ S
Sbjct  581  SDQVMVMS  588


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P +V  ++D+ WRVR  + + +  L   +G       L    ++ L+D    +R AAA  
Sbjct  245  PVMVNFSQDKSWRVRYMVAQELYELCEAVGPEPTRSDLVPAYVRLLRDNEAEVRIAAAGK  304

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +L     PE A+Q I+P V E+  D     R  +   +  +APV+G + T  +LLP  
Sbjct  305  VTKLCSILNPELAIQQILPCVKELSADSSQHVRSALASVIMGMAPVLGKDATIEQLLPTF  364

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  365  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  416



>ref|XP_009415447.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Musa acuminata subsp. malaccensis]
Length=587

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG+LCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGSLCMQWLEDKVFSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG++ITC KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGADITCQKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I+ SKDRVPNIKFNVAKVLQSL+PIV  S VE TIRPCLVELSEDPDVDVR+FA QALQA
Sbjct  520  ISLSKDRVPNIKFNVAKVLQSLVPIVGQSGVEATIRPCLVELSEDPDVDVRYFAGQALQA  579

Query  268  ADQVMMSS  245
             DQVM+S 
Sbjct  580  CDQVMVSG  587


 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEATRIDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +  +   PE A+QHIIP V E+ +D     R  +   +  +AP++G + T  +LLP+ 
Sbjct  304  VTKFCQILSPELAIQHIIPCVKELSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_004972370.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Setaria italica]
Length=587

 Score =   345 bits (885),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEF PEWAMQ+IIPQVLE IN+PHYLYRMT L A+SLLAPVMG++ITC +LLPV+
Sbjct  460  LKRLAEEFSPEWAMQYIIPQVLEKINNPHYLYRMTTLQAISLLAPVMGADITCQQLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPN+KFNVAKVLQSLIPI+D SVVEKT++PCLVELSEDPDVDVR++ANQALQA
Sbjct  520  IASSKDRVPNMKFNVAKVLQSLIPILDQSVVEKTVKPCLVELSEDPDVDVRYYANQALQA  579

Query  268  ADQVMMSS  245
             DQ++MS+
Sbjct  580  CDQMVMST  587


 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 90/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G     D L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRDDLVQAYVRVLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +  +   PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCKILSPEIAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_004956390.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Setaria italica]
Length=583

 Score =   344 bits (882),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 178/188 (95%), Gaps = 4/188 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPVI
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVI  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQSLIPI+D S    T++PCLVELSEDPDVDVR++ANQALQA
Sbjct  520  INSSKDRVPNIKFNVAKVLQSLIPILDQS----TVKPCLVELSEDPDVDVRYYANQALQA  575

Query  268  ADQVMMSS  245
             DQ+M+SS
Sbjct  576  CDQMMVSS  583


 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KJB80118.1| hypothetical protein B456_013G081300 [Gossypium raimondii]
Length=528

 Score =   342 bits (877),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLA+QLGVGFFDDKLG LCMQWL+DKVYSIRDAAANN
Sbjct  341  PAIVELAEDRHWRVRLAIIEYIPLLANQLGVGFFDDKLGGLCMQWLQDKVYSIRDAAANN  400

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQHIIPQVLE+ ND HYL+RMT+L A+SLL PV+GSEITC+KLLPV+
Sbjct  401  LKRLAEEFGPDWAMQHIIPQVLEIANDSHYLHRMTLLRAISLLGPVLGSEITCSKLLPVV  460

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAKVLQSLI +VD SVVEKTIRPCLVELSEDPDVDVR+FA Q LQ+
Sbjct  461  VNASKDRVPNIKFNVAKVLQSLISVVDQSVVEKTIRPCLVELSEDPDVDVRYFAVQGLQS  520

Query  268  ADQVMMSS  245
             DQV MSS
Sbjct  521  IDQVTMSS  528


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 81/184 (44%), Gaps = 19/184 (10%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPIRTDLLPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIP-------------------QVLEMINDPHYLYRMTILHAVS  506
            V +  +   PE A+QHI+P                    ++E+  D H+  R+ I+  + 
Sbjct  304  VTKFCQILSPELAIQHILPCVKVHTVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIP  363

Query  505  LLAPVMGSEITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVE  326
            LLA  +G     +KL  + +   +D+V +I+   A  L+ L          + I P ++E
Sbjct  364  LLANQLGVGFFDDKLGGLCMQWLQDKVYSIRDAAANNLKRLAEEFGPDWAMQHIIPQVLE  423

Query  325  LSED  314
            ++ D
Sbjct  424  IAND  427



>ref|XP_010237331.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Brachypodium 
distachyon]
Length=583

 Score =   343 bits (881),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 177/188 (94%), Gaps = 4/188 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG EITC KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGVEITCQKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQSL+PI+D S    T++PCLVELSEDPDVDVR++ANQALQA
Sbjct  520  INSSKDRVPNIKFNVAKVLQSLVPIIDQS----TVKPCLVELSEDPDVDVRYYANQALQA  575

Query  268  ADQVMMSS  245
             DQ+MMSS
Sbjct  576  CDQIMMSS  583


 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRVDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPQLAVQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006367043.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Solanum tuberosum]
Length=585

 Score =   343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG LCMQWL+D+VYSIRDAAAN+
Sbjct  398  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGTLCMQWLQDEVYSIRDAAANS  457

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVL++IN+ HYLYRMTIL A+SLLAPVMGSEITC+KLLPV+
Sbjct  458  LKRLAEEFGPEWAMQHIIPQVLDVINNSHYLYRMTILRAISLLAPVMGSEITCSKLLPVV  517

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITA+KDRVPN+KFNVAKVLQSLIP+VD SV EKTIR  L+EL+EDPDVDVRF+A+QALQ+
Sbjct  518  ITAAKDRVPNVKFNVAKVLQSLIPVVDQSVAEKTIRSSLIELAEDPDVDVRFYASQALQS  577

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  578  IDDVMMSS  585


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  242  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPETSRTDLVPAYVRLLRDNEAEVRIAAAGK  301

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
              + ++   PE ++QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  302  TTKFSQILSPELSIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  361

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  362  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  413



>ref|NP_001105839.1| LOC732740 [Zea mays]
 gb|AAY24685.1| protein phosphatase 2A regulatory subunit A [Zea mays]
 gb|AFW75381.1| protein phosphatase 2A regulatory subunit A [Zea mays]
Length=583

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 178/188 (95%), Gaps = 4/188 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQSL+PI+D S    T++PCLVELSEDPDVDVR++ANQALQA
Sbjct  520  INSSKDRVPNIKFNVAKVLQSLVPILDQS----TVKPCLVELSEDPDVDVRYYANQALQA  575

Query  268  ADQVMMSS  245
             DQ+M+SS
Sbjct  576  CDQMMVSS  583


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +L+P+ 
Sbjct  304  VTKFCRILNPQLSVQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLVPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KJB80114.1| hypothetical protein B456_013G081300 [Gossypium raimondii]
 gb|KJB80115.1| hypothetical protein B456_013G081300 [Gossypium raimondii]
 gb|KJB80116.1| hypothetical protein B456_013G081300 [Gossypium raimondii]
Length=587

 Score =   342 bits (878),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLA+QLGVGFFDDKLG LCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLANQLGVGFFDDKLGGLCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQHIIPQVLE+ ND HYL+RMT+L A+SLL PV+GSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPDWAMQHIIPQVLEIANDSHYLHRMTLLRAISLLGPVLGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAKVLQSLI +VD SVVEKTIRPCLVELSEDPDVDVR+FA Q LQ+
Sbjct  520  VNASKDRVPNIKFNVAKVLQSLISVVDQSVVEKTIRPCLVELSEDPDVDVRYFAVQGLQS  579

Query  268  ADQVMMSS  245
             DQV MSS
Sbjct  580  IDQVTMSS  587


 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPIRTDLLPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +  +   PE A+QHI+P V E+  D     R  +   V  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCQILSPELAIQHILPCVKELSLDSSQHVRAALASVVMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KJB80117.1| hypothetical protein B456_013G081300 [Gossypium raimondii]
Length=589

 Score =   342 bits (878),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLA+QLGVGFFDDKLG LCMQWL+DKVYSIRDAAANN
Sbjct  402  PAIVELAEDRHWRVRLAIIEYIPLLANQLGVGFFDDKLGGLCMQWLQDKVYSIRDAAANN  461

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQHIIPQVLE+ ND HYL+RMT+L A+SLL PV+GSEITC+KLLPV+
Sbjct  462  LKRLAEEFGPDWAMQHIIPQVLEIANDSHYLHRMTLLRAISLLGPVLGSEITCSKLLPVV  521

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAKVLQSLI +VD SVVEKTIRPCLVELSEDPDVDVR+FA Q LQ+
Sbjct  522  VNASKDRVPNIKFNVAKVLQSLISVVDQSVVEKTIRPCLVELSEDPDVDVRYFAVQGLQS  581

Query  268  ADQVMMSS  245
             DQV MSS
Sbjct  582  IDQVTMSS  589


 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 88/174 (51%), Gaps = 2/174 (1%)
 Frame = -2

Query  808  PAIVELAE--DRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAA  635
            P IV  ++  D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA
Sbjct  244  PVIVNFSQVYDKSWRVRYMVANQLYELCEAVGPEPIRTDLLPAYVRLLRDNEAEVRIAAA  303

Query  634  NNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLP  455
              V +  +   PE A+QHI+P V E+  D     R  +   V  +APV+G + T  +LLP
Sbjct  304  GKVTKFCQILSPELAIQHILPCVKELSLDSSQHVRAALASVVMGMAPVLGKDATIEQLLP  363

Query  454  VIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            + ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  IFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  417



>ref|XP_002282096.2| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Vitis vinifera]
 ref|XP_010647838.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Vitis vinifera]
Length=587

 Score =   342 bits (878),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLG+ FFDD+LGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGIKFFDDELGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQH+IPQVLEMIN+ HYLYRMT+L A+SLLAP MG+EIT +KLLPV+
Sbjct  460  LKRLAEEFGPDWAMQHLIPQVLEMINNSHYLYRMTVLRAISLLAPAMGAEITYSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I+AS DRVPN+KFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF ANQA+  
Sbjct  520  ISASNDRVPNVKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFSANQAIHV  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  IDHVMMSS  587


 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P I+  ++DR WRVR  + + +  L   +G       L    M+ L+D    +R AAA  
Sbjct  244  PVIISFSQDRSWRVRYMVADQLYELCHAVGPEATRTDLVPAYMRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +  +   PE A+ HI+P V E+  D     R  +   +  +APV+G + T ++LLP+ 
Sbjct  304  VTKFCQILNPELAIHHILPCVKELSLDSSQHVRSALASVLMGMAPVLGKDATIDQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDDFPDVRLNIISKLDQINQVIGTDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KHG15336.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta-like protein [Gossypium arboreum]
Length=587

 Score =   342 bits (877),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLA+QLGVGFFDDKLG LCMQWL+DKVYSIRDAAA N
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLANQLGVGFFDDKLGGLCMQWLQDKVYSIRDAAAKN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQHIIPQVLE+ ND HYL+RMT+L A+SLL PVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPDWAMQHIIPQVLEIANDSHYLHRMTLLRAISLLGPVMGSEITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAKVLQSLI +VD SVVEKTIRPCLVELSEDPDVDVR+FA Q LQ+
Sbjct  520  VNASKDRVPNIKFNVAKVLQSLISVVDQSVVEKTIRPCLVELSEDPDVDVRYFAVQGLQS  579

Query  268  ADQVMMSS  245
             DQV MSS
Sbjct  580  IDQVTMSS  587


 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   LG       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEALGPEPIRTDLLPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +  +   PE A+QHI+P V E+  D     R  +   V  +APV+G + T  +LL + 
Sbjct  304  VTKFCQILSPELAIQHILPCVKELSLDSSQHVRAALASVVMGMAPVLGKDATIEQLLLIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006854054.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Amborella trichopoda]
 gb|ERN15521.1| hypothetical protein AMTR_s00048p00082810 [Amborella trichopoda]
Length=587

 Score =   342 bits (876),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+D+V+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDQVFSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAM HI+PQVLEMIN+ HYL+RMTILHA++LLAPVMGS+ITC KLLPV+
Sbjct  460  LKRLAEEFGPDWAMLHIVPQVLEMINNQHYLHRMTILHAIALLAPVMGSDITCQKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I A+KDRVPNIKFNVAKVLQSLIPI+D SVVE+T+RPCL +LSEDPDVDVRFF+  ALQA
Sbjct  520  INAAKDRVPNIKFNVAKVLQSLIPILDQSVVEQTVRPCLADLSEDPDVDVRFFSGLALQA  579

Query  268  ADQVMMSS  245
             DQVMMSS
Sbjct  580  CDQVMMSS  587


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T ++LLP+ 
Sbjct  304  VTKFCRILNPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIDQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 70/142 (49%), Gaps = 0/142 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     D+L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIDQLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  441

Query  448  ITASKDRVPNIKFNVAKVLQSL  383
            +   +D+V +I+   A  L+ L
Sbjct  442  MQWLQDQVFSIREAAANNLKRL  463



>dbj|BAD94840.1| phosphoprotein phosphatase 2A regulatory subunit A [Arabidopsis 
thaliana]
Length=324

 Score =   333 bits (853),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+AAANN
Sbjct  136  PAIVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAAANN  195

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQH++PQVL+M+N+PHYL+RM +L A+SL+APVMGSEITC+K LPV+
Sbjct  196  LKRLAEEFGPEWAMQHLVPQVLDMVNNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVV  255

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL +
Sbjct  256  VEASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALNS  315

Query  268  AD  263
             D
Sbjct  316  ID  317


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 70/130 (54%), Gaps = 0/130 (0%)
 Frame = -2

Query  682  MQWLKDKVYSIRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSL  503
            ++ L+D    +R AAA  V +      PE A+QHI+P V E+ +D     R  +   +  
Sbjct  22   VRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILPCVKELSSDSSQHVRSALASVIMG  81

Query  502  LAPVMGSEITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVEL  323
            +AP++G + T   LLP+ ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL
Sbjct  82   MAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVEL  141

Query  322  SEDPDVDVRF  293
            +ED    VR 
Sbjct  142  AEDRHWRVRL  151



>ref|XP_010237336.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform X2 [Brachypodium distachyon]
Length=583

 Score =   341 bits (874),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 178/188 (95%), Gaps = 4/188 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQ+IIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLP++
Sbjct  460  LKRLAEEFGPDWAMQYIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPIV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQSL+PI+D S    T++PCLVELSEDPDVDVR++ANQALQA
Sbjct  520  INSSKDRVPNIKFNVAKVLQSLVPIIDQS----TVKPCLVELSEDPDVDVRYYANQALQA  575

Query  268  ADQVMMSS  245
             DQ+MMSS
Sbjct  576  CDQIMMSS  583


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVSFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>emb|CBI27044.3| unnamed protein product [Vitis vinifera]
Length=636

 Score =   342 bits (878),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLG+ FFDD+LGALCMQWL+DKVYSIRDAAANN
Sbjct  449  PAIVELAEDRHWRVRLAIIEYIPLLASQLGIKFFDDELGALCMQWLQDKVYSIRDAAANN  508

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQH+IPQVLEMIN+ HYLYRMT+L A+SLLAP MG+EIT +KLLPV+
Sbjct  509  LKRLAEEFGPDWAMQHLIPQVLEMINNSHYLYRMTVLRAISLLAPAMGAEITYSKLLPVV  568

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I+AS DRVPN+KFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF ANQA+  
Sbjct  569  ISASNDRVPNVKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFSANQAIHV  628

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  629  IDHVMMSS  636


 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P I+  ++DR WRVR  + + +  L   +G       L    M+ L+D    +R AAA  
Sbjct  293  PVIISFSQDRSWRVRYMVADQLYELCHAVGPEATRTDLVPAYMRLLRDNEAEVRIAAAGK  352

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +  +   PE A+ HI+P V E+  D     R  +   +  +APV+G + T ++LLP+ 
Sbjct  353  VTKFCQILNPELAIHHILPCVKELSLDSSQHVRSALASVLMGMAPVLGKDATIDQLLPIF  412

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  413  LSLLKDDFPDVRLNIISKLDQINQVIGTDLLSQSLLPAIVELAEDRHWRVRL  464



>ref|XP_008659344.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X3 [Zea mays]
 gb|AFW86038.1| hypothetical protein ZEAMMB73_179225 [Zea mays]
Length=583

 Score =   340 bits (873),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 178/188 (95%), Gaps = 4/188 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVL+SL+PI+D S    T++PCLVELSEDPDVDVR++ANQALQA
Sbjct  520  INSSKDRVPNIKFNVAKVLKSLVPILDQS----TVKPCLVELSEDPDVDVRYYANQALQA  575

Query  268  ADQVMMSS  245
             DQ+M+SS
Sbjct  576  CDQMMVSS  583


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPQLSIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATMEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++    + +T+ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDFLSQTLLPAIVELAEDRHWRVRL  415



>ref|XP_009396657.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Musa acuminata subsp. malaccensis]
Length=992

 Score =   350 bits (899),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG+LCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGSLCMQWLEDKVFSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K LAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SL+APVMG++ITC KLLPV+
Sbjct  460  LKLLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLIAPVMGADITCQKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I  SKDRVPNIKFNVAKVLQ LIPIVD SVVEKTIRPCLVEL EDPDVDVR+FA QALQA
Sbjct  520  IAFSKDRVPNIKFNVAKVLQLLIPIVDQSVVEKTIRPCLVELGEDPDVDVRYFAGQALQA  579

Query  268  ADQVMMSS  245
             DQVMMSS
Sbjct  580  CDQVMMSS  587


 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +      L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQFYELCEAVGPEATRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V ++ +D     R  +   +  +AP++G + T  +LLP+ 
Sbjct  304  VTKFCHISSPQLAVQHILPCVKDLSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_009391301.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Musa acuminata subsp. malaccensis]
 ref|XP_009391302.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Musa acuminata subsp. malaccensis]
Length=587

 Score =   340 bits (872),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQ GVGFF+DKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQFGVGFFNDKLGALCMQWLEDKVFSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQ+I+PQ+LE I++PHYL+RMTIL ++SLLAPV+GSE TC KLLPVI
Sbjct  460  LKRLAEEFGPEWAMQNIVPQLLEKISNPHYLHRMTILQSISLLAPVLGSESTCQKLLPVI  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDRVPNIKFNVAKVLQSLIPI DHSVVE+ +RPCLVELSEDPDVDVR+FA+QA+Q 
Sbjct  520  ITASKDRVPNIKFNVAKVLQSLIPIFDHSVVEQAVRPCLVELSEDPDVDVRYFASQAIQT  579

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  580  CDSVMMSS  587


 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTCSDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P  A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPHLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEELLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010551283.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Tarenaya hassleriana]
 ref|XP_010551284.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Tarenaya hassleriana]
Length=587

 Score =   340 bits (872),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEM+ + HYL+RM +L A+SL+APV+GS+ITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMVANSHYLHRMMVLRAISLMAPVLGSDITCSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAK+LQSLIPIVD SVVEKTIRPCLV+LSEDPDVDVRFFANQAL +
Sbjct  520  VDASKDRVPNIKFNVAKLLQSLIPIVDQSVVEKTIRPCLVDLSEDPDVDVRFFANQALHS  579

Query  268  ADQVMMSS  245
             D   M S
Sbjct  580  IDTTTMES  587


 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P I++ ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIIDFSQDKSWRVRYMVANQLYELCEAVGPDSTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE ++QHI+P V E+  D     R  +   +  +AP++G + T   LLP+ 
Sbjct  304  VTKFCRLLSPEISIQHILPCVKELSTDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 78/181 (43%), Gaps = 0/181 (0%)
 Frame = -2

Query  796  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  617
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDDQDSVRLLAVEGCASLGKLLEPNDCVARILPVIIDFSQDKSWRVRYMVANQLYEL  268

Query  616  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  437
             E  GP+     ++P  + ++ D     R+     V+    ++  EI+   +LP +   S
Sbjct  269  CEAVGPDSTRTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLSPEISIQHILPCVKELS  328

Query  436  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  257
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  TDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  256  M  254
            +
Sbjct  389  I  389



>ref|XP_006660452.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Oryza brachyantha]
Length=583

 Score =   340 bits (871),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 177/188 (94%), Gaps = 4/188 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC +LLPV+
Sbjct  460  LKRLAEEFGPDWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQQLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQ+LIPI+D S     ++PCLVELSEDPDVDVR++ANQALQA
Sbjct  520  INSSKDRVPNIKFNVAKVLQALIPILDQS----NVKPCLVELSEDPDVDVRYYANQALQA  575

Query  268  ADQVMMSS  245
             DQ+MMSS
Sbjct  576  CDQIMMSS  583


 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L    G     + L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAAGPEHSREHLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|NP_001150156.1| LOC100283785 [Zea mays]
 gb|ACG38064.1| serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
Abeta isoform [Zea mays]
 gb|ACR36218.1| unknown [Zea mays]
 gb|AFW87186.1| Serine/threonine-protein phosphatase regulatory subunit Abeta 
isoform [Zea mays]
Length=587

 Score =   339 bits (870),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVEL+EDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDA ANN
Sbjct  400  PAIVELSEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAGANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRL EEFGPEWAMQHIIPQVLE IN+PHYLYRMT L A+SLLAPVMG +ITC +LLPV+
Sbjct  460  LKRLTEEFGPEWAMQHIIPQVLEKINNPHYLYRMTTLQAISLLAPVMGPDITCQQLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPN+KFNVAKVLQSL+PI+D SVVEKT++PCLVELSEDPDVDVR++A+QAL+A
Sbjct  520  IASSKDRVPNMKFNVAKVLQSLVPILDQSVVEKTVKPCLVELSEDPDVDVRYYAHQALRA  579

Query  268  ADQVMMSS  245
             DQ+++SS
Sbjct  580  CDQMVISS  587


 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L +  ++ L D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGTEPTRGDLVSAYVRLLCDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +  +   P+ A++HI+P + E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCKILNPQIAIEHILPCIKELSSDSSQHVRSALASVIMGMAPVLGKDATLEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VELSED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELSEDRHWRVRL  415



>ref|XP_008783038.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Phoenix dactylifera]
 ref|XP_008783039.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Phoenix dactylifera]
 ref|XP_008783040.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Phoenix dactylifera]
Length=587

 Score =   338 bits (867),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAI+ELAEDRHWRVRLAIIEYIPLLASQLGVGFFD+KLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIMELAEDRHWRVRLAIIEYIPLLASQLGVGFFDEKLGALCMQWLEDKVFSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K LAEEFGPEWAMQHIIPQV + I++PHYLYRMTILHA+SLLA VMG +ITC KLLPV+
Sbjct  460  LKHLAEEFGPEWAMQHIIPQVPDKISNPHYLYRMTILHAISLLAHVMGIDITCQKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I +SKDRVPNIKFNVAKVLQSL+PI+D SVVE  IRPCLVELSEDPDVDVR+FANQALQA
Sbjct  520  IASSKDRVPNIKFNVAKVLQSLVPILDQSVVENMIRPCLVELSEDPDVDVRYFANQALQA  579

Query  268  ADQVMMSS  245
             DQVM+SS
Sbjct  580  CDQVMVSS  587


 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 86/172 (50%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  + D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSRDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+  +QHI+P + E+ +D     R  +   +  +AP++G + T  +LLP+ 
Sbjct  304  VTKFCRILNPQLPIQHILPCLKELSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P ++EL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQINQVIGIDLLSQSLLPAIMELAEDRHWRVRL  415



>gb|AAG09551.1|AC011810_10 Putative protein phosphotase 2a 65kd regulatory subunit [Arabidopsis 
thaliana]
Length=591

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 177/192 (92%), Gaps = 4/192 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFD+KLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDEKLGALCMQWLQDKVHSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAL  519

Query  448  IT----ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQ  281
                  +S  RVPNIKFNVAK++QSLIPIVD +VVE  IRPCLVELSEDPDVDVR+FANQ
Sbjct  520  TKRTTLSSSFRVPNIKFNVAKMMQSLIPIVDQAVVENMIRPCLVELSEDPDVDVRYFANQ  579

Query  280  ALQAADQVMMSS  245
            ALQ+ D VMMSS
Sbjct  580  ALQSIDNVMMSS  591


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 85/172 (49%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L     + L D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYARLLCDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006415878.1| hypothetical protein EUTSA_v10007162mg [Eutrema salsugineum]
 dbj|BAJ33743.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ34231.1| hypothetical protein EUTSA_v10007162mg [Eutrema salsugineum]
Length=588

 Score =   336 bits (862),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQH++PQVL+M+N+PHYL+RM +L A+SL+APVMGSEITC+K LPV+
Sbjct  460  LKRLAEEFGPEWAMQHLVPQVLDMVNNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLVELSEDPDVDVR+FANQAL +
Sbjct  520  VEASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVELSEDPDVDVRYFANQALHS  579

Query  268  ADQVMMS  248
             D   +S
Sbjct  580  IDGAAVS  586


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDCTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ 
Sbjct  304  VTKFCRLLNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 77/181 (43%), Gaps = 0/181 (0%)
 Frame = -2

Query  796  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  617
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  616  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  437
             E  GP+     ++P  + ++ D     R+     V+    ++  E+    +LP +   S
Sbjct  269  CEAVGPDCTRTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILPCVKELS  328

Query  436  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  257
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  256  M  254
            +
Sbjct  389  I  389



>ref|XP_010460344.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Camelina sativa]
Length=588

 Score =   334 bits (856),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQH++PQVL+M+N+PHYL+RM +L A+SL+APVMGSEITC+K LPV+
Sbjct  460  LKRLAEEFGPEWAMQHLVPQVLDMVNNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL +
Sbjct  520  VEASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALNS  579

Query  268  AD  263
             D
Sbjct  580  ID  581


 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ 
Sbjct  304  VTKFCRLLNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 77/181 (43%), Gaps = 0/181 (0%)
 Frame = -2

Query  796  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  617
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  616  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  437
             E  GP+     ++P  + ++ D     R+     V+    ++  E+    +LP +   S
Sbjct  269  CEAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILPCVKELS  328

Query  436  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  257
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  256  M  254
            +
Sbjct  389  I  389



>ref|XP_010499103.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Camelina sativa]
Length=588

 Score =   333 bits (855),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQH++PQVL+M+N+PHYL+RM +L A+SL+APVMGSEITC+K LPV+
Sbjct  460  LKRLAEEFGPEWAMQHLVPQVLDMVNNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL +
Sbjct  520  VEASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALNS  579

Query  268  AD  263
             D
Sbjct  580  ID  581


 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ 
Sbjct  304  VTKFCRLLNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 77/181 (43%), Gaps = 0/181 (0%)
 Frame = -2

Query  796  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  617
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  616  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  437
             E  GP+     ++P  + ++ D     R+     V+    ++  E+    +LP +   S
Sbjct  269  CEAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILPCVKELS  328

Query  436  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  257
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  256  M  254
            +
Sbjct  389  I  389



>ref|XP_010477897.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Camelina sativa]
Length=588

 Score =   333 bits (855),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQH++PQVL+M+N+PHYL+RM +L A+SL+APVMGSEITC+K LPV+
Sbjct  460  LKRLAEEFGPEWAMQHLVPQVLDMVNNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL +
Sbjct  520  VEASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALNS  579

Query  268  AD  263
             D
Sbjct  580  ID  581


 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ 
Sbjct  304  VTKFCRLLNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 77/181 (43%), Gaps = 0/181 (0%)
 Frame = -2

Query  796  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  617
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  616  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  437
             E  GP+     ++P  + ++ D     R+     V+    ++  E+    +LP +   S
Sbjct  269  CEAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILPCVKELS  328

Query  436  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  257
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  256  M  254
            +
Sbjct  389  I  389



>gb|AFW75382.1| hypothetical protein ZEAMMB73_324274 [Zea mays]
Length=623

 Score =   335 bits (858),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 181/224 (81%), Gaps = 36/224 (16%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDH--------------------------------  365
            I +SKDRVPNIKFNVAKVLQSL+PI+D                                 
Sbjct  520  INSSKDRVPNIKFNVAKVLQSLVPILDQSVSSSSYSAHMLPTFSKKAVHLYFSWYWGISS  579

Query  364  ----SVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQVMMSS  245
                 VVEKT++PCLVELSEDPDVDVR++ANQALQA DQ+M+SS
Sbjct  580  VLTPQVVEKTVKPCLVELSEDPDVDVRYYANQALQACDQMMVSS  623


 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +L+P+ 
Sbjct  304  VTKFCRILNPQLSVQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLVPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_002893420.1| serine/threonine protein phosphatase type 2A regulatory subunit 
A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69679.1| serine/threonine protein phosphatase type 2A regulatory subunit 
A [Arabidopsis lyrata subsp. lyrata]
Length=588

 Score =   333 bits (855),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQH++PQVL+M+N+PHYL+RM +L A+SL+APVMGSEITC+K LPV+
Sbjct  460  LKRLAEEFGPEWAMQHLVPQVLDMVNNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL +
Sbjct  520  VEASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALNS  579

Query  268  AD  263
             D
Sbjct  580  ID  581


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDCTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ 
Sbjct  304  VTKFCRLLNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 77/181 (43%), Gaps = 0/181 (0%)
 Frame = -2

Query  796  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  617
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  616  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  437
             E  GP+     ++P  + ++ D     R+     V+    ++  E+    +LP +   S
Sbjct  269  CEAVGPDCTRTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILPCVKELS  328

Query  436  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  257
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  256  M  254
            +
Sbjct  389  I  389



>emb|CDY24397.1| BnaCnng04640D [Brassica napus]
Length=413

 Score =   328 bits (840),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQW++DKVYSIR+AAANN
Sbjct  225  PAIVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWMQDKVYSIREAAANN  284

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFG EWAMQHI+PQVL+M+N+PHYL+RM  L A+SL+APVMGSEITC+K L V+
Sbjct  285  LKRLAEEFGSEWAMQHIVPQVLDMVNNPHYLHRMMALRAISLMAPVMGSEITCSKFLSVV  344

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + A+KDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL++
Sbjct  345  VEAAKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALRS  404

Query  268  AD  263
             D
Sbjct  405  ID  406


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 81/170 (48%), Gaps = 0/170 (0%)
 Frame = -2

Query  802  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  623
            IV  ++D+ WRVR  +   +  L   +G       L     + L+D    +R AAA  V 
Sbjct  71   IVNFSQDKSWRVRYMVANQLYELCEAVGPDCTKTDLVPAYERLLRDNEAEVRIAAAGKVT  130

Query  622  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  443
            + ++    E A+QHI+  V E+  D        +   +  +AP++G + T   LL + ++
Sbjct  131  KFSQLLNLELAIQHILSCVKELSTDSSQHVCSALASVIMGMAPILGKDSTIENLLSIFLS  190

Query  442  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
              KD  P++  N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  191  LLKDEFPDVHLNIINKLDQVNQVIGIDLLSESLLPAIVELAEDRHWRVRL  240



>ref|NP_173920.1| serine/threonine-protein phosphatase 2A regulatory subunit A 
alpha isoform [Arabidopsis thaliana]
 sp|Q38845.1|2AAA_ARATH RecName: Full=Serine/threonine-protein phosphatase 2A 65 kDa 
regulatory subunit A alpha isoform; Short=AtA alpha; Short=PP2A, 
subunit A, alpha isoform; Short=PR-65 A; AltName: Full=Protein 
ROOTS CURL IN NAPHTHYLPHTHALAMIC ACID 1; AltName: Full=Protein 
enhancer of ethylene-response 1 [Arabidopsis thaliana]
 gb|AAG50801.1|AC079281_3 phosphoprotein phosphatase 2A, regulatory subunit A [Arabidopsis 
thaliana]
 gb|AAC49255.1| phosphoprotein phosphatase 2A, regulatory subunit A [Arabidopsis 
thaliana]
 gb|AAM53315.1| phosphoprotein phosphatase 2A regulatory subunit A [Arabidopsis 
thaliana]
 gb|AAN15427.1| phosphoprotein phosphatase 2A regulatory subunit A [Arabidopsis 
thaliana]
 gb|AEE30632.1| serine/threonine-protein phosphatase 2A regulatory subunit A 
alpha isoform [Arabidopsis thaliana]
Length=588

 Score =   333 bits (855),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQH++PQVL+M+N+PHYL+RM +L A+SL+APVMGSEITC+K LPV+
Sbjct  460  LKRLAEEFGPEWAMQHLVPQVLDMVNNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL +
Sbjct  520  VEASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALNS  579

Query  268  AD  263
             D
Sbjct  580  ID  581


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDCTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ 
Sbjct  304  VTKFCRLLNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 77/181 (43%), Gaps = 0/181 (0%)
 Frame = -2

Query  796  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  617
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  616  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  437
             E  GP+     ++P  + ++ D     R+     V+    ++  E+    +LP +   S
Sbjct  269  CEAVGPDCTRTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILPCVKELS  328

Query  436  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  257
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  256  M  254
            +
Sbjct  389  I  389



>ref|XP_006307078.1| hypothetical protein CARUB_v10008664mg [Capsella rubella]
 gb|EOA39976.1| hypothetical protein CARUB_v10008664mg [Capsella rubella]
Length=588

 Score =   333 bits (855),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQH++PQVL+M+N+PHYL+RM +L A+SL+APVMGSEITC+K LPV+
Sbjct  460  LKRLAEEFGPEWAMQHLVPQVLDMVNNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL +
Sbjct  520  VEASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALNS  579

Query  268  AD  263
             D
Sbjct  580  ID  581


 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ 
Sbjct  304  VTKFCRLLNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 77/181 (43%), Gaps = 0/181 (0%)
 Frame = -2

Query  796  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  617
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  616  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  437
             E  GP+     ++P  + ++ D     R+     V+    ++  E+    +LP +   S
Sbjct  269  CEAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILPCVKELS  328

Query  436  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  257
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  256  M  254
            +
Sbjct  389  I  389



>ref|XP_001777048.1| predicted protein [Physcomitrella patens]
 gb|EDQ58162.1| predicted protein [Physcomitrella patens]
Length=589

 Score =   333 bits (854),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGV FFDDKLGALCMQWL D+VYSIR+AAANN
Sbjct  403  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVDFFDDKLGALCMQWLGDQVYSIREAAANN  462

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWA+QHIIPQV+E IN+PHYLYRMT+L A+SLLAPV+GSE TC  +LPV+
Sbjct  463  LKRLAEEFGPEWALQHIIPQVMEKINNPHYLYRMTVLVAISLLAPVVGSEATCQTMLPVV  522

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I A+KDRVPNIKFNVAK+LQS+IPIVD +VVE+TIRPCL+EL EDPDVDVRFFA QALQA
Sbjct  523  INAAKDRVPNIKFNVAKMLQSMIPIVDSTVVEQTIRPCLLELQEDPDVDVRFFAGQALQA  582

Query  268  ADQVMMS  248
             DQVM +
Sbjct  583  CDQVMCA  589


 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 85/172 (49%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  247  PVIVSFSQDKSWRVRYMVANQLYELCEAVGQEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  306

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A  HI+P V ++  D     R  +   +  +AP++G E T  +LLP+ 
Sbjct  307  VTKFCGIVSPQVAQLHILPCVKDLSTDSSQHVRAALASVIMGMAPLLGKEATIEQLLPIF  366

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  367  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  418



>ref|XP_004236962.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Solanum lycopersicum]
Length=583

 Score =   333 bits (853),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEY P+LASQLGVGFFDDKLG LCMQWL+D+VYSIRDAAANN
Sbjct  396  PAIVELAEDRHWRVRLAIIEYTPMLASQLGVGFFDDKLGTLCMQWLQDEVYSIRDAAANN  455

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEE GPEWAMQHIIPQVL +IN+ HYLYRM IL A+SLLAPVMGSEITC+KLLPV+
Sbjct  456  LKRLAEELGPEWAMQHIIPQVLGVINNSHYLYRMAILRAISLLAPVMGSEITCSKLLPVV  515

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            IT +KDRVPN+KFNVAKVLQSLIP+VD SV EK IR  LVEL+EDPDVDVRF+A+QALQ+
Sbjct  516  ITVAKDRVPNVKFNVAKVLQSLIPVVDQSVAEKMIRSSLVELAEDPDVDVRFYASQALQS  575

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  576  IDGVMMSS  583


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  240  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPETSRKDLVPSYVRLLRDNEAEVRIAAAGK  299

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
              + ++   PE ++QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  300  ATKFSQILSPELSLQHILPSVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  359

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  360  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  411



>emb|CDY42101.1| BnaA09g28590D [Brassica napus]
Length=589

 Score =   332 bits (850),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+AAANN
Sbjct  401  PAIVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAAANN  460

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFG EWAMQHI+PQVL+M+ +PHYL+RM +L A+SL+APVMGSEITC+K LPV+
Sbjct  461  LKRLAEEFGSEWAMQHIVPQVLDMVTNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVV  520

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPN+KFNVAK+LQSLIPIVD SVVEKTIR CLV+LSEDPDVDVR+FANQAL++
Sbjct  521  VEASKDRVPNVKFNVAKLLQSLIPIVDQSVVEKTIRQCLVDLSEDPDVDVRYFANQALRS  580

Query  268  AD  263
             D
Sbjct  581  ID  582


 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/173 (28%), Positives = 85/173 (49%), Gaps = 1/173 (1%)
 Frame = -2

Query  808  PAIVELAE-DRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAAN  632
            P IV  ++ D+ WRVR  +   +  L   +G       L    +  L+D    +R AAA 
Sbjct  244  PVIVNFSQQDKSWRVRYMVANQLYELCEAVGPDSTRTDLVPAYVGLLRDNEAEVRIAAAG  303

Query  631  NVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPV  452
             V +  +   PE  +QHI+P V E+  D     R  +   +  +AP++G + T   LLP+
Sbjct  304  KVTKFCQLLNPELVVQHILPCVKELSTDSSQHVRSALASVIMGMAPILGKDSTIEHLLPI  363

Query  451  IITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
             ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  FLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  416



>ref|XP_009115632.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Brassica rapa]
Length=370

 Score =   324 bits (831),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEY+PLLAS LG+GFFDDKLGALCMQWL+DKV SIR+AAANN
Sbjct  182  PAIVELAEDRHWRVRLAIIEYVPLLASPLGIGFFDDKLGALCMQWLQDKVSSIREAAANN  241

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFG EWAMQHI+PQVL+M+ +PHYL+RM +L A+SL+APVMGSEITC+K LPV+
Sbjct  242  LKRLAEEFGSEWAMQHIVPQVLDMVTNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVV  301

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPN+KFNVAK+LQSLIPIVD SVVEKTIR CLV+LSEDPDVDVR+FANQAL++
Sbjct  302  VEASKDRVPNVKFNVAKLLQSLIPIVDQSVVEKTIRQCLVDLSEDPDVDVRYFANQALRS  361

Query  268  AD  263
             D
Sbjct  362  ID  363


 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 85/171 (50%), Gaps = 0/171 (0%)
 Frame = -2

Query  805  AIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNV  626
            A+V  ++D+ WRVR  +   +  L   +G       L    +  L+D    +R AAA  V
Sbjct  27   AVVNFSQDKSWRVRYMVANQLYELCEAVGPDSTRTDLVPAYVGLLRDNEAEVRIAAAGKV  86

Query  625  KRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVII  446
             +  +   PE  +QHI+P V E+  D     R  +   +  +AP++G + T   LLP+ +
Sbjct  87   TKFCQLLNPELVIQHILPCVKELSTDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFL  146

Query  445  TASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            +  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  147  SLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  197


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 47/199 (24%), Positives = 91/199 (46%), Gaps = 4/199 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     + L  + +  LKD+   +R    + 
Sbjct  104  PCVKELSTDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISK  163

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  V LLA  +G     +KL  + 
Sbjct  164  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYVPLLASPLGIGFFDDKLGALC  223

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +   +D+V +I+   A  L+ L          + I P ++++  +P    R    +A+  
Sbjct  224  MQWLQDKVSSIREAAANNLKRLAEEFGSEWAMQHIVPQVLDMVTNPHYLHRMMVLRAISL  283

Query  268  ADQVMMSS*GNFMLC*EFV  212
               VM    G+ + C +F+
Sbjct  284  MAPVM----GSEITCSKFL  298



>emb|CDY39185.1| BnaC09g21590D [Brassica napus]
Length=463

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 170/188 (90%), Gaps = 9/188 (5%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  285  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIRDAAANN  344

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV+
Sbjct  345  LKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVV  404

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ITASKDR         +VL SLIPIVD SVVE  IRP LVELSEDPDVDVRFFANQALQ+
Sbjct  405  ITASKDR---------QVLTSLIPIVDQSVVENMIRPGLVELSEDPDVDVRFFANQALQS  455

Query  268  ADQVMMSS  245
             D VMM S
Sbjct  456  IDNVMMFS  463


 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 88/173 (51%), Gaps = 1/173 (1%)
 Frame = -2

Query  808  PAIVELAE-DRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAAN  632
            P IV  ++ D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA 
Sbjct  128  PVIVNFSQQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAG  187

Query  631  NVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPV  452
             V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G E T   LLP+
Sbjct  188  KVTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEHLLPI  247

Query  451  IITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
             ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  248  FLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  300



>emb|CDY36104.1| BnaA08g19440D [Brassica napus]
Length=588

 Score =   329 bits (843),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQW++DKVYSIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWMQDKVYSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFG EWAMQHI+PQVL+M+N+PHYL+RM  L A+SL+APVMGSEITC+K LPV+
Sbjct  460  LKRLAEEFGSEWAMQHIVPQVLDMVNNPHYLHRMMALRAISLMAPVMGSEITCSKFLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + A+KDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL++
Sbjct  520  VEAAKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALRS  579

Query  268  AD  263
             D
Sbjct  580  ID  581


 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 86/172 (50%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +  +   PE  +QHI+P V E+  D     R  +   +  +AP++G + T   LLP+ 
Sbjct  304  VTKFCQLLNPELTIQHILPCVKELSTDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 77/180 (43%), Gaps = 0/180 (0%)
 Frame = -2

Query  793  LAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLA  614
            L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L 
Sbjct  210  LTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYELC  269

Query  613  EEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASK  434
            E  GP+     ++P  + ++ D     R+     V+    ++  E+T   +LP +   S 
Sbjct  270  EAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCQLLNPELTIQHILPCVKELST  329

Query  433  DRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQVM  254
            D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV+
Sbjct  330  DSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQVI  389


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 92/199 (46%), Gaps = 4/199 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     + L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSTDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  V LLA  +G     +KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALC  441

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +   +D+V +I+   A  L+ L          + I P ++++  +P    R  A +A+  
Sbjct  442  MQWMQDKVYSIREAAANNLKRLAEEFGSEWAMQHIVPQVLDMVNNPHYLHRMMALRAISL  501

Query  268  ADQVMMSS*GNFMLC*EFV  212
               VM    G+ + C +F+
Sbjct  502  MAPVM----GSEITCSKFL  516



>gb|AAB60713.1| serine/threonine protein phosphatase type 2A regulatory subunit 
A [Arabidopsis thaliana]
Length=590

 Score =   329 bits (843),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 174/184 (95%), Gaps = 2/184 (1%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAA--  635
            PAIVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+AAA  
Sbjct  400  PAIVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAAAAA  459

Query  634  NNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLP  455
            NN+KRLAEEFGPEWAMQH++PQVL+M+N+PHYL+RM +L A+SL+APVMGSEITC+K LP
Sbjct  460  NNLKRLAEEFGPEWAMQHLVPQVLDMVNNPHYLHRMMVLRAISLMAPVMGSEITCSKFLP  519

Query  454  VIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            V++ ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL
Sbjct  520  VVVEASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQAL  579

Query  274  QAAD  263
             + D
Sbjct  580  NSID  583


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDCTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ 
Sbjct  304  VTKFCRLLNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 77/181 (43%), Gaps = 0/181 (0%)
 Frame = -2

Query  796  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  617
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  616  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  437
             E  GP+     ++P  + ++ D     R+     V+    ++  E+    +LP +   S
Sbjct  269  CEAVGPDCTRTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILPCVKELS  328

Query  436  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  257
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  256  M  254
            +
Sbjct  389  I  389



>ref|XP_009109883.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Brassica rapa]
 ref|XP_009109885.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Brassica rapa]
Length=588

 Score =   328 bits (842),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQW++DKVYSIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWMQDKVYSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFG EWAMQHI+PQVL+M+N+PHYL+RM  L A+SL+APVMGSEITC+K LPV+
Sbjct  460  LKRLAEEFGSEWAMQHIVPQVLDMVNNPHYLHRMMALRAISLMAPVMGSEITCSKFLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + A+KDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL++
Sbjct  520  VEAAKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALRS  579

Query  268  AD  263
             D
Sbjct  580  ID  581


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +  +   PE ++QHI+P V E+  D     R  +   +  +AP++G + T   LLP+ 
Sbjct  304  VTKFCQLLNPELSIQHILPCVKELSTDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/180 (22%), Positives = 77/180 (43%), Gaps = 0/180 (0%)
 Frame = -2

Query  793  LAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLA  614
            L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L 
Sbjct  210  LTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYELC  269

Query  613  EEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASK  434
            E  GP+     ++P  + ++ D     R+     V+    ++  E++   +LP +   S 
Sbjct  270  EAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCQLLNPELSIQHILPCVKELST  329

Query  433  DRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQVM  254
            D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV+
Sbjct  330  DSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQVI  389


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 92/199 (46%), Gaps = 4/199 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     + L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSTDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  V LLA  +G     +KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALC  441

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +   +D+V +I+   A  L+ L          + I P ++++  +P    R  A +A+  
Sbjct  442  MQWMQDKVYSIREAAANNLKRLAEEFGSEWAMQHIVPQVLDMVNNPHYLHRMMALRAISL  501

Query  268  ADQVMMSS*GNFMLC*EFV  212
               VM    G+ + C +F+
Sbjct  502  MAPVM----GSEITCSKFL  516



>emb|CDY51132.1| BnaA07g37150D [Brassica napus]
Length=586

 Score =   328 bits (842),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+A ANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAGANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFG EWAMQH++PQVLEM+N+PHYL+RM  L A+SL+APVMGSEITC+K LPV+
Sbjct  460  LKRLAEEFGSEWAMQHLVPQVLEMVNNPHYLHRMMALRAISLMAPVMGSEITCSKFLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL++
Sbjct  520  VEASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALKS  579


 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDCTKTDLVPAYVRLLQDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +  +   PE ++QHI+P V ++ +D     R  +   +  +AP++G + T   LLP+ 
Sbjct  304  VTKFCQLLNPELSIQHILPCVKDLSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 78/181 (43%), Gaps = 0/181 (0%)
 Frame = -2

Query  796  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  617
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDEQDSVRLLAVEGCAALGKLLEPQDCVARVLPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  616  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  437
             E  GP+     ++P  + ++ D     R+     V+    ++  E++   +LP +   S
Sbjct  269  CEAVGPDCTKTDLVPAYVRLLQDNEAEVRIAAAGKVTKFCQLLNPELSIQHILPCVKDLS  328

Query  436  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  257
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  256  M  254
            +
Sbjct  389  I  389



>gb|KJB50734.1| hypothetical protein B456_008G184500 [Gossypium raimondii]
Length=587

 Score =   328 bits (842),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 169/187 (90%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG LCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGTLCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + RLAEEFG +WAM+HIIPQVLEM N PHYLYRMTIL ++S+LAPVMGSEI C+KLLPV+
Sbjct  460  LIRLAEEFGRDWAMEHIIPQVLEMANSPHYLYRMTILRSISILAPVMGSEIACSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKDRV NIKFNVAKVLQSL+PIVD SV EKTI PCLVELSED DVDVR+FANQ LQ+
Sbjct  520  VNASKDRVANIKFNVAKVLQSLVPIVDKSVAEKTIYPCLVELSEDSDVDVRYFANQGLQS  579

Query  268  ADQVMMS  248
             +   MS
Sbjct  580  INHATMS  586


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPQPTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V + ++   PE A  HI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFSQILSPELANHHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIS  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  +V   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVVGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_001775815.1| predicted protein [Physcomitrella patens]
 gb|EDQ59354.1| predicted protein [Physcomitrella patens]
Length=589

 Score =   326 bits (835),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGV FFDDKLGALCMQWL+D+VYSIR+AAANN
Sbjct  403  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVDFFDDKLGALCMQWLEDQVYSIREAAANN  462

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFG EWA+QHIIPQV+E IN+PHYLYRMT+L A+SLLAPV+G+E TC  +LPV+
Sbjct  463  LKRLAEEFGSEWALQHIIPQVMEKINNPHYLYRMTVLVAISLLAPVVGAEATCQTMLPVV  522

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I A+KDRVPNIKFNVAK+LQS+IPIVD +VVE+TIRPCL+EL EDPDVDVRFFA QALQA
Sbjct  523  INAAKDRVPNIKFNVAKMLQSMIPIVDSTVVEQTIRPCLLELQEDPDVDVRFFAGQALQA  582

Query  268  ADQVM  254
              QVM
Sbjct  583  CVQVM  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 86/172 (50%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  247  PVIVSFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGK  306

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+   QHI+P V E+  D     R  +   +  +AP++G E T  +LLP+ 
Sbjct  307  VTKFCGIVNPQVGQQHILPCVKELSTDSSQHVRAALASVIMGMAPLLGKEATIEQLLPIF  366

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  367  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  418



>ref|XP_009103071.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Brassica rapa]
Length=586

 Score =   325 bits (834),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+A ANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAGANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFG EWAMQH++PQVLEM+N+PHYL+RM  L A+SL+APVMGSEITC+K LPV+
Sbjct  460  LKRLAEEFGSEWAMQHLVPQVLEMVNNPHYLHRMMALRAISLMAPVMGSEITCSKFLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            + ASKD VPNIKFNVAK++QSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQALQ+
Sbjct  520  VEASKDIVPNIKFNVAKLMQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALQS  579


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPDCTKTDLVPAYVRLLQDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +  +   PE ++QHI+P V ++ +D     R  +   +  +AP++G + T   LLP+ 
Sbjct  304  VTKFCQLLNPELSIQHILPCVKDLSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDRLSQSLLPAIVELAEDRHWRVRL  415


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 78/181 (43%), Gaps = 0/181 (0%)
 Frame = -2

Query  796  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  617
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDEQDSVRLLAVEGCAALGKLLEPQDCVARVLPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  616  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  437
             E  GP+     ++P  + ++ D     R+     V+    ++  E++   +LP +   S
Sbjct  269  CEAVGPDCTKTDLVPAYVRLLQDNEAEVRIAAAGKVTKFCQLLNPELSIQHILPCVKDLS  328

Query  436  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  257
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  256  M  254
            +
Sbjct  389  I  389



>emb|CAA57527.1| 65 kDa regulatory subunit of protein phosphatase 2A [Arabidopsis 
thaliana]
Length=590

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 173/184 (94%), Gaps = 2/184 (1%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAA--  635
            PAIVELAEDRHWRVRLAIIEY+PLLASQLG+GFFD KLGALCMQWL+DKVYSIR+AAA  
Sbjct  400  PAIVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDYKLGALCMQWLQDKVYSIREAAAAA  459

Query  634  NNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLP  455
            NN+KRLAEEFGPEWAMQH++PQVL+M+N+PHYL+RM +L A+SL+APVMGSEITC+K LP
Sbjct  460  NNLKRLAEEFGPEWAMQHLVPQVLDMVNNPHYLHRMMVLRAISLMAPVMGSEITCSKFLP  519

Query  454  VIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            V++ ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL
Sbjct  520  VVVEASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQAL  579

Query  274  QAAD  263
             + D
Sbjct  580  NSID  583


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCKAVGPDCTRTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ 
Sbjct  304  VTKFCRLLNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_001769725.1| predicted protein [Physcomitrella patens]
 gb|EDQ65526.1| predicted protein [Physcomitrella patens]
Length=589

 Score =   324 bits (831),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGV FFDDKLGALCMQWL D+V+SIR+AAANN
Sbjct  403  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVDFFDDKLGALCMQWLGDQVFSIREAAANN  462

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFG EWA+QHIIPQV++ IN+PHYLYRMT+L A+SLLAPV+G+E TC  +LPV+
Sbjct  463  LKRLAEEFGSEWALQHIIPQVMDKINNPHYLYRMTVLVAISLLAPVVGAEATCQTMLPVV  522

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I A+KDRVPNIKFNVAK+LQS+IPIV+ +VVE+TIRPCL+EL EDPDVDVRFFA QALQA
Sbjct  523  INAAKDRVPNIKFNVAKMLQSMIPIVESTVVEQTIRPCLLELQEDPDVDVRFFAGQALQA  582

Query  268  ADQVMMS  248
             DQVM +
Sbjct  583  CDQVMCA  589


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 86/172 (50%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  247  PVIVSFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGK  306

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A QHI+P V E+  D     R  +   +  +AP++G E T  +LLP+ 
Sbjct  307  VTKFCGIVSPQVAQQHILPCVKELSTDSSQHVRAALASVIMGMAPLLGKEATIEQLLPIF  366

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            +   KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  367  LALLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  418



>ref|XP_002988290.1| hypothetical protein SELMODRAFT_447252 [Selaginella moellendorffii]
 gb|EFJ10709.1| hypothetical protein SELMODRAFT_447252 [Selaginella moellendorffii]
Length=584

 Score =   317 bits (813),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED+HWRVRLAIIEYIPLLASQLGV FFDDKLGALCM WL D+V SIR+AAANN
Sbjct  398  PAIVELAEDKHWRVRLAIIEYIPLLASQLGVEFFDDKLGALCMHWLGDQVCSIREAAANN  457

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRL EEFG EWA +HIIPQVLEMIN+PHYLYR+TIL+A+SL APV+GSE+TC  +LPV+
Sbjct  458  LKRLTEEFGTEWACRHIIPQVLEMINNPHYLYRLTILYAISLFAPVVGSEVTCQMMLPVV  517

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I A+KDR+PN+KFNVAK+LQS IPIV   VVE++IRPCLVELSEDPDVDVR+FANQALQ+
Sbjct  518  INAAKDRIPNVKFNVAKILQSFIPIVGSEVVEQSIRPCLVELSEDPDVDVRYFANQALQS  577

Query  268  ADQVM  254
             +Q M
Sbjct  578  CEQAM  582


 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 87/172 (51%), Gaps = 3/172 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P I+  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA+ 
Sbjct  245  PLILNFSQDKSWRVRYMVANQLYELCETVGPECTRVDLVPAYVRLLRDNEAEVRIAAADK  304

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +  E   PE AMQ I+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  305  VTKFCEIVQPEIAMQSILPCVKELSLDSSQHVRAALASVIMGMAPVLGKDATIEQLLPIF  364

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            +   KD  P+++ N+   L  +I I    ++ +++ P +VEL+ED    VR 
Sbjct  365  LALLKDEFPDVRLNIISKLDQVIGI---DLLSQSLLPAIVELAEDKHWRVRL  413


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/166 (26%), Positives = 79/166 (48%), Gaps = 3/166 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    N 
Sbjct  323  PCVKELSLDSSQHVRAALASVIMGMAPVLGKDATIEQLLPIFLALLKDEFPDVR---LNI  379

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + +L +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G E   +KL  + 
Sbjct  380  ISKLDQVIGIDLLSQSLLPAIVELAEDKHWRVRLAIIEYIPLLASQLGVEFFDDKLGALC  439

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDP  311
            +    D+V +I+   A  L+ L          + I P ++E+  +P
Sbjct  440  MHWLGDQVCSIREAAANNLKRLTEEFGTEWACRHIIPQVLEMINNP  485



>ref|XP_002963887.1| hypothetical protein SELMODRAFT_166330 [Selaginella moellendorffii]
 gb|EFJ35758.1| hypothetical protein SELMODRAFT_166330 [Selaginella moellendorffii]
Length=587

 Score =   317 bits (813),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED+HWRVRLAIIEYIPLLASQLGV FFDDKLGALCM WL D+V SIR+AAANN
Sbjct  401  PAIVELAEDKHWRVRLAIIEYIPLLASQLGVEFFDDKLGALCMHWLGDQVCSIREAAANN  460

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRL EEFG EWA +HIIPQVLEMIN+PHYLYR+TIL+A+SL APV+GSE+TC  +LPV+
Sbjct  461  LKRLTEEFGTEWACRHIIPQVLEMINNPHYLYRLTILYAISLFAPVVGSEVTCQMMLPVV  520

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I A+KDR+PN+KFNVAK+LQS IPIV   VVE++IRPCLVELSEDPDVDVR+FANQALQ+
Sbjct  521  INAAKDRIPNVKFNVAKILQSFIPIVGSEVVEQSIRPCLVELSEDPDVDVRYFANQALQS  580

Query  268  ADQVM  254
             +Q M
Sbjct  581  CEQAM  585


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P I+  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA+ 
Sbjct  245  PLILNFSQDKSWRVRYMVANQLYELCETVGPECTRVDLVPAYVRLLRDNEAEVRIAAADK  304

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +  E   PE AMQ I+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  305  VTKFCEIVQPEIAMQSILPCVKELSLDSSQHVRAALASVIMGMAPVLGKDATIEQLLPIF  364

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            +   KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  365  LALLKDEFPDVRLNIISKLDQVNKVIGIDLLSQSLLPAIVELAEDKHWRVRL  416



>ref|XP_007036503.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform 2, partial [Theobroma cacao]
 gb|EOY21004.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform 2, partial [Theobroma cacao]
Length=432

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  275  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  334

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPVMG EI C+ LLP++
Sbjct  335  VKRLAEEFGPQWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVMGPEIICSNLLPLV  394

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPC  335
            I ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPC
Sbjct  395  INASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPC  432



>ref|XP_002973833.1| hypothetical protein SELMODRAFT_232183 [Selaginella moellendorffii]
 ref|XP_002983557.1| hypothetical protein SELMODRAFT_268734 [Selaginella moellendorffii]
 gb|EFJ15458.1| hypothetical protein SELMODRAFT_268734 [Selaginella moellendorffii]
 gb|EFJ24788.1| hypothetical protein SELMODRAFT_232183 [Selaginella moellendorffii]
Length=580

 Score =   311 bits (797),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  805  AIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNV  626
            +++ELAEDRHWRVRLAIIEYIPLLASQLGV  FDDKLG+LCMQWL D+V+SIR+AAANN+
Sbjct  395  SLLELAEDRHWRVRLAIIEYIPLLASQLGVEVFDDKLGSLCMQWLGDQVFSIREAAANNL  454

Query  625  KRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVII  446
            KRLAEEFGPEW  QHI+PQV+ MIN+PHYLYRMTILHA+SLLAPV+G E+TC  LLPV+I
Sbjct  455  KRLAEEFGPEWTCQHILPQVINMINNPHYLYRMTILHAISLLAPVVGGEVTCQTLLPVVI  514

Query  445  TASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAA  266
             ASKDRVPNIKFNVAKVL+SLIP VD SVV++TIRP L EL+EDPDVDVR+FA++AL+A 
Sbjct  515  NASKDRVPNIKFNVAKVLKSLIPTVDASVVDQTIRPTLQELNEDPDVDVRYFASEALKAC  574

Query  265  DQVMMS  248
            D  M +
Sbjct  575  DDTMST  580


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/172 (27%), Positives = 83/172 (48%), Gaps = 4/172 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  242  PVIVSFSQDKSWRVRFMVANQLYELCEAVGAEATRTELVPAYVRLLRDNEAEVRIAAAGK  301

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A Q I+P V ++  D     R  +   +  +APV+G E+T  +LLP  
Sbjct  302  VTKFCRIISPQLATQQILPCVKDLAIDSSQHVRAALASVIMGMAPVLGKEVTIEQLLPTF  361

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            +   KD  P+++ ++   L  +  ++   ++ ++    L+EL+ED    VR 
Sbjct  362  LALLKDEFPDVRLSIMSKLDQVNQVIGIDLLSQS----LLELAEDRHWRVRL  409



>ref|XP_011623847.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Amborella trichopoda]
Length=586

 Score =   310 bits (795),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+D+V+SIRDAAA N
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDQVFSIRDAAATN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLE IN  HYL R+TILH + LLAPV+GSEIT   LLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEKINSTHYLQRITILHTIYLLAPVLGSEITSQSLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +  +KDRVPN+KFN AKVL+SLIPI+D SVVE+ + PCLV+L EDPDVDVRFF+  AL+ 
Sbjct  520  VNTTKDRVPNVKFNAAKVLRSLIPILDQSVVEQRVHPCLVDLYEDPDVDVRFFSGLALEV  579

Query  268  ADQVMMS  248
             +QV +S
Sbjct  580  CEQVKLS  586


 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPESTRVELVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ 
Sbjct  304  VTKFCRILNPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDATIELLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|ERN07361.1| hypothetical protein AMTR_s00019p00236090 [Amborella trichopoda]
Length=604

 Score =   310 bits (795),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+D+V+SIRDAAA N
Sbjct  418  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDQVFSIRDAAATN  477

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLE IN  HYL R+TILH + LLAPV+GSEIT   LLPV+
Sbjct  478  LKRLAEEFGPEWAMQHIIPQVLEKINSTHYLQRITILHTIYLLAPVLGSEITSQSLLPVV  537

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +  +KDRVPN+KFN AKVL+SLIPI+D SVVE+ + PCLV+L EDPDVDVRFF+  AL+ 
Sbjct  538  VNTTKDRVPNVKFNAAKVLRSLIPILDQSVVEQRVHPCLVDLYEDPDVDVRFFSGLALEV  597

Query  268  ADQVMMS  248
             +QV +S
Sbjct  598  CEQVKLS  604


 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  262  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPESTRVELVPAYVRLLRDNEAEVRIAAAGK  321

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ 
Sbjct  322  VTKFCRILNPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDATIELLLPIF  381

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  382  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  433



>emb|CAN68660.1| hypothetical protein VITISV_002162 [Vitis vinifera]
Length=582

 Score =   299 bits (765),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 161/188 (86%), Gaps = 5/188 (3%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLG+ FFDD+LGALCMQWL+DKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGIKFFDDELGALCMQWLQDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGP+WAMQH+IPQVLEMIN+ HYLYRMT+L A+SLLAP MG+EIT +KLLPV+
Sbjct  460  LKRLAEEFGPDWAMQHLIPQVLEMINNSHYLYRMTVLRAISLLAPAMGAEITYSKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I     R P     + +     IPIVDHSVVEKTIRPCLVELSEDPDVDVRF ANQA+  
Sbjct  520  I-----RCPMSNSMLPRCCSPWIPIVDHSVVEKTIRPCLVELSEDPDVDVRFSANQAIHV  574

Query  268  ADQVMMSS  245
             D VMMSS
Sbjct  575  IDHVMMSS  582


 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P I+  ++DR WRVR  + + +  L   +G       L    M+ L+D    +R AAA  
Sbjct  244  PVIISFSQDRSWRVRYMVADQLYELCHAVGPEATRTDLVPAYMRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +  +   PE A+ HI+P V E+  D     R  +   +  +APV+G + T ++LLP+ 
Sbjct  304  VTKFCQILNPELAIHHILPCVKELSLDSSQHVRSALASVLMGMAPVLGKDATIDQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDDFPDVRLNIISKLDQINQVIGTDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KHG29905.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Gossypium arboreum]
Length=436

 Score =   288 bits (736),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 160/200 (80%), Gaps = 13/200 (7%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDK-----------  662
            PAIVELAEDRHWRVRL IIEYIPLLASQLGVGFF DKL  LCMQWL+DK           
Sbjct  234  PAIVELAEDRHWRVRLPIIEYIPLLASQLGVGFFYDKLDTLCMQWLQDKEVPMLLACDYC  293

Query  661  --VYSIRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVM  488
              + +    +ANN+ RLAEEFG +WAM+ IIPQVLEM N PHYLYRMTIL ++S+LAP+M
Sbjct  294  YYLEACNRHSANNLTRLAEEFGRDWAMEQIIPQVLEMANSPHYLYRMTILRSISILAPLM  353

Query  487  GSEITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPD  308
            GSEITC+KLLPV+  ASKDRV NIKFNVAKVLQSL+PIV  SVVEKTIRPCL ELSED D
Sbjct  354  GSEITCSKLLPVVENASKDRVANIKFNVAKVLQSLVPIVYKSVVEKTIRPCLFELSEDSD  413

Query  307  VDVRFFANQALQAADQVMMS  248
            VDVR+FANQ LQ+ +   +S
Sbjct  414  VDVRYFANQGLQSINHATIS  433


 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  78   PVIVNFSQDKSWRVRYMVANQLFELCEAVGPQPTRMDLVPAYVRLLRDNEAEVRIAAAGK  137

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + + ++   PE A QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  138  ITKFSQILSPELATQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIY  197

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  +V   ++ +++ P +VEL+ED    VR 
Sbjct  198  LSLLKDEFPDVRLNIISKLDQVNQVVGIDLLSQSLLPAIVELAEDRHWRVRL  249



>ref|XP_006297363.1| hypothetical protein CARUB_v10013383mg [Capsella rubella]
 gb|EOA30261.1| hypothetical protein CARUB_v10013383mg [Capsella rubella]
Length=550

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/149 (91%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHS  362
            ITASKDRVPNIKFNVAK++QSLIPIVD S
Sbjct  520  ITASKDRVPNIKFNVAKMMQSLIPIVDQS  548


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTKTDLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KHG29904.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Gossypium arboreum]
Length=505

 Score =   287 bits (735),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 160/200 (80%), Gaps = 13/200 (7%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDK-----------  662
            PAIVELAEDRHWRVRL IIEYIPLLASQLGVGFF DKL  LCMQWL+DK           
Sbjct  303  PAIVELAEDRHWRVRLPIIEYIPLLASQLGVGFFYDKLDTLCMQWLQDKEVPMLLACDYC  362

Query  661  --VYSIRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVM  488
              + +    +ANN+ RLAEEFG +WAM+ IIPQVLEM N PHYLYRMTIL ++S+LAP+M
Sbjct  363  YYLEACNRHSANNLTRLAEEFGRDWAMEQIIPQVLEMANSPHYLYRMTILRSISILAPLM  422

Query  487  GSEITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPD  308
            GSEITC+KLLPV+  ASKDRV NIKFNVAKVLQSL+PIV  SVVEKTIRPCL ELSED D
Sbjct  423  GSEITCSKLLPVVENASKDRVANIKFNVAKVLQSLVPIVYKSVVEKTIRPCLFELSEDSD  482

Query  307  VDVRFFANQALQAADQVMMS  248
            VDVR+FANQ LQ+ +   +S
Sbjct  483  VDVRYFANQGLQSINHATIS  502


 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  147  PVIVNFSQDKSWRVRYMVANQLFELCEAVGPQPTRMDLVPAYVRLLRDNEAEVRIAAAGK  206

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + + ++   PE A QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  207  ITKFSQILSPELATQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIY  266

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  +V   ++ +++ P +VEL+ED    VR 
Sbjct  267  LSLLKDEFPDVRLNIISKLDQVNQVVGIDLLSQSLLPAIVELAEDRHWRVRL  318



>ref|XP_008659342.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Zea mays]
 gb|AFW86037.1| hypothetical protein ZEAMMB73_179225 [Zea mays]
Length=592

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVV  519

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSV  359
            I +SKDRVPNIKFNVAKVL+SL+PI+D SV
Sbjct  520  INSSKDRVPNIKFNVAKVLKSLVPILDQSV  549


 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPQLSIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATMEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++    + +T+ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDFLSQTLLPAIVELAEDRHWRVRL  415



>ref|XP_010319425.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Solanum lycopersicum]
Length=549

 Score =   275 bits (704),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEY P+LASQLGVGFFDDKLG LCMQWL+D+VYSIRDAAANN
Sbjct  396  PAIVELAEDRHWRVRLAIIEYTPMLASQLGVGFFDDKLGTLCMQWLQDEVYSIRDAAANN  455

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEE GPEWAMQHIIPQVL +IN+ HYLYRM IL A+SLLAPVMGSEITC+KLLPV+
Sbjct  456  LKRLAEELGPEWAMQHIIPQVLGVINNSHYLYRMAILRAISLLAPVMGSEITCSKLLPVV  515

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHS  362
            IT +KDRVPN+KFNVAKVLQSLIP+VD S
Sbjct  516  ITVAKDRVPNVKFNVAKVLQSLIPVVDQS  544


 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  240  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPETSRKDLVPSYVRLLRDNEAEVRIAAAGK  299

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
              + ++   PE ++QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  300  ATKFSQILSPELSLQHILPSVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  359

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  360  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  411



>ref|XP_006279159.1| hypothetical protein CARUB_v100079671mg, partial [Capsella rubella]
 gb|EOA12057.1| hypothetical protein CARUB_v100079671mg, partial [Capsella rubella]
Length=139

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -2

Query  661  VYSIRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGS  482
            V+SIR+AAANN+KRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGS
Sbjct  1    VHSIREAAANNLKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGS  60

Query  481  EITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVD  302
            EITC+KLLP +ITASKDRVPNIKFNVAK++QSLIPIVD SVVE  IRPCLVELSEDPDVD
Sbjct  61   EITCSKLLPAVITASKDRVPNIKFNVAKMMQSLIPIVDQSVVESMIRPCLVELSEDPDVD  120

Query  301  VRFFANQALQAADQVMMSS  245
            VRFFANQALQ+ D VMMSS
Sbjct  121  VRFFANQALQSIDNVMMSS  139



>ref|XP_009616233.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana tomentosiformis]
Length=583

 Score =   268 bits (686),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  802  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  623
            I EL+E +HWRVR+A+I +IPLLASQLG GF++DK+GALCMQWL DKV+ +R AAANN++
Sbjct  403  IDELSEAKHWRVRVALINFIPLLASQLGFGFYNDKIGALCMQWLIDKVHQVRVAAANNLR  462

Query  622  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  443
             LAE+FGPEWA +HIIPQVL+M++D +YLYR+TILHA+SLLAPVMGSEIT +  LPVI+ 
Sbjct  463  LLAEKFGPEWASEHIIPQVLDMVDDRNYLYRITILHALSLLAPVMGSEITTSTFLPVILA  522

Query  442  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  263
            AS DRVPN++FNVAKVL  L  +VD SVVE+ IRPCL + +ED DVDVRFFAN+ALQA  
Sbjct  523  ASTDRVPNVRFNVAKVLGYLASVVDQSVVEERIRPCLNKFNEDEDVDVRFFANKALQAIY  582

Query  262  Q  260
            Q
Sbjct  583  Q  583


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 83/164 (51%), Gaps = 0/164 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P ++ LA+D  W+VR  + + I  L   +G      ++    +  L+D    +R AAA  
Sbjct  245  PVMISLAQDASWQVRYTVADQIYELCETVGPDATRTEMVPAYVGLLRDNETEVRKAAAGK  304

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V ++ +   PE  +QHI P V E+ +DP       +   +  LAP++G + T  +LLP+ 
Sbjct  305  VTKVFQILSPELPVQHIFPCVKELSSDPFQEVPFALASDIMGLAPILGKDQTVEQLLPIF  364

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSE  317
            ++  KD    I+ N+   ++ +  ++   ++ +++   + ELSE
Sbjct  365  LSLLKDESTQIRVNIISKIEQVNQVIGIDLLSQSLLSVIDELSE  408



>ref|XP_009419803.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Musa acuminata subsp. 
malaccensis]
Length=146

 Score =   254 bits (648),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  682  MQWLKDKVYSIRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSL  503
            MQWL+DKV+SIR+AA NN+KRLAEEFGPEWAMQHI+PQ+LE I++PHYL+RMTIL A+SL
Sbjct  1    MQWLEDKVFSIREAATNNLKRLAEEFGPEWAMQHIVPQLLEKISNPHYLHRMTILQAISL  60

Query  502  LAPVMGSEITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVEL  323
            L+PV+GS+ITC KLLPVII+ASKDRVPNIKFNVAKVLQSL+PI DHSVVE+T+RPCLVEL
Sbjct  61   LSPVLGSDITCQKLLPVIISASKDRVPNIKFNVAKVLQSLVPIFDHSVVEQTVRPCLVEL  120

Query  322  SEDPDVDVRFFANQALQAADQVMMSS  245
             EDPDVDVR+FA+QALQ  D  MMS+
Sbjct  121  GEDPDVDVRYFASQALQTCDSAMMSN  146



>gb|ABR14732.1| protein phosphatase, partial [Gossypium hirsutum]
Length=245

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 127/128 (99%), Gaps = 0/128 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  118  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  177

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVL++IN+PHYLYRMTILHA+SLLAPVMGS+ITC+KLLPV+
Sbjct  178  VKRLAEEFGPDWAMQHIVPQVLDVINNPHYLYRMTILHAISLLAPVMGSDITCSKLLPVV  237

Query  448  ITASKDRV  425
            I ASKDRV
Sbjct  238  INASKDRV  245


 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 70/130 (54%), Gaps = 0/130 (0%)
 Frame = -2

Query  682  MQWLKDKVYSIRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSL  503
            ++ L+D    +R AAA  V +      PE A+QHI+P V E+  D     R  +   +  
Sbjct  4    VRLLRDNEAEVRIAAAGKVTKFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMG  63

Query  502  LAPVMGSEITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVEL  323
            +APV+G + T  +LLP+ ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL
Sbjct  64   MAPVLGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVEL  123

Query  322  SEDPDVDVRF  293
            +ED    VR 
Sbjct  124  AEDRHWRVRL  133



>emb|CDY03849.1| BnaC07g10740D [Brassica napus]
Length=529

 Score =   263 bits (671),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 149/183 (81%), Gaps = 3/183 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAII---EYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAA  638
            P  + L +D    VRL II   + +  LA    +  F DKLGALCMQWL+DKVYSIR+A 
Sbjct  340  PIFLSLLKDEFPDVRLNIISKLDQVNQLAEDRHLRGFSDKLGALCMQWLQDKVYSIREAG  399

Query  637  ANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLL  458
            ANN+KRLAEEFG EWAMQH++PQVLEM+N PHYL+RM  L  +SL+APVMGSEITC+K L
Sbjct  400  ANNLKRLAEEFGSEWAMQHLVPQVLEMVNTPHYLHRMMALRVISLMAPVMGSEITCSKFL  459

Query  457  PVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQA  278
            PV++ ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQA
Sbjct  460  PVVVEASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQA  519

Query  277  LQA  269
            LQ 
Sbjct  520  LQT  522



>gb|AFB74194.1| protein phosphatase 2A, partial [Halocnemum strobilaceum]
Length=314

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG LCMQWL+DKVYSIRDAAANN
Sbjct  188  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGNLCMQWLQDKVYSIRDAAANN  247

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGPEWAMQHI+PQVLEM+N+PHYLYRMTILHA+SLLAPV+G+EITC+KLLPV+
Sbjct  248  VKRLAEEFGPEWAMQHIVPQVLEMMNNPHYLYRMTILHAISLLAPVLGAEITCSKLLPVV  307

Query  448  ITASKDR  428
            I ASKDR
Sbjct  308  INASKDR  314


 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  
Sbjct  32   PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGK  91

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V ++ +D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  92   VTKFCRILSPELAIQHILPCVKDLSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  151

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  152  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  203



>gb|KJB39314.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
 gb|KJB39315.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
 gb|KJB39316.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
Length=526

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPVMGS+ITC+KLLPV+
Sbjct  460  VKRLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVMGSDITCSKLLPVV  519

Query  448  ITASKDR  428
            I ASKDR
Sbjct  520  INASKDR  526


 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSELVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|NP_001030769.1| protein phosphatase 2A subunit A2 [Arabidopsis thaliana]
 gb|AEE77070.1| protein phosphatase 2A subunit A2 [Arabidopsis thaliana]
Length=544

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEM+N+PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV+
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMVNNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVV  519

Query  448  ITASKDR  428
            +TASKDR
Sbjct  520  MTASKDR  526


 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILNPEIAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>emb|CDY04181.1| BnaA09g19590D [Brassica napus]
Length=347

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 150/208 (72%), Gaps = 24/208 (12%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKL--------GALCMQWLKDKVYS  653
            P  + L +D    V L II  +  +   +G+      L          LCMQWL+DKV+S
Sbjct  144  PIFLSLLKDEFPDVCLNIISKLDQVNQVIGIDLLSRSLLPAIVLASSTLCMQWLQDKVHS  203

Query  652  IRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEIT  473
            IRDAAANN+KRLAEEFG EWAMQHI+PQ LEMI +PHYLYRMTIL AVSLLAPV+GSEIT
Sbjct  204  IRDAAANNLKRLAEEFGHEWAMQHIVPQFLEMIYNPHYLYRMTILRAVSLLAPVIGSEIT  263

Query  472  CNKLLPVIITASKD------------RVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLV  329
            C+KLLPV+ITASKD            RVPNIKFNVAKVLQSLIPI    VVE  IRP LV
Sbjct  264  CSKLLPVVITASKDRQYNKQGFFIYHRVPNIKFNVAKVLQSLIPI----VVENMIRPGLV  319

Query  328  ELSEDPDVDVRFFANQALQAADQVMMSS  245
            ELSEDPDVDVRFFANQALQ+ D VMMSS
Sbjct  320  ELSEDPDVDVRFFANQALQSIDNVMMSS  347


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/161 (27%), Positives = 80/161 (50%), Gaps = 11/161 (7%)
 Frame = -2

Query  808  PAIVELA-EDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAAN  632
            P IV  + +D+ WRV L ++  + LL   L   +         ++ L+D    +R AAA 
Sbjct  36   PLIVNFSHQDKSWRV-LYMLWDLNLLGKDLVPAY---------VRLLRDNEAEVRIAAAE  85

Query  631  NVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPV  452
             V +      PE A+QHI+P V E+ +D     +  +   +  +APV+G + T   LLP+
Sbjct  86   KVTKFCRILNPELAIQHILPSVKELSSDSSQHIKSALASVIMGMAPVLGKDATIEHLLPI  145

Query  451  IITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLV  329
             ++  KD  P++  N+   L  +  ++   ++ +++ P +V
Sbjct  146  FLSLLKDEFPDVCLNIISKLDQVNQVIGIDLLSRSLLPAIV  186



>gb|KDO41973.1| hypothetical protein CISIN_1g007863mg [Citrus sinensis]
Length=536

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/126 (93%), Positives = 124/126 (98%), Gaps = 0/126 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGP+WAMQHI+PQVLEMIN+PHYLYRMTIL A+SLLAPVMGSEITC++LLPV+
Sbjct  460  VKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVV  519

Query  448  ITASKD  431
            I ASKD
Sbjct  520  INASKD  525


 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 89/172 (52%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       +    ++ L+D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V ++     PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ 
Sbjct  304  VTKICRILNPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 46/187 (25%), Positives = 86/187 (46%), Gaps = 0/187 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   I  +A  LG     ++L  + +  LKD+   +R    + 
Sbjct  322  PCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISK  381

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P ++E+  D H+  R+ I+  + LLA  +G     +KL  + 
Sbjct  382  LDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALC  441

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +   KD+V +I+   A  ++ L          + I P ++E+  +P    R    QA+  
Sbjct  442  MQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISL  501

Query  268  ADQVMMS  248
               VM S
Sbjct  502  LAPVMGS  508



>ref|NP_001031035.1| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
 gb|AEE28999.1| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
Length=537

 Score =   249 bits (637),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFD+KLGALCMQWL+DKV+SIR+AAANN
Sbjct  400  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDEKLGALCMQWLQDKVHSIREAAANN  459

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +KRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +
Sbjct  460  LKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAV  519

Query  448  ITASKDR  428
            ITASKDR
Sbjct  520  ITASKDR  526


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 85/172 (49%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IV  ++D+ WRVR  +   +  L   +G       L     + L D    +R AAA  
Sbjct  244  PVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYARLLCDNEAEVRIAAAGK  303

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ 
Sbjct  304  VTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIF  363

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>emb|CDY69424.1| BnaAnng30450D, partial [Brassica napus]
Length=531

 Score =   249 bits (635),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN
Sbjct  401  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANN  460

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            VKRLAEEFGPEWAMQHI+PQVLEMI++PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV+
Sbjct  461  VKRLAEEFGPEWAMQHIVPQVLEMISNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVV  520

Query  448  ITASKDR  428
            +T +KDR
Sbjct  521  MTGAKDR  527


 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 87/173 (50%), Gaps = 1/173 (1%)
 Frame = -2

Query  808  PAIVELAE-DRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAAN  632
            P IV  ++ D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA 
Sbjct  244  PVIVNFSQQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAG  303

Query  631  NVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPV  452
             V +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T   LLP+
Sbjct  304  KVTKFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEHLLPI  363

Query  451  IITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
             ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  FLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  416



>ref|XP_009764796.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana sylvestris]
Length=601

 Score =   250 bits (639),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = -2

Query  802  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  623
            I EL+E +HWRVR+A+I +IPLLASQLGV F++DK+GALCMQWL D+V+ +R AAANN+ 
Sbjct  421  IDELSEAKHWRVRVALINFIPLLASQLGVSFYNDKIGALCMQWLTDEVHQVRVAAANNLV  480

Query  622  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  443
             LA +FGPEWA++HII QVL+M+ND  Y YR+ IL  +SLLAPV+G EIT + + PVI+ 
Sbjct  481  LLAVKFGPEWALEHIISQVLDMVNDRRYQYRINILRTLSLLAPVVGLEITTSTIFPVILA  540

Query  442  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  263
            AS DRVPN++FNVAKVL SL  IVD SVVE+ IRPCL +L++D DVDVRFFAN+ALQA  
Sbjct  541  ASTDRVPNVRFNVAKVLPSLASIVDQSVVEERIRPCLNKLNQDEDVDVRFFANKALQAIY  600

Query  262  Q  260
            Q
Sbjct  601  Q  601


 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 81/164 (49%), Gaps = 8/164 (5%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P I+ L++D  W+VR  + + +  L   +G      ++    ++ L+D    +R AAA  
Sbjct  271  PVIISLSQDDSWQVRYTVADQLCELCETVGPDATRTEMVPAYVRLLRDNETDVRRAAAGK  330

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V +  +   PE  +QHI+P V E+        R  +   +  L+P++G + T  +LLP+ 
Sbjct  331  VTKFFQILSPELPVQHILPCVKEV--------RFALASDIMGLSPILGKDQTVEQLLPIF  382

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSE  317
            +T  KD    I+ N+   +  +  ++   ++ +++   + ELSE
Sbjct  383  LTLLKDESTQIRVNIISKIDQVNQVIGIDLLSQSLLSVIDELSE  426



>ref|XP_005644559.1| ARM repeat-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20015.1| ARM repeat-containing protein [Coccomyxa subellipsoidea C-169]
Length=589

 Score =   248 bits (632),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAI  LA+D HWRVRLAII+YIPLLA+QLG   F  +LG  CM+WL+D+V+ IR+AA  N
Sbjct  403  PAIENLADDNHWRVRLAIIKYIPLLATQLGADVFQQQLGQQCMRWLEDQVFCIREAATLN  462

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +++LA EFGPEWA +H++PQVL M+N+ HYLYRMTIL AV+ LAP +  ++ CN +LPV+
Sbjct  463  LQKLAAEFGPEWAKEHLVPQVLAMVNNSHYLYRMTILSAVAALAPAVSHDVLCNNMLPVV  522

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            I+ +KD+VPNIKF VAK+L+ L+P+VD ++ E TI+PCL+EL++D D DV+FFA  ALQ+
Sbjct  523  ISCAKDKVPNIKFTVAKMLERLVPLVDAAIAEHTIKPCLLELADDSDADVQFFAQHALQS  582

Query  268  AD  263
             +
Sbjct  583  CE  584


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 83/172 (48%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P +   A+D+ WRVR  + + + +L + LG     +++    ++ L+D    +R AAA  
Sbjct  247  PVVQRFAQDKSWRVRYNVAQQLHMLCAALGAEASRNEIVPPFLKLLRDSEAEVRVAAAGK  306

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V  ++     +  ++ ++P V  +  D     R  +   V  +A  +G   T   LLPV 
Sbjct  307  VAAISNLLDADTVIRVVLPCVKVLAADSSQYVRSALAAVVMEMAAALGKSATIEHLLPVF  366

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            ++  KD VP+++ N+   L  +  ++   ++ +++ P +  L++D    VR 
Sbjct  367  LSLLKDDVPDVRLNIISKLDQVNQVIGIDLLGESLMPAIENLADDNHWRVRL  418



>ref|XP_002954993.1| hypothetical protein VOLCADRAFT_83018 [Volvox carteri f. nagariensis]
 gb|EFJ43981.1| hypothetical protein VOLCADRAFT_83018 [Volvox carteri f. nagariensis]
Length=584

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 145/183 (79%), Gaps = 0/183 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAI ELAED+HWRVRLAI+E+IPLLA QLG  FF +KLG  CM+ L+D+V SIR+AA   
Sbjct  399  PAIEELAEDKHWRVRLAIVEHIPLLAGQLGSEFFQEKLGPQCMKSLEDQVASIREAATRT  458

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            ++++A +FGP+WA  H++P VL +I +PHYLYRMT+L A+S+LA ++  ++ CN +LPV+
Sbjct  459  LQKVAAQFGPDWARDHLVPHVLSLIKNPHYLYRMTVLVAISMLATIVNQDVLCNLMLPVL  518

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
              A+KD+VPN+KFNVAK+++ L  +V+ +V+E TIRP L+EL ED D+DVRF+A QAL A
Sbjct  519  TAAAKDKVPNVKFNVAKIMEKLAGLVNRNVLESTIRPVLLELCEDSDMDVRFYARQALYA  578

Query  268  ADQ  260
             D 
Sbjct  579  CDH  581


 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P I + A+D+ WRVR  + + +  LA  LG+     +L    ++ L+D    +R AAA  
Sbjct  243  PIIHKFAQDKSWRVRYNVAQQLVQLAEALGIDVTRIELTPNFVRLLRDNEAEVRVAAAGK  302

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V   ++    +  +  +IP V E+  D     R  +   V  +APV+G ++T   L+P+ 
Sbjct  303  VSAFSKLLTAQQVVTSVIPCVRELSMDSSQYVRAALAGVVMEMAPVLGKQLTIEHLVPIF  362

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            +T  KD  P+++ NV   L  +  ++   ++ +++ P + EL+ED    VR 
Sbjct  363  LTLLKDVYPDVRLNVISKLDQVNQVIGIDLLAQSLLPAIEELAEDKHWRVRL  414


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/146 (27%), Positives = 72/146 (49%), Gaps = 8/146 (5%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLA----IIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDA  641
            P + EL+ D    VR A    ++E  P+L  QL +    + L  + +  LKD    +R  
Sbjct  321  PCVRELSMDSSQYVRAALAGVVMEMAPVLGKQLTI----EHLVPIFLTLLKDVYPDVRLN  376

Query  640  AANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
              + + ++ +  G +   Q ++P + E+  D H+  R+ I+  + LLA  +GSE    KL
Sbjct  377  VISKLDQVNQVIGIDLLAQSLLPAIEELAEDKHWRVRLAIVEHIPLLAGQLGSEFFQEKL  436

Query  460  LPVIITASKDRVPNIKFNVAKVLQSL  383
             P  + + +D+V +I+    + LQ +
Sbjct  437  GPQCMKSLEDQVASIREAATRTLQKV  462



>ref|XP_004363241.1| protein phosphatase 2A scaffold subunit [Dictyostelium fasciculatum]
 gb|EGG25390.1| protein phosphatase 2A scaffold subunit [Dictyostelium fasciculatum]
Length=626

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED+ WRVRLA+I+YIPLLASQLGV FFD+KLG LCM WL D V+SIR+AA NN
Sbjct  446  PAIVELAEDQQWRVRLAVIDYIPLLASQLGVEFFDEKLGNLCMTWLGDPVFSIREAATNN  505

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +++L E FG EWA  +IIP+VL + + P+YLYRMT L AV +L+PV+GS++  + ++P++
Sbjct  506  LRKLTEVFGVEWAKSNIIPKVLTLHSHPNYLYRMTTLFAVGVLSPVVGSDVIASSMIPLL  565

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQ  272
                 D+VPNI+FNVAK  Q +IP+VD +VV+  ++P L++L EDPD DV+F+ANQALQ
Sbjct  566  SKMVLDKVPNIRFNVAKTFQIIIPLVDSTVVQSRVKPSLLKLIEDPDKDVKFYANQALQ  624


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 81/172 (47%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + ++D+ WRVR  +      L   +G      +L    ++ LKD    +R  A+  
Sbjct  290  PTLRQSSQDKSWRVRYMVAHLFKELCDSMGPEITKAELVGAFVKLLKDSEAEVRTEASLR  349

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V  +      + + + I+P + ++++D     R  +   +  LAP+ G E T   L  + 
Sbjct  350  VTEVCSLISKDMSTKQILPCIRDLVSDSSQHVRAALAQVIMGLAPIFGKEDTLTHLKDLF  409

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            +   KD  P+++ N+   L S+  ++   ++ +++ P +VEL+ED    VR 
Sbjct  410  LQLLKDDFPDVRLNIISKLDSVNKVIGIEMLSQSLLPAIVELAEDQQWRVRL  461



>ref|XP_001697300.1| protein phosphatase 2A regulatory subunit [Chlamydomonas reinhardtii]
 gb|EDP00240.1| protein phosphatase 2A regulatory subunit [Chlamydomonas reinhardtii]
Length=593

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 144/183 (79%), Gaps = 0/183 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAI ELAED+HWRVRLAI+E+IPLLASQLG  FF +KLG  CM+ L+D+V SIR+A A  
Sbjct  407  PAIEELAEDKHWRVRLAIVEHIPLLASQLGAEFFQEKLGPQCMKSLEDQVASIREAGART  466

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            ++++A EFG EWA  H++P VL +I +PHYLYRMT+L A+S+LA ++  ++ CN +LPVI
Sbjct  467  LQKVAGEFGAEWARDHLVPHVLGLIKNPHYLYRMTVLVALSMLATIVSQDVLCNLMLPVI  526

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
             TA+KD+VPN+KFNVAK+++ L  +V   V+E +IRP L+EL ED D+DVRF+A QAL A
Sbjct  527  TTAAKDKVPNVKFNVAKIMEKLATLVPRPVLESSIRPVLLELCEDGDMDVRFYARQALYA  586

Query  268  ADQ  260
             D 
Sbjct  587  CDH  589


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/167 (28%), Positives = 81/167 (49%), Gaps = 0/167 (0%)
 Frame = -2

Query  793  LAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLA  614
            LA D+ WRVR  + + +  L   LG      +L    ++ L+D    +R AAA  V   +
Sbjct  256  LARDKSWRVRYNVAQQLVQLCEVLGPDVTRIELTPNFVRLLRDSEAEVRVAAAGKVAAFS  315

Query  613  EEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASK  434
            +   P+  +  +IP V E+  D     R  +   V  +AP +G  +T   L+P+ +T  K
Sbjct  316  KLLTPQQIVTSVIPCVRELSMDSSQYVRAALAGVVMEMAPTLGKALTIEHLVPIFLTLLK  375

Query  433  DRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            D  P+++ NV   L  +  ++   ++ +++ P + EL+ED    VR 
Sbjct  376  DVYPDVRLNVISKLDQVNQVIGIDLLAQSLLPAIEELAEDKHWRVRL  422


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 70/142 (49%), Gaps = 0/142 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + EL+ D    VR A+   +  +A  LG     + L  + +  LKD    +R    + 
Sbjct  329  PCVRELSMDSSQYVRAALAGVVMEMAPTLGKALTIEHLVPIFLTLLKDVYPDVRLNVISK  388

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + ++ +  G +   Q ++P + E+  D H+  R+ I+  + LLA  +G+E    KL P  
Sbjct  389  LDQVNQVIGIDLLAQSLLPAIEELAEDKHWRVRLAIVEHIPLLASQLGAEFFQEKLGPQC  448

Query  448  ITASKDRVPNIKFNVAKVLQSL  383
            + + +D+V +I+   A+ LQ +
Sbjct  449  MKSLEDQVASIREAGARTLQKV  470



>emb|CDX84995.1| BnaC05g20600D [Brassica napus]
Length=188

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 128/142 (90%), Gaps = 6/142 (4%)
 Frame = -2

Query  682  MQWLKDKVYSIRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSL  503
            MQWL+DKVYSIR+AAANN+KRLAEEFGPEWAMQH++P VLEM+++PHYL+RM +L A+SL
Sbjct  1    MQWLQDKVYSIREAAANNLKRLAEEFGPEWAMQHLVPHVLEMVSNPHYLHRMMVLRAISL  60

Query  502  LAPVMGSEITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVEL  323
            + PV+GSEITC+K LPV++ ASKDRVPN+KFNVAK+LQSLIPI    VVEKTIR CLV+L
Sbjct  61   MDPVLGSEITCSKFLPVVVEASKDRVPNVKFNVAKLLQSLIPI----VVEKTIRQCLVDL  116

Query  322  SEDP--DVDVRFFANQALQAAD  263
            SEDP  DVDVR+FANQAL++ D
Sbjct  117  SEDPDVDVDVRYFANQALRSID  138



>gb|EFA85153.1| protein phosphatase 2A scaffold subunit [Polysphondylium pallidum 
PN500]
Length=628

 Score =   236 bits (601),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED+ WRVRLAII+YIPLLASQLGV FFD+KLG LCM WL D V+SIR+AA NN
Sbjct  448  PAIVELAEDQQWRVRLAIIDYIPLLASQLGVEFFDEKLGNLCMTWLGDPVFSIREAATNN  507

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E FG EWA  +IIP+VL + + P+YLYRMT L ++ +L+PV+GS++  + ++P++
Sbjct  508  LKKLTEVFGVEWAKSNIIPKVLTLHSHPNYLYRMTTLFSIGVLSPVVGSDVIASSMIPLL  567

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQ  272
                 D+VPNI+FNVAK  Q +IP++D ++V+  ++P L++L EDPD DV+F+ANQALQ
Sbjct  568  TKMVTDKVPNIRFNVAKTFQIIIPLLDSTIVQSRVKPSLLKLLEDPDKDVKFYANQALQ  626


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/172 (24%), Positives = 82/172 (48%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P +   A+D+ WRVR  +      L   +G      +L    ++ LKD    +R  AA  
Sbjct  292  PILKSSAQDKSWRVRYMVARLFKELCDSMGQEITKSELVGSFVKLLKDTEAEVRTEAAQR  351

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V  +      + ++++I+P V ++++D     R  +   +  L P+ G + T   LL + 
Sbjct  352  VTEVCALISKDMSVKNILPCVKDLVSDVSQHVRAALAQVIMGLCPIFGKDDTLQYLLELF  411

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            +   KD  P+++ N+   L ++  ++   ++ +++ P +VEL+ED    VR 
Sbjct  412  LQLLKDDFPDVRLNIISKLDAVNKVIGIEMLSQSLLPAIVELAEDQQWRVRL  463



>ref|XP_638954.1| protein phosphatase 2A scaffold subunit [Dictyostelium discoideum 
AX4]
 sp|Q54QR9.1|2AAA_DICDI RecName: Full=Serine/threonine-protein phosphatase 2A regulatory 
subunit pppA; AltName: Full=Protein phosphatase 2A 65 kDa 
regulatory subunit; AltName: Full=Protein phosphatase 2A A 
subunit; AltName: Full=Protein phosphatase 2A scaffold subunit 
[Dictyostelium discoideum]
 gb|EAL65567.1| protein phosphatase 2A scaffold subunit [Dictyostelium discoideum 
AX4]
Length=584

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAII+YIPLLASQLGV FFD+KLG LCM WL D V+SIR+AA NN
Sbjct  404  PAIVELAEDHQWRVRLAIIDYIPLLASQLGVEFFDEKLGNLCMTWLGDPVFSIREAATNN  463

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E FG +WA  +IIP+VL + + P+YLYRMT L ++S L+ V+G ++  + ++P++
Sbjct  464  LKKLTEVFGVDWAKNNIIPKVLSLHSHPNYLYRMTTLFSISTLSTVVGGDVISSSMVPLL  523

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQ  272
                 D+VPNI+FNVAK  Q++IP++D ++V+  ++P LV+L ED D DV+F+A+QALQ
Sbjct  524  AKMVSDKVPNIRFNVAKTFQTIIPLLDSTIVQSRVKPLLVKLHEDTDKDVKFYASQALQ  582


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 80/172 (47%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P I   + D+ WRVR  +   +  L   +G      +L    ++ LKD    +R  A+  
Sbjct  248  PTIKASSLDKSWRVRYMVARLLKELCESMGTEITKTELIGAFVKLLKDTEAEVRTEASLR  307

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +  +      E  ++ I+P V ++++D     R  +   +  LAP+ G E T   LL + 
Sbjct  308  IADVCSLLTKEMNIKTILPCVKDLVSDSSQHVRAALAQVIMSLAPIYGKEDTLTHLLELF  367

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            +   KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  368  LHLLKDDFPDVRLNIISKLDQVSKVIGIEMLSQSLLPAIVELAEDHQWRVRL  419



>ref|XP_004358064.1| HEAT repeat containing protein, partial [Acanthamoeba castellanii 
str. Neff]
 gb|ELR25631.1| HEAT repeat containing protein, partial [Acanthamoeba castellanii 
str. Neff]
Length=580

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 138/181 (76%), Gaps = 1/181 (1%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAEDR WRVRLAIIEYIPLLA QLGV FFD+KLG LCM WL D V+SIR+AA NN
Sbjct  399  PAIVELAEDRQWRVRLAIIEYIPLLADQLGVAFFDEKLGFLCMTWLGDCVFSIREAATNN  458

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMG-SEITCNKLLPV  452
            +K+L E FG EWA  +IIP+VL +   P+YLYRMT L A+S+LA V G  E+  N +LP+
Sbjct  459  LKKLTEVFGVEWAQNNIIPKVLALYTHPNYLYRMTTLFAISVLAEVKGMKEVIQNSMLPL  518

Query  451  IITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQ  272
            +I  + D VPNI+FNVAK L +LI  +D +VV+  +RPCL  L +D D DV+F+A +AL+
Sbjct  519  VIRMADDPVPNIRFNVAKTLYTLIKYLDATVVQNKVRPCLQNLEKDKDRDVQFYAGRALR  578

Query  271  A  269
            A
Sbjct  579  A  579


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 85/172 (49%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P +   + D+ WRVR  + E+   L   +G      +L    ++ L+D    +R AAA  
Sbjct  243  PVVRATSVDKSWRVRYMMAEHFVELCDAMGPEITQAELIPAFVRLLRDTEAEVRTAAAFK  302

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V  +A++   + +++H++P V E++ D     R  +   +  LAPV G E T   LL + 
Sbjct  303  VTGVAKKLPADVSIKHLLPCVKELVTDSSQHARAALASVIMGLAPVFGREHTIEHLLDLF  362

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            +   +D  P ++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  363  LQLLRDDFPEVRLNIISKLDEVNKVIGVEMLSQSLLPAIVELAEDRQWRVRL  414



>ref|XP_004671588.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Jaculus jaculus]
Length=265

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N
Sbjct  82   PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSN  141

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FG EWA   IIP+VL M  DP+YL+RMT L  +++L+ V G +IT N +LP +
Sbjct  142  LKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTNHMLPTV  201

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  202  LRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPTLEKLTQDQDVDVKYFAQEAL  259



>dbj|GAM25934.1| hypothetical protein SAMD00019534_091090 [Acytostelium subglobosum 
LB1]
Length=665

 Score =   229 bits (584),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 144/180 (80%), Gaps = 1/180 (1%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED+ WRVRLAIIEYIPLLASQLGV FFD+KLG LCM WL D V+SIR+AA NN
Sbjct  484  PAIVELAEDQQWRVRLAIIEYIPLLASQLGVEFFDEKLGNLCMTWLGDSVFSIREAATNN  543

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E F  EWA   IIP+VL + + P+YLYRMT L A+S+L+PV+GS++  + ++P++
Sbjct  544  LKKLTEVFSVEWAKSTIIPKVLTLHSHPNYLYRMTTLFAISVLSPVVGSDVISSSMIPLL  603

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVEL-SEDPDVDVRFFANQALQ  272
               + D+VPNI+FNVAK LQ +IP++D ++V+  ++P L +L S++ D DV+F+ANQALQ
Sbjct  604  SKMATDKVPNIRFNVAKTLQIIIPLIDSTLVQSKVKPLLTKLISDETDKDVKFYANQALQ  663


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 81/172 (47%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P +   A+D+ WRVR  + ++   L   +G      +L    ++ LKD    +R  AA  
Sbjct  328  PILKSSAQDKSWRVRYMVAKFFKELCDSMGPEITRSELVPAFVKLLKDTEPEVRTEAAQR  387

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V  +      + A++ I+P V ++++D     R  +   +  LAP+ G + T   LL + 
Sbjct  388  VTEVCSIIPKDVAIKSILPCVKDLVSDSSQHVRAALAQVIMGLAPIFGKDDTRQHLLDLF  447

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            +   KD  P ++ N+   L  +  ++   ++  ++ P +VEL+ED    VR 
Sbjct  448  LQLLKDDFPEVRLNIISKLDQVNKVIGIEMLSHSLLPAIVELAEDQQWRVRL  499



>gb|AAB03670.1| phosphoprotein phosphatase A [Dictyostelium discoideum]
Length=584

 Score =   227 bits (579),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAII+YIPLLASQLGV FFD+KLG LCM WL D V+SIR+AA NN
Sbjct  404  PAIVELAEDHQWRVRLAIIDYIPLLASQLGVEFFDEKLGNLCMTWLGDPVFSIREAATNN  463

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E FG +WA  +IIP+VL + + P+Y YRMT L ++S L+ V+G ++  + ++P++
Sbjct  464  LKKLTEVFGVDWAKNNIIPKVLSLHSHPNYFYRMTTLFSISTLSTVVGGDVIFSSMVPLL  523

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQ  272
                 D+VPNI+FNVAK  Q++IP++D ++V+  ++P LV+L ED D DV+F+A+QALQ
Sbjct  524  AKMVSDKVPNIRFNVAKTFQTIIPLLDSTIVQSRVKPLLVKLHEDTDKDVKFYASQALQ  582


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 80/172 (47%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P I   + D+ WRVR  +   +  L   +G      +L    ++ LKD    +R  A+  
Sbjct  248  PTIKASSLDKSWRVRYMVARLLKELCESMGTEITKTELIGAFVKLLKDTEAEVRTEASLR  307

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +  +      E  ++ I+P V ++++D     R  +   +  LAP+ G E T   LL + 
Sbjct  308  IADVCSLLTKEMNIKTILPCVKDLVSDSSQHVRAALAQVIMSLAPIYGKEDTLTHLLELF  367

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            +   KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  368  LHLLKDDFPDVRLNIISKLDQVSKVIGIEMLSQSLLPAIVELAEDHQWRVRL  419



>pdb|3C5W|A Chain A, Complex Between Pp2a-Specific Methylesterase Pme-1 And 
Pp2a Core Enzyme
Length=232

 Score =   217 bits (552),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N
Sbjct  49   PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSN  108

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FG EWA   IIP+VL M  DP+YL+RMT L  +++L+ V G +IT   +LP +
Sbjct  109  LKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTV  168

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  169  LRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEAL  226



>ref|XP_006746607.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Leptonychotes weddellii]
Length=235

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N
Sbjct  52   PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSN  111

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FG EWA   IIP+VL M  DP+YL+RMT L  +++L+ V G +IT   +LP +
Sbjct  112  LKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTV  171

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  172  LRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEAL  229



>dbj|GAM23034.1| hypothetical protein SAMD00019534_062090 [Acytostelium subglobosum 
LB1]
Length=581

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED+ WRVRLAII+YIPLLASQLGV FFD+KLG LCM WL D V+SIR+A+ NN
Sbjct  399  PAIVELAEDQQWRVRLAIIDYIPLLASQLGVEFFDEKLGNLCMTWLGDPVFSIREASTNN  458

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +++L E FG EWA   +IP+VL + + P+YLYRMT L ++ +LAPV+GS++  + ++P++
Sbjct  459  LRKLTEVFGVEWAKTSVIPKVLTLHSHPNYLYRMTTLFSIGVLAPVVGSDVISSSMVPLL  518

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVEL-SEDPDVDVRFFANQALQ  272
               + D+VPNI+FNVAK  + +IP +D ++V+  +RP L +L ++D D DV+F+ANQALQ
Sbjct  519  SKMASDKVPNIRFNVAKTFECIIPYIDSTLVQSKVRPLLTKLQNDDQDKDVKFYANQALQ  578


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 83/172 (48%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P +   A D+ WRVR  +      L   +G      +L    ++ LKD    +R  AA  
Sbjct  243  PILKSSANDKSWRVRYMVARLFKELCEAMGPEITRSELLGCFVKLLKDTESEVRTEAAQR  302

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            V  ++     +   + I+P V +++ DP    R  +  ++  LAP++G E T N LL + 
Sbjct  303  VTEVSTFISKDMCAKIILPCVKDLVTDPSQHVRAALAQSIMGLAPILGKEDTLNHLLNIF  362

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            +   KD  P+++ N+   L ++  ++   ++ +++ P +VEL+ED    VR 
Sbjct  363  LQLLKDDFPDVRLNIISKLDTVNQVIGIEMLSQSLLPAIVELAEDQQWRVRL  414



>ref|XP_006376761.1| hypothetical protein POPTR_0012s06200g [Populus trichocarpa]
 ref|XP_006376762.1| hypothetical protein POPTR_0012s06200g [Populus trichocarpa]
 gb|ERP54558.1| hypothetical protein POPTR_0012s06200g [Populus trichocarpa]
 gb|ERP54559.1| hypothetical protein POPTR_0012s06200g [Populus trichocarpa]
Length=115

 Score =   211 bits (538),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = -2

Query  589  MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASKDRVPNIKF  410
            MQHI+PQVL++IN+PHYLYRMTILHAVSLL+PVMGSEITC++LLP++I ASKDRVPNIKF
Sbjct  1    MQHIVPQVLDLINNPHYLYRMTILHAVSLLSPVMGSEITCSQLLPIVINASKDRVPNIKF  60

Query  409  NVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQVMMSS  245
            NVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVRFFA QALQ++D VMMS+
Sbjct  61   NVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRFFATQALQSSDHVMMST  115



>ref|XP_001625764.1| predicted protein [Nematostella vectensis]
 gb|EDO33664.1| predicted protein [Nematostella vectensis]
Length=586

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 137/180 (76%), Gaps = 0/180 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL  LCM WL D V SIR+AAA N
Sbjct  406  PAIVELAEDTKWRVRLAIIEYMPLLAGQLGVDFFDEKLNTLCMSWLVDHVCSIREAAAIN  465

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FGPEWA Q +IP+VL M  +P+YL+R+T L++VS+LA V G E     +LPV+
Sbjct  466  LKKLVEKFGPEWAQQQVIPKVLAMAREPNYLHRLTTLNSVSVLADVCGPENISKLMLPVV  525

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +  + D V N++FNVAK LQ + P++D S ++  I+PCL +L+ D DVDV++FA +AL A
Sbjct  526  LNLATDNVANVRFNVAKTLQKIGPLLDASTIQAQIKPCLDKLNADADVDVKYFAQEALTA  585


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/176 (28%), Positives = 84/176 (48%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P +   A D+ WRVR  + + I  L   +G      +L       LKD    +R AAA  
Sbjct  246  PTVKSAAYDKSWRVRYMVADKITELQKAVGPEITKTELVPAFQVLLKDCEAEVRAAAAGK  305

Query  628  VKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK  +E    +      M +I+P V E++ DP+   +  +   +  L+P++G + T   L
Sbjct  306  VKEFSESLSSDIRESVLMTNILPCVKELVIDPNQHVKSALASVIMGLSPLLGKDNTIEHL  365

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +T  KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  366  LPLFLTMLKDEFPEVRLNIISNLDCVNQVIGVHQLSQSLLPAIVELAEDTKWRVRL  421



>ref|XP_003290313.1| phosphoprotein phosphatase A [Dictyostelium purpureum]
 gb|EGC33157.1| phosphoprotein phosphatase A [Dictyostelium purpureum]
Length=579

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 138/179 (77%), Gaps = 0/179 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAII+YIPLLASQLGV FFD+KLG LCM WL D V+SIR+AA NN
Sbjct  399  PAIVELAEDHQWRVRLAIIDYIPLLASQLGVEFFDEKLGNLCMTWLGDSVFSIREAATNN  458

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +++L E FG EWA  +IIP+VL + + P+YLYRMT L ++S L+ V+G ++    ++P++
Sbjct  459  LRKLTEVFGVEWAKNNIIPKVLSLHSHPNYLYRMTTLFSISTLSTVVGGDLISQAMVPLL  518

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQ  272
                 D+VPNI+FNVAK  Q++IP++D +VV+  ++P L++L ED D DV+F++ QAL 
Sbjct  519  AKMVSDKVPNIRFNVAKTFQTIIPLLDSTVVQSRVKPLLLKLQEDTDKDVKFYSMQALN  577


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/172 (26%), Positives = 82/172 (48%), Gaps = 0/172 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P I   + D+ WRVR  +   +  L   +G     ++L    ++ LKD    +R  AA  
Sbjct  243  PTIKSCSLDKSWRVRYMVARLLKELCESMGPEITKNELVGAFVKLLKDTEAEVRTEAALR  302

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +  +      E +++ I+P V ++++D     R  +   +  LAPV G E T   LL + 
Sbjct  303  IADVCSLLPKEISIKTILPCVKDLVSDSSQHVRAALAQVIMSLAPVFGKEDTVAHLLELF  362

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            +   KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  363  LQLLKDDFPDVRLNIISKLDQVSKVIGIEMLAQSLLPAIVELAEDHQWRVRL  414



>gb|KFM75065.1| Serine/threonine-protein phosphatase 2A regulatory subunit A 
alpha isoform, partial [Stegodyphus mimosarum]
Length=409

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL  LCM WL D V++IR+AA  N
Sbjct  227  PAIVELAEDSKWRVRLAIIEYMPLLAGQLGVEFFDEKLNTLCMTWLVDHVFAIREAATQN  286

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FGP+WA   +IP+VL M  D +YL+RMT L  V++LA   G EIT   +LP +
Sbjct  287  LKKLVEKFGPDWATNTVIPKVLTMSQDQNYLHRMTCLFCVNVLAEACGPEITAKYMLPTV  346

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +  + D V N++FNVAK LQ + P++D++ +E  ++PCL +L+ D D+DVR+FA++AL A
Sbjct  347  LGLANDNVANVRFNVAKTLQRIGPVLDNAALESQVKPCLDKLNNDNDMDVRYFASEALAA  406


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/176 (26%), Positives = 86/176 (49%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + +    +   +G       L       LKD    +R AAA+ 
Sbjct  67   PILRQAAEDKSWRVRYMVADKFNEIQKAVGPEITKTDLVPAFQNLLKDCEAEVRAAAAHK  126

Query  628  VK----RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK     L  +   +  M +I+P + E++ D +   +  +   +  L+P++G + T   L
Sbjct  127  VKDFCQNLPTDIQEQVIMSNILPCIKELVADANQHVKSALASVIMGLSPILGKQNTVEHL  186

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ ++  KD  P+++ N+   L  +  ++  + + +++ P +VEL+ED    VR 
Sbjct  187  LPLFLSQLKDECPDVRLNIISNLDCVNEVIGITQLSQSLLPAIVELAEDSKWRVRL  242



>emb|CDX87453.1| BnaA07g34200D [Brassica napus]
Length=154

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 118/137 (86%), Gaps = 8/137 (6%)
 Frame = -2

Query  673  LKDKVYSIRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAP  494
            L  KVYSIR+AAANN+KR AEEFGPEWAMQH++PQVL+M+ +PHYL+RM +L A+SL+AP
Sbjct  19   LFGKVYSIREAAANNLKRFAEEFGPEWAMQHLVPQVLDMVTNPHYLHRMMVLRAISLMAP  78

Query  493  VMGSEITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSED  314
            VMGSEITC+K LPV+  ASKDRVPN+KFNVAK+LQSLIPIVD S        CLV+LSED
Sbjct  79   VMGSEITCSKFLPVVAEASKDRVPNVKFNVAKLLQSLIPIVDQS--------CLVDLSED  130

Query  313  PDVDVRFFANQALQAAD  263
            PDVDVR+FANQAL++ D
Sbjct  131  PDVDVRYFANQALRSID  147



>gb|ETE63053.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A alpha isoform, partial [Ophiophagus hannah]
Length=572

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 138/178 (78%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N
Sbjct  389  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSN  448

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FG +WA   IIP+VL M NDP+YL+RMT L  +++L+ V G EIT   +LP +
Sbjct  449  LKKLVEKFGKDWAHATIIPKVLAMSNDPNYLHRMTTLFCINVLSEVCGQEITTKHMLPTV  508

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++DPDVDV++FA +AL
Sbjct  509  LRMAGDAVANVRFNVAKSLQKIGPILDNSTLQNEVKPVLEKLTQDPDVDVKYFAQEAL  566


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 82/180 (46%), Gaps = 15/180 (8%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCM----QWLKDKVYSIRDA  641
            P    LA D    VRL  +E    +A  L      + L +L M    Q  +DK + +R  
Sbjct  232  PMFSNLASDEQDSVRLLAVEACVNIAQLL----LQEDLESLVMPTLRQAAEDKSWRVRYM  287

Query  640  AANNVKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEIT  473
             A   ++  E   P+      M  I+P + E+++D +   +  +   +  L+P++G + T
Sbjct  288  VA---EKFTENLSPDCRENIIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNT  344

Query  472  CNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
               LLP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  345  IEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  404



>gb|ACN58639.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Salmo salar]
Length=256

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 133/178 (75%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL  LCM WL D VY+IR+AA  N
Sbjct  73   PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNTLCMAWLIDHVYAIREAATCN  132

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + +L E+FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+ V G +IT  ++LPV+
Sbjct  133  LMKLVEKFGAEWAQNTIVPKVLGMANDPNYLHRMTTLFCINALSEVCGQDITTKQMLPVV  192

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  S D+V N++FNVAK LQ + P++D + ++  ++P L +L  D D+DV++FA +A+
Sbjct  193  LKMSNDQVANVRFNVAKSLQKIGPVLDSNALQTEVKPVLEKLDTDTDMDVKYFAQEAI  250



>ref|XP_007441284.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Python bivittatus]
Length=589

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 138/178 (78%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N
Sbjct  406  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSN  465

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FG +WA   IIP+VL M NDP+YL+RMT L  +++L+ V G EIT   +LP +
Sbjct  466  LKKLVEKFGKDWAHATIIPKVLAMSNDPNYLHRMTTLFCINVLSEVCGQEITTKHMLPTV  525

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++DPDVDV++FA +AL
Sbjct  526  LRMAGDAVANVRFNVAKSLQKIGPILDNSTLQNEVKPVLEKLTQDPDVDVKYFAQEAL  583


 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 83/176 (47%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + E    L   +G       L       +KD    +R AA++ 
Sbjct  246  PTLRQAAEDKSWRVRYMVAEKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASSK  305

Query  628  VKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK   E   P+      M  I+P + E+++D +   +  +   +  L+P++G + T   L
Sbjct  306  VKEFCENLSPDCRENIIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHL  365

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  366  LPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  421



>pdb|4LAC|A Chain A, Crystal Structure Of Protein Phosphatase 2a (pp2a) And 
Pp2a Phosphatase Activator (ptpa) Complex With Atpgammas
Length=258

 Score =   213 bits (543),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P IVELAED  WRVRLAIIEY+PLLA QLGV +FD+KL +LCM WL D VY+IR+AA +N
Sbjct  75   PFIVELAEDAKWRVRLAIIEYMPLLAGQLGVEYFDEKLNSLCMAWLVDHVYAIREAATSN  134

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FG EWA   IIP+VL M  DP+YL+RMT L  +++L+ V G +IT   +LP +
Sbjct  135  LKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTV  194

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  195  LRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEAL  252



>ref|XP_005404518.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform X3 [Chinchilla 
lanigera]
Length=462

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEYIPLLA QLGV FFD+KL +LCM  L D VY+IR+AA +N
Sbjct  279  PAIVELAEDAKWRVRLAIIEYIPLLAGQLGVEFFDEKLNSLCMACLMDHVYAIREAATSN  338

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FG EWA   IIP+VL M  DP+YLYRMT L  +++L+ V G +IT  ++LP +
Sbjct  339  LKKLVEKFGREWARAAIIPKVLAMSGDPNYLYRMTTLFCINVLSEVCGQDITTKQMLPTV  398

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D V NI+FNVAK LQ + PI+D+S+++  ++P L +L++D DVDV++F+ QAL
Sbjct  399  LQMAGDPVANIRFNVAKSLQKIGPILDNSILQSKVKPILEKLTQDQDVDVKYFSQQAL  456


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 84/176 (48%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + E +  L   +G      +L  +    + D    +R AA+  
Sbjct  119  PTLSQAAEDKSWRVRYMVAEKVTELQKAVGPEITKTELVPIFQNLMNDFEAEVRAAASQK  178

Query  628  VKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK   E    +      M  I+P + E+ +D ++L +  +   +  L+PV+G + T   L
Sbjct  179  VKEFCENLSDDCRENVIMTQILPCIKELASDNNHLVKSALASVIMGLSPVLGKDNTIEHL  238

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  239  LPLFLAQLKDECPEVRLNIISNLDCVNQVIGVRQLSQSLLPAIVELAEDAKWRVRL  294



>gb|KFO36119.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A alpha isoform [Fukomys damarensis]
Length=589

 Score =   222 bits (565),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAI+EYIPLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N
Sbjct  406  PAIVELAEDAKWRVRLAIVEYIPLLAGQLGVEFFDEKLNSLCMAWLMDHVYAIREAATSN  465

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FG EWA   IIP+VL M  DP+YLYRMT L  V++L+ V G +IT   +LP +
Sbjct  466  LKKLVEKFGKEWACATIIPKVLAMSRDPNYLYRMTTLFCVNVLSEVCGQDITTKLMLPTV  525

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            ++ + D V NI+FNVAK LQ + PI+D+S ++  +RP L +L++D DVDV++F+ +AL
Sbjct  526  LSMAGDPVANIRFNVAKSLQKIGPILDNSTLQSKVRPILEKLTQDQDVDVKYFSQEAL  583


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 83/176 (47%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PA+ ++AED+ WRVR  + +    L   +G       L  +    + D    +R AA+  
Sbjct  246  PALSQIAEDKSWRVRYMVADKFTELQKAVGSEITKTDLVPVFQNLMNDCEAEVRAAASQK  305

Query  628  VKRLAEEFGPEW----AMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK   E    +      M  I+P + E+ +D ++  +  +   +  L+P++G + T   L
Sbjct  306  VKEFCENLPADCRENVVMTQILPCIKELASDTNHHVKSALASVIMGLSPILGKDNTIEHL  365

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  366  LPLFLAQLKDECPEVRLNIISNLNCVNQVIGIQQLSQSLLPAIVELAEDAKWRVRL  421



>emb|CDY70440.1| BnaAnng33670D, partial [Brassica napus]
Length=155

 Score =   209 bits (532),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 116/133 (87%), Gaps = 8/133 (6%)
 Frame = -2

Query  661  VYSIRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGS  482
            VYSIR+AAANN+KR AEEFGPEWAMQH++PQVL+M+ +PHYL+RM +L A+SL+APVMGS
Sbjct  24   VYSIREAAANNLKRFAEEFGPEWAMQHLVPQVLDMVTNPHYLHRMMVLRAISLMAPVMGS  83

Query  481  EITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVD  302
            EITC+K LPV+  ASKDRVPN+KFNVAK+LQSLIPIVD S        CLV+LSEDPDVD
Sbjct  84   EITCSKFLPVVAEASKDRVPNVKFNVAKLLQSLIPIVDQS--------CLVDLSEDPDVD  135

Query  301  VRFFANQALQAAD  263
            VR+FANQAL++ D
Sbjct  136  VRYFANQALRSID  148



>ref|XP_004316880.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Tursiops truncatus]
 ref|XP_004694117.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Condylura cristata]
Length=410

 Score =   217 bits (552),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N
Sbjct  227  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSN  286

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FG EWA   IIP+VL M  DP+YL+RMT L  +++L+ V G +IT   +LP +
Sbjct  287  LKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTV  346

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  347  LRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEAL  404


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 82/176 (47%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + +    L   +G       L       +KD    +R AA++ 
Sbjct  67   PTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHK  126

Query  628  VKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK   E    +      M  I+P + E+++D +   +  +   +  L+P++G + T   L
Sbjct  127  VKEFCENLSADCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHL  186

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  187  LPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  242



>dbj|BAG52168.1| unnamed protein product [Homo sapiens]
Length=410

 Score =   217 bits (552),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N
Sbjct  227  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSN  286

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FG EWA   IIP+VL M  DP+YL+RMT L  +++L+ V G +IT   +LP +
Sbjct  287  LKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTV  346

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  347  LRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEAL  404


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 82/176 (47%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + +    L   +G       L       +KD    +R AA++ 
Sbjct  67   PTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHK  126

Query  628  VKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK   E    +      M  I+P + E+++D +   +  +   +  L+P++G + T   L
Sbjct  127  VKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHL  186

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  187  LPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  242



>ref|XP_008969519.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform X2 [Pan paniscus]
Length=365

 Score =   215 bits (548),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA NN
Sbjct  182  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNN  241

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + +L ++FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+   G EIT  ++LP++
Sbjct  242  LMKLVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIV  301

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D+V N++FNVAK LQ + PI+D + ++  ++P L +L +D D+DV++FA +A+
Sbjct  302  LKMAGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAI  359


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 75/180 (42%), Gaps = 18/180 (10%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCM----QWLKDKVYSIRDA  641
            P    LA D    VRL  +E    +A  L      D L  L M    Q  +DK + +R  
Sbjct  28   PLFTSLASDEQDSVRLLAVEACVSIAQLLS----QDDLETLVMPTLRQAAEDKSWRVRYM  83

Query  640  AANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLA---PVMGSE-IT  473
             A+    L +  GP+  +  +IP    ++ D     R    H V  L    P+   E I 
Sbjct  84   VADRFSELQKAMGPKITLNDLIPAFQNLLKDCEAEVRAAAAHKVKELGENLPIEDRETII  143

Query  472  CNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
             N++LP I      + P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  144  MNQILPYI------KCPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  197



>ref|NP_001272048.1| uncharacterized protein LOC101865435 [Macaca fascicularis]
 dbj|BAE87279.1| unnamed protein product [Macaca fascicularis]
Length=425

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N
Sbjct  242  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSN  301

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FG EWA   IIP+VL M  DP+YL+RMT L  +++L+ V G +IT   +LP +
Sbjct  302  LKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTV  361

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  362  LRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEAL  419


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 82/176 (47%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + +    L   +G       L       +KD    +R AA++ 
Sbjct  82   PTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHK  141

Query  628  VKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK   E    +      M  I+P + E+++D +   +  +   +  L+P++G + T   L
Sbjct  142  VKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHL  201

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  202  LPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  257



>ref|XP_008174129.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Chrysemys picta bellii]
Length=537

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N
Sbjct  354  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSN  413

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FG +WA   IIP+VL M NDP+YL+RMT L  +++L+ V G EIT   +LP +
Sbjct  414  LKKLVEKFGKDWAHATIIPKVLAMSNDPNYLHRMTTLFCINVLSEVCGQEITTKHMLPTV  473

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  474  LRMAGDAVANVRFNVAKSLQKIGPILDNSTLQNEVKPVLEKLTQDQDVDVKYFAQEAL  531


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 82/176 (47%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + +    L   +G       L       +KD    +R AA++ 
Sbjct  194  PTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHK  253

Query  628  VKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK   E    +      M  I+P + E+++D +   +  +   +  L+P++G + T   L
Sbjct  254  VKEFCENLSADCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHL  313

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  314  LPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  369



>ref|XP_008969515.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform X1 [Pan paniscus]
Length=410

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA NN
Sbjct  227  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNN  286

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + +L ++FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+   G EIT  ++LP++
Sbjct  287  LMKLVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIV  346

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D+V N++FNVAK LQ + PI+D + ++  ++P L +L +D D+DV++FA +A+
Sbjct  347  LKMAGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAI  404


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 83/176 (47%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + +    L   +G     + L       LKD    +R AAA+ 
Sbjct  67   PTLRQAAEDKSWRVRYMVADRFSELQKAMGPKITLNDLIPAFQNLLKDCEAEVRAAAAHK  126

Query  628  VKRLAEEFGPE----WAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK L E    E      M  I+P + E+++D +   +  +   +  L+ ++G E T   L
Sbjct  127  VKELGENLPIEDRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKENTIEHL  186

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  187  LPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  242



>ref|XP_002162841.2| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Hydra vulgaris]
Length=587

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAI+ELAED  WRVRLAIIEY+PLLA QLG+ FFD+KL ALCM WL D VY+IR+AAA N
Sbjct  407  PAIMELAEDPKWRVRLAIIEYMPLLAGQLGMQFFDEKLSALCMSWLVDHVYAIREAAALN  466

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FG  WA  ++IP+VL M  D +YL+RMT L A++ +  V   +ITC  +LP +
Sbjct  467  LKKLVEKFGLTWAQSNVIPKVLAMSKDTNYLHRMTTLFAINTMIEVCEPDITCKLILPTV  526

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            ++ +KD V N++FNVAK LQ + P  D +VV  TI+PCL +L++D DVDV++FA  AL A
Sbjct  527  LSLAKDSVANVRFNVAKTLQKIAPTTDTTVVNGTIKPCLTQLNQDSDVDVKYFAGVALSA  586


 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 90/176 (51%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P++   A+D+ WRVR  + + I  L   +G      +L       LKD    ++ AAA+ 
Sbjct  247  PSLRNAAQDKSWRVRYMVADKIVELQKAVGPEINKQELVPAFASLLKDGEAEVKTAAAHK  306

Query  628  VKR----LAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK     L E+   +  M  ++P V +++ DP+   +  +   +  L+P++G + T   L
Sbjct  307  VKEFCENLPEDIREQSIMMTLLPCVKDLVIDPNMHVKAALAGVIMGLSPMLGKDNTIEHL  366

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +T  KD  P+++ N+   L S+  ++    + +++ P ++EL+EDP   VR 
Sbjct  367  LPLFLTMLKDEFPDVRLNIISNLDSVNQVIGIHQLSQSLLPAIMELAEDPKWRVRL  422



>ref|XP_007173032.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform X2 [Balaenoptera acutorostrata 
scammoni]
Length=473

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 137/178 (77%), Gaps = 1/178 (1%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA NN
Sbjct  291  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNN  350

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + +L ++FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+ V G EIT  ++LPV+
Sbjct  351  LMKLVQKFGKEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEVCGQEITTKQMLPVV  410

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  ++D+V N++FNVAK LQ + PI+D   +E+ ++P L +L +D DVDV++FA +A+
Sbjct  411  LKMARDQVANVRFNVAKSLQKIGPILDTDALEE-VKPVLQKLGQDEDVDVKYFAQEAI  467


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/176 (27%), Positives = 82/176 (47%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + +    L   +G     + L       LKD    +R AAA+ 
Sbjct  131  PTLRQAAEDKSWRVRYMVADKFSELQKAVGPKITLNDLIPAFQNLLKDCEAEVRAAAAHK  190

Query  628  VKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK L E    E      M  I+P + E+++D +   +  +   +  L+ ++G   T   L
Sbjct  191  VKELCENLPMEGRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKGNTIEHL  250

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  251  LPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  306



>ref|XP_005404517.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform X2 [Chinchilla 
lanigera]
Length=546

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEYIPLLA QLGV FFD+KL +LCM  L D VY+IR+AA +N
Sbjct  363  PAIVELAEDAKWRVRLAIIEYIPLLAGQLGVEFFDEKLNSLCMACLMDHVYAIREAATSN  422

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FG EWA   IIP+VL M  DP+YLYRMT L  +++L+ V G +IT  ++LP +
Sbjct  423  LKKLVEKFGREWARAAIIPKVLAMSGDPNYLYRMTTLFCINVLSEVCGQDITTKQMLPTV  482

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D V NI+FNVAK LQ + PI+D+S+++  ++P L +L++D DVDV++F+ QAL
Sbjct  483  LQMAGDPVANIRFNVAKSLQKIGPILDNSILQSKVKPILEKLTQDQDVDVKYFSQQAL  540



>ref|XP_007054025.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Chelonia mydas]
 gb|EMP41291.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A alpha isoform [Chelonia mydas]
Length=605

 Score =   220 bits (560),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N
Sbjct  422  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSN  481

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FG +WA   IIP+VL M NDP+YL+RMT L  +++L+ V G EIT   +LP +
Sbjct  482  LKKLVEKFGKDWAHATIIPKVLAMSNDPNYLHRMTTLFCINVLSEVCGQEITTKHMLPTV  541

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  542  LRMAGDAVANVRFNVAKSLQKIGPILDNSTLQNEVKPVLEKLTQDQDVDVKYFAQEAL  599


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 79/181 (44%), Gaps = 9/181 (5%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + +    L   +G       L       +KD    +R AA++ 
Sbjct  257  PTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHK  316

Query  628  VKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK   E    +      M  I+P + E+++D +   +  +   +  L+P++G +     L
Sbjct  317  VKEFCENLSADCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGQDNNIEHL  376

Query  460  LPV-----IITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVR  296
            L        +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR
Sbjct  377  LXXXXXXXFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR  436

Query  295  F  293
             
Sbjct  437  L  437



>ref|NP_001171792.1| protein phosphatase 2, regulatory subunit A, alpha [Saccoglossus 
kowalevskii]
Length=590

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 132/180 (73%), Gaps = 0/180 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL  LCM WL D VY+IR+AA NN
Sbjct  407  PAIVELAEDTKWRVRLAIIEYMPLLAGQLGVEFFDEKLNTLCMAWLVDNVYAIREAATNN  466

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FG EWA   +IP+VL M  D +YL+RMT L  V++LA   G+E+T   +LPV+
Sbjct  467  LKKLVEKFGTEWAQNAVIPKVLLMARDQNYLHRMTCLFCVNVLADACGAEVTVKLMLPVV  526

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  269
            +    D V N++FNVAK LQ + PI+D + V+  ++ CL +L  D DVDV+FFA +AL A
Sbjct  527  LNLGGDAVANVRFNVAKTLQRVGPILDSNTVQSQVKSCLDKLGTDSDVDVKFFAQEALAA  586


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/176 (27%), Positives = 85/176 (48%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + +    +   +G       L       LKD    +R AAA+ 
Sbjct  247  PTLRQCAEDKSWRVRYMVADKFTEIQKAVGPEIAKTDLVPAFQSLLKDCEAEVRAAAAHK  306

Query  628  VKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK+  E+  P       M +I+P V E+++D +   +  +   +  L+P++G + T   L
Sbjct  307  VKKFCEDLDPSVRETVIMNNILPCVKELVSDANQHVKSALASVIMGLSPILGKDNTIEHL  366

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  367  LPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDTKWRVRL  422



>ref|XP_006114916.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like, partial [Pelodiscus sinensis]
Length=400

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +L M WL D VY+IR+AA +N
Sbjct  217  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLSMAWLVDHVYAIREAATSN  276

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FG +WA   IIP+VL M NDP+YL+RMT L  +++L+ V G EIT   +LP +
Sbjct  277  LKKLVEKFGKDWAHATIIPKVLAMSNDPNYLHRMTTLFCINVLSEVCGQEITTKHMLPTV  336

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  337  LRMAGDAVANVRFNVAKSLQKIGPILDNSTLQNEVKPVLEKLTQDQDVDVKYFAQEAL  394



>ref|XP_003225135.2| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Anolis carolinensis]
Length=614

 Score =   219 bits (559),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N
Sbjct  431  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSN  490

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FG +WA   IIP+VL M NDP+YL+RMT L  +++L+ V G EIT   +LP +
Sbjct  491  LKKLVEKFGKDWAHATIIPKVLAMSNDPNYLHRMTTLFCINVLSEVCGQEITTKHMLPTV  550

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  551  LRMAGDAVANVRFNVAKSLQKIGPILDNSTLQNEVKPVLEKLTQDADVDVKYFAQEAL  608


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/176 (26%), Positives = 83/176 (47%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + +    L   +G       L       +KD    +R AA++ 
Sbjct  271  PTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHK  330

Query  628  VKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK   E   P+      M  I+P + E+++D +   +  +   +  L+P++G + T   L
Sbjct  331  VKEFCENLSPDCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHL  390

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  391  LPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  446



>ref|XP_001418916.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97209.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=603

 Score =   219 bits (558),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 137/191 (72%), Gaps = 10/191 (5%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFF----------DDKLGALCMQWLKDKV  659
            PAI ELAED+HWRVRLAIIEYIP+LA Q+G  F           DD L +LC+QWL+D V
Sbjct  412  PAIKELAEDKHWRVRLAIIEYIPVLAQQIGTTFLFQKDEGSDSGDDLLNSLCLQWLQDSV  471

Query  658  YSIRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSE  479
            YSIR+AAANN+ RL E FG +WA+++I P++ E+++  HYLYR+T+L AVSLLAP +G E
Sbjct  472  YSIREAAANNLFRLTEIFGADWALEYIFPRIKELMSSHHYLYRLTVLRAVSLLAPAVGEE  531

Query  478  ITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDV  299
            +   ++LP+I  A+ D VPN++FN AK L  LI  +D +  +  IRP LV L  DPD DV
Sbjct  532  VILGEILPIIKHATTDTVPNVRFNAAKALSPLIKAIDVAKFQSEIRPILVGLQSDPDADV  591

Query  298  RFFANQALQAA  266
            R+FA++ L +A
Sbjct  592  RYFASEVLTSA  602


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 85/177 (48%), Gaps = 10/177 (6%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGV-----GFFDDKLGALCMQWLKDKVYSIRD  644
            P +++LA D+ WRVR A+ + I  +   +G      G FD  +       L D    +R 
Sbjct  256  PIVLKLAADKSWRVRYAVAQQIYEMCDVVGAEVAAKGLFDAYVA-----LLGDSEGEVRI  310

Query  643  AAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNK  464
            +AA  +       G  ++ + I+P+V E+ ND     R  +  AV  LAP MG + T  K
Sbjct  311  SAAGKISEFCSLAGAVYSAEKILPKVHELANDSSQHVRAALAEAVLGLAPTMGKDTTVEK  370

Query  463  LLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LLPV     KD  P+++ N+   L+ +  ++   ++   + P + EL+ED    VR 
Sbjct  371  LLPVFFILLKDEFPDVRLNIISKLEQVNTVIGVEMLSTELLPAIKELAEDKHWRVRL  427



>ref|XP_006190431.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Camelus ferus]
Length=439

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA NN
Sbjct  256  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNN  315

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + +L ++FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+   G EIT  ++LP++
Sbjct  316  LMKLVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIV  375

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D+V N++FNVAK LQ + PI+D   +++ ++P L +L +D D+DV++FA +A+
Sbjct  376  LKMAGDQVANVRFNVAKSLQKIGPILDTDALQEEVKPVLQKLGQDEDMDVKYFAQEAM  433


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 83/176 (47%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + +    L   +G     + L       LKD    +R AAA+ 
Sbjct  96   PILRQAAEDKSWRVRYMVADKFSELQKAVGPKITQNDLIPAFQNLLKDCEAEVRAAAAHK  155

Query  628  VKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK L E    E      M  I+P + E+++D +   +  +   +  L+ ++G E T   L
Sbjct  156  VKELCENLPIEGRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKENTIEHL  215

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  216  LPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  271



>ref|XP_005987322.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform X1 [Latimeria chalumnae]
Length=589

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 136/179 (76%), Gaps = 0/179 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA NN
Sbjct  406  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNN  465

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + +L E+FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+   G EIT  ++LPV+
Sbjct  466  LMKLVEKFGAEWAQNTIVPKVLAMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPVV  525

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQ  272
            +  S D+V N++FNVAK LQ + PI++++ ++  I+P L +L +D D+DV++FA +A+ 
Sbjct  526  LKMSGDQVANVRFNVAKSLQKIGPILENNTLQTEIKPVLEKLGQDQDIDVKYFAQEAIN  584


 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 83/176 (47%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + +    L   +G     + L       LKD    +R AAAN 
Sbjct  246  PILRQAAEDKSWRVRYMVADKFSELQKAVGPEITKNDLVPAFQNLLKDCEAEVRAAAANK  305

Query  628  VKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK   E    +      M HI+P V E+++D +   +  +   +  L+ ++G + T   L
Sbjct  306  VKEFCENLPADSKENIIMNHILPCVKELVSDTNQHVKSALASVIMGLSTILGKDNTIEHL  365

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  366  LPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  421



>ref|XP_005404516.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform X1 [Chinchilla 
lanigera]
Length=589

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEYIPLLA QLGV FFD+KL +LCM  L D VY+IR+AA +N
Sbjct  406  PAIVELAEDAKWRVRLAIIEYIPLLAGQLGVEFFDEKLNSLCMACLMDHVYAIREAATSN  465

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FG EWA   IIP+VL M  DP+YLYRMT L  +++L+ V G +IT  ++LP +
Sbjct  466  LKKLVEKFGREWARAAIIPKVLAMSGDPNYLYRMTTLFCINVLSEVCGQDITTKQMLPTV  525

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D V NI+FNVAK LQ + PI+D+S+++  ++P L +L++D DVDV++F+ QAL
Sbjct  526  LQMAGDPVANIRFNVAKSLQKIGPILDNSILQSKVKPILEKLTQDQDVDVKYFSQQAL  583


 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 84/176 (48%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + E +  L   +G      +L  +    + D    +R AA+  
Sbjct  246  PTLSQAAEDKSWRVRYMVAEKVTELQKAVGPEITKTELVPIFQNLMNDFEAEVRAAASQK  305

Query  628  VKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK   E    +      M  I+P + E+ +D ++L +  +   +  L+PV+G + T   L
Sbjct  306  VKEFCENLSDDCRENVIMTQILPCIKELASDNNHLVKSALASVIMGLSPVLGKDNTIEHL  365

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  366  LPLFLAQLKDECPEVRLNIISNLDCVNQVIGVRQLSQSLLPAIVELAEDAKWRVRL  421



>ref|XP_004709032.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Echinops telfairi]
Length=410

 Score =   214 bits (546),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 133/178 (75%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N
Sbjct  227  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSN  286

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + +L ++FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+   G EIT  ++LP++
Sbjct  287  LMKLVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIV  346

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D+V N++FNVAK LQ + PI+D   ++  +RP L  L +D D+DV++FA +A+
Sbjct  347  LKMAGDQVANVRFNVAKSLQKIGPILDTDALQGEVRPVLQRLGQDEDMDVKYFAQEAI  404


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/176 (27%), Positives = 82/176 (47%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + +  ED+ WRVR  + +    L   +G     + L       LKD    +R AAA+ 
Sbjct  67   PTLRQAVEDKSWRVRYMVADKFSELQKAVGPKITLNDLIPAFQNLLKDCEAEVRAAAAHK  126

Query  628  VKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK L E    E      M  I+P + E+++D +   +  +   +  L+ ++G E T   L
Sbjct  127  VKELCENLPNEGRETIIMSQILPYIKELVSDTNQHVKSALASVIMGLSTILGKENTIEHL  186

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  187  LPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  242



>ref|XP_004273471.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform 5 [Orcinus orca]
Length=474

 Score =   216 bits (550),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA N 
Sbjct  291  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNG  350

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + +L ++FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+   G EIT  ++LPV+
Sbjct  351  LVKLVQKFGKEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPVV  410

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  ++D+V N++FNVAK LQ + PI+D + +++ ++P L +L +D DVDV++FA +A+
Sbjct  411  LKMARDQVANVRFNVAKSLQKIGPILDTNALQEEVKPVLQKLGQDEDVDVKYFAQEAI  468


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/176 (27%), Positives = 82/176 (47%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + +    L   +G     + L       LKD    +R AAA+ 
Sbjct  131  PTLGQAAEDKSWRVRYMVADKFSELQKAVGPKITLNDLIPAFQNLLKDCEAEVRAAAAHK  190

Query  628  VKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK L E    E      M  I+P + E+++D +   +  +   +  L+ ++G   T   L
Sbjct  191  VKELCENLPMEGRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKGNTIEHL  250

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  251  LPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  306



>gb|ELT97469.1| hypothetical protein CAPTEDRAFT_152474 [Capitella teleta]
Length=591

 Score =   219 bits (557),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIV+LAED  WRVRLAIIEY+PLLA QLG  FFD+KL ALCM WL D V++IR+AA  N
Sbjct  408  PAIVDLAEDTKWRVRLAIIEYMPLLAGQLGTEFFDEKLNALCMTWLVDHVFAIREAATIN  467

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FGPEWA Q ++P+++ M  D +YL+RMT L +++LLA   GS++T  +LLPV+
Sbjct  468  LKKLVEKFGPEWAGQTVVPRIIPMSRDVNYLHRMTCLFSINLLAEPCGSQLTTRQLLPVV  527

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            I  + D V N++FN AK LQ L P +D   +EK ++PCL +L +DPD DV+F+A +AL
Sbjct  528  IEMAGDAVANVRFNTAKTLQKLGPQIDQPTLEKLVKPCLEKLKQDPDSDVQFYAQEAL  585


 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 85/176 (48%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + A D+ WRVR  + +    L + +G     + L A     LKD    +R AAAN 
Sbjct  248  PTLRDAANDKSWRVRYMVADKFTELQNAVGPEITKNDLVAAFQTLLKDCEAEVRAAAANK  307

Query  628  VKRLAEEFGP----EWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK   +   P    +  M +I+P V +++ D +   +  +   +  L+P++G + T   L
Sbjct  308  VKEFCQNLAPDSREQLIMTNILPCVKDLVTDANQHVKSALASVIMGLSPILGKDNTIEHL  367

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ N+   L  +  ++    + +++ P +V+L+ED    VR 
Sbjct  368  LPLFLIQLKDECPEVRLNIISNLDCVNVVIGIQQLSQSLLPAIVDLAEDTKWRVRL  423



>ref|NP_998541.1| serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Danio rerio]
 gb|AAH46055.1| Protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 
65), alpha isoform [Danio rerio]
Length=476

 Score =   216 bits (550),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 134/178 (75%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA  N
Sbjct  293  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATCN  352

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + +L E+FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+ V G EIT   +LPV+
Sbjct  353  LMKLVEKFGAEWAQNTIVPKVLGMANDPNYLHRMTTLFCINALSEVCGQEITTKHMLPVV  412

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  S D+V N++FNVAK LQ + P++D S ++  ++P L +L+ D D+DV++FA +A+
Sbjct  413  LKMSNDQVANVRFNVAKSLQKIGPVLDSSCLQTEVKPVLEKLASDQDMDVKYFAQEAI  470


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 85/177 (48%), Gaps = 7/177 (4%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + +    L   +G     + L       LKD    +R AAAN 
Sbjct  134  PTLRQAAEDKSWRVRYMVADKFSDLQKAVGPEITKNDLVPAFQNLLKDCEAEVR-AAANK  192

Query  628  VKRLAEEFGPEWA-----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNK  464
            VK   E   PE +     M HI+P V E+++D +   +  +   +  L+ ++G + T   
Sbjct  193  VKEFCENL-PEDSRETIIMTHILPCVKELVSDTNQHVKSALASVIMGLSTILGKDNTIEH  251

Query  463  LLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LLP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  252  LLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  308



>ref|XP_004689333.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Condylura cristata]
Length=410

 Score =   214 bits (545),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA NN
Sbjct  227  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNN  286

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + +L ++FG EWA   I+P+VL M +DP+YL+RMT L  ++ L+   G EIT  ++LP++
Sbjct  287  LMKLVQKFGTEWAQNAIVPKVLVMADDPNYLHRMTTLFCINALSEACGQEITTKQMLPIV  346

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D+V N++FNVAK LQ + PI+D   +++ ++P L +L +D D+DV++FA +A+
Sbjct  347  LKMAGDQVANVRFNVAKSLQKIGPILDTDALQEEVKPVLQKLGQDEDMDVKYFAQEAI  404


 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 82/176 (47%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + +    L   +G       L       LKD    +R AAA+ 
Sbjct  67   PTLRQAAEDKSWRVRYMVADKFSELQKAVGPKITQSDLIPAFQNLLKDCEAEVRAAAAHK  126

Query  628  VKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK L E    E      M  I+P + E+++D +   +  +   +  L+ ++G E T   L
Sbjct  127  VKELCENLPTEGRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKENTIEHL  186

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  187  LPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  242



>ref|XP_004413638.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform 5 [Odobenus rosmarus 
divergens]
Length=474

 Score =   216 bits (549),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA NN
Sbjct  291  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVQFFDEKLNSLCMAWLVDHVYAIREAATNN  350

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + +L ++FG EWA   I+P+VL M  DP+YL+RMT L  +++L+   G EIT  ++LP++
Sbjct  351  LMKLVKKFGTEWAQNTIVPKVLVMAGDPNYLHRMTTLFCINVLSEACGQEITTKQMLPIV  410

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D+V N++FNVAK LQ + PI+D   +++ ++P L +L +D DVDV++FA +AL
Sbjct  411  LKMAGDQVANVRFNVAKSLQKIGPILDTDALQEEVKPVLQKLGQDEDVDVKYFAQEAL  468


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/176 (28%), Positives = 84/176 (48%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + +    L   +G     + L       LKD    +R AAA+ 
Sbjct  131  PTLRQAAEDKSWRVRYMVADKFSELQKAVGPKITLNDLIPAFQNLLKDCEAEVRAAAAHK  190

Query  628  VKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK L E   PE      M  I+P + E+++D +   +  +   +  L+ ++G E T   L
Sbjct  191  VKELCENLPPEGRETIIMNQILPFIKELVSDTNQHVKSALASVIMGLSTILGKENTIEHL  250

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  251  LPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  306



>ref|XP_006868186.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform X2 [Chrysochloris 
asiatica]
Length=532

 Score =   217 bits (553),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N
Sbjct  349  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSN  408

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            +K+L E+FG EWA   IIP+VL M  DP+YL+RMT L  +++L+ V G +IT   +LP +
Sbjct  409  LKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTV  468

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D V N++FNVAK LQ + PI+D+S ++  ++P L +LS+D DVDV++FA +AL
Sbjct  469  LRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPVLEKLSQDQDVDVKYFAQEAL  526


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 82/176 (47%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + +    L   +G       L       +KD    +R AA++ 
Sbjct  189  PTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHK  248

Query  628  VKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK   E    +      M  I+P + E+++D +   +  +   +  L+P++G + T   L
Sbjct  249  VKEFCENLSADCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHL  308

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  309  LPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  364



>ref|XP_004382552.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform 5 [Trichechus manatus 
latirostris]
Length=474

 Score =   216 bits (549),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 134/178 (75%), Gaps = 0/178 (0%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            PAIVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA NN
Sbjct  291  PAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNN  350

Query  628  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  449
            + +L ++FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+   G EIT  ++LP++
Sbjct  351  LMKLVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIV  410

Query  448  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  275
            +  + D+V N++FNVAK LQ + PI+D   ++  ++P L +L +D D+DV++FA +A+
Sbjct  411  LKMAGDQVANVRFNVAKSLQKIGPILDTDALQGEVKPVLQKLGQDEDIDVKYFAQEAI  468


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/176 (28%), Positives = 83/176 (47%), Gaps = 4/176 (2%)
 Frame = -2

Query  808  PAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  629
            P + + AED+ WRVR  + +    L   +G     + L       LKD    +R AAA+ 
Sbjct  131  PTLQQAAEDKSWRVRYMVADKFSELQKAVGPKITLNDLIPAFQNLLKDCEAEVRAAAAHK  190

Query  628  VKRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKL  461
            VK L E    E      M  I+P + E+++D +   +  +   +  L+ ++G E T   L
Sbjct  191  VKELCENLPIEGRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKENTIEHL  250

Query  460  LPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  293
            LP+ +   KD  P ++ NV   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  251  LPLFLAQLKDECPEVRLNVISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  306



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1683214431688