BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9962

Length=784
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767734.1|  PREDICTED: uncharacterized protein LOC104218849    236   4e-68   Nicotiana sylvestris
ref|XP_009622867.1|  PREDICTED: uncharacterized protein LOC104114193    236   4e-68   Nicotiana tomentosiformis
ref|XP_004239152.1|  PREDICTED: uncharacterized protein LOC101249174    234   2e-67   Solanum lycopersicum
ref|XP_010320950.1|  PREDICTED: uncharacterized protein LOC101249...    232   3e-67   Solanum lycopersicum
gb|ADN32812.1|  sieve element occlusion c                               233   5e-67   Solanum phureja [chaucha]
ref|XP_006341794.1|  PREDICTED: uncharacterized protein LOC102602329    233   6e-67   Solanum tuberosum [potatoes]
ref|XP_004239153.1|  PREDICTED: uncharacterized protein LOC101249...    233   6e-67   Solanum lycopersicum
gb|ADN32811.1|  sieve element occlusion b                               232   9e-67   Solanum phureja [chaucha]
ref|XP_004237262.1|  PREDICTED: uncharacterized protein LOC101263509    230   4e-66   Solanum lycopersicum
emb|CDP13257.1|  unnamed protein product                                199   1e-54   Coffea canephora [robusta coffee]
ref|XP_006387170.1|  hypothetical protein POPTR_1619s002001g            171   3e-49   
emb|CAN83922.1|  hypothetical protein VITISV_026532                     181   8e-49   Vitis vinifera
ref|XP_002282172.1|  PREDICTED: uncharacterized protein LOC100261038    181   9e-49   Vitis vinifera
ref|XP_006388019.1|  hypothetical protein POPTR_0395s002002g            172   3e-48   
ref|XP_006378256.1|  hypothetical protein POPTR_0010s06010g             178   1e-47   
ref|XP_011012451.1|  PREDICTED: uncharacterized protein LOC105116695    177   3e-47   Populus euphratica
ref|XP_006379953.1|  hypothetical protein POPTR_0008s18360g             176   5e-47   
ref|XP_010044527.1|  PREDICTED: uncharacterized protein LOC104433471    175   1e-46   Eucalyptus grandis [rose gum]
ref|XP_011034021.1|  PREDICTED: uncharacterized protein LOC105132310    174   3e-46   Populus euphratica
ref|XP_012085537.1|  PREDICTED: uncharacterized protein LOC105644705    174   4e-46   Jatropha curcas
ref|XP_010912936.1|  PREDICTED: uncharacterized protein LOC105038753    174   5e-46   Elaeis guineensis
ref|XP_002282165.1|  PREDICTED: uncharacterized protein LOC100266247    173   7e-46   Vitis vinifera
emb|CAN83923.1|  hypothetical protein VITISV_026533                     172   9e-46   Vitis vinifera
ref|XP_008793697.1|  PREDICTED: uncharacterized protein LOC103709939    171   3e-45   Phoenix dactylifera
ref|XP_002515051.1|  conserved hypothetical protein                     171   4e-45   
ref|XP_009386688.1|  PREDICTED: uncharacterized protein LOC103973766    170   6e-45   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP15097.1|  unnamed protein product                                170   7e-45   Coffea canephora [robusta coffee]
gb|KEH20741.1|  sieve element occlusion protein                         169   3e-44   Medicago truncatula
ref|XP_010682345.1|  PREDICTED: uncharacterized protein LOC104897214    168   3e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008786702.1|  PREDICTED: uncharacterized protein LOC103704947    168   4e-44   Phoenix dactylifera
ref|XP_009415984.1|  PREDICTED: uncharacterized protein LOC103996731    167   1e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403632.1|  PREDICTED: uncharacterized protein LOC103987147    166   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008464490.1|  PREDICTED: uncharacterized protein LOC103502...    166   3e-43   Cucumis melo [Oriental melon]
ref|XP_008464491.1|  PREDICTED: uncharacterized protein LOC103502...    166   3e-43   Cucumis melo [Oriental melon]
ref|XP_006848934.1|  PREDICTED: uncharacterized protein LOC18438687     165   3e-43   Amborella trichopoda
emb|CAH59411.1|  hypothetical protein                                   162   3e-43   Plantago major [cart-track plant]
ref|XP_006438201.1|  hypothetical protein CICLE_v10030843mg             165   4e-43   Citrus clementina [clementine]
ref|XP_006483988.1|  PREDICTED: uncharacterized protein LOC102625551    165   4e-43   Citrus sinensis [apfelsine]
ref|XP_010695991.1|  PREDICTED: uncharacterized protein LOC104908569    165   6e-43   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH35012.1|  sieve element occlusion protein                         164   7e-43   Medicago truncatula
ref|XP_006378263.1|  hypothetical protein POPTR_0010s06060g             164   9e-43   
ref|XP_004501847.1|  PREDICTED: uncharacterized protein LOC101501922    164   1e-42   Cicer arietinum [garbanzo]
gb|KDO82146.1|  hypothetical protein CISIN_1g005245mg                   162   1e-42   Citrus sinensis [apfelsine]
ref|XP_007044877.1|  Sieve element occlusion e, putative                163   2e-42   
ref|XP_012071647.1|  PREDICTED: uncharacterized protein LOC105633633    163   3e-42   Jatropha curcas
gb|KDO82145.1|  hypothetical protein CISIN_1g005245mg                   162   4e-42   Citrus sinensis [apfelsine]
ref|XP_004138263.2|  PREDICTED: uncharacterized protein LOC101204...    161   8e-42   Cucumis sativus [cucumbers]
ref|XP_011653503.1|  PREDICTED: uncharacterized protein LOC101204...    161   9e-42   Cucumis sativus [cucumbers]
gb|KDO37241.1|  hypothetical protein CISIN_1g014387mg                   159   9e-42   Citrus sinensis [apfelsine]
gb|KHG00715.1|  hypothetical protein F383_23634                         161   1e-41   Gossypium arboreum [tree cotton]
gb|KJB21018.1|  hypothetical protein B456_003G178000                    161   1e-41   Gossypium raimondii
gb|KJB31087.1|  hypothetical protein B456_005G175200                    161   1e-41   Gossypium raimondii
gb|KHG30263.1|  hypothetical protein F383_10527                         160   1e-41   Gossypium arboreum [tree cotton]
gb|KHG30262.1|  hypothetical protein F383_10527                         160   2e-41   Gossypium arboreum [tree cotton]
gb|KJB19528.1|  hypothetical protein B456_003G107900                    160   2e-41   Gossypium raimondii
ref|XP_010904538.1|  PREDICTED: uncharacterized protein LOC105031936    160   3e-41   Elaeis guineensis
ref|XP_008444389.1|  PREDICTED: uncharacterized protein LOC103487729    159   4e-41   Cucumis melo [Oriental melon]
gb|EPS71838.1|  hypothetical protein M569_02915                         159   5e-41   Genlisea aurea
gb|KHG00716.1|  hypothetical protein F383_23634                         159   6e-41   Gossypium arboreum [tree cotton]
gb|KJB21010.1|  hypothetical protein B456_003G177800                    159   7e-41   Gossypium raimondii
gb|KJB21009.1|  hypothetical protein B456_003G177800                    159   7e-41   Gossypium raimondii
ref|XP_004143056.1|  PREDICTED: uncharacterized protein LOC101208559    159   8e-41   Cucumis sativus [cucumbers]
ref|XP_006470197.1|  PREDICTED: uncharacterized protein LOC102630205    160   8e-41   Citrus sinensis [apfelsine]
ref|XP_007037798.1|  Sieve element occlusion e, putative                159   8e-41   
gb|KDO69426.1|  hypothetical protein CISIN_1g044391mg                   159   9e-41   Citrus sinensis [apfelsine]
ref|XP_006439977.1|  hypothetical protein CICLE_v10019128mg             159   9e-41   Citrus clementina [clementine]
ref|XP_008340127.1|  PREDICTED: uncharacterized protein LOC103403084    159   1e-40   Malus domestica [apple tree]
ref|XP_004236294.1|  PREDICTED: uncharacterized protein LOC101251765    158   2e-40   Solanum lycopersicum
gb|KHN29013.1|  hypothetical protein glysoja_008348                     157   2e-40   Glycine soja [wild soybean]
ref|NP_001240968.1|  uncharacterized protein LOC100799626               157   2e-40   Glycine max [soybeans]
ref|XP_009359245.1|  PREDICTED: uncharacterized protein LOC103949844    158   2e-40   Pyrus x bretschneideri [bai li]
ref|XP_004504145.1|  PREDICTED: uncharacterized protein LOC101504...    156   6e-40   Cicer arietinum [garbanzo]
ref|XP_004504143.1|  PREDICTED: uncharacterized protein LOC101504...    156   6e-40   Cicer arietinum [garbanzo]
ref|XP_002526964.1|  conserved hypothetical protein                     157   7e-40   Ricinus communis
ref|XP_002526965.1|  conserved hypothetical protein                     157   7e-40   
gb|ADN32810.1|  sieve element occlusion a                               156   7e-40   Solanum phureja [chaucha]
ref|XP_006351433.1|  PREDICTED: uncharacterized protein LOC102598958    156   8e-40   Solanum tuberosum [potatoes]
emb|CAN65891.1|  hypothetical protein VITISV_041167                     155   1e-39   Vitis vinifera
emb|CBI14908.3|  unnamed protein product                                155   1e-39   Vitis vinifera
ref|XP_010663068.1|  PREDICTED: uncharacterized protein LOC100243366    155   1e-39   Vitis vinifera
gb|AFN06072.1|  sieve element occlusion protein 1                       155   2e-39   Nicotiana tabacum [American tobacco]
ref|XP_009769607.1|  PREDICTED: uncharacterized protein LOC104220433    155   2e-39   Nicotiana sylvestris
ref|XP_004236293.1|  PREDICTED: uncharacterized protein LOC101251462    155   2e-39   Solanum lycopersicum
ref|XP_010026936.1|  PREDICTED: uncharacterized protein LOC104417333    154   4e-39   Eucalyptus grandis [rose gum]
ref|XP_009359248.1|  PREDICTED: uncharacterized protein LOC103949...    154   6e-39   
gb|KHN05808.1|  hypothetical protein glysoja_038722                     153   7e-39   Glycine soja [wild soybean]
ref|NP_001241263.1|  uncharacterized protein LOC100811452               153   8e-39   Glycine max [soybeans]
ref|XP_007159683.1|  hypothetical protein PHAVU_002G258300g             153   8e-39   Phaseolus vulgaris [French bean]
emb|CDP05462.1|  unnamed protein product                                153   9e-39   Coffea canephora [robusta coffee]
ref|XP_009359246.1|  PREDICTED: uncharacterized protein LOC103949...    154   9e-39   Pyrus x bretschneideri [bai li]
ref|XP_010248721.1|  PREDICTED: uncharacterized protein LOC104591550    153   1e-38   Nelumbo nucifera [Indian lotus]
ref|XP_007225209.1|  hypothetical protein PRUPE_ppa002007mg             152   2e-38   
ref|XP_011071161.1|  PREDICTED: uncharacterized protein LOC105156657    153   2e-38   Sesamum indicum [beniseed]
ref|XP_010102927.1|  hypothetical protein L484_018946                   152   2e-38   Morus notabilis
ref|XP_002526966.1|  conserved hypothetical protein                     152   3e-38   
ref|XP_008340128.1|  PREDICTED: uncharacterized protein LOC103403085    152   4e-38   Malus domestica [apple tree]
gb|KJB21000.1|  hypothetical protein B456_003G177000                    150   5e-38   Gossypium raimondii
ref|XP_006476926.1|  PREDICTED: uncharacterized protein LOC102609296    151   5e-38   Citrus sinensis [apfelsine]
gb|KHN07967.1|  hypothetical protein glysoja_039841                     150   6e-38   Glycine soja [wild soybean]
gb|KDO69425.1|  hypothetical protein CISIN_1g019680mg                   147   6e-38   Citrus sinensis [apfelsine]
ref|XP_009592492.1|  PREDICTED: uncharacterized protein LOC104089332    150   7e-38   Nicotiana tomentosiformis
ref|NP_001241461.1|  uncharacterized protein LOC100789215               150   8e-38   Glycine max [soybeans]
gb|KJB21011.1|  hypothetical protein B456_003G177900                    150   1e-37   Gossypium raimondii
gb|KJB39996.1|  hypothetical protein B456_007G041500                    150   1e-37   Gossypium raimondii
ref|XP_008221943.1|  PREDICTED: uncharacterized protein LOC103321871    150   2e-37   Prunus mume [ume]
ref|XP_010250966.1|  PREDICTED: uncharacterized protein LOC104593030    150   2e-37   Nelumbo nucifera [Indian lotus]
ref|XP_007031664.1|  Uncharacterized protein TCM_017019                 149   2e-37   
ref|XP_007221911.1|  hypothetical protein PRUPE_ppa001579mg             149   4e-37   
ref|XP_006476925.1|  PREDICTED: uncharacterized protein LOC102608...    147   6e-37   
ref|XP_006476923.1|  PREDICTED: uncharacterized protein LOC102608...    148   6e-37   Citrus sinensis [apfelsine]
ref|XP_006476924.1|  PREDICTED: uncharacterized protein LOC102608...    148   7e-37   
ref|XP_007137985.1|  hypothetical protein PHAVU_009G171300g             147   7e-37   Phaseolus vulgaris [French bean]
ref|XP_007137986.1|  hypothetical protein PHAVU_009G171300g             147   1e-36   Phaseolus vulgaris [French bean]
ref|XP_008350940.1|  PREDICTED: uncharacterized protein LOC103414321    147   1e-36   
ref|XP_008389748.1|  PREDICTED: uncharacterized protein LOC103452052    148   1e-36   Malus domestica [apple tree]
ref|XP_009333910.1|  PREDICTED: uncharacterized protein LOC103926766    142   3e-36   
ref|XP_006439978.1|  hypothetical protein CICLE_v10019109mg             145   4e-36   Citrus clementina [clementine]
gb|EYU22546.1|  hypothetical protein MIMGU_mgv1a001374mg                145   2e-35   Erythranthe guttata [common monkey flower]
ref|XP_004309998.2|  PREDICTED: uncharacterized protein LOC101307854    145   2e-35   Fragaria vesca subsp. vesca
ref|XP_011625117.1|  PREDICTED: uncharacterized protein LOC18438685     143   2e-35   
ref|XP_011087135.1|  PREDICTED: uncharacterized protein LOC105168700    141   2e-34   Sesamum indicum [beniseed]
ref|XP_004310159.1|  PREDICTED: uncharacterized protein LOC101309120    142   2e-34   Fragaria vesca subsp. vesca
ref|XP_010248720.1|  PREDICTED: uncharacterized protein LOC104591548    141   2e-34   Nelumbo nucifera [Indian lotus]
ref|XP_008374367.1|  PREDICTED: uncharacterized protein LOC103437653    139   1e-33   
emb|CBI34827.3|  unnamed protein product                                138   2e-33   Vitis vinifera
ref|XP_002271950.2|  PREDICTED: uncharacterized protein LOC100261056    138   2e-33   Vitis vinifera
gb|KJB21019.1|  hypothetical protein B456_003G178100                    135   3e-33   Gossypium raimondii
gb|KHG11411.1|  Ornithine aminotransferase                              137   4e-33   Gossypium arboreum [tree cotton]
ref|XP_012064671.1|  PREDICTED: uncharacterized protein LOC105627966    135   2e-32   Jatropha curcas
ref|XP_009769433.1|  PREDICTED: uncharacterized protein LOC104220...    135   3e-32   Nicotiana sylvestris
ref|XP_009769432.1|  PREDICTED: uncharacterized protein LOC104220...    135   3e-32   Nicotiana sylvestris
ref|XP_004299166.1|  PREDICTED: uncharacterized protein LOC101294943    135   3e-32   Fragaria vesca subsp. vesca
ref|XP_007211100.1|  hypothetical protein PRUPE_ppa023699mg             134   5e-32   
ref|XP_006378262.1|  hypothetical protein POPTR_0010s060501g            130   2e-31   
ref|XP_008239364.1|  PREDICTED: uncharacterized protein LOC103337969    132   3e-31   Prunus mume [ume]
ref|XP_002324001.2|  hypothetical protein POPTR_0017s10720g             132   3e-31   Populus trichocarpa [western balsam poplar]
ref|XP_006440671.1|  hypothetical protein CICLE_v10019121mg             128   3e-30   
ref|XP_006369945.1|  hypothetical protein POPTR_0001s35850g             129   4e-30   
gb|EYU17767.1|  hypothetical protein MIMGU_mgv1a002070mg                129   4e-30   Erythranthe guttata [common monkey flower]
ref|XP_011010496.1|  PREDICTED: uncharacterized protein LOC105115342    129   5e-30   Populus euphratica
ref|XP_006440672.1|  hypothetical protein CICLE_v10019121mg             128   6e-30   Citrus clementina [clementine]
ref|XP_008449999.1|  PREDICTED: uncharacterized protein LOC103491716    127   1e-29   Cucumis melo [Oriental melon]
ref|XP_006477599.1|  PREDICTED: uncharacterized protein LOC102631158    127   1e-29   Citrus sinensis [apfelsine]
ref|XP_002298572.2|  hypothetical protein POPTR_0001s35880g             127   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_002298571.2|  hypothetical protein POPTR_0001s35870g             127   2e-29   
ref|XP_008239602.1|  PREDICTED: uncharacterized protein LOC103338194    125   5e-29   Prunus mume [ume]
ref|XP_006378260.1|  hypothetical protein POPTR_0010s060301g            116   7e-29   
ref|XP_004145690.1|  PREDICTED: uncharacterized protein LOC101221710    125   8e-29   Cucumis sativus [cucumbers]
ref|XP_006369946.1|  hypothetical protein POPTR_0001s35860g             125   1e-28   
ref|XP_012071596.1|  PREDICTED: uncharacterized protein LOC105633578    124   1e-28   Jatropha curcas
gb|KJB75975.1|  hypothetical protein B456_012G066400                    124   2e-28   Gossypium raimondii
ref|XP_006369948.1|  hypothetical protein POPTR_0001s35900g             124   3e-28   Populus trichocarpa [western balsam poplar]
ref|XP_011046122.1|  PREDICTED: uncharacterized protein LOC105140824    123   4e-28   Populus euphratica
gb|ERN10511.1|  hypothetical protein AMTR_s00166p00027900               115   4e-28   Amborella trichopoda
ref|XP_011013170.1|  PREDICTED: uncharacterized protein LOC105117262    123   4e-28   Populus euphratica
ref|XP_011014132.1|  PREDICTED: uncharacterized protein LOC105117991    123   4e-28   Populus euphratica
ref|XP_011016134.1|  PREDICTED: uncharacterized protein LOC105119666    123   5e-28   Populus euphratica
ref|XP_010029070.1|  PREDICTED: uncharacterized protein LOC104419194    123   5e-28   Eucalyptus grandis [rose gum]
ref|XP_011013023.1|  PREDICTED: uncharacterized protein LOC105117152    123   5e-28   Populus euphratica
ref|XP_010496280.1|  PREDICTED: uncharacterized protein LOC104773381    123   7e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010435651.1|  PREDICTED: uncharacterized protein LOC104719421    123   7e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010485384.1|  PREDICTED: uncharacterized protein LOC104763723    123   7e-28   Camelina sativa [gold-of-pleasure]
ref|XP_011014351.1|  PREDICTED: uncharacterized protein LOC105118161    122   8e-28   Populus euphratica
ref|XP_011013686.1|  PREDICTED: uncharacterized protein LOC105117652    122   9e-28   Populus euphratica
ref|XP_011014801.1|  PREDICTED: uncharacterized protein LOC105118...    122   9e-28   Populus euphratica
ref|XP_007031665.1|  Uncharacterized protein TCM_017020                 122   1e-27   
ref|XP_010029072.1|  PREDICTED: uncharacterized protein LOC104419195    122   1e-27   Eucalyptus grandis [rose gum]
gb|KCW55913.1|  hypothetical protein EUGRSUZ_I01711                     121   1e-27   Eucalyptus grandis [rose gum]
ref|XP_011014800.1|  PREDICTED: uncharacterized protein LOC105118...    122   1e-27   Populus euphratica
dbj|BAF01938.1|  hypothetical protein                                   116   2e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CBI34825.3|  unnamed protein product                                121   2e-27   Vitis vinifera
ref|XP_010029069.1|  PREDICTED: uncharacterized protein LOC104419193    121   2e-27   Eucalyptus grandis [rose gum]
ref|XP_003633822.1|  PREDICTED: uncharacterized protein LOC100249294    121   2e-27   Vitis vinifera
emb|CDX74311.1|  BnaA03g27360D                                          121   2e-27   
ref|XP_009134596.1|  PREDICTED: uncharacterized protein LOC103858898    121   2e-27   Brassica rapa
gb|KJB75974.1|  hypothetical protein B456_012G066300                    121   3e-27   Gossypium raimondii
ref|XP_011457422.1|  PREDICTED: uncharacterized protein LOC101309418    120   5e-27   Fragaria vesca subsp. vesca
ref|XP_003633800.1|  PREDICTED: uncharacterized protein LOC100244128    120   5e-27   Vitis vinifera
emb|CDX91934.1|  BnaC03g32360D                                          120   8e-27   
ref|XP_006408536.1|  hypothetical protein EUTSA_v10020071mg             120   8e-27   Eutrema salsugineum [saltwater cress]
ref|XP_006432374.1|  hypothetical protein CICLE_v10000431mg             119   2e-26   Citrus clementina [clementine]
ref|XP_012071551.1|  PREDICTED: uncharacterized protein LOC105633544    119   2e-26   Jatropha curcas
ref|NP_566145.1|  uncharacterized protein                               119   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb|AAF01550.1|AC009325_20  unknown protein                              119   2e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CDX77078.1|  BnaC04g38730D                                          119   2e-26   
ref|XP_010660833.1|  PREDICTED: uncharacterized protein LOC100245845    118   3e-26   Vitis vinifera
gb|KFK37629.1|  hypothetical protein AALP_AA3G008100                    118   3e-26   Arabis alpina [alpine rockcress]
emb|CAN65452.1|  hypothetical protein VITISV_003896                     118   4e-26   Vitis vinifera
emb|CAN61289.1|  hypothetical protein VITISV_032473                     117   7e-26   Vitis vinifera
ref|XP_010660831.1|  PREDICTED: uncharacterized protein LOC100264492    117   7e-26   Vitis vinifera
ref|XP_006471327.1|  PREDICTED: uncharacterized protein LOC102619778    117   8e-26   Citrus sinensis [apfelsine]
ref|XP_010660832.1|  PREDICTED: uncharacterized protein LOC100268167    117   8e-26   Vitis vinifera
ref|XP_002271723.2|  PREDICTED: uncharacterized protein LOC100242213    116   1e-25   Vitis vinifera
ref|XP_002526962.1|  conserved hypothetical protein                     117   1e-25   
ref|XP_002884267.1|  hypothetical protein ARALYDRAFT_477348             116   1e-25   
ref|XP_012071576.1|  PREDICTED: uncharacterized protein LOC105633559    116   3e-25   Jatropha curcas
gb|KHG01411.1|  hypothetical protein F383_21965                         115   3e-25   Gossypium arboreum [tree cotton]
gb|KJB70882.1|  hypothetical protein B456_011G093700                    115   4e-25   Gossypium raimondii
ref|XP_010550172.1|  PREDICTED: uncharacterized protein LOC104821100    114   5e-25   
ref|XP_010524284.1|  PREDICTED: uncharacterized protein LOC104802389    114   9e-25   Tarenaya hassleriana [spider flower]
ref|XP_009124043.1|  PREDICTED: uncharacterized protein LOC103848960    113   2e-24   Brassica rapa
emb|CDY37507.1|  BnaA05g33720D                                          113   2e-24   Brassica napus [oilseed rape]
ref|XP_012071641.1|  PREDICTED: uncharacterized protein LOC105633625    112   2e-24   Jatropha curcas
ref|XP_010029073.1|  PREDICTED: uncharacterized protein LOC104419196    112   3e-24   Eucalyptus grandis [rose gum]
emb|CAN62582.1|  hypothetical protein VITISV_034667                     112   4e-24   Vitis vinifera
gb|KCW55914.1|  hypothetical protein EUGRSUZ_I01712                     109   6e-24   Eucalyptus grandis [rose gum]
ref|XP_002526959.1|  conserved hypothetical protein                     110   1e-23   Ricinus communis
ref|XP_003633839.2|  PREDICTED: uncharacterized protein LOC100254392    110   2e-23   Vitis vinifera
ref|XP_010029068.1|  PREDICTED: uncharacterized protein LOC104419192    109   3e-23   Eucalyptus grandis [rose gum]
ref|XP_002526960.1|  conserved hypothetical protein                     108   5e-23   Ricinus communis
ref|XP_010030737.1|  PREDICTED: uncharacterized protein LOC104420628    106   3e-22   
ref|XP_010040606.1|  PREDICTED: uncharacterized protein LOC104429454    102   1e-21   Eucalyptus grandis [rose gum]
ref|XP_008239606.1|  PREDICTED: uncharacterized protein LOC103338199    103   2e-21   Prunus mume [ume]
ref|XP_011040448.1|  PREDICTED: uncharacterized protein LOC105136707    103   3e-21   Populus euphratica
ref|NP_001239838.1|  uncharacterized protein LOC100801064               102   8e-21   Glycine max [soybeans]
gb|KHN27576.1|  hypothetical protein glysoja_018688                     101   2e-20   Glycine soja [wild soybean]
ref|XP_006446667.1|  hypothetical protein CICLE_v10015478mg           99.0    2e-20   
ref|XP_010694662.1|  PREDICTED: uncharacterized protein LOC104907427    100   5e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006299972.1|  hypothetical protein CARUB_v10016185mg             100   5e-20   
ref|XP_006376885.1|  hypothetical protein POPTR_0012s09220g           99.0    1e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010087773.1|  hypothetical protein L484_016343                 99.0    1e-19   Morus notabilis
ref|XP_010694661.1|  PREDICTED: uncharacterized protein LOC104907426  99.0    1e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009628800.1|  PREDICTED: uncharacterized protein LOC104119093  97.1    4e-19   Nicotiana tomentosiformis
ref|XP_007140863.1|  hypothetical protein PHAVU_008G147900g           97.4    4e-19   Phaseolus vulgaris [French bean]
emb|CAN65453.1|  hypothetical protein VITISV_003897                   96.7    6e-19   Vitis vinifera
ref|XP_010268430.1|  PREDICTED: uncharacterized protein LOC104605382  95.5    1e-18   Nelumbo nucifera [Indian lotus]
ref|XP_004516128.1|  PREDICTED: uncharacterized protein LOC101508220  95.9    1e-18   Cicer arietinum [garbanzo]
ref|XP_002526961.1|  conserved hypothetical protein                   95.1    2e-18   
ref|XP_002884266.1|  hypothetical protein ARALYDRAFT_477347           95.1    2e-18   
emb|CDY17992.1|  BnaC03g30640D                                        92.0    3e-18   Brassica napus [oilseed rape]
emb|CBI16824.3|  unnamed protein product                              94.0    5e-18   Vitis vinifera
gb|KDP46380.1|  hypothetical protein JCGZ_10220                       93.2    1e-17   Jatropha curcas
ref|XP_009124045.1|  PREDICTED: uncharacterized protein LOC103848...  92.8    1e-17   Brassica rapa
emb|CDY37506.1|  BnaA05g33710D                                        92.8    1e-17   Brassica napus [oilseed rape]
ref|XP_009124044.1|  PREDICTED: uncharacterized protein LOC103848...  92.8    1e-17   Brassica rapa
emb|CDX77080.1|  BnaC04g38750D                                        92.8    1e-17   
ref|XP_012071626.1|  PREDICTED: uncharacterized protein LOC105633603  92.8    1e-17   Jatropha curcas
ref|XP_010550173.1|  PREDICTED: uncharacterized protein LOC104821101  92.4    2e-17   Tarenaya hassleriana [spider flower]
gb|KDO40196.1|  hypothetical protein CISIN_1g046837mg                 92.0    2e-17   Citrus sinensis [apfelsine]
ref|XP_012085724.1|  PREDICTED: uncharacterized protein LOC105644841  90.1    2e-17   
ref|XP_008224076.1|  PREDICTED: uncharacterized protein LOC103323832  91.7    3e-17   Prunus mume [ume]
ref|XP_007225119.1|  hypothetical protein PRUPE_ppa002624mg           91.3    3e-17   
ref|NP_186817.1|  uncharacterized protein                             91.7    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435652.1|  PREDICTED: uncharacterized protein LOC104719422  90.9    5e-17   Camelina sativa [gold-of-pleasure]
gb|KCW45067.1|  hypothetical protein EUGRSUZ_L01341                   89.7    7e-17   Eucalyptus grandis [rose gum]
ref|XP_009124817.1|  PREDICTED: uncharacterized protein LOC103849857  89.7    1e-16   Brassica rapa
ref|XP_003622294.1|  hypothetical protein MTR_7g032660                89.7    1e-16   Medicago truncatula
ref|XP_010040608.1|  PREDICTED: uncharacterized protein LOC104429456  89.4    1e-16   Eucalyptus grandis [rose gum]
gb|KCW83210.1|  hypothetical protein EUGRSUZ_B001512                  87.8    1e-16   Eucalyptus grandis [rose gum]
gb|ADN32815.1|  sieve element occlusion a                             89.7    1e-16   Malus domestica [apple tree]
ref|XP_008362016.1|  PREDICTED: uncharacterized protein LOC103425707  89.4    1e-16   
ref|XP_008362017.1|  PREDICTED: uncharacterized protein LOC103425708  89.4    1e-16   
emb|CDY28669.1|  BnaCnng05550D                                        89.0    2e-16   Brassica napus [oilseed rape]
ref|XP_010087775.1|  hypothetical protein L484_016346                 88.6    2e-16   Morus notabilis
gb|AES61036.2|  sieve element occlusion protein                       88.6    3e-16   Medicago truncatula
ref|XP_010087772.1|  hypothetical protein L484_016342                 88.6    3e-16   Morus notabilis
ref|XP_003590785.1|  Sieve element-occluding protein                  88.2    3e-16   
ref|XP_006408537.1|  hypothetical protein EUTSA_v10020146mg           88.2    4e-16   Eutrema salsugineum [saltwater cress]
ref|XP_007226977.1|  hypothetical protein PRUPE_ppa002363mg           87.8    4e-16   Prunus persica
gb|KDP45223.1|  hypothetical protein JCGZ_15088                       87.8    4e-16   Jatropha curcas
ref|XP_008224078.1|  PREDICTED: uncharacterized protein LOC103323835  87.8    5e-16   Prunus mume [ume]
ref|XP_010045508.1|  PREDICTED: uncharacterized protein LOC104434233  88.2    5e-16   
ref|XP_012085712.1|  PREDICTED: uncharacterized protein LOC105644833  87.8    5e-16   Jatropha curcas
ref|NP_001239846.1|  uncharacterized protein LOC100801833             87.4    6e-16   Glycine max [soybeans]
ref|XP_007144080.1|  hypothetical protein PHAVU_007G127000g           87.4    6e-16   Phaseolus vulgaris [French bean]
gb|KFK37630.1|  hypothetical protein AALP_AA3G008200                  87.4    7e-16   Arabis alpina [alpine rockcress]
gb|KHN01071.1|  Putative nucleoredoxin 2                              87.0    7e-16   Glycine soja [wild soybean]
ref|XP_010496279.1|  PREDICTED: uncharacterized protein LOC104773380  87.4    7e-16   Camelina sativa [gold-of-pleasure]
gb|KCW83211.1|  hypothetical protein EUGRSUZ_B001511                  82.8    9e-16   Eucalyptus grandis [rose gum]
emb|CBI34823.3|  unnamed protein product                              87.8    9e-16   Vitis vinifera
ref|XP_010087771.1|  hypothetical protein L484_016341                 86.7    1e-15   Morus notabilis
gb|KDP45224.1|  hypothetical protein JCGZ_15089                       86.3    2e-15   Jatropha curcas
ref|XP_012084657.1|  PREDICTED: uncharacterized protein LOC105644022  86.3    2e-15   Jatropha curcas
ref|XP_004288436.1|  PREDICTED: uncharacterized protein LOC101298363  86.3    2e-15   Fragaria vesca subsp. vesca
emb|CBI34824.3|  unnamed protein product                              85.5    3e-15   Vitis vinifera
gb|KHN13158.1|  hypothetical protein glysoja_040438                   85.5    3e-15   Glycine soja [wild soybean]
ref|NP_001241224.1|  uncharacterized protein LOC100794293             85.5    3e-15   Glycine max [soybeans]
ref|NP_001241173.1|  uncharacterized protein LOC100793771             85.1    4e-15   Glycine max [soybeans]
gb|KHN13159.1|  hypothetical protein glysoja_040439                   85.1    4e-15   Glycine soja [wild soybean]
gb|KDP45229.1|  hypothetical protein JCGZ_15094                       81.3    4e-15   
emb|CBI34826.3|  unnamed protein product                              85.1    4e-15   
gb|KHG12713.1|  hypothetical protein F383_04328                       84.3    7e-15   
ref|XP_011097584.1|  PREDICTED: uncharacterized protein LOC105176465  84.0    9e-15   
ref|XP_006440670.1|  hypothetical protein CICLE_v10023346mg           83.6    1e-14   
ref|XP_003590763.1|  Sieve element-occluding protein                  82.8    2e-14   
ref|XP_004495321.1|  PREDICTED: uncharacterized protein LOC101490473  82.8    2e-14   
ref|XP_003590760.1|  Sieve element-occluding protein                  82.0    4e-14   
ref|XP_007221903.1|  hypothetical protein PRUPE_ppa015869mg           81.6    4e-14   
gb|KDP45228.1|  hypothetical protein JCGZ_15093                       80.9    5e-14   
ref|XP_012084667.1|  PREDICTED: uncharacterized protein LOC105644033  81.6    6e-14   
ref|XP_012085736.1|  PREDICTED: uncharacterized protein LOC105644852  81.3    7e-14   
ref|XP_012084675.1|  PREDICTED: uncharacterized protein LOC105644...  80.9    8e-14   
ref|XP_012084670.1|  PREDICTED: uncharacterized protein LOC105644...  80.9    8e-14   
emb|CBI34821.3|  unnamed protein product                              81.6    8e-14   
ref|XP_007226973.1|  hypothetical protein PRUPE_ppa002391mg           80.9    9e-14   
ref|NP_001280876.1|  uncharacterized LOC103453287                     80.1    2e-13   
ref|XP_007227400.1|  hypothetical protein PRUPE_ppb019745mg           75.1    2e-13   
ref|XP_004288435.1|  PREDICTED: uncharacterized protein LOC101298064  79.3    3e-13   
ref|XP_009346429.1|  PREDICTED: uncharacterized protein LOC103938158  78.6    5e-13   
ref|XP_008224077.1|  PREDICTED: uncharacterized protein LOC103323834  78.2    6e-13   
ref|XP_008222003.1|  PREDICTED: uncharacterized protein LOC103321928  77.8    1e-12   
ref|XP_004288433.1|  PREDICTED: uncharacterized protein LOC101296807  77.4    1e-12   
ref|XP_012084695.1|  PREDICTED: uncharacterized protein LOC105644...  76.6    2e-12   
ref|XP_004304991.1|  PREDICTED: uncharacterized protein LOC101294285  77.0    2e-12   
ref|XP_008222002.1|  PREDICTED: uncharacterized protein LOC103321927  77.0    2e-12   
ref|XP_008224124.1|  PREDICTED: uncharacterized protein LOC103323881  76.6    2e-12   
gb|KDP45230.1|  hypothetical protein JCGZ_15095                       77.0    2e-12   
ref|XP_012084686.1|  PREDICTED: uncharacterized protein LOC105644...  76.6    2e-12   
ref|XP_004288434.1|  PREDICTED: uncharacterized protein LOC101297774  76.6    2e-12   
ref|XP_008224125.1|  PREDICTED: uncharacterized protein LOC103323883  77.0    2e-12   
ref|XP_007224445.1|  hypothetical protein PRUPE_ppa021991mg           76.3    3e-12   
ref|XP_002515052.1|  conserved hypothetical protein                   75.9    3e-12   
ref|XP_012071563.1|  PREDICTED: uncharacterized protein LOC105633553  75.9    4e-12   
ref|XP_010650779.1|  PREDICTED: uncharacterized protein LOC100255...  75.5    4e-12   
ref|XP_002282178.2|  PREDICTED: uncharacterized protein LOC100255...  75.5    5e-12   
emb|CBI16822.3|  unnamed protein product                              75.5    5e-12   
ref|XP_010650784.1|  PREDICTED: uncharacterized protein LOC100255...  75.1    6e-12   
ref|XP_011100417.1|  PREDICTED: uncharacterized protein LOC105178604  75.1    7e-12   
ref|XP_007029300.1|  Uncharacterized protein TCM_025178               73.9    1e-11   
ref|XP_007044876.1|  Uncharacterized protein isoform 2                73.9    1e-11   
emb|CAN82617.1|  hypothetical protein VITISV_012086                   73.9    2e-11   
ref|XP_010904539.1|  PREDICTED: uncharacterized protein LOC105031937  73.2    2e-11   
ref|XP_003590766.1|  Sieve element-occluding protein                  73.2    2e-11   
ref|XP_007226583.1|  hypothetical protein PRUPE_ppa023840mg           73.2    3e-11   
gb|KEH42743.1|  sieve element occlusion protein                       72.8    4e-11   
ref|XP_010100344.1|  hypothetical protein L484_027653                 72.0    7e-11   
ref|XP_002315652.2|  hypothetical protein POPTR_0010s06000g           71.2    1e-10   
gb|KHG21363.1|  hypothetical protein F383_27730                       71.2    1e-10   
gb|KJB75973.1|  hypothetical protein B456_012G066200                  70.9    1e-10   
gb|KJB75171.1|  hypothetical protein B456_012G028700                  70.5    2e-10   
ref|XP_002271883.2|  PREDICTED: putative disease resistance prote...  70.5    2e-10   
ref|XP_008224484.1|  PREDICTED: uncharacterized protein LOC103324225  70.1    2e-10   
emb|CAN64088.1|  hypothetical protein VITISV_006939                   70.5    2e-10   
ref|XP_008224131.1|  PREDICTED: uncharacterized protein LOC103323888  70.1    3e-10   
ref|XP_010674858.1|  PREDICTED: uncharacterized protein LOC104890938  69.7    3e-10   
ref|XP_010025851.1|  PREDICTED: uncharacterized protein LOC104416113  68.9    6e-10   
ref|XP_010069166.1|  PREDICTED: uncharacterized protein LOC104456130  68.9    7e-10   
gb|KCW57424.1|  hypothetical protein EUGRSUZ_H00204                   68.6    9e-10   
ref|XP_010069165.1|  PREDICTED: uncharacterized protein LOC104456129  68.6    1e-09   
ref|XP_008340363.1|  PREDICTED: uncharacterized protein LOC103403330  67.8    1e-09   
ref|XP_009359348.1|  PREDICTED: uncharacterized protein LOC103949937  67.8    1e-09   
ref|XP_011097560.1|  PREDICTED: uncharacterized protein LOC105176450  67.4    2e-09   
ref|XP_008793699.1|  PREDICTED: uncharacterized protein LOC103709...  67.0    2e-09   
ref|XP_008793698.1|  PREDICTED: uncharacterized protein LOC103709...  67.0    2e-09   
gb|KJB31088.1|  hypothetical protein B456_005G175300                  67.0    3e-09   
ref|XP_010087776.1|  hypothetical protein L484_016347                 65.1    1e-08   
gb|KCW45441.1|  hypothetical protein EUGRSUZ_L00852                   64.7    1e-08   
ref|XP_010069161.1|  PREDICTED: uncharacterized protein LOC104456127  64.7    2e-08   
ref|XP_010040159.1|  PREDICTED: uncharacterized protein LOC104428938  64.7    2e-08   
ref|XP_010069164.1|  PREDICTED: uncharacterized protein LOC104456...  64.7    2e-08   
ref|XP_008465184.1|  PREDICTED: uncharacterized protein LOC103502847  64.7    2e-08   
gb|KCW57422.1|  hypothetical protein EUGRSUZ_H00202                   63.9    2e-08   
gb|KJB26821.1|  hypothetical protein B456_004G261600                  64.7    2e-08   
ref|XP_007225527.1|  hypothetical protein PRUPE_ppa026573mg           63.9    3e-08   
ref|XP_012071615.1|  PREDICTED: uncharacterized protein LOC105633596  63.9    3e-08   
gb|KHG30244.1|  Acid phosphatase 1                                    63.5    3e-08   
ref|XP_010069162.1|  PREDICTED: uncharacterized protein LOC104456...  63.5    4e-08   
ref|XP_010069163.1|  PREDICTED: uncharacterized protein LOC104456...  63.5    4e-08   
ref|XP_011457420.1|  PREDICTED: uncharacterized protein LOC101308835  62.8    7e-08   
gb|AFN06074.1|  sieve element occlusion protein 1                     62.4    1e-07   
gb|KDO82147.1|  hypothetical protein CISIN_1g039432mg                 62.0    1e-07   
ref|XP_006438202.1|  hypothetical protein CICLE_v10030798mg           61.6    2e-07   
ref|XP_008224130.1|  PREDICTED: uncharacterized protein LOC103323887  61.6    2e-07   
ref|XP_006483987.1|  PREDICTED: uncharacterized protein LOC102625281  61.6    2e-07   
ref|XP_010044529.1|  PREDICTED: uncharacterized protein LOC104433473  61.6    2e-07   
gb|KCW86614.1|  hypothetical protein EUGRSUZ_B03242                   61.2    2e-07   
ref|XP_010069159.1|  PREDICTED: uncharacterized protein LOC104456126  60.8    3e-07   
ref|XP_004150430.2|  PREDICTED: uncharacterized protein LOC101203350  60.8    3e-07   
ref|XP_009403631.1|  PREDICTED: uncharacterized protein LOC103987146  60.1    5e-07   
ref|XP_004150405.2|  PREDICTED: uncharacterized protein LOC101216599  60.1    5e-07   
ref|XP_008465188.1|  PREDICTED: uncharacterized protein LOC103502851  60.1    5e-07   
ref|XP_012085882.1|  PREDICTED: uncharacterized protein LOC105644987  59.7    9e-07   
ref|XP_004150407.1|  PREDICTED: uncharacterized protein LOC101217067  59.7    9e-07   
gb|KHN01070.1|  hypothetical protein glysoja_000738                   59.3    1e-06   
ref|XP_008465190.1|  PREDICTED: uncharacterized protein LOC103502853  59.3    1e-06   
ref|XP_007044875.1|  Uncharacterized protein isoform 1                58.9    1e-06   
gb|KCW60443.1|  hypothetical protein EUGRSUZ_H03162                   58.9    2e-06   
ref|XP_010024027.1|  PREDICTED: uncharacterized protein LOC104414574  58.5    2e-06   
gb|AGV54562.1|  sieve element occlusion c                             58.2    2e-06   
ref|XP_004150431.2|  PREDICTED: uncharacterized protein LOC101203597  58.2    2e-06   
ref|XP_008465186.1|  PREDICTED: uncharacterized protein LOC103502848  57.8    3e-06   
ref|XP_011469447.1|  PREDICTED: uncharacterized protein LOC101294...  57.0    7e-06   
ref|XP_011469448.1|  PREDICTED: uncharacterized protein LOC101294...  56.6    8e-06   
ref|XP_011469446.1|  PREDICTED: uncharacterized protein LOC101294...  56.6    8e-06   
ref|XP_011649167.1|  PREDICTED: uncharacterized protein LOC101222989  56.6    8e-06   
ref|XP_011469445.1|  PREDICTED: uncharacterized protein LOC101294...  56.6    9e-06   
ref|XP_008465187.1|  PREDICTED: uncharacterized protein LOC103502849  56.2    1e-05   
ref|XP_011649166.1|  PREDICTED: uncharacterized protein LOC101204570  55.8    1e-05   
gb|AHY04439.1|  sieve element occlusion by forisomes 1                55.5    2e-05   
gb|KHG22560.1|  hypothetical protein F383_04018                       55.5    2e-05   
ref|XP_008465183.1|  PREDICTED: uncharacterized protein LOC103502846  55.1    3e-05   
ref|XP_002315651.1|  hypothetical protein POPTR_0010s06040g           54.3    3e-05   
ref|XP_010026373.1|  PREDICTED: uncharacterized protein LOC104416720  55.1    3e-05   
gb|KHG17606.1|  hypothetical protein F383_20800                       54.7    3e-05   
ref|XP_010026374.1|  PREDICTED: uncharacterized protein LOC104416722  54.7    4e-05   
emb|CDP13256.1|  unnamed protein product                              54.3    5e-05   
ref|XP_007221631.1|  hypothetical protein PRUPE_ppb018052mg           52.8    1e-04   
ref|XP_008224079.1|  PREDICTED: uncharacterized protein LOC103323836  52.8    2e-04   
gb|ACH92806.1|  sieve element-occluding protein 1                     52.4    2e-04   
ref|XP_007145937.1|  hypothetical protein PHAVU_007G280500g           52.4    2e-04   
ref|XP_003590781.1|  Sieve element-occluding protein                  52.4    2e-04   
ref|XP_006378257.1|  hypothetical protein POPTR_0010s06020g           50.8    2e-04   
ref|XP_010024026.1|  PREDICTED: uncharacterized protein LOC104414573  52.0    3e-04   
ref|NP_001239643.1|  uncharacterized protein LOC100778245             52.0    3e-04   
ref|NP_001239787.1|  uncharacterized protein LOC100812318             51.2    5e-04   
ref|XP_010068525.1|  PREDICTED: uncharacterized protein LOC104455428  50.8    7e-04   
gb|KCW63898.1|  hypothetical protein EUGRSUZ_G01580                   50.4    8e-04   
ref|XP_004495334.1|  PREDICTED: uncharacterized protein LOC101493939  50.4    9e-04   
ref|NP_001239844.1|  uncharacterized protein LOC100797481             50.4    9e-04   



>ref|XP_009767734.1| PREDICTED: uncharacterized protein LOC104218849 [Nicotiana sylvestris]
Length=793

 Score =   236 bits (601),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 136/184 (74%), Gaps = 13/184 (7%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N KER+++NS  IQ E LS ++QD T+IWFFWERLESMW  + +     QD
Sbjct  623  LEMLYVGKRNPKERVRKNSAIIQVENLSHVVQDQTLIWFFWERLESMWHSRTQ-----QD  677

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                   IP E+ DPILQ++  ILSYDGS++GWAVFSRGLAEMT+G+G  +V+V+  F+ 
Sbjct  678  -------IPGET-DPILQEIVTILSYDGSDQGWAVFSRGLAEMTRGKGDLMVQVMRGFER  729

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+HEVTD   F+P++D+QLR L+T HHCTR+++P   GH PE V C EC R MEKF MYS
Sbjct  730  WKHEVTDITEFVPSVDRQLRALHTPHHCTRLILPGTTGHIPERVVCAECSRPMEKFIMYS  789

Query  242  CCLD  231
            CC+D
Sbjct  790  CCID  793



>ref|XP_009622867.1| PREDICTED: uncharacterized protein LOC104114193 [Nicotiana tomentosiformis]
 gb|AFN06073.1| sieve element occlusion protein 2 [Nicotiana tabacum]
Length=786

 Score =   236 bits (601),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 136/184 (74%), Gaps = 13/184 (7%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N KER+++NS  IQ E LS ++QD T+IWFFWERLESMW  + +     QD
Sbjct  616  LEMLYVGKRNPKERVRKNSAIIQVENLSHVVQDQTLIWFFWERLESMWHSRTQ-----QD  670

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                   IP E+ DPILQ++  ILSYDGS++GWAVFSRGLAEMT+G+G  +V+V+  F+ 
Sbjct  671  -------IPGET-DPILQEIVTILSYDGSDQGWAVFSRGLAEMTRGKGDLMVQVMRGFER  722

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+HEVTD   F+P++D+QLR L+T HHCTR+++P   GH PE V C EC R MEKF MYS
Sbjct  723  WKHEVTDITEFVPSVDRQLRALHTPHHCTRLILPGTTGHIPERVVCAECSRPMEKFIMYS  782

Query  242  CCLD  231
            CC+D
Sbjct  783  CCID  786



>ref|XP_004239152.1| PREDICTED: uncharacterized protein LOC101249174 [Solanum lycopersicum]
Length=795

 Score =   234 bits (597),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 136/184 (74%), Gaps = 13/184 (7%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N KER+++NS  IQ E LS ++QD T+IWFFWERLESMW  + +     QD
Sbjct  625  LEMLYVGKKNPKERVRKNSSIIQMENLSHVVQDQTLIWFFWERLESMWHSRTQ-----QD  679

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                   IP ES DPILQ++  ILSYDGS+ GWAVFSRGLAEMT+G+G  +V+V+  FD 
Sbjct  680  -------IPGES-DPILQEIVTILSYDGSDLGWAVFSRGLAEMTRGKGDLIVQVMKGFDR  731

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            WR+EV+D   F+PALD+QLR L++ HHCTR+++P+  GH PE V C ECGR M+KF MY 
Sbjct  732  WRNEVSDITTFVPALDRQLRDLHSPHHCTRLILPSTSGHIPERVVCAECGRPMDKFIMYR  791

Query  242  CCLD  231
            CC++
Sbjct  792  CCIE  795



>ref|XP_010320950.1| PREDICTED: uncharacterized protein LOC101249457 isoform X2 [Solanum 
lycopersicum]
Length=694

 Score =   232 bits (591),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 134/184 (73%), Gaps = 13/184 (7%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N KER+++NS  IQ E LS ++QD T+IWFFWERLESMW  + +     QD
Sbjct  524  LEMLYVGKKNPKERVRKNSSIIQMENLSHVVQDQTLIWFFWERLESMWHSRTQ-----QD  578

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                   IP E+ DPILQ++  ILSYDGS+ GWAVFSRGLAEMT+G+G  +V+V+  FD 
Sbjct  579  -------IPGET-DPILQEIVTILSYDGSDLGWAVFSRGLAEMTRGKGDLIVQVMKGFDR  630

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            WR+EV+D   F+PALD+QLR L++ HHCTR+++P+  GH PE V C EC R MEKF MY 
Sbjct  631  WRNEVSDITTFVPALDRQLRDLHSPHHCTRLILPSTSGHIPERVVCAECSRPMEKFIMYR  690

Query  242  CCLD  231
            CC D
Sbjct  691  CCTD  694



>gb|ADN32812.1| sieve element occlusion c [Solanum phureja]
Length=818

 Score =   233 bits (595),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 133/184 (72%), Gaps = 13/184 (7%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N KER+++NS  IQ E LS ++QD T+IWFFWERLESMW  + +     QD
Sbjct  648  LEMLYVGKKNPKERVRKNSSIIQMENLSHVVQDQTLIWFFWERLESMWHSRTQ-----QD  702

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                   IP E+ DPILQ++  ILSYDGS+ GWAVFSRGLAEMT+G+G  +V+V+  FD 
Sbjct  703  -------IPGET-DPILQEIVTILSYDGSDLGWAVFSRGLAEMTRGKGDLIVQVMKGFDR  754

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            WR EV+D   F+PALD+QLR L++ HHCTR+++P+  GH PE V C EC R MEKF MY 
Sbjct  755  WRDEVSDITTFVPALDRQLRDLHSPHHCTRLILPSTTGHVPERVVCAECSRPMEKFIMYR  814

Query  242  CCLD  231
            CC D
Sbjct  815  CCTD  818



>ref|XP_006341794.1| PREDICTED: uncharacterized protein LOC102602329 [Solanum tuberosum]
Length=811

 Score =   233 bits (594),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 133/184 (72%), Gaps = 13/184 (7%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N KER+++NS  IQ E LS ++QD T+IWFFWERLESMW  + +     QD
Sbjct  641  LEMLYVGKKNPKERVRKNSSIIQIENLSHVVQDQTLIWFFWERLESMWHSRTQ-----QD  695

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                   IP E+ DPILQ++  ILSYDGS+ GWAVFSRGLAEMT+G+G  +V+V+  FD 
Sbjct  696  -------IPGET-DPILQEIVTILSYDGSDLGWAVFSRGLAEMTRGKGDLIVQVMKGFDR  747

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            WR EV+D   F+PALD+QLR L++ HHCTR+++P+  GH PE V C EC R MEKF MY 
Sbjct  748  WRDEVSDVTTFVPALDRQLRDLHSPHHCTRLILPSTTGHVPERVVCAECSRPMEKFIMYR  807

Query  242  CCLD  231
            CC D
Sbjct  808  CCTD  811



>ref|XP_004239153.1| PREDICTED: uncharacterized protein LOC101249457 isoform X1 [Solanum 
lycopersicum]
Length=789

 Score =   233 bits (593),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 134/184 (73%), Gaps = 13/184 (7%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N KER+++NS  IQ E LS ++QD T+IWFFWERLESMW  + +     QD
Sbjct  619  LEMLYVGKKNPKERVRKNSSIIQMENLSHVVQDQTLIWFFWERLESMWHSRTQ-----QD  673

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                   IP E+ DPILQ++  ILSYDGS+ GWAVFSRGLAEMT+G+G  +V+V+  FD 
Sbjct  674  -------IPGET-DPILQEIVTILSYDGSDLGWAVFSRGLAEMTRGKGDLIVQVMKGFDR  725

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            WR+EV+D   F+PALD+QLR L++ HHCTR+++P+  GH PE V C EC R MEKF MY 
Sbjct  726  WRNEVSDITTFVPALDRQLRDLHSPHHCTRLILPSTSGHIPERVVCAECSRPMEKFIMYR  785

Query  242  CCLD  231
            CC D
Sbjct  786  CCTD  789



>gb|ADN32811.1| sieve element occlusion b [Solanum phureja]
Length=823

 Score =   232 bits (592),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 134/184 (73%), Gaps = 13/184 (7%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N KER+++NS  IQ E LS ++QD T+IWFFWERLESMW  + +     QD
Sbjct  653  LEMLYVGKKNPKERVRKNSSIIQMENLSHVVQDQTLIWFFWERLESMWHSRTQ-----QD  707

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                   IP E+ DPILQ++  ILSYDGS+ GWAVFSRGLAEMT+G+G  +V+V+  FD 
Sbjct  708  -------IPGET-DPILQEIVTILSYDGSDLGWAVFSRGLAEMTRGKGDLIVQVMKGFDR  759

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            WR EV+D   F+PALD+QLR L++ HHCTR+++P+  GH PE V C EC R MEKF MY 
Sbjct  760  WRDEVSDVTTFVPALDRQLRDLHSPHHCTRLILPSTTGHIPERVVCAECSRPMEKFIMYR  819

Query  242  CCLD  231
            CC++
Sbjct  820  CCIE  823



>ref|XP_004237262.1| PREDICTED: uncharacterized protein LOC101263509 [Solanum lycopersicum]
Length=788

 Score =   230 bits (587),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 133/184 (72%), Gaps = 13/184 (7%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N KERI++N+  IQ E LS ++QD T+IWFFWERLESMW  + +     QD
Sbjct  618  LEMLYVGKKNPKERIRKNNSIIQIENLSHVVQDQTLIWFFWERLESMWHSRTQ-----QD  672

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                   IP E+ DPILQ++  ILSYDGS+ GWAVFSRGL EMT+G+G  +V+V+  FD 
Sbjct  673  -------IPGET-DPILQEIVTILSYDGSDLGWAVFSRGLVEMTRGKGDLIVQVMKGFDR  724

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            WR+EV+D   F+PALD+QLR L++ HHCTR+++P+  GH PE V C EC R MEKF MY 
Sbjct  725  WRNEVSDITTFVPALDRQLRDLHSPHHCTRLILPSTTGHVPERVICAECSRPMEKFIMYR  784

Query  242  CCLD  231
            CC D
Sbjct  785  CCTD  788



>emb|CDP13257.1| unnamed protein product [Coffea canephora]
Length=812

 Score =   199 bits (505),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 120/184 (65%), Gaps = 13/184 (7%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N KER++RN+  IQ E LS IL D T+IWFFW RLESMW  K +  + +++
Sbjct  642  LEMLYVGKSNPKERVRRNNSIIQAENLSHILTDLTLIWFFWVRLESMWHSKNQHGMTVEN  701

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         DPI+Q++  +LS+DGS++GWAVF RG  EM KG+   + + ++ FD 
Sbjct  702  -------------DPIMQEIVTMLSFDGSDQGWAVFCRGSHEMAKGKAETIYECMSQFDR  748

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +V   + F+ A++  LR L+T HHC R+++P   GH PE V C ECGR ME+F MY 
Sbjct  749  WKDKVVYPDGFVIAMNDHLRELHTPHHCNRLILPGPTGHIPERVVCAECGRPMERFIMYR  808

Query  242  CCLD  231
            CC+D
Sbjct  809  CCID  812



>ref|XP_006387170.1| hypothetical protein POPTR_1619s002001g [Populus trichocarpa]
 gb|ERP46084.1| hypothetical protein POPTR_1619s002001g [Populus trichocarpa]
Length=168

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 112/182 (62%), Gaps = 14/182 (8%)
 Frame = -3

Query  776  MLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQDND  597
            MLY GK N +E++++N+  I  E LS +L D T+IWFFW RLESMW  K +    +++  
Sbjct  1    MLYVGKSNPREKVRKNNSIITTEKLSHVLPDLTLIWFFWVRLESMWHSKVQHKRTVEN--  58

Query  596  TRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDSWR  417
                       D I+Q++  +LS+DGS++GWAV SRG A+M K +G  ++K   +F+ WR
Sbjct  59   -----------DAIMQEIMTMLSFDGSDQGWAVISRGPADMAKAKGETILKSFVDFEIWR  107

Query  416  HEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYSCC  237
             +   E  F+PAL   L  L++  HC R+++P A G  PE V C ECGR MEKF MY CC
Sbjct  108  -DGAQEKGFLPALIDNLLALHSPLHCNRLILPGATGSIPEKVVCAECGRPMEKFIMYRCC  166

Query  236  LD  231
             D
Sbjct  167  TD  168



>emb|CAN83922.1| hypothetical protein VITISV_026532 [Vitis vinifera]
Length=714

 Score =   181 bits (460),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 119/184 (65%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N +E+I++ +  I  + LS  L D  ++WFFW RLESMW+ K      MQ 
Sbjct  545  LEMLYVGKSNPREKIQKINAIISTDNLSHTLPDLHLVWFFWVRLESMWYSK------MQH  598

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
              T          DPI+Q++ ++LS+DGS++GW VFS+G  EMTK +G N+V+ L+++D 
Sbjct  599  GKTV-------ESDPIMQEIVSMLSFDGSDQGWVVFSKGSGEMTKAKGENIVRCLSDYDV  651

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W++ V+ +  F+ AL+  LR ++T HHC R+++P   G  PE V C ECGR MEKF MY 
Sbjct  652  WKNNVSSK-GFLGALNDYLREIHTPHHCNRLILPGTTGSIPERVVCAECGRPMEKFVMYR  710

Query  242  CCLD  231
            CC D
Sbjct  711  CCTD  714



>ref|XP_002282172.1| PREDICTED: uncharacterized protein LOC100261038 [Vitis vinifera]
 emb|CBI16823.3| unnamed protein product [Vitis vinifera]
Length=714

 Score =   181 bits (460),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 119/184 (65%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N +E+I++ +  I  + LS  L D  ++WFFW RLESMW+ K      MQ 
Sbjct  545  LEMLYVGKSNPREKIQKINAIISTDNLSHTLPDLHLVWFFWVRLESMWYSK------MQH  598

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
              T          DPI+Q++ ++LS+DGS++GW VFS+G  EMTK +G N+V+ L+++D 
Sbjct  599  GKTV-------ESDPIMQEIVSMLSFDGSDQGWVVFSKGSGEMTKAKGENIVRCLSDYDV  651

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W++ V+ +  F+ AL+  LR ++T HHC R+++P   G  PE V C ECGR MEKF MY 
Sbjct  652  WKNNVSSK-GFLGALNDYLREIHTPHHCNRLILPGTTGSIPERVVCAECGRPMEKFVMYR  710

Query  242  CCLD  231
            CC D
Sbjct  711  CCTD  714



>ref|XP_006388019.1| hypothetical protein POPTR_0395s002002g, partial [Populus trichocarpa]
 gb|ERP46933.1| hypothetical protein POPTR_0395s002002g, partial [Populus trichocarpa]
Length=277

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 115/184 (63%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N +E+++ N+  I+ E LS +L D T+IWFFW RLESMW  K +    +++
Sbjct  108  LEMLYVGKCNPREKVRENNVIIKNEKLSHVLPDLTLIWFFWVRLESMWHSKVQLKRTVEN  167

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+Q++  +LS+DGS++GWAV SRG A+M K +G  ++K   +F++
Sbjct  168  -------------DAIMQEIMTMLSFDGSDQGWAVISRGPADMAKAKGETILKSFVDFET  214

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            WR +   E  F+PAL   L  L++  HC R+++P A G  PE V C ECGR M+KF MY 
Sbjct  215  WR-DGAQEKGFLPALIDNLLALHSPLHCNRLILPGATGSIPEKVVCAECGRPMKKFIMYR  273

Query  242  CCLD  231
            CC D
Sbjct  274  CCTD  277



>ref|XP_006378256.1| hypothetical protein POPTR_0010s06010g [Populus trichocarpa]
 gb|ERP56053.1| hypothetical protein POPTR_0010s06010g [Populus trichocarpa]
Length=706

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 114/184 (62%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N +E++++N+  I  E LS +L D T+IWFFW RLESMW  K +    +++
Sbjct  537  LEMLYVGKSNPREKVRKNNSIITTEKLSHVLPDLTLIWFFWVRLESMWHSKVQHKRTVEN  596

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+Q++  +LS+DGS++GWAV SRG A+M K +G  ++K   +F+ 
Sbjct  597  -------------DAIMQEIMTMLSFDGSDQGWAVISRGPADMAKAKGETILKSFADFEI  643

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ E   E  F+PAL   L  L+T  HC R+++P A G  PE V C ECGR MEKF MY 
Sbjct  644  WK-EGAQEKGFLPALIDHLHELHTPFHCNRLILPGATGSIPERVVCAECGRPMEKFIMYR  702

Query  242  CCLD  231
            CC D
Sbjct  703  CCTD  706



>ref|XP_011012451.1| PREDICTED: uncharacterized protein LOC105116695 [Populus euphratica]
Length=715

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 115/184 (63%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N +E++++N+  I  E LS +L D T+IWFFW RLESMW  K +    ++ 
Sbjct  546  LEMLYVGKSNPREKVRKNNSIITTEKLSHVLPDLTLIWFFWVRLESMWHSKVQHKRTVE-  604

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            NDT            I+Q++  +LS+DGS++GWAV SRG  +M K +G  ++K  + F+ 
Sbjct  605  NDT------------IMQEIMTMLSFDGSDQGWAVISRGPTDMAKAKGETILKSFDEFEM  652

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ E   EN F+PAL   L  L++  HC R+++P A G  PE V C ECGR MEKF MY 
Sbjct  653  WK-EGAQENGFLPALIDYLHQLHSPFHCNRLILPGATGGIPERVVCAECGRPMEKFIMYR  711

Query  242  CCLD  231
            CC D
Sbjct  712  CCTD  715



>ref|XP_006379953.1| hypothetical protein POPTR_0008s18360g [Populus trichocarpa]
 gb|ERP57750.1| hypothetical protein POPTR_0008s18360g [Populus trichocarpa]
Length=706

 Score =   176 bits (447),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 114/184 (62%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N KE+ ++ +G I  E LS +L D T+IWFFW RLESMW  K +       
Sbjct  537  LEMLYVGKSNPKEKARKINGVIVNENLSHVLPDLTLIWFFWVRLESMWHSKVQHQ-----  591

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
               RT        DPI+Q++  +LS+DGS++GWAV S+G  EM K +G  ++K   +F+S
Sbjct  592  ---RT-----ADNDPIMQEIMTMLSFDGSDQGWAVISKGSDEMAKAKGDTILKSFVDFES  643

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +  +   F+PAL+  L  L++  HC R+++P A G  PE + C ECGR MEKF MY 
Sbjct  644  WK-QSAEVKGFLPALNDHLHELHSPSHCNRLILPGATGSIPERIVCAECGRPMEKFIMYR  702

Query  242  CCLD  231
            CC D
Sbjct  703  CCTD  706



>ref|XP_010044527.1| PREDICTED: uncharacterized protein LOC104433471 [Eucalyptus grandis]
 gb|KCW86613.1| hypothetical protein EUGRSUZ_B03241 [Eucalyptus grandis]
Length=699

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 116/184 (63%), Gaps = 15/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N +E+++ NS TI  E LS +L D T+IWFFW RLESMW  K ++  ++ D
Sbjct  531  LEMLYVGKSNTREKLRNNSNTILAENLSHVLPDLTLIWFFWVRLESMWHSKVQQGKSV-D  589

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            ND            PI+Q++  +LS+DGS+ GWAV  RG A++ K +G  ++K L ++DS
Sbjct  590  ND------------PIMQEIMMMLSFDGSDHGWAVICRG-ADVAKAKGDVILKTLLDYDS  636

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  +  +  F+PAL   +    T HHC R+++P+  G  PE V C ECGR MEKF MY 
Sbjct  637  WKDRI-GQMGFLPALGSHIHDEKTPHHCNRLILPSTTGTIPERVVCAECGRVMEKFIMYR  695

Query  242  CCLD  231
            CC D
Sbjct  696  CCTD  699



>ref|XP_011034021.1| PREDICTED: uncharacterized protein LOC105132310 [Populus euphratica]
Length=706

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 115/184 (63%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK   KE+ ++ +G I  E LS +L D T+IWFFW RLESMW  K +      D
Sbjct  537  LEMLYVGKSKPKEKARKINGVIVNENLSHVLPDLTLIWFFWVRLESMWHSKVQHK-RTAD  595

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            ND            PI++++ A+LS+DGS++GWAV S+G  EM K +G  ++K   +F+S
Sbjct  596  ND------------PIMKEIMAMLSFDGSDQGWAVISKGSDEMAKAKGDTILKSFVDFES  643

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +  +   F+PAL+  L  L++  HC R+++P A G+ PE + C ECGR MEKF MY 
Sbjct  644  WK-QSAEVKGFLPALNDHLHELHSPSHCCRLILPGATGNIPERIVCAECGRPMEKFIMYR  702

Query  242  CCLD  231
            CC D
Sbjct  703  CCTD  706



>ref|XP_012085537.1| PREDICTED: uncharacterized protein LOC105644705 [Jatropha curcas]
 gb|KDP26703.1| hypothetical protein JCGZ_17861 [Jatropha curcas]
Length=709

 Score =   174 bits (441),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 117/187 (63%), Gaps = 17/187 (9%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N +E++++N+ TIQ E LS +L D T+IWFFW RLESMW  K      +Q 
Sbjct  537  LEMLYVGKSNPREKVRKNNVTIQSENLSHVLPDLTLIWFFWVRLESMWHSK------VQH  590

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLA---EMTKGEGSNVVKVLNN  432
            N T          D I+Q++  +LS+DGS +GWAV S G     +M K +G +++K L+ 
Sbjct  591  NRTV-------ENDSIMQEIVTMLSFDGSEQGWAVLSHGSGVNDQMAKAKGVDILKSLDE  643

Query  431  FDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
            F +WR +  +E+ F+PAL++ L G ++  HC R+++P   G  PE V C EC R MEKF 
Sbjct  644  FQTWR-KTAEESGFVPALNEYLTGHHSPLHCNRLILPGTTGSIPEKVVCAECSRPMEKFI  702

Query  251  MYSCCLD  231
            MY CC D
Sbjct  703  MYRCCTD  709



>ref|XP_010912936.1| PREDICTED: uncharacterized protein LOC105038753 [Elaeis guineensis]
Length=707

 Score =   174 bits (440),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 106/184 (58%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y G+ N KER+K+   TI  E LS   QDP M+WFFW RLESMW  K      MQ 
Sbjct  538  LEMVYVGRSNPKERVKKAVATITAEKLSGYWQDPVMVWFFWVRLESMWHSK------MQH  591

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
              T          DPI+Q+V  +L+YDGS+ GWA+ SRG  EM K +G  ++  L  FD 
Sbjct  592  GKTI-------ENDPIMQEVMTLLTYDGSDEGWALISRGSVEMVKAQGKKLIDCLTEFDK  644

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  V  E  FIPA+   L   +T  HCTR+++P   G   E V C EC R MEKF +Y 
Sbjct  645  WKAAVEQE-GFIPAMTNALLPYHTHEHCTRLILPGDTGKITEKVVCTECKRPMEKFILYR  703

Query  242  CCLD  231
            CC D
Sbjct  704  CCND  707



>ref|XP_002282165.1| PREDICTED: uncharacterized protein LOC100266247 [Vitis vinifera]
Length=712

 Score =   173 bits (438),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 118/191 (62%), Gaps = 24/191 (13%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLK----GEKTL  615
            LEMLY GK N++E++++N+ +I +E LS +L D + +WFFW RLESMW  K    GE   
Sbjct  539  LEMLYVGKSNLREKVRKNNDSIAQENLSHVLPDLSSVWFFWARLESMWHSKVQHGGENA-  597

Query  614  AMQDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRG---LAEMTKGEGSNVVK  444
                            RDPI+Q++ ++LS+DG + GWAVF RG   +++MTK +G  +V 
Sbjct  598  ---------------ERDPIMQEIVSMLSFDGGDHGWAVFGRGWGEMSQMTKAKGDTIVG  642

Query  443  VLNNFDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSM  264
             L ++  W++ +  +  F+ A++  L  L+T HHC R+V+P   G  P+ VAC ECGR M
Sbjct  643  CLRDYHVWKNNIATK-GFVGAVNDYLPQLHTPHHCNRLVLPGTTGRTPDRVACAECGRPM  701

Query  263  EKFFMYSCCLD  231
            EKF MY CC D
Sbjct  702  EKFIMYRCCTD  712



>emb|CAN83923.1| hypothetical protein VITISV_026533 [Vitis vinifera]
Length=673

 Score =   172 bits (437),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 118/191 (62%), Gaps = 24/191 (13%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLK----GEKTL  615
            LEMLY GK N++E++++N+ +I +E LS +L D + +WFFW RLESMW  K    GE   
Sbjct  500  LEMLYVGKSNLREKVRKNNDSIAQENLSHVLPDLSSVWFFWARLESMWHSKVQHGGENA-  558

Query  614  AMQDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRG---LAEMTKGEGSNVVK  444
                            RDPI+Q++ ++LS+DG + GWAVF RG   +++MTK +G  +V 
Sbjct  559  ---------------ERDPIMQEIVSMLSFDGGDHGWAVFGRGWGEMSQMTKAKGDTIVG  603

Query  443  VLNNFDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSM  264
             L ++  W++ +  +  F+ A++  L  L+T HHC R+V+P   G  P+ VAC ECGR M
Sbjct  604  CLRDYHVWKNNIATK-GFVGAVNDYLPQLHTPHHCNRLVLPGTTGRTPDRVACAECGRPM  662

Query  263  EKFFMYSCCLD  231
            EKF MY CC D
Sbjct  663  EKFIMYRCCTD  673



>ref|XP_008793697.1| PREDICTED: uncharacterized protein LOC103709939 [Phoenix dactylifera]
Length=712

 Score =   171 bits (433),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 107/184 (58%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KER+K+  G I  E LS   QDP M+WFFW RLESMW  K +   +++D
Sbjct  543  LEMVYVGKSNPKERVKKAVGVIAAEKLSGYWQDPVMVWFFWVRLESMWHSKMQHGKSIED  602

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+Q+V  +LS+DGS+ GWAV SRG  EM K +G  +V  L  FD+
Sbjct  603  -------------DTIMQEVMTMLSFDGSDEGWAVISRGSVEMVKSQGKKLVDCLTQFDA  649

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ E  +   FIPAL   L   +T  HCTR+++P   G     V C +C R MEKF +Y 
Sbjct  650  WK-ETVETEGFIPALTNALIPYHTHEHCTRLILPGDNGRIKHQVICAQCKRPMEKFILYR  708

Query  242  CCLD  231
            CC D
Sbjct  709  CCND  712



>ref|XP_002515051.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47605.1| conserved hypothetical protein [Ricinus communis]
Length=701

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 116/188 (62%), Gaps = 18/188 (10%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N +E++++N+  IQ E LS +LQD T+IWFFW RLESMW  K      +Q 
Sbjct  528  LEMLYVGKSNPREKVRKNNIIIQNEKLSHVLQDLTLIWFFWVRLESMWHSK------VQH  581

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLA----EMTKGEGSNVVKVLN  435
            N T          D I+Q++  +LS+DGS++GWAV S+G      ++ K +GS+++   +
Sbjct  582  NRTV-------ENDIIMQEIVTMLSFDGSDQGWAVISKGSGAENRQLAKAKGSDILNCFD  634

Query  434  NFDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKF  255
            ++ SWR E+ +E  F+PA+   L G +   HC R+++P   G  PE V C EC R MEKF
Sbjct  635  DYQSWR-EIAEEEGFVPAILDYLHGHHNPLHCNRLILPGTTGSIPEKVVCAECSRPMEKF  693

Query  254  FMYSCCLD  231
             MY CC D
Sbjct  694  IMYRCCTD  701



>ref|XP_009386688.1| PREDICTED: uncharacterized protein LOC103973766 [Musa acuminata 
subsp. malaccensis]
Length=702

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 111/182 (61%), Gaps = 14/182 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            +EM+Y GK + K+R+++    I  E LS   QDP M+WFFW RLESMW+ K +    +++
Sbjct  533  IEMVYVGKSSPKDRVRKAISVIAREKLSGYWQDPVMVWFFWVRLESMWYSKMQHGRTIEN  592

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         DPI+ +V  +LS+DGS+ GWA+ SRG  EM K  G  +V  L+ FDS
Sbjct  593  -------------DPIMLEVMTMLSFDGSDEGWAIVSRGSMEMVKAHGKMIVDCLSQFDS  639

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +V +E+ F+PAL + L  L+T  HCTR+++P   G   E V C EC R MEKF +Y 
Sbjct  640  WKGKV-EEDGFVPALTEALLPLHTHEHCTRLILPGDTGRIKEEVVCAECKRPMEKFVLYR  698

Query  242  CC  237
            CC
Sbjct  699  CC  700



>emb|CDP15097.1| unnamed protein product [Coffea canephora]
Length=705

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 109/184 (59%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KER+++ +  I  E LS    DPT +W+FW R+ESM + K +     QD
Sbjct  536  LEMVYVGKNNTKERVRKINSQITGENLSHCWSDPTYVWYFWTRVESMLYSKMQNQKTAQD  595

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+Q+V  ILS+DGS+ GWA+ SRG AEM + +   + + L  F +
Sbjct  596  -------------DKIMQEVMTILSFDGSDEGWALISRGSAEMARAKSETMSQSLEEFTN  642

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  +   E  F+PAL+  L+ L+T HHC R+++P   G  PE V C ECGR MEK+FMY 
Sbjct  643  WEDD-AKEKGFVPALNDYLKRLHTPHHCNRLILPGTAGGIPELVVCSECGRQMEKYFMYR  701

Query  242  CCLD  231
            CC D
Sbjct  702  CCTD  705



>gb|KEH20741.1| sieve element occlusion protein [Medicago truncatula]
Length=704

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 116/182 (64%), Gaps = 14/182 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N  +++KR + TI +E LS++L DPT+IWFFW RLESMW  K +++  +++
Sbjct  535  LEMMYVGKSNPGQKVKRINKTIYDENLSNVLTDPTIIWFFWVRLESMWHSKLQQSKTVEN  594

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+ ++  ILS+D S+ GWAV S+G   MT+G+G + +K L+  D 
Sbjct  595  -------------DQIMLEIMRILSFDSSDLGWAVLSQGTVRMTQGKGDSFLKCLDELDE  641

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +V D+   + A+D  ++G+   HHC R+++P   G  P+ + C ECG+ MEKF+MY 
Sbjct  642  WKGDVNDK-GVLTAMDDYIQGIQQPHHCNRLILPGVDGTIPDKIVCAECGQPMEKFYMYR  700

Query  242  CC  237
            CC
Sbjct  701  CC  702



>ref|XP_010682345.1| PREDICTED: uncharacterized protein LOC104897214 [Beta vulgaris 
subsp. vulgaris]
Length=706

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 114/184 (62%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N+KE+I++ +  I ++G S +L D T++W+FW RLESMW  K +  + +++
Sbjct  537  LEMLYVGKSNLKEKIRKINNAIVDQGWSHVLPDVTLVWYFWVRLESMWHSKMQHRMTVEN  596

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+Q++  ++S+D S++GWA+ SRG  EMTK +G  ++  L NF  
Sbjct  597  -------------DRIMQEIVTMMSFDASDQGWALISRGSTEMTKAKGDTLLTCLMNFSE  643

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +V     F+ A+   L+ L T HHC R+++P   G  PE V C ECGR+M+KF MY 
Sbjct  644  WKEDVP-LKGFVQAITDYLQKLQTPHHCNRLILPGTTGSIPEKVVCAECGRTMDKFIMYR  702

Query  242  CCLD  231
            CC D
Sbjct  703  CCND  706



>ref|XP_008786702.1| PREDICTED: uncharacterized protein LOC103704947 [Phoenix dactylifera]
Length=699

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 108/184 (59%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KER+K+   TI  E LS   QDP M+WFFW RLESMW  K      MQ 
Sbjct  530  LEMVYVGKSNPKERVKKVVATIAAEKLSGYWQDPVMVWFFWVRLESMWHSK------MQH  583

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
              T          DPI+Q+V  +L++DGS+ GWA+ SRG  EM K +G  ++  L+ FD+
Sbjct  584  GKTI-------ENDPIMQEVMTMLTFDGSDEGWALISRGSVEMVKAQGKKLIDCLSEFDN  636

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  V  E  FI A+   L   +T  HCTR+++P       E VAC EC R MEKF +YS
Sbjct  637  WKATVEQE-GFIQAMTNALLPYHTTEHCTRLILPGDTAPITEKVACNECKRPMEKFTLYS  695

Query  242  CCLD  231
            CC D
Sbjct  696  CCND  699



>ref|XP_009415984.1| PREDICTED: uncharacterized protein LOC103996731 [Musa acuminata 
subsp. malaccensis]
Length=702

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 106/182 (58%), Gaps = 14/182 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + ++R+K+    I  E LS   QDP M+WFFW RLESMW+ K      +++
Sbjct  533  LEMVYVGKSSPRDRVKKAVTVIANEKLSGYWQDPVMMWFFWTRLESMWYSKMHHGKTVEN  592

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         DPI+Q+V  +LS+DGS+ GWAV SRG  EM K +G  +   L  FD 
Sbjct  593  -------------DPIVQEVLTMLSFDGSDDGWAVVSRGSVEMVKAQGKMINNCLETFDK  639

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  V +E  FIPAL   L+  +T  HCTR+++P   G   E V C EC R MEKF +Y 
Sbjct  640  WKVRV-EEEGFIPALTNALQPFHTPEHCTRLILPGDTGRITEQVVCAECKRPMEKFVLYR  698

Query  242  CC  237
            CC
Sbjct  699  CC  700



>ref|XP_009403632.1| PREDICTED: uncharacterized protein LOC103987147 [Musa acuminata 
subsp. malaccensis]
Length=699

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 104/184 (57%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            +EM+Y GK N KER+K+    I  E LS   QDP M+WFFW RLESMW  K      MQ 
Sbjct  530  IEMVYVGKSNPKERVKKAINVIANEKLSGYWQDPVMVWFFWVRLESMWHSK------MQS  583

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
              T          DPI+++V  +LS+DGS+ GWA+ S G  +M K  G  ++  L  FDS
Sbjct  584  GRTI-------DNDPIMREVMTMLSFDGSDDGWAIISHGSMDMVKSHGRKIIDCLLQFDS  636

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  V  E  F+PAL   L   +T  HCTR+++P   G   E V C EC R MEKF +Y 
Sbjct  637  WKGSV-QEQGFVPALTGALEPYHTHEHCTRLILPGDTGRITEQVVCAECNRPMEKFVLYR  695

Query  242  CCLD  231
            CC D
Sbjct  696  CCND  699



>ref|XP_008464490.1| PREDICTED: uncharacterized protein LOC103502357 isoform X1 [Cucumis 
melo]
Length=700

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 112/184 (61%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L+M Y GK N KER+++ S  I +  LS    D T++WFFW RLESM + K      +++
Sbjct  531  LQMAYVGKNNAKERVRKISIMISDNKLSHYWPDSTLVWFFWTRLESMMYSKLNYGKTVEN  590

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         DPI+Q++  +LS+DGS++GWA+F     E T+ +G  V+  L  FD 
Sbjct  591  -------------DPIMQEIMTLLSFDGSDKGWAIFFGRAGETTRAKGETVLSCLLAFDQ  637

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ EV +E  F+ ALD+ L+ L T HHC R+++P   G+ PE V C ECGR+MEK+ MY 
Sbjct  638  WKEEV-EEKGFVKALDEYLQQLKTPHHCNRLILPGLAGNIPENVVCAECGRAMEKYLMYR  696

Query  242  CCLD  231
            CC++
Sbjct  697  CCVE  700



>ref|XP_008464491.1| PREDICTED: uncharacterized protein LOC103502357 isoform X2 [Cucumis 
melo]
Length=697

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 112/184 (61%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L+M Y GK N KER+++ S  I +  LS    D T++WFFW RLESM + K      +++
Sbjct  528  LQMAYVGKNNAKERVRKISIMISDNKLSHYWPDSTLVWFFWTRLESMMYSKLNYGKTVEN  587

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         DPI+Q++  +LS+DGS++GWA+F     E T+ +G  V+  L  FD 
Sbjct  588  -------------DPIMQEIMTLLSFDGSDKGWAIFFGRAGETTRAKGETVLSCLLAFDQ  634

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ EV +E  F+ ALD+ L+ L T HHC R+++P   G+ PE V C ECGR+MEK+ MY 
Sbjct  635  WKEEV-EEKGFVKALDEYLQQLKTPHHCNRLILPGLAGNIPENVVCAECGRAMEKYLMYR  693

Query  242  CCLD  231
            CC++
Sbjct  694  CCVE  697



>ref|XP_006848934.1| PREDICTED: uncharacterized protein LOC18438687 [Amborella trichopoda]
 gb|ERN10515.1| hypothetical protein AMTR_s00166p00029650 [Amborella trichopoda]
Length=695

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 114/184 (62%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            +EM+Y GK N +ER++R    I +E LS    D TMIW+FW RLESMW  K      + D
Sbjct  526  IEMVYVGKSNPRERVRRIISAIIQEKLSGYWSD-TMIWYFWVRLESMWHSKRHYGRTI-D  583

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            ND            PI+Q+V ++LS+DGS+ GWAV SRG  E+ K  G  +++ L++FD+
Sbjct  584  ND------------PIVQEVMSMLSFDGSDEGWAVMSRGSTEILKTLGKKLMECLSHFDT  631

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  +T+ + FIPAL + L+  +   HCTR+++P   G   E V C ECGR MEK+ +Y 
Sbjct  632  WKANITNVDTFIPALREALQPYHKPEHCTRLILPGTTGPIQEKVVCAECGRQMEKYVLYR  691

Query  242  CCLD  231
            CC+D
Sbjct  692  CCMD  695



>emb|CAH59411.1| hypothetical protein [Plantago major]
Length=391

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 113/188 (60%), Gaps = 18/188 (10%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLS---SILQDPTMIWFFWERLESMWFLKGEKTLA  612
            LEMLY GK N + +++     I  E LS   S+ +    +W+FW RL SMW    +K L 
Sbjct  218  LEMLYVGKRNPRAKVQHCHEVIDREKLSHVFSVKEYYDYVWYFWIRLWSMW--NSKKQLG  275

Query  611  MQ-DNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLN  435
            M  DND             I+Q++  IL+YD S +GWAVFSRG  EMTKG G  VV VL+
Sbjct  276  MTVDNDL------------IMQEIMDILTYDSSEQGWAVFSRGNHEMTKGMGETVVSVLD  323

Query  434  NFDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKF  255
            N+  W H+V   + F+P LD+ +RG + +HHC ++++P+  G+ PE V C ECG+ M+K+
Sbjct  324  NYQYWGHKVDHPDKFVPVLDEAIRGTHPEHHCNKLILPSYTGYIPERVVCSECGKIMDKY  383

Query  254  FMYSCCLD  231
             MY CC D
Sbjct  384  VMYRCCND  391



>ref|XP_006438201.1| hypothetical protein CICLE_v10030843mg [Citrus clementina]
 gb|ESR51441.1| hypothetical protein CICLE_v10030843mg [Citrus clementina]
Length=706

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 109/184 (59%), Gaps = 15/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N KE+++R+  TI  E LS  L DPT+IWFFW RLESMW  K +    +Q 
Sbjct  538  LEMLYVGKSNPKEKVRRSISTITVEKLSHTLPDPTLIWFFWVRLESMWHSKMKFGRKVQ-  596

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                        +DPI+Q++  +LS+DGS++GWAV SRG   M K +   ++K L  ++ 
Sbjct  597  ------------QDPIMQEIVTMLSFDGSDQGWAVISRG-PHMAKAKDETILKCLTEYNK  643

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W   V  E +F+ A++  L      HHC R+++P   G  PE V C ECGR ME+F MY 
Sbjct  644  WEPNVP-EKSFVVAMNDYLNENRPPHHCNRLILPGEAGRIPEKVVCAECGRRMEEFIMYR  702

Query  242  CCLD  231
            CC D
Sbjct  703  CCTD  706



>ref|XP_006483988.1| PREDICTED: uncharacterized protein LOC102625551 [Citrus sinensis]
Length=706

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 109/184 (59%), Gaps = 15/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N KE+++R+  TI  E LS  L DPT+IWFFW RLESMW  K +    +Q 
Sbjct  538  LEMLYVGKSNPKEKVRRSISTITVEKLSHTLPDPTLIWFFWVRLESMWHSKMKFGRKVQ-  596

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                        +DPI+Q++  +LS+DGS++GWAV SRG   M K +   ++K L  + +
Sbjct  597  ------------QDPIMQEIVTMLSFDGSDQGWAVISRG-PHMAKAKDETILKCLTEYTT  643

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W   V  E +F+ A++  L      HHC R+++P   G  PE V C ECGR ME+F MY 
Sbjct  644  WEPNVP-EKSFVVAMNDYLNENRPPHHCNRLILPGEAGRIPEKVVCAECGRRMEEFIMYR  702

Query  242  CCLD  231
            CC D
Sbjct  703  CCTD  706



>ref|XP_010695991.1| PREDICTED: uncharacterized protein LOC104908569 [Beta vulgaris 
subsp. vulgaris]
Length=698

 Score =   165 bits (417),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 114/188 (61%), Gaps = 22/188 (12%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LE++Y GK N KER+++ +G I EE LS  L D T +W+FW RLE M + K +   +++ 
Sbjct  529  LELMYVGKTNAKERMRKITGNISEENLSHFLPDLTSMWYFWTRLECMLYSKMQHGRSVE-  587

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                        RD I+Q+V  +LS+DGS++GWA    G  EM +G+G  +++    F  
Sbjct  588  ------------RDIIMQEVMTVLSFDGSDQGWATMWFGSHEMARGKGDTILECFQMFQE  635

Query  422  WRHEVTDENA----FIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKF  255
            W     +ENA    F+PAL + L+ L+T HHC R+++P   G  PE+V C ECGR+MEK+
Sbjct  636  W-----EENARIKGFLPALKEHLQQLHTPHHCNRLILPGVEGGIPESVVCAECGRTMEKY  690

Query  254  FMYSCCLD  231
            FMY CC D
Sbjct  691  FMYRCCTD  698



>gb|KEH35012.1| sieve element occlusion protein [Medicago truncatula]
Length=706

 Score =   164 bits (416),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 112/184 (61%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KER++R   T   +  S    + T IWFFW RLESM + K +    +++
Sbjct  537  LEMVYVGKSNAKERMQRMITTFNNKKFSYFFPNVTSIWFFWARLESMLYSKLQHGRTVEN  596

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+ +V  +LS+DGS+RGWA+F RG +EM + +G   +  L +FD 
Sbjct  597  -------------DKIMSEVMTVLSFDGSDRGWAIFCRGPSEMARAKGDTALTSLRDFDK  643

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+H + +++ ++PAL+  ++ +   HHC R+++P + G  P+ V C ECGR MEK+FMY 
Sbjct  644  WKHRI-EQDGWVPALNDYIKEIQQPHHCNRLILPGSTGGIPQKVVCAECGRQMEKYFMYR  702

Query  242  CCLD  231
            CC++
Sbjct  703  CCVE  706



>ref|XP_006378263.1| hypothetical protein POPTR_0010s06060g [Populus trichocarpa]
 gb|ERP56060.1| hypothetical protein POPTR_0010s06060g [Populus trichocarpa]
Length=685

 Score =   164 bits (415),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 110/184 (60%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N +E++++N+  I  E LS +L D T+IWFFW RLESMW  K +    +++
Sbjct  516  LEMLYVGKSNPREKVRKNNSIITTEKLSHVLPDLTLIWFFWVRLESMWHSKVQHKRTVEN  575

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+Q++  +L +DGS++GWAV SRG A+M K +G  ++K   +F+ 
Sbjct  576  -------------DVIMQEIITMLIFDGSDQGWAVISRGPADMAKAKGETILKSFVDFEI  622

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            WR +   E  F+PAL   L  L+T  H  R+++P A G  PE   C  CGR M+KF MY 
Sbjct  623  WR-DGAQEKGFLPALIDHLHELHTPFHGNRLILPGATGSIPERFVCAGCGRPMQKFIMYR  681

Query  242  CCLD  231
            CC D
Sbjct  682  CCTD  685



>ref|XP_004501847.1| PREDICTED: uncharacterized protein LOC101501922 [Cicer arietinum]
Length=705

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 114/184 (62%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KER++R   T   +  S    + T IWFFW RLESM + K ++   +++
Sbjct  536  LEMVYVGKSNAKERMQRMISTFNTKKFSYFWPNVTSIWFFWARLESMLYSKLQQGKTVEN  595

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+ +V  +LS+DGS+RGWA+F RG +EM + +G   +  L +FD 
Sbjct  596  -------------DKIMSEVMTVLSFDGSDRGWAIFCRGPSEMARAKGDTALTSLRDFDK  642

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+H++ +++ ++PAL + ++ +   HHC R+++P + G  P+ V C ECGR MEK+FMY 
Sbjct  643  WKHKI-EQDGWVPALGEYIKEIQQPHHCNRLILPGSTGGIPQKVVCAECGRQMEKYFMYR  701

Query  242  CCLD  231
            CC++
Sbjct  702  CCVE  705



>gb|KDO82146.1| hypothetical protein CISIN_1g005245mg [Citrus sinensis]
Length=527

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 108/184 (59%), Gaps = 15/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N KE+ +R   TI  E LS  L DPT+IWFFW RLESMW  K +    +Q 
Sbjct  359  LEMLYVGKSNPKEKARRIISTISVEKLSHTLPDPTLIWFFWVRLESMWHSKMKFGTKVQ-  417

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                        +DPI+Q++  +LS+DGS++GWAV SRG   M K +   ++K L  + +
Sbjct  418  ------------QDPIMQEIVTMLSFDGSDQGWAVISRG-PHMAKAKDETILKCLTEYTT  464

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W   V  E +F+ A++  L    T +HC R+++P   G  PE V C ECGR ME+F MY 
Sbjct  465  WEPNVP-EKSFVVAMNDYLNENRTPYHCNRLILPGEAGRIPEKVVCAECGRRMEEFIMYR  523

Query  242  CCLD  231
            CC D
Sbjct  524  CCTD  527



>ref|XP_007044877.1| Sieve element occlusion e, putative [Theobroma cacao]
 gb|EOY00709.1| Sieve element occlusion e, putative [Theobroma cacao]
Length=705

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 112/186 (60%), Gaps = 16/186 (9%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N  E+++RN  TIQ E LS +L D +++ FFW RLESMW  + +  + +++
Sbjct  534  LEMLYVGKSNPTEKVRRNMTTIQRENLSRVLSDISLMRFFWVRLESMWHSRVQHGVTVEN  593

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D IL ++  +LS+DGS +GWAV SRG  E+ + +   V+K L+ +  
Sbjct  594  -------------DHILPEIMTMLSFDGSEQGWAVISRGSDELARAKAEIVLKSLDQYPV  640

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVG--HYPETVACVECGRSMEKFFM  249
            W   +  E  FIPAL+  +RGL T+HHC R+++P   G     E V C +CG+ MEKFFM
Sbjct  641  WE-ALAAEKGFIPALNDHIRGLRTEHHCNRLILPGTAGIRSIHERVVCFDCGKQMEKFFM  699

Query  248  YSCCLD  231
            Y CC D
Sbjct  700  YRCCTD  705



>ref|XP_012071647.1| PREDICTED: uncharacterized protein LOC105633633 [Jatropha curcas]
 gb|KDP46383.1| hypothetical protein JCGZ_10223 [Jatropha curcas]
Length=709

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 113/182 (62%), Gaps = 14/182 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M+Y GK N KER++RN  TI  E LS   QD T IW+FW R+ESMW  K +       
Sbjct  540  LGMVYVGKSNPKERVRRNIATIIVEKLSHYWQDLTSIWYFWVRIESMWRSKNQLG-----  594

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
               RT   PE   DPI++++  +LS+DGS+ GWA+F+RG  E+ + +G+  +  L N+ +
Sbjct  595  ---RT---PEN--DPIMKEIMTMLSFDGSDGGWAIFTRGSDEIVRAKGNIFLTCLANYSA  646

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ ++  +  F+P L +QL     +HHC R+V+P A G  PE + C +CGRSMEKF MY 
Sbjct  647  WKDQI-QQKGFMPTLKEQLYLSAPEHHCNRLVLPGAAGMIPERIVCSDCGRSMEKFIMYR  705

Query  242  CC  237
            CC
Sbjct  706  CC  707



>gb|KDO82145.1| hypothetical protein CISIN_1g005245mg [Citrus sinensis]
Length=706

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 108/184 (59%), Gaps = 15/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N KE+ +R   TI  E LS  L DPT+IWFFW RLESMW  K +    +Q 
Sbjct  538  LEMLYVGKSNPKEKARRIISTISVEKLSHTLPDPTLIWFFWVRLESMWHSKMKFGTKVQ-  596

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                        +DPI+Q++  +LS+DGS++GWAV SRG   M K +   ++K L  + +
Sbjct  597  ------------QDPIMQEIVTMLSFDGSDQGWAVISRG-PHMAKAKDETILKCLTEYTT  643

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W   V  E +F+ A++  L    T +HC R+++P   G  PE V C ECGR ME+F MY 
Sbjct  644  WEPNVP-EKSFVVAMNDYLNENRTPYHCNRLILPGEAGRIPEKVVCAECGRRMEEFIMYR  702

Query  242  CCLD  231
            CC D
Sbjct  703  CCTD  706



>ref|XP_004138263.2| PREDICTED: uncharacterized protein LOC101204444 isoform X2 [Cucumis 
sativus]
 gb|KGN63518.1| hypothetical protein Csa_1G002870 [Cucumis sativus]
Length=698

 Score =   161 bits (408),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 110/184 (60%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L+M Y GK N KER+++ S  I +  LS    D T++WFFW RLESM + K      +++
Sbjct  529  LQMAYVGKNNAKERVRKISIMISDNKLSHYWADSTLVWFFWARLESMMYSKLNYGKTVEN  588

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         DPI+Q++  +LS+DGS++GWA+F     E T+ +G  V+  +  FD 
Sbjct  589  -------------DPIMQEIMTLLSFDGSDKGWAIFFGRAGETTRAKGETVLSCILAFDQ  635

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ EV +E  F+ AL   L+ L T HHC R+++P   G+ PE V C ECGR+MEK+ MY 
Sbjct  636  WKEEV-EEKGFVKALADYLQQLKTPHHCNRLILPGLAGNIPENVVCAECGRAMEKYLMYR  694

Query  242  CCLD  231
            CC++
Sbjct  695  CCVE  698



>ref|XP_011653503.1| PREDICTED: uncharacterized protein LOC101204444 isoform X1 [Cucumis 
sativus]
Length=701

 Score =   161 bits (408),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 110/184 (60%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L+M Y GK N KER+++ S  I +  LS    D T++WFFW RLESM + K      +++
Sbjct  532  LQMAYVGKNNAKERVRKISIMISDNKLSHYWADSTLVWFFWARLESMMYSKLNYGKTVEN  591

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         DPI+Q++  +LS+DGS++GWA+F     E T+ +G  V+  +  FD 
Sbjct  592  -------------DPIMQEIMTLLSFDGSDKGWAIFFGRAGETTRAKGETVLSCILAFDQ  638

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ EV +E  F+ AL   L+ L T HHC R+++P   G+ PE V C ECGR+MEK+ MY 
Sbjct  639  WKEEV-EEKGFVKALADYLQQLKTPHHCNRLILPGLAGNIPENVVCAECGRAMEKYLMYR  697

Query  242  CCLD  231
            CC++
Sbjct  698  CCVE  701



>gb|KDO37241.1| hypothetical protein CISIN_1g014387mg [Citrus sinensis]
Length=425

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 109/183 (60%), Gaps = 15/183 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M+Y GK N K+R++RN+ TI  E LS I QD T IW+FW RLESMW+           
Sbjct  255  LGMVYVGKSNPKDRVRRNNDTIASENLSHIWQDLTSIWYFWVRLESMWY-----------  303

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
              ++  +      D ++Q++  +L+YD S  GWAVF+RG AEM   +G+  +  +  +++
Sbjct  304  --SKVQLGRNAETDHVMQEIMRMLTYDSSEGGWAVFARGSAEMASAKGAIFLTCMQEYNT  361

Query  422  -WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
             W+ +V +   F+PA+   L  L+T HHC R+V+P   G  PE + C ECGR MEKF MY
Sbjct  362  VWKDQV-EPKGFMPAMRDHLGQLHTPHHCNRLVLPGTAGKIPERIICSECGRVMEKFLMY  420

Query  245  SCC  237
             CC
Sbjct  421  RCC  423



>gb|KHG00715.1| hypothetical protein F383_23634 [Gossypium arboreum]
Length=715

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 110/186 (59%), Gaps = 15/186 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KER+K+ +G I+E+ LS   +D   +WFFW RLESM + K +    +++
Sbjct  538  LEMVYVGKNNAKERVKKITGLIKEKQLSHAWEDEN-VWFFWNRLESMLYSKTQHGKTIEN  596

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I Q+V  +L+YDGS  GWAVF  G  EM +  G  V+  + +FD 
Sbjct  597  -------------DVIKQEVMTMLAYDGSENGWAVFFTGSDEMVRANGEKVLSSMKSFDE  643

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  ++  +  FIPAL K L G+   HHCTR+++P   G  PE V C ECGR ME +FMY 
Sbjct  644  WE-KLAKQMGFIPALRKHLDGITDDHHCTRLILPGNGGGIPERVQCAECGRPMEMYFMYR  702

Query  242  CCLDEY  225
            CC+D +
Sbjct  703  CCVDPH  708



>gb|KJB21018.1| hypothetical protein B456_003G178000 [Gossypium raimondii]
Length=706

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 110/184 (60%), Gaps = 15/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KER+K+ +G I+E+ LS   +D   +WFFW RLESM + K +    +++
Sbjct  538  LEMVYIGKNNAKERVKKITGLIKEKQLSHAWEDDN-VWFFWNRLESMLYSKIQHGKTIEN  596

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I Q+V  +L+YDGS  GWAVF  G  EM +  G  V+  + +FD 
Sbjct  597  -------------DAIKQEVMTMLAYDGSENGWAVFFTGSDEMVRANGDKVLSSMESFDK  643

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  ++  +  FIPAL KQL G+   HHCTR+++P   G  PE V C ECGR ME +FMY 
Sbjct  644  WE-KLAKQMGFIPALRKQLEGITDDHHCTRLILPENSGGIPERVQCAECGRPMEMYFMYR  702

Query  242  CCLD  231
            CC++
Sbjct  703  CCVE  706



>gb|KJB31087.1| hypothetical protein B456_005G175200 [Gossypium raimondii]
Length=705

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 109/188 (58%), Gaps = 18/188 (10%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N +ER++RN   I+ E LS  L D ++IWFFW RLESMW  + +  + +++
Sbjct  532  LEMLYVGKSNPRERVRRNMTNIELENLSHTLSDISLIWFFWVRLESMWHSRAQHGVTVRN  591

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+Q++  +L +DGS++GWAV SRG  EM + +    +K L  + +
Sbjct  592  -------------DLIMQEILTMLGFDGSDQGWAVISRGADEMARAKAETFLKSLEEYTA  638

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVP----AAVGHYPETVACVECGRSMEKF  255
            W      E  FIPAL+   R L T+HHC R+ +P    A +G   +TV CV+CG+ ME  
Sbjct  639  WEAAAA-EKGFIPALNDHFRSLRTEHHCNRLTLPGISVAEIGSIKDTVVCVDCGKPMEAL  697

Query  254  FMYSCCLD  231
             M+ CC D
Sbjct  698  LMFRCCTD  705



>gb|KHG30263.1| hypothetical protein F383_10527 [Gossypium arboreum]
Length=633

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 109/184 (59%), Gaps = 15/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KER+K+ +G I+E+ LS   +D   +WFFW RLESM + K +    +++
Sbjct  465  LEMVYVGKNNAKERVKKITGLIKEKQLSHAWEDDN-VWFFWNRLESMLYSKTQHGKTVEN  523

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I Q+V  +L+YDG   GWAVF  G  EM +  G  V+  + +FD 
Sbjct  524  -------------DAIKQEVMTMLAYDGRENGWAVFFSGSDEMVRANGDKVISSMESFDE  570

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  ++  +  FIPAL KQL G+   HHCTR+++P   G  PE V C ECGR ME +FMY 
Sbjct  571  WE-KLAKQMGFIPALRKQLEGITDDHHCTRLILPENSGGIPERVQCAECGRPMEMYFMYR  629

Query  242  CCLD  231
            CC++
Sbjct  630  CCVE  633



>gb|KHG30262.1| hypothetical protein F383_10527 [Gossypium arboreum]
Length=646

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 109/184 (59%), Gaps = 15/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KER+K+ +G I+E+ LS   +D   +WFFW RLESM + K +    +++
Sbjct  465  LEMVYVGKNNAKERVKKITGLIKEKQLSHAWEDDN-VWFFWNRLESMLYSKTQHGKTVEN  523

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I Q+V  +L+YDG   GWAVF  G  EM +  G  V+  + +FD 
Sbjct  524  -------------DAIKQEVMTMLAYDGRENGWAVFFSGSDEMVRANGDKVISSMESFDE  570

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  ++  +  FIPAL KQL G+   HHCTR+++P   G  PE V C ECGR ME +FMY 
Sbjct  571  WE-KLAKQMGFIPALRKQLEGITDDHHCTRLILPENSGGIPERVQCAECGRPMEMYFMYR  629

Query  242  CCLD  231
            CC++
Sbjct  630  CCVE  633



>gb|KJB19528.1| hypothetical protein B456_003G107900 [Gossypium raimondii]
Length=699

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 107/184 (58%), Gaps = 15/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KER+K+ SG I E+ LS   QD + +WFFW RLESM +    KT   + 
Sbjct  531  LEMVYVGKNNAKERVKKISGLITEKQLSHSWQDAS-VWFFWNRLESMLY---SKTQHGKT  586

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            ND           D I Q+V  IL YDGS  GWA+F  G  EM +  G  V+  + +F+ 
Sbjct  587  NDP----------DIIKQEVMTILGYDGSEHGWAIFFLGTTEMVRANGERVLSSMQSFEE  636

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  E+  +  FIPAL K L G+   HHCTR+++P   G   E V C ECGR ME +FMY 
Sbjct  637  WE-EMARQMGFIPALRKHLEGITDDHHCTRLILPGISGGIAERVVCAECGRPMEMYFMYR  695

Query  242  CCLD  231
            CC++
Sbjct  696  CCVE  699



>ref|XP_010904538.1| PREDICTED: uncharacterized protein LOC105031936 [Elaeis guineensis]
Length=707

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 110/184 (60%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L+M+Y GK + KER+K+    I  E LSS  QDP M+WFFW RLESMW  K +   ++ D
Sbjct  538  LDMVYVGKSSSKERVKKAVAAIAAEKLSSSWQDPVMVWFFWVRLESMWHSKMQHGKSI-D  596

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            ND+            I+Q+V  +LS+DGS+ GWA+ SRG  EM K +G  +V+ LN F+ 
Sbjct  597  NDS------------IMQEVMTLLSFDGSDEGWAIISRGSLEMVKSQGKKLVECLNQFEQ  644

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  V  E  FIPAL   L   +T  HCTR+++P   G   E V C EC R MEKF +Y 
Sbjct  645  WKATVETE-GFIPALTNALLPYHTHEHCTRLILPGENGRIQEHVICAECRRPMEKFILYR  703

Query  242  CCLD  231
            CC D
Sbjct  704  CCND  707



>ref|XP_008444389.1| PREDICTED: uncharacterized protein LOC103487729 [Cucumis melo]
Length=703

 Score =   159 bits (403),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 113/185 (61%), Gaps = 15/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LE+LY GK N  E+IK+N   I  + +   L DPT+IWFFW RLESMW+ K ++   ++D
Sbjct  533  LEILYVGKSNPGEKIKKNIAAILADKVIHTLVDPTLIWFFWVRLESMWYSKTQRGNTIED  592

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         DP++Q+   +LS+D  ++GWA+F +G  ++ + +   +  V++ ++ 
Sbjct  593  -------------DPVMQETMTMLSFDSGDQGWALFCKGSTDILRAKAETITNVVDGYEE  639

Query  422  -WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
             W+  V +E  FIPA+ K L+ ++T  HC R+++P++ G  PE V C ECG +MEKF MY
Sbjct  640  RWKVHVQEE-GFIPAMSKDLQDIHTPEHCNRLILPSSNGTIPEKVVCSECGSAMEKFIMY  698

Query  245  SCCLD  231
             CC D
Sbjct  699  RCCND  703



>gb|EPS71838.1| hypothetical protein M569_02915, partial [Genlisea aurea]
Length=688

 Score =   159 bits (403),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 113/187 (60%), Gaps = 17/187 (9%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSI--LQDPT-MIWFFWERLESMWFLKGEKTLA  612
            LEMLY GK   KE+ +R    IQ EGLS I  L+D +  +WFFW RL SMW    +K + 
Sbjct  516  LEMLYVGKREPKEKTRRCHEIIQREGLSHIFPLKDYSDYVWFFWVRLTSMW--NSKKQIG  573

Query  611  MQDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNN  432
            M +ND             I+Q++K +L +D S +GWAVFSRG  E+TKG G  V++VL N
Sbjct  574  MTENDE------------IMQEIKDMLVFDSSEQGWAVFSRGNQEITKGNGEKVIQVLEN  621

Query  431  FDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
              +W ++V     F+  L +++  L  +HHC R+++P   G+ PE V C ECG++M+K+ 
Sbjct  622  SGNWMYKVDQPEKFVAVLHEEVSTLQPEHHCNRLILPGQGGNIPEIVKCSECGKTMDKYV  681

Query  251  MYSCCLD  231
            MY CC D
Sbjct  682  MYRCCTD  688



>gb|KHG00716.1| hypothetical protein F383_23634 [Gossypium arboreum]
Length=706

 Score =   159 bits (402),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 109/184 (59%), Gaps = 15/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KER+K+ +G I+E+ LS   +D   +WFFW RLESM + K +    +++
Sbjct  538  LEMVYVGKNNAKERVKKITGLIKEKQLSHAWEDEN-VWFFWNRLESMLYSKTQHGKTIEN  596

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I Q+V  +L+YDGS  GWAVF  G  EM +  G  V+  + +FD 
Sbjct  597  -------------DVIKQEVMTMLAYDGSENGWAVFFTGSDEMVRANGEKVLSSMKSFDE  643

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  ++  +  FIPAL K L G+   HHCTR+++P   G  PE V C ECGR ME +FMY 
Sbjct  644  WE-KLAKQMGFIPALRKHLDGITDDHHCTRLILPGNGGGIPERVQCAECGRPMEMYFMYR  702

Query  242  CCLD  231
            CC++
Sbjct  703  CCVE  706



>gb|KJB21010.1| hypothetical protein B456_003G177800 [Gossypium raimondii]
Length=707

 Score =   159 bits (402),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 111/184 (60%), Gaps = 15/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            +EM+Y GK N +ER+K+ +G I+E+ LS   +D   +WFFW RLESM + K +   A+++
Sbjct  539  IEMVYVGKNNARERVKKITGLIKEKKLSHAWEDGN-VWFFWNRLESMLYSKTQHGKAIEN  597

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I Q+V  +L+YDGS  GWAVF  G  EM +  G  V+  + +F+ 
Sbjct  598  -------------DVIKQEVMTLLAYDGSENGWAVFFTGSDEMVRANGDKVLSSMKSFEE  644

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  ++  +  FIPAL K L G+  +HHCTR+++P   G  PE V C ECGR ME +FMY 
Sbjct  645  WE-KLAKQMGFIPALRKHLEGITDEHHCTRLILPGNSGGIPERVQCAECGRPMEMYFMYR  703

Query  242  CCLD  231
            CC++
Sbjct  704  CCVE  707



>gb|KJB21009.1| hypothetical protein B456_003G177800 [Gossypium raimondii]
Length=706

 Score =   159 bits (402),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 111/184 (60%), Gaps = 15/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            +EM+Y GK N +ER+K+ +G I+E+ LS   +D   +WFFW RLESM + K +   A+++
Sbjct  538  IEMVYVGKNNARERVKKITGLIKEKKLSHAWEDGN-VWFFWNRLESMLYSKTQHGKAIEN  596

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I Q+V  +L+YDGS  GWAVF  G  EM +  G  V+  + +F+ 
Sbjct  597  -------------DVIKQEVMTLLAYDGSENGWAVFFTGSDEMVRANGDKVLSSMKSFEE  643

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  ++  +  FIPAL K L G+  +HHCTR+++P   G  PE V C ECGR ME +FMY 
Sbjct  644  WE-KLAKQMGFIPALRKHLEGITDEHHCTRLILPGNSGGIPERVQCAECGRPMEMYFMYR  702

Query  242  CCLD  231
            CC++
Sbjct  703  CCVE  706



>ref|XP_004143056.1| PREDICTED: uncharacterized protein LOC101208559 [Cucumis sativus]
 gb|KGN62332.1| hypothetical protein Csa_2G349660 [Cucumis sativus]
Length=703

 Score =   159 bits (401),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 113/185 (61%), Gaps = 15/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LE+LY GK N  E+IK+N   I  + +   L DPT+IWFFW RLESMW+ K ++   ++D
Sbjct  533  LEILYVGKSNPGEKIKKNIAGILADKMIRTLVDPTLIWFFWVRLESMWYSKTQRGNTIED  592

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         DP++Q+   +LS+D  ++GWA+F +G  ++ + +   +  V++ ++ 
Sbjct  593  -------------DPVMQETMTMLSFDSGDQGWALFCKGSTDILRAKAETITNVVDGYEE  639

Query  422  -WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
             W+  V +E  FIPA+ K L+ ++T  HC R+++P++ G  PE V C ECG +MEKF MY
Sbjct  640  RWKVHVKEE-GFIPAMTKDLQDIHTPEHCNRLILPSSNGTIPEKVVCSECGSAMEKFIMY  698

Query  245  SCCLD  231
             CC D
Sbjct  699  RCCND  703



>ref|XP_006470197.1| PREDICTED: uncharacterized protein LOC102630205 [Citrus sinensis]
Length=845

 Score =   160 bits (405),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 109/183 (60%), Gaps = 15/183 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M+Y GK N K+R++RN+ TI  E LS I QD T IW+FW RLESMW+           
Sbjct  675  LGMVYVGKSNPKDRVRRNNDTIASENLSHIWQDLTSIWYFWVRLESMWY-----------  723

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
              ++  +      D ++Q++  +L+YD S  GWAVF+RG AEM   +G+  +  +  +++
Sbjct  724  --SKVQLGRNAETDHVMQEIMRMLTYDSSEGGWAVFARGSAEMASAKGAIFLTCMQEYNT  781

Query  422  -WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
             W+ +V +   F+PA+   L  L+T HHC R+V+P   G  PE + C ECGR MEKF MY
Sbjct  782  VWKDQV-EPKGFMPAMRDHLGQLHTPHHCNRLVLPGTAGKIPERIICSECGRVMEKFLMY  840

Query  245  SCC  237
             CC
Sbjct  841  RCC  843



>ref|XP_007037798.1| Sieve element occlusion e, putative [Theobroma cacao]
 gb|EOY22299.1| Sieve element occlusion e, putative [Theobroma cacao]
Length=705

 Score =   159 bits (401),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 109/184 (59%), Gaps = 15/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N +ER+++ +G I E+ LS   QD T IWFFW RLESM F    KT   + 
Sbjct  537  LEMVYVGKNNARERVRKITGFINEKQLSHAWQDGT-IWFFWNRLESMLF---SKTRHGKT  592

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            N+T          D I Q+V  +L YDGS  GWAVF  G  EM + +G   +  + +F++
Sbjct  593  NET----------DVIKQEVMTLLGYDGSEHGWAVFFLGSIEMVRAKGDKALSSMQSFET  642

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W + +  E  F+PAL K L G+   HHCTR+++P   G   E V C ECGR ME +FMY 
Sbjct  643  WEY-LAREMGFMPALRKYLEGIAEDHHCTRLILPGISGGIAERVVCAECGRPMEMYFMYR  701

Query  242  CCLD  231
            CC+D
Sbjct  702  CCVD  705



>gb|KDO69426.1| hypothetical protein CISIN_1g044391mg [Citrus sinensis]
Length=691

 Score =   159 bits (401),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 107/182 (59%), Gaps = 14/182 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M Y GK N KER ++ S  + +E LS  L DPT +WFFW RLESM + K +    ++D
Sbjct  522  LGMAYVGKNNAKERFRKISRIVIQENLSHTLTDPTEVWFFWARLESMLYSKLQHGATVED  581

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+Q+V  ILS+DGS +GWA+F RG  EM + +G   V  +  F+ 
Sbjct  582  -------------DHIMQEVMTILSFDGSEQGWAIFWRGTHEMARAKGEMAVDCMMEFEK  628

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +  D+  F+  L+  L+ ++T  HC R+++P   G  PE +AC ECGR+ME FFMY 
Sbjct  629  WKDD-ADQMGFVAGLNNYLQRVHTPRHCNRLILPDIHGPIPERLACAECGRTMEMFFMYR  687

Query  242  CC  237
            CC
Sbjct  688  CC  689



>ref|XP_006439977.1| hypothetical protein CICLE_v10019128mg [Citrus clementina]
 gb|ESR53217.1| hypothetical protein CICLE_v10019128mg [Citrus clementina]
Length=691

 Score =   159 bits (401),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 107/182 (59%), Gaps = 14/182 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M Y GK N KER ++ S  + +E LS  L DPT +WFFW RLESM + K +    ++D
Sbjct  522  LGMAYVGKNNAKERFRKISRIVIQENLSHTLTDPTEVWFFWARLESMLYSKLQHGATVED  581

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+Q+V  ILS+DGS +GWA+F RG  EM + +G   V  +  F+ 
Sbjct  582  -------------DHIMQEVMTILSFDGSEQGWAIFWRGTHEMARAKGEMAVDCMMEFEK  628

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +  D+  F+  L+  L+ ++T  HC R+++P   G  PE +AC ECGR+ME FFMY 
Sbjct  629  WKDD-ADQMGFVAGLNNYLQRVHTPRHCNRLILPDIHGPIPERLACAECGRTMEMFFMYR  687

Query  242  CC  237
            CC
Sbjct  688  CC  689



>ref|XP_008340127.1| PREDICTED: uncharacterized protein LOC103403084 [Malus domestica]
Length=743

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 120/187 (64%), Gaps = 9/187 (5%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNS-GTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            LEMLY G+   KE +  N    IQ E LS  L D  +IWFFW RLESMW  KG+  L  +
Sbjct  563  LEMLYVGRSKAKENVMNNIIKIIQAEKLSHTL-DWNLIWFFWIRLESMWQSKGQ--LLSE  619

Query  605  DNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFD  426
               T++   P +S DP++Q + ++LS+  S+RGWAV S G A M+K  G +++K L+ F+
Sbjct  620  QGKTQSRTDPLKS-DPMMQGIISLLSFGSSDRGWAVISLGSAAMSKANGEHMLKSLSEFN  678

Query  425  SWRHEVTDENAFIPALDKQLRGLYTK--HHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
             W++  + E  F PAL++ L G++ +  HHCT +++P A G  PETVAC ECGR ME+F 
Sbjct  679  DWKNR-SSEVGFTPALNEHLEGVHRQAPHHCTSLILP-ATGIMPETVACAECGRVMERFS  736

Query  251  MYSCCLD  231
            M+ CCLD
Sbjct  737  MFRCCLD  743



>ref|XP_004236294.1| PREDICTED: uncharacterized protein LOC101251765 [Solanum lycopersicum]
Length=723

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 111/184 (60%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L+MLY GK N KER+++ + TI +E LS+ L D T +W+FW R+ESM++ K +    +Q+
Sbjct  554  LQMLYVGKSNNKERVRKINSTITDEKLSNCLTDLTSVWYFWTRIESMFYSKMQLGKTIQE  613

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+Q+V  +LS+DGS++GWA+ SRG  EM + +   + K L ++ +
Sbjct  614  -------------DKIMQEVLTMLSFDGSDQGWALISRGSFEMARAKSQIITKTLEDYTT  660

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  +      F+PAL +    L+T  HC R+++P   G  P+ + C ECGR ME+FFMY 
Sbjct  661  WE-DSAKTKGFVPALIEYFLQLHTPEHCNRLILPGLDGDIPDVIVCAECGRPMERFFMYR  719

Query  242  CCLD  231
            CC D
Sbjct  720  CCTD  723



>gb|KHN29013.1| hypothetical protein glysoja_008348 [Glycine soja]
Length=696

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 110/182 (60%), Gaps = 14/182 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N  ++++  +  +Q E LS++L D  + WFFW RLESMW  K +++  +++
Sbjct  527  LEMIYVGKSNPGKKVQEINNAVQTEKLSNVLPDLAISWFFWVRLESMWHSKSQQSKTVEN  586

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+ +V  IL+YD  + GWAV S+G  +M +G+G   +K LN  + 
Sbjct  587  -------------DHIMHEVMRILTYDSGDPGWAVISQGTGKMAQGKGDTFLKCLNEHEQ  633

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+    D+   +PA+D  ++ L T HHC R+++P   G  P+ V+C ECG++MEKF+MY 
Sbjct  634  WKDAAKDK-GLLPAMDDYIKELQTPHHCNRLILPGTSGGIPDKVSCAECGQTMEKFYMYR  692

Query  242  CC  237
            CC
Sbjct  693  CC  694



>ref|NP_001240968.1| uncharacterized protein LOC100799626 [Glycine max]
 gb|ADN32787.1| sieve element occlusion e [Glycine max]
Length=703

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 110/182 (60%), Gaps = 14/182 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N  ++++  +  +Q E LS++L D  + WFFW RLESMW  K +++  +++
Sbjct  534  LEMIYVGKSNPGKKVQEINNAVQTEKLSNVLPDLAISWFFWVRLESMWHSKSQQSKTVEN  593

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+ +V  IL+YD  + GWAV S+G  +M +G+G   +K LN  + 
Sbjct  594  -------------DHIMHEVMRILTYDSGDPGWAVISQGTGKMAQGKGDTFLKCLNEHEQ  640

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+    D+   +PA+D  ++ L T HHC R+++P   G  P+ V+C ECG++MEKF+MY 
Sbjct  641  WKDAAKDK-GLLPAMDDYIKELQTPHHCNRLILPGTSGGIPDKVSCAECGQTMEKFYMYR  699

Query  242  CC  237
            CC
Sbjct  700  CC  701



>ref|XP_009359245.1| PREDICTED: uncharacterized protein LOC103949844 [Pyrus x bretschneideri]
Length=746

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 119/187 (64%), Gaps = 9/187 (5%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRN-SGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            LEMLY G+   KE + +N    IQ E LS IL D  +IWFFW RLESMW  KG+  L  +
Sbjct  566  LEMLYVGRSKPKETVVKNIMNIIQAEKLSHIL-DLNLIWFFWIRLESMWQSKGQ--LLSE  622

Query  605  DNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFD  426
               T +   P +S DPI+Q + ++LS+  S+RGWAV S+G   M++  G +++K L  F 
Sbjct  623  QGKTHSPTDPLKS-DPIMQGIISMLSFGSSDRGWAVISQGSPVMSRANGEHMLKSLGAFK  681

Query  425  SWRHEVTDENAFIPALDKQLRGLYTK--HHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
             W++  + E  FIPAL++ L G++ +  HHCT +++PA  G  PETV C ECGR ME+F 
Sbjct  682  DWKNR-SSEVGFIPALNEHLEGVHRQAPHHCTSLILPAT-GIMPETVQCAECGRLMERFS  739

Query  251  MYSCCLD  231
            M+ CCLD
Sbjct  740  MFRCCLD  746



>ref|XP_004504145.1| PREDICTED: uncharacterized protein LOC101504285 isoform X3 [Cicer 
arietinum]
Length=704

 Score =   156 bits (395),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 112/182 (62%), Gaps = 14/182 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LE++Y GK N  E+I++ + TI EE LS++L  PT+ WFFW RLESMW  K      +Q 
Sbjct  535  LEIMYVGKSNPGEKIRKINKTINEEKLSNVLAYPTINWFFWVRLESMWHSK------LQQ  588

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
             +T          D I+ ++  ILS+D S++GWAV S+G  +MT+G+G + +K +  F+ 
Sbjct  589  GNTV-------ENDQIMLEIVRILSFDSSDQGWAVISQGTVKMTQGKGDSFLKCVVEFEE  641

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+    D+   + A+D  ++G+ T HHC R+++P   G  PE + C EC + MEKF+MY 
Sbjct  642  WKDNAKDK-GVLAAMDDYIQGIQTPHHCNRLILPGVDGRTPEQIICAECRQPMEKFYMYR  700

Query  242  CC  237
            CC
Sbjct  701  CC  702



>ref|XP_004504143.1| PREDICTED: uncharacterized protein LOC101504285 isoform X1 [Cicer 
arietinum]
 ref|XP_004504144.1| PREDICTED: uncharacterized protein LOC101504285 isoform X2 [Cicer 
arietinum]
Length=706

 Score =   156 bits (395),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 112/182 (62%), Gaps = 14/182 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LE++Y GK N  E+I++ + TI EE LS++L  PT+ WFFW RLESMW  K      +Q 
Sbjct  537  LEIMYVGKSNPGEKIRKINKTINEEKLSNVLAYPTINWFFWVRLESMWHSK------LQQ  590

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
             +T          D I+ ++  ILS+D S++GWAV S+G  +MT+G+G + +K +  F+ 
Sbjct  591  GNTV-------ENDQIMLEIVRILSFDSSDQGWAVISQGTVKMTQGKGDSFLKCVVEFEE  643

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+    D+   + A+D  ++G+ T HHC R+++P   G  PE + C EC + MEKF+MY 
Sbjct  644  WKDNAKDK-GVLAAMDDYIQGIQTPHHCNRLILPGVDGRTPEQIICAECRQPMEKFYMYR  702

Query  242  CC  237
            CC
Sbjct  703  CC  704



>ref|XP_002526964.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35451.1| conserved hypothetical protein [Ricinus communis]
Length=805

 Score =   157 bits (397),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 109/182 (60%), Gaps = 14/182 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M+Y GK N KER++RN  TI  E LS   QD T IW+FW R+ESMW  K +       
Sbjct  636  LGMVYVGKSNPKERVRRNIATIMVEKLSHYWQDLTSIWYFWVRIESMWRSKNQ-------  688

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                  +      D +++++ A+LS+D S  GWA+F+ G  E+ K +GS  +  L+ + S
Sbjct  689  ------LGKTSENDSLMKEIMAMLSFDSSEGGWAIFTGGTDEIVKAKGSIFLTCLSEYTS  742

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ ++  +  F+P+L   L+GL+T HHC R+++P + G  PE + C +C R+ME++ MY 
Sbjct  743  WKDQI-QQKGFLPSLKDYLKGLHTDHHCNRLILPGSAGTIPERIVCSDCSRNMERYIMYK  801

Query  242  CC  237
            CC
Sbjct  802  CC  803



>ref|XP_002526965.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35452.1| conserved hypothetical protein [Ricinus communis]
Length=809

 Score =   157 bits (397),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 112/182 (62%), Gaps = 14/182 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M+Y GK N KER++RN  TI  E LS   QD T IW+FW R+ESMW  K +     ++
Sbjct  640  LGMVYVGKSNPKERVRRNVSTIMVEKLSHYWQDLTSIWYFWVRIESMWRSKNQLGKTSEN  699

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D +++++ A+LS+D S  GWA+F++G  E+ K +GS  +  L+++  
Sbjct  700  -------------DSLMKEIMAMLSFDSSEGGWAIFTKGTEELVKAKGSISLTCLSDYTI  746

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ ++  +  F+P+L   L+ L+T+HHC R+++P++ G  PE + C EC R+ME++ +Y 
Sbjct  747  WKDQI-QQKGFLPSLKDYLKSLHTEHHCNRLILPSSAGMIPEKIVCTECSRNMERYILYK  805

Query  242  CC  237
            CC
Sbjct  806  CC  807



>gb|ADN32810.1| sieve element occlusion a [Solanum phureja]
Length=723

 Score =   156 bits (395),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 108/184 (59%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L+MLY GK N KER++R +  I  E LS  L D T +W+FW R+ESM++ K +    +Q+
Sbjct  554  LQMLYVGKSNNKERVRRINSMITAENLSYCLMDLTSVWYFWTRIESMFYSKMQLGKTIQE  613

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D ++Q+V  +LS+DGS++GWA+ SRG  EM + +   + K L ++  
Sbjct  614  -------------DKVMQEVLTMLSFDGSDQGWALISRGSFEMARAKSQIITKTLEDYTI  660

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  E      F+PAL +    L+T  HC R+++P   G  PE + C ECGR+ME+FFMY 
Sbjct  661  WE-EDARSKGFVPALIEYFLQLHTPQHCNRLILPGLDGDIPEMIVCAECGRAMERFFMYR  719

Query  242  CCLD  231
            CC D
Sbjct  720  CCTD  723



>ref|XP_006351433.1| PREDICTED: uncharacterized protein LOC102598958 [Solanum tuberosum]
Length=723

 Score =   156 bits (395),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 109/184 (59%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L+MLY GK N KER++R +  I  E LS  L D T +W+FW R+ESM++ K +    +Q+
Sbjct  554  LQMLYVGKSNNKERVRRINSMITAENLSYCLMDLTSVWYFWTRIESMFYSKMQLGKTIQE  613

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D ++Q+V  +LS+DGS++GWA+ SRG  EM + +   + K L ++  
Sbjct  614  -------------DKVMQEVLTMLSFDGSDQGWALISRGSFEMARAKSQIITKTLEDYTI  660

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  +   +  F+PAL +    L+T  HC R+++P   G  PE + C ECGR+ME+FFMY 
Sbjct  661  WEEDARSK-GFVPALIEYFLQLHTPQHCNRLILPGLDGDIPEMIVCAECGRAMERFFMYR  719

Query  242  CCLD  231
            CC D
Sbjct  720  CCTD  723



>emb|CAN65891.1| hypothetical protein VITISV_041167 [Vitis vinifera]
Length=693

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 103/184 (56%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KE++++    I    L     DPT IWFFW R+ESM + K +    +++
Sbjct  524  LEMVYVGKSNAKEQVRKTITFIDSRSLGYCWTDPTNIWFFWTRMESMLYSKTQHGKTIEN  583

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I   V  +LS+DGS++GW+V   G  EM K +G  ++K    +  
Sbjct  584  -------------DSIFAGVLTMLSFDGSDQGWSVICHGPTEMAKAKGDMILKCFTEYSD  630

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W   V  +N F+PAL++ L+ L+T  HC R+++P   G  PE V C ECGR MEK+FMY 
Sbjct  631  WSDNV-QQNGFMPALNEHLQKLHTPEHCNRLILPGINGDIPEKVVCAECGRPMEKYFMYR  689

Query  242  CCLD  231
            CC D
Sbjct  690  CCTD  693



>emb|CBI14908.3| unnamed protein product [Vitis vinifera]
Length=708

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 103/184 (56%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KE++++    I    L     DPT IWFFW R+ESM + K +    +++
Sbjct  539  LEMVYVGKSNAKEQVRKTITFIDSRSLGYCWTDPTNIWFFWTRMESMLYSKTQHGKTIEN  598

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I   V  +LS+DGS++GW+V   G  EM K +G  ++K    +  
Sbjct  599  -------------DSIFAGVLTMLSFDGSDQGWSVICHGPTEMAKAKGDMILKCFTEYSD  645

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W   V  +N F+PAL++ L+ L+T  HC R+++P   G  PE V C ECGR MEK+FMY 
Sbjct  646  WSDNV-QQNGFMPALNEHLQKLHTPEHCNRLILPGINGDIPEKVVCAECGRPMEKYFMYR  704

Query  242  CCLD  231
            CC D
Sbjct  705  CCTD  708



>ref|XP_010663068.1| PREDICTED: uncharacterized protein LOC100243366 [Vitis vinifera]
Length=706

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 103/184 (56%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KE++++    I    L     DPT IWFFW R+ESM + K +    +++
Sbjct  537  LEMVYVGKSNAKEQVRKTITFIDSRSLGYCWTDPTNIWFFWTRMESMLYSKTQHGKTIEN  596

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I   V  +LS+DGS++GW+V   G  EM K +G  ++K    +  
Sbjct  597  -------------DSIFAGVLTMLSFDGSDQGWSVICHGPTEMAKAKGDMILKCFTEYSD  643

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W   V  +N F+PAL++ L+ L+T  HC R+++P   G  PE V C ECGR MEK+FMY 
Sbjct  644  WSDNV-QQNGFMPALNEHLQKLHTPEHCNRLILPGINGDIPEKVVCAECGRPMEKYFMYR  702

Query  242  CCLD  231
            CC D
Sbjct  703  CCTD  706



>gb|AFN06072.1| sieve element occlusion protein 1 [Nicotiana tabacum]
Length=719

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 107/184 (58%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M+Y GK N KER++R +  +  E LS  L D T +W+FW R+ESM++ K +    +Q+
Sbjct  550  LLMMYVGKSNNKERVRRINSMVTAENLSYCLMDLTSVWYFWTRIESMFYSKMQLGKTIQE  609

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+Q+V  +LS+DGS++GWA+ SRG  EM + +   + K L+++  
Sbjct  610  -------------DKIMQEVLTMLSFDGSDQGWALISRGSFEMARAKSQIITKTLDDYTV  656

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  E   E  F+PAL      L+T  HC R+++P   G  PE + C ECGR ME+FFMY 
Sbjct  657  WE-EDAREKGFVPALIDYFLQLHTPQHCNRLILPGLDGDIPEMIVCAECGRPMERFFMYR  715

Query  242  CCLD  231
            CC D
Sbjct  716  CCTD  719



>ref|XP_009769607.1| PREDICTED: uncharacterized protein LOC104220433 [Nicotiana sylvestris]
Length=719

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 107/184 (58%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M+Y GK N KER++R +  +  E LS  L D T +W+FW R+ESM++ K +    +Q+
Sbjct  550  LLMMYVGKSNNKERVRRINSMVTAENLSYCLMDLTSVWYFWTRIESMFYSKMQLGKTIQE  609

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+Q+V  +LS+DGS++GWA+ SRG  EM + +   + K L+++  
Sbjct  610  -------------DKIMQEVLTMLSFDGSDQGWALISRGSFEMARAKSQIITKTLDDYTV  656

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  E   E  F+PAL      L+T  HC R+++P   G  PE + C ECGR ME+FFMY 
Sbjct  657  WE-EDAREKGFVPALIDYFLQLHTPQHCNRLILPGLDGDIPEMIVCAECGRPMERFFMYR  715

Query  242  CCLD  231
            CC D
Sbjct  716  CCTD  719



>ref|XP_004236293.1| PREDICTED: uncharacterized protein LOC101251462 [Solanum lycopersicum]
Length=724

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 108/184 (59%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L+MLY GK N KER++R +  I  E LS  L D T +W+FW R+ESM++ K +    +Q+
Sbjct  555  LQMLYVGKSNNKERVRRINSMITAENLSYCLMDLTSVWYFWTRIESMFYSKMQLGKTIQE  614

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D ++Q+V  +LS+DGS++GWA+ SRG  EM + +   + K L+++  
Sbjct  615  -------------DKVMQEVLTMLSFDGSDQGWALISRGSFEMARAKSQIITKTLDDYTV  661

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  E      F+PAL +    L+T  HC R+++P   G  PE + C ECGR ME+FFMY 
Sbjct  662  WE-EDARVKGFVPALIEYFLQLHTPEHCNRLILPGLDGDIPEMIVCAECGRPMERFFMYR  720

Query  242  CCLD  231
            CC D
Sbjct  721  CCTD  724



>ref|XP_010026936.1| PREDICTED: uncharacterized protein LOC104417333 [Eucalyptus grandis]
 gb|KCW83234.1| hypothetical protein EUGRSUZ_B00175 [Eucalyptus grandis]
Length=713

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 104/185 (56%), Gaps = 17/185 (9%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M+Y GK N KER+KR +  I  E LS   +DP   WFFW RLESM   K +  ++ ++
Sbjct  541  LGMIYLGKSNAKERVKRIAAAITSENLSHCWKDPRYFWFFWARLESMLHSKLQHGMSTEN  600

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGL-AEMTKGEGSNVVKVLNNFD  426
                         DP++ ++  ILSYDGS++GWA+F       M + +  NV+  +   +
Sbjct  601  -------------DPVMHEIMTILSYDGSDQGWAIFCHAAEPTMARAKAKNVLDSMEEIN  647

Query  425  SWRHEVTDENAFIPALDKQLRG--LYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
             W+  + DE  FIPAL   LR   + + HHC+R+++P   G  PE V C ECGR MEKF 
Sbjct  648  DWKDGI-DEKGFIPALQDHLRQKEIDSPHHCSRLILPGIDGGIPERVVCAECGRVMEKFI  706

Query  251  MYSCC  237
            MY CC
Sbjct  707  MYRCC  711



>ref|XP_009359248.1| PREDICTED: uncharacterized protein LOC103949845 isoform X2 [Pyrus 
x bretschneideri]
Length=775

 Score =   154 bits (389),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 119/188 (63%), Gaps = 10/188 (5%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRN-SGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLA-M  609
            LE+LY GK N KE++ RN    IQ E LS  L+  ++IWFFW RLESMW  KG +  + +
Sbjct  594  LELLYVGKRNPKEKVVRNIMNVIQAEKLSYTLE-WSLIWFFWMRLESMWQSKGHQMQSEV  652

Query  608  QDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNF  429
            +    RT     +  DP++Q + ++LS+  S+RGWAV   G +EM K  G ++ + L+ +
Sbjct  653  RSGRVRT---DNKKNDPVMQGIISMLSFGSSDRGWAVIGAGSSEMAKANGEHMHRSLSEY  709

Query  428  DSWRHEVTDENAFIPALDKQLRGLYTK--HHCTRMVVPAAVGHYPETVACVECGRSMEKF  255
            + W   V +E  F+PAL++ L G+Y +  HHCT +++P A G  PETVAC ECGR ME+F
Sbjct  710  NLWNRRV-NEIGFVPALNEYLTGVYKEAPHHCTSLILP-ATGLMPETVACAECGRLMERF  767

Query  254  FMYSCCLD  231
             M+ CC D
Sbjct  768  TMFRCCTD  775



>gb|KHN05808.1| hypothetical protein glysoja_038722 [Glycine soja]
Length=673

 Score =   153 bits (387),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 106/184 (58%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM Y GK N KER+++   T      S    + T IWFFW RLESM + K +    +++
Sbjct  504  LEMAYVGKSNAKERMQKMIKTFTTRKFSYFWPNVTSIWFFWTRLESMLYSKLQHGRTVEN  563

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +D             I+ QV  +LS+DGS+RGWA+F RG  EM + +G + +  L +FD 
Sbjct  564  DD-------------IMSQVMTVLSFDGSDRGWAIFCRGATEMARAKGDSALICLQDFDK  610

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  + +E+  + A++  L      HHC R+++P + G  P+ V C ECGR MEK+FMY 
Sbjct  611  WKDRI-EEDGVVQAMNDYLNKNKPPHHCNRLILPGSTGGIPQKVVCAECGRQMEKYFMYR  669

Query  242  CCLD  231
            CC++
Sbjct  670  CCVE  673



>ref|NP_001241263.1| uncharacterized protein LOC100811452 [Glycine max]
 gb|ADN32785.1| sieve element occlusion c [Glycine max]
Length=698

 Score =   153 bits (387),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 106/184 (58%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM Y GK N KER+++   T      S    + T IWFFW RLESM + K +    +++
Sbjct  529  LEMAYVGKSNAKERMQKMIKTFTTRKFSYFWPNVTSIWFFWTRLESMLYSKLQHGRTVEN  588

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +D             I+ QV  +LS+DGS+RGWA+F RG  EM + +G + +  L +FD 
Sbjct  589  DD-------------IMSQVMTVLSFDGSDRGWAIFCRGATEMARAKGDSALICLQDFDK  635

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  + +E+  + A++  L      HHC R+++P + G  P+ V C ECGR MEK+FMY 
Sbjct  636  WKDRI-EEDGVVQAMNDYLNKNKPPHHCNRLILPGSTGGIPQKVVCAECGRQMEKYFMYR  694

Query  242  CCLD  231
            CC++
Sbjct  695  CCVE  698



>ref|XP_007159683.1| hypothetical protein PHAVU_002G258300g [Phaseolus vulgaris]
 gb|ESW31677.1| hypothetical protein PHAVU_002G258300g [Phaseolus vulgaris]
Length=702

 Score =   153 bits (387),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 105/181 (58%), Gaps = 14/181 (8%)
 Frame = -3

Query  779  EMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQDN  600
            EM+Y GK N  ++++     IQ E LS++L D  +IWFFW RLESMW  K + +  +++ 
Sbjct  534  EMIYVGKSNPGKKVQETINAIQAEKLSNVLPDLAIIWFFWVRLESMWHSKSQHSKTVEN-  592

Query  599  DTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDSW  420
                        D I+ +V  IL+YD  + GWAV S G   M +G+G   ++ LN  + W
Sbjct  593  ------------DNIMHEVMRILTYDSGDSGWAVISEGTGSMAQGKGDAFLRCLNEREQW  640

Query  419  RHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYSC  240
            +    D    +PA+   ++GL   HHC R+++P + G  P++V C ECG++MEKF+MY C
Sbjct  641  KDTAKD-IGILPAMADYIQGLQAPHHCNRLILPGSSGGVPDSVVCAECGKTMEKFYMYRC  699

Query  239  C  237
            C
Sbjct  700  C  700



>emb|CDP05462.1| unnamed protein product [Coffea canephora]
Length=673

 Score =   153 bits (386),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 101/184 (55%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N KE +++N+  IQ E LS IL D   I  FW RL+ M    G+  + ++ 
Sbjct  504  LEMLYVGKKNPKESMRKNNFIIQAENLSHILPDLIKIQIFWMRLDIMLKSWGQHGMFVKS  563

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +              ++  V  I+ YD    GWA  +RG  EM KG    V + L+ FD 
Sbjct  564  D--------------LIHHVGKIICYDQDGEGWAFIARGRHEMAKGTDKEVYQCLSKFDE  609

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +V   + F+ AL +QLR L T HHC R+++P + GH PE V C ECGR ME F MY 
Sbjct  610  WKDKVVYPDGFVIALGEQLRELQTPHHCNRLILPESTGHIPEKVVCAECGRPMESFIMYR  669

Query  242  CCLD  231
            CC D
Sbjct  670  CCTD  673



>ref|XP_009359246.1| PREDICTED: uncharacterized protein LOC103949845 isoform X1 [Pyrus 
x bretschneideri]
Length=842

 Score =   154 bits (390),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 118/188 (63%), Gaps = 10/188 (5%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRN-SGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLA-M  609
            LE+LY GK N KE++ RN    IQ E LS  L+  ++IWFFW RLESMW  KG +  + +
Sbjct  661  LELLYVGKRNPKEKVVRNIMNVIQAEKLSYTLEW-SLIWFFWMRLESMWQSKGHQMQSEV  719

Query  608  QDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNF  429
            +    RT     +  DP++Q + ++LS+  S+RGWAV   G +EM K  G ++ + L+ +
Sbjct  720  RSGRVRT---DNKKNDPVMQGIISMLSFGSSDRGWAVIGAGSSEMAKANGEHMHRSLSEY  776

Query  428  DSWRHEVTDENAFIPALDKQLRGLY--TKHHCTRMVVPAAVGHYPETVACVECGRSMEKF  255
            + W   V +E  F+PAL++ L G+Y    HHCT +++P A G  PETVAC ECGR ME+F
Sbjct  777  NLWNRRV-NEIGFVPALNEYLTGVYKEAPHHCTSLILP-ATGLMPETVACAECGRLMERF  834

Query  254  FMYSCCLD  231
             M+ CC D
Sbjct  835  TMFRCCTD  842



>ref|XP_010248721.1| PREDICTED: uncharacterized protein LOC104591550 [Nelumbo nucifera]
Length=718

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 108/183 (59%), Gaps = 15/183 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            +EM+Y GK N KER++ N   I  E LS  L + T IWFFW RLESMW+ K ++   + D
Sbjct  548  IEMMYVGKSNPKERVRSNINAISSEKLSYYLPELTFIWFFWVRLESMWYSKTQQGRTIAD  607

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+++V ++L++DGSN+GWA+   G  EMTK  G+ +++ L +F +
Sbjct  608  -------------DNIMREVMSLLTFDGSNQGWAILGHGNGEMTKASGNRMLEALESFPT  654

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGH-YPETVACVECGRSMEKFFMY  246
            W+      + FIPAL + L   ++K HC  +V+P A+G    E + C EC R MEK+ +Y
Sbjct  655  WKENAV-RDGFIPALARVLASYHSKEHCASLVLPRALGKDVHEHITCAECNRPMEKYVLY  713

Query  245  SCC  237
             CC
Sbjct  714  RCC  716



>ref|XP_007225209.1| hypothetical protein PRUPE_ppa002007mg [Prunus persica]
 gb|EMJ26408.1| hypothetical protein PRUPE_ppa002007mg [Prunus persica]
Length=730

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 112/187 (60%), Gaps = 8/187 (4%)
 Frame = -3

Query  782  LEMLYXGKMNVKERI-KRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            LE+LY G+   KE++ K+    IQ E LS  L+  T IW+FW RLESMW  KG+    + 
Sbjct  549  LELLYVGRSKPKEKVVKQILSIIQTENLSHTLEWNTTIWYFWVRLESMWQSKGQ---LLS  605

Query  605  DNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFD  426
            +  T  +       DPI+Q + ++LS+  S+RGWAV     A+M K  G +++K +  F 
Sbjct  606  EQSTTHFKTDNLKNDPIMQGIISMLSFGSSDRGWAVIGIPSADMAKANGDHMLKSMKEFT  665

Query  425  SWRHEVTDENAFIPALDKQLRGLYTK--HHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
             W+    D   FIPAL++ L G++ +  HHCT +++P A G  PETVAC ECGR ME+F 
Sbjct  666  DWKIRAADA-GFIPALNEHLEGVFKQAPHHCTNLILP-ATGIMPETVACAECGRLMERFS  723

Query  251  MYSCCLD  231
            M+ CC D
Sbjct  724  MFRCCTD  730



>ref|XP_011071161.1| PREDICTED: uncharacterized protein LOC105156657 [Sesamum indicum]
Length=768

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 111/187 (59%), Gaps = 16/187 (9%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLS---SILQDPTMIWFFWERLESMWFLKGEKTLA  612
            LEMLY GK N KE+++     I +E LS   S+ +    +W+FW RL SMW  K +  + 
Sbjct  595  LEMLYVGKRNPKEKVRLCHEVIDKEKLSNVFSVTEYYDYVWYFWVRLWSMWNSKKQMGMT  654

Query  611  MQDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNN  432
            +++             D I+Q++  +L+ D S +GWAVFSR   E+TK  G  ++ VL N
Sbjct  655  VEN-------------DRIMQEIMDVLALDSSEKGWAVFSRANFEITKSNGDKLLPVLEN  701

Query  431  FDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
            +  W ++V D N F+  LD++L+ ++  HHC R+++P   G+ PE V C ECG++M+K+ 
Sbjct  702  YRDWIYKVDDPNKFVMVLDEELKRVHPDHHCNRLILPGHAGYIPERVVCSECGKTMDKYV  761

Query  251  MYSCCLD  231
            MY CC D
Sbjct  762  MYRCCTD  768



>ref|XP_010102927.1| hypothetical protein L484_018946 [Morus notabilis]
 gb|EXB94445.1| hypothetical protein L484_018946 [Morus notabilis]
Length=712

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 107/185 (58%), Gaps = 15/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNV-KERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            LEM+Y GK NV KER+++ + TI+ EGLS I  + T IWFFW RLESM   K      ++
Sbjct  542  LEMIYVGKSNVPKERLRKINSTIETEGLSQIWPEMTSIWFFWSRLESMRCSKARYGKTIE  601

Query  605  DNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFD  426
                          DP+L+++  +LSYDGS++GW    RG +EM +  G   ++ L  F 
Sbjct  602  -------------ADPVLKEIMTLLSYDGSDQGWVSVWRGQSEMARANGQLALQTLKEFQ  648

Query  425  SWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
             W  +   +   IPA D++L+  ++  HCTR+++P      P+ V C ECGR MEKFFM+
Sbjct  649  QWETQ-AKQMGLIPAYDEELKKRHSPQHCTRLILPGLGQDIPQKVVCTECGREMEKFFMF  707

Query  245  SCCLD  231
             CC D
Sbjct  708  RCCTD  712



>ref|XP_002526966.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35453.1| conserved hypothetical protein [Ricinus communis]
Length=792

 Score =   152 bits (385),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 111/182 (61%), Gaps = 14/182 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M+Y GK N KER++RN  TI  E LS   QD T IW+FW R+ESMW  K +       
Sbjct  623  LGMVYVGKSNPKERVRRNVSTIMVEKLSHYWQDLTSIWYFWVRIESMWRSKNQ-------  675

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                  +      D +++++ ++LS+D S  GWA+FSR   E+ K +G+  +  L+++  
Sbjct  676  ------LGKNSENDLVMKEIMSMLSFDSSEGGWAIFSRMADEVVKAKGNIFLTCLSDYTV  729

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ ++  +  F+P++   L+GL+T+HHC R+++P++ G  PE + C +CG +ME++ +Y 
Sbjct  730  WKDQI-QQKGFLPSVKDYLKGLHTEHHCNRLILPSSAGMIPEKIVCTDCGLNMERYILYK  788

Query  242  CC  237
            CC
Sbjct  789  CC  790



>ref|XP_008340128.1| PREDICTED: uncharacterized protein LOC103403085 [Malus domestica]
Length=873

 Score =   152 bits (385),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 117/189 (62%), Gaps = 11/189 (6%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRN-SGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            LE+LY GK N KE++ RN    IQ E LS  L+   +IWFFW RLESMW  KG +   MQ
Sbjct  691  LELLYVGKRNPKEKVVRNIMNVIQAEKLSHTLEW-NLIWFFWMRLESMWQSKGHQ---MQ  746

Query  605  DNDTRTYIIPEES--RDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNN  432
                R+  +  ++   DP++Q + ++LS+  S+RGWAV   G +EM+K  G ++ + L+ 
Sbjct  747  SEAIRSGRLRTDNMKNDPVMQGIISMLSFGSSDRGWAVIGAGSSEMSKANGEHMHRSLSE  806

Query  431  FDSWRHEVTDENAFIPALDKQLRGLY--TKHHCTRMVVPAAVGHYPETVACVECGRSMEK  258
            +  W   V DE  F+ AL++ L G+Y    HHCT +++P A G  PETVAC ECGR ME+
Sbjct  807  YSLWNKRV-DEIGFVRALNEYLTGVYKEAPHHCTSLILP-ATGLMPETVACAECGRLMER  864

Query  257  FFMYSCCLD  231
            F M+ CC D
Sbjct  865  FTMFRCCTD  873



>gb|KJB21000.1| hypothetical protein B456_003G177000 [Gossypium raimondii]
Length=681

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 108/184 (59%), Gaps = 15/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            +EM+Y GK N +ER+K+ +G I+E+ LS   +D   +WFFW  LESM + K +    +++
Sbjct  513  IEMVYVGKKNKRERVKKITGLIKEKELSRAWEDDN-VWFFWNLLESMLYSKNQHGKTIEN  571

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I Q+V  +L YD S  GWAVF  G  EM K  G  V+  ++ FD 
Sbjct  572  -------------DVIKQEVMTMLEYDSSKNGWAVFYTGSGEMVKANGEKVLSTMDKFDE  618

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W++ +  +  F+PAL ++L G+  +HHCTR+++P+  G  PE V C ECGR ME  F+Y 
Sbjct  619  WKN-LAKQMGFVPALREKLEGVIPRHHCTRLILPSNGGRIPERVQCAECGRPMELNFLYR  677

Query  242  CCLD  231
            CC +
Sbjct  678  CCAE  681



>ref|XP_006476926.1| PREDICTED: uncharacterized protein LOC102609296 [Citrus sinensis]
Length=693

 Score =   151 bits (381),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 106/183 (58%), Gaps = 15/183 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M Y GK N KER ++ S  + +E LS  L DP  +WFFW RLESM + K +    +++
Sbjct  523  LGMAYVGKNNAKERFRKISRIVIQENLSHTLTDPAEVWFFWARLESMLYSKLQHGATVEN  582

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLA-EMTKGEGSNVVKVLNNFD  426
                         D I+Q+V  ILS+DGS +GWA+F RG   EM + +G   V  +  F+
Sbjct  583  -------------DHIMQEVMTILSFDGSEQGWAIFWRGTTHEMARAKGEMAVDCMMEFE  629

Query  425  SWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
             W+ +  D+  F+  L+  L+ ++T  HC R+++P   G  PE +AC ECGR+ME FFMY
Sbjct  630  KWKDD-ADQMGFVAGLNNYLQRVHTPRHCNRLILPDIHGPIPERLACAECGRTMEMFFMY  688

Query  245  SCC  237
             CC
Sbjct  689  RCC  691



>gb|KHN07967.1| hypothetical protein glysoja_039841 [Glycine soja]
Length=550

 Score =   150 bits (378),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 105/184 (57%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM Y GK N KER+++   T      S    + T IWFFW RLESM + K      ++ 
Sbjct  381  LEMAYAGKSNAKERMQKMIKTFTTRKFSYFWPNVTSIWFFWTRLESMLYSKLLHGRTVE-  439

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                        +D I+ +V  +LS+DGS+RGWA+F RG  EM + +G + ++ L +FD 
Sbjct  440  ------------KDEIMSEVMTVLSFDGSDRGWAIFCRGATEMARAKGDSALRCLQDFDK  487

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  + +E+  + A++  L      HHC R+++P + G  P+ V C ECGR MEK+FMY 
Sbjct  488  WKGRI-EEDGVVHAINDYLNKNKPPHHCNRLILPGSTGGIPQKVVCAECGRQMEKYFMYR  546

Query  242  CCLD  231
            CC++
Sbjct  547  CCVE  550



>gb|KDO69425.1| hypothetical protein CISIN_1g019680mg [Citrus sinensis]
Length=337

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 104/183 (57%), Gaps = 15/183 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M Y GK N KE++ + S  I +E LS  L D T +WFFW RLESM + K +    +++
Sbjct  167  LGMAYVGKNNAKEKLGKISSIIIQENLSHTLADSTAVWFFWARLESMLYSKLQHGATVEN  226

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLA-EMTKGEGSNVVKVLNNFD  426
                         D IL++V  +LS+DGS +GWA+F RG   EM + +G      +  F+
Sbjct  227  -------------DRILKEVTTVLSFDGSEQGWAIFWRGTTHEMARAKGKVATDCMVEFE  273

Query  425  SWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
             W+ +   +N F+P L+  L  + T  HC R+++P   G  PETVAC +CGR ME FF+Y
Sbjct  274  KWKDDAY-QNGFVPGLNNYLERVRTPDHCNRLILPGIHGPIPETVACADCGRVMEMFFLY  332

Query  245  SCC  237
             CC
Sbjct  333  RCC  335



>ref|XP_009592492.1| PREDICTED: uncharacterized protein LOC104089332 [Nicotiana tomentosiformis]
Length=712

 Score =   150 bits (380),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 105/184 (57%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M+Y GK N K+R++R +  I++E LS  L D   +W+FW RLESM++ K +    ++D
Sbjct  543  LHMIYVGKSNNKDRVRRINSIIRKENLSYCLDDVMSVWYFWTRLESMFYSKMQLGQTIKD  602

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+Q+V  +LS+DGS++GWAV SRG  EM + +   + K L +F  
Sbjct  603  -------------DKIMQEVLTMLSFDGSDQGWAVISRGSFEMARAKSVVITKTLEDFHV  649

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  E   E  F+ AL      L+T  HC R+++P      PE + C ECGR M+KFFMY 
Sbjct  650  WE-EDAREKGFVLALIDYFLHLHTPQHCNRLILPGLDVDIPEMITCAECGRQMDKFFMYR  708

Query  242  CCLD  231
            CC D
Sbjct  709  CCTD  712



>ref|NP_001241461.1| uncharacterized protein LOC100789215 [Glycine max]
 gb|ADN32786.1| sieve element occlusion d [Glycine max]
Length=705

 Score =   150 bits (380),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 105/184 (57%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM Y GK N KER+++   T      S    + T IWFFW RLESM + K      ++ 
Sbjct  536  LEMAYAGKSNAKERMQKMIKTFTTRKFSYFWPNVTSIWFFWTRLESMLYSKLLHGRTVE-  594

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                        +D I+ +V  +LS+DGS+RGWA+F RG  EM + +G + ++ L +FD 
Sbjct  595  ------------KDEIMSEVMTVLSFDGSDRGWAIFCRGATEMARAKGDSALRCLQDFDK  642

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  + +E+  + A++  L      HHC R+++P + G  P+ V C ECGR MEK+FMY 
Sbjct  643  WKGRI-EEDGVVHAINDYLNKNKPPHHCNRLILPGSTGGIPQKVVCAECGRQMEKYFMYR  701

Query  242  CCLD  231
            CC++
Sbjct  702  CCVE  705



>gb|KJB21011.1| hypothetical protein B456_003G177900 [Gossypium raimondii]
Length=691

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 106/184 (58%), Gaps = 17/184 (9%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KER+K+ +G I+E+ LS   +D   +WFFW R  SM + K +    +++
Sbjct  525  LEMVYVGKNNAKERVKKITGLIKEKQLSHAWEDDN-VWFFWNR--SMLYSKTQHGKTIEN  581

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I Q+V  +L+YDGS  GWAVF  G  EM +  G  V+  + +FD 
Sbjct  582  -------------DVIKQEVMTMLAYDGSENGWAVFFTGSYEMVRANGDKVLSSMKSFDE  628

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  ++  +  FIPA  K L G+   HHCTR+++P   G  PE V C ECGR ME +FMY 
Sbjct  629  WE-KLAKQMGFIPAFRKHLDGITDDHHCTRLILPGNGGRIPERVQCAECGRPMEMYFMYR  687

Query  242  CCLD  231
            CC++
Sbjct  688  CCVE  691



>gb|KJB39996.1| hypothetical protein B456_007G041500 [Gossypium raimondii]
Length=700

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 106/182 (58%), Gaps = 16/182 (9%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KER+K+ +G I E  LS   QD   +WFFW+RLESM F    KT   + 
Sbjct  533  LEMVYVGKNNAKERVKKITGLINERQLSHAWQDAN-VWFFWKRLESMLF---SKTQQGKT  588

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            N+           D I Q+V  +L YDGS +GWAVF  G   M + +G  V+  + +F+ 
Sbjct  589  NEI----------DVIKQEVMTLLGYDGSEQGWAVFFSG-TNMVRAKGDKVLNAIQSFEQ  637

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  ++   + FI A+   L G+  +HHCTR+++P   G   ETV C ECGR+ME +FMY 
Sbjct  638  WE-DMARVSGFISAIRGHLEGIADEHHCTRLILPGISGGIAETVVCAECGRTMEMYFMYR  696

Query  242  CC  237
            CC
Sbjct  697  CC  698



>ref|XP_008221943.1| PREDICTED: uncharacterized protein LOC103321871 [Prunus mume]
Length=843

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 119/188 (63%), Gaps = 10/188 (5%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGT-IQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            LE+LY GK   KE++ +N  T IQ E LS  L+   +IWFFW RLESMW  +G++   +Q
Sbjct  662  LELLYVGKSKPKEKVVKNIMTAIQFEKLSHTLEW-NLIWFFWVRLESMWQSRGQQ---LQ  717

Query  605  DNDTRTYIIPEESR-DPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNF  429
                R+  + +  + D ++Q + ++LS+  S+RGWAV   G A M+K  G ++ K LN F
Sbjct  718  TEALRSGRLTDSLKSDAVMQGIISMLSFGSSDRGWAVIGTGSAGMSKANGEHMFKSLNEF  777

Query  428  DSWRHEVTDENAFIPALDKQLRGLYTK--HHCTRMVVPAAVGHYPETVACVECGRSMEKF  255
            + W   V +E  F+PAL++ L G+Y +  HHCT +++P A G  PETVAC ECGR ME+F
Sbjct  778  NLWNRRV-NEIGFVPALNEYLDGVYKQAPHHCTNLILP-ATGLMPETVACAECGRLMERF  835

Query  254  FMYSCCLD  231
             M+ CC D
Sbjct  836  TMFRCCTD  843



>ref|XP_010250966.1| PREDICTED: uncharacterized protein LOC104593030 [Nelumbo nucifera]
Length=747

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 111/189 (59%), Gaps = 5/189 (3%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGE---KTLA  612
            LE +Y GK   +  + R    I+ + L +   + T+IWFFW RL+SM++ K +   KT  
Sbjct  559  LEFVYVGKSKPRLPLSRIIDFIKAKNLGNYWTERTLIWFFWARLQSMYYSKTQLPSKTTT  618

Query  611  MQDNDTRTYIIPEESR--DPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVL  438
              DN  + ++   ++   D ++ ++  +LS+D S++GWA+ SRG AEM++ +G  +   +
Sbjct  619  DNDNKIQQHLPSSKTSESDHVMHEIMNMLSFDSSDQGWAIISRGTAEMSRSKGDQIYSSI  678

Query  437  NNFDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEK  258
            + ++ W+  +  +   IPAL+  L    T+HHC R+++P  VG  PETV C EC R MEK
Sbjct  679  SQYNDWKVHIPTKGGVIPALNDHLHSHPTEHHCNRLILPGTVGRIPETVPCSECTRPMEK  738

Query  257  FFMYSCCLD  231
            + +Y CC D
Sbjct  739  YILYRCCTD  747



>ref|XP_007031664.1| Uncharacterized protein TCM_017019 [Theobroma cacao]
 gb|EOY02590.1| Uncharacterized protein TCM_017019 [Theobroma cacao]
Length=705

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 103/182 (57%), Gaps = 14/182 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KER+ RN  TI  E LS  L + T +W+FW R+ESMW+ K +       
Sbjct  536  LEMVYVGKSNPKERVSRNMATITAEKLSFCLPNLTAVWYFWIRMESMWYSKYQ-------  588

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                  +  E+  DPI +++  +L+YDGS  GWA+ SRG AE+T+ +GS  +  L  ++ 
Sbjct  589  ------LGKEDENDPITREIMTLLTYDGSGDGWALLSRGSAELTRAKGSAFLTCLTEYNL  642

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  ++  +   +PA+          HHC R+ +P   G  PE V C +CGR ME++ +Y 
Sbjct  643  WAADLQTK-GLVPAVHDYFLQHPAPHHCNRLELPGTTGRIPERVTCSDCGRMMERYILYR  701

Query  242  CC  237
            CC
Sbjct  702  CC  703



>ref|XP_007221911.1| hypothetical protein PRUPE_ppa001579mg [Prunus persica]
 gb|EMJ23110.1| hypothetical protein PRUPE_ppa001579mg [Prunus persica]
Length=799

 Score =   149 bits (377),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 119/188 (63%), Gaps = 10/188 (5%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRN-SGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            LE+LY GK   KE++ +N   TIQ E LS  L+   +IWFFW RLESMW  +G++   +Q
Sbjct  618  LELLYVGKSKPKEKVVKNIMTTIQFEKLSHTLEW-NLIWFFWVRLESMWQSRGQQ---LQ  673

Query  605  DNDTRTYIIPEESR-DPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNF  429
                R+  + +  + D ++Q + ++LS+  S+RGWAV   G A M+K  G ++ + LN F
Sbjct  674  TEALRSGRLTDSLKSDLVMQGIISMLSFGSSDRGWAVIGTGSAGMSKANGEHMFRSLNEF  733

Query  428  DSWRHEVTDENAFIPALDKQLRGLYTK--HHCTRMVVPAAVGHYPETVACVECGRSMEKF  255
            + W   V +E  F+PAL++ L G+Y +  HHCT +++P A G  PETVAC ECGR ME+F
Sbjct  734  NLWNRRV-NEIGFVPALNEYLDGVYKQAPHHCTNLILP-ATGLMPETVACAECGRLMERF  791

Query  254  FMYSCCLD  231
             M+ CC D
Sbjct  792  TMFRCCTD  799



>ref|XP_006476925.1| PREDICTED: uncharacterized protein LOC102608617 isoform X3 [Citrus 
sinensis]
Length=613

 Score =   147 bits (371),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 103/183 (56%), Gaps = 15/183 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M Y GK N KE++ + S  I +E LS  L D T +WFFW RLESM + K +    +++
Sbjct  443  LGMAYVGKNNAKEKLGKISSIIIQENLSHTLADSTAVWFFWARLESMLYSKLQHGATVEN  502

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLA-EMTKGEGSNVVKVLNNFD  426
                         D IL++V  +LS+DGS +GWA+F RG   EM + +G      +  F+
Sbjct  503  -------------DRILKEVTTVLSFDGSEQGWAIFWRGTTHEMARAKGKVATDCMVEFE  549

Query  425  SWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
             W+ +   +N F+P L   L  + T  HC R+++P   G  PETVAC +CGR ME FF+Y
Sbjct  550  KWKDDAY-QNGFVPGLHNYLERVRTPDHCNRLILPGTHGPIPETVACADCGRVMEMFFLY  608

Query  245  SCC  237
             CC
Sbjct  609  RCC  611



>ref|XP_006476923.1| PREDICTED: uncharacterized protein LOC102608617 isoform X1 [Citrus 
sinensis]
Length=698

 Score =   148 bits (373),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 103/183 (56%), Gaps = 15/183 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M Y GK N KE++ + S  I +E LS  L D T +WFFW RLESM + K +    +++
Sbjct  528  LGMAYVGKNNAKEKLGKISSIIIQENLSHTLADSTAVWFFWARLESMLYSKLQHGATVEN  587

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLA-EMTKGEGSNVVKVLNNFD  426
                         D IL++V  +LS+DGS +GWA+F RG   EM + +G      +  F+
Sbjct  588  -------------DRILKEVTTVLSFDGSEQGWAIFWRGTTHEMARAKGKVATDCMVEFE  634

Query  425  SWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
             W+ +   +N F+P L   L  + T  HC R+++P   G  PETVAC +CGR ME FF+Y
Sbjct  635  KWKDDAY-QNGFVPGLHNYLERVRTPDHCNRLILPGTHGPIPETVACADCGRVMEMFFLY  693

Query  245  SCC  237
             CC
Sbjct  694  RCC  696



>ref|XP_006476924.1| PREDICTED: uncharacterized protein LOC102608617 isoform X2 [Citrus 
sinensis]
Length=693

 Score =   148 bits (373),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 103/183 (56%), Gaps = 15/183 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M Y GK N KE++ + S  I +E LS  L D T +WFFW RLESM + K +    +++
Sbjct  523  LGMAYVGKNNAKEKLGKISSIIIQENLSHTLADSTAVWFFWARLESMLYSKLQHGATVEN  582

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLA-EMTKGEGSNVVKVLNNFD  426
                         D IL++V  +LS+DGS +GWA+F RG   EM + +G      +  F+
Sbjct  583  -------------DRILKEVTTVLSFDGSEQGWAIFWRGTTHEMARAKGKVATDCMVEFE  629

Query  425  SWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
             W+ +   +N F+P L   L  + T  HC R+++P   G  PETVAC +CGR ME FF+Y
Sbjct  630  KWKDDAY-QNGFVPGLHNYLERVRTPDHCNRLILPGTHGPIPETVACADCGRVMEMFFLY  688

Query  245  SCC  237
             CC
Sbjct  689  RCC  691



>ref|XP_007137985.1| hypothetical protein PHAVU_009G171300g [Phaseolus vulgaris]
 gb|ESW09979.1| hypothetical protein PHAVU_009G171300g [Phaseolus vulgaris]
Length=584

 Score =   147 bits (370),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 103/184 (56%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KER+++   T      S    + T IWFFW RLESM + K +    +++
Sbjct  415  LEMVYVGKSNAKERMQKMIKTFNTRKFSYFWPNVTSIWFFWTRLESMLYSKLQHGRTVEN  474

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D ++ +V  +LS+DGS+RGWA+F  G  EM + +G + +  L +FD 
Sbjct  475  -------------DEVMSEVMTVLSFDGSDRGWAIFCNGATEMARAKGDSALVCLQDFDK  521

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  V +E   + A+   L      HHC R+++P + G  P+ V C ECGR MEK+FMY 
Sbjct  522  WKDRV-EEEGVVQAMKDYLDKNKPPHHCNRLILPGSTGGIPQKVVCAECGRQMEKYFMYR  580

Query  242  CCLD  231
            CC++
Sbjct  581  CCVE  584



>ref|XP_007137986.1| hypothetical protein PHAVU_009G171300g [Phaseolus vulgaris]
 gb|ESW09980.1| hypothetical protein PHAVU_009G171300g [Phaseolus vulgaris]
Length=747

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 103/184 (56%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KER+++   T      S    + T IWFFW RLESM + K +    +++
Sbjct  578  LEMVYVGKSNAKERMQKMIKTFNTRKFSYFWPNVTSIWFFWTRLESMLYSKLQHGRTVEN  637

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D ++ +V  +LS+DGS+RGWA+F  G  EM + +G + +  L +FD 
Sbjct  638  -------------DEVMSEVMTVLSFDGSDRGWAIFCNGATEMARAKGDSALVCLQDFDK  684

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  V +E   + A+   L      HHC R+++P + G  P+ V C ECGR MEK+FMY 
Sbjct  685  WKDRV-EEEGVVQAMKDYLDKNKPPHHCNRLILPGSTGGIPQKVVCAECGRQMEKYFMYR  743

Query  242  CCLD  231
            CC++
Sbjct  744  CCVE  747



>ref|XP_008350940.1| PREDICTED: uncharacterized protein LOC103414321 [Malus domestica]
Length=744

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 118/195 (61%), Gaps = 27/195 (14%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNS-GTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            LE+LY GK   KE++ +N    IQ E LS  L+   +IWFFW RLESMW  KG+      
Sbjct  566  LELLYVGKSKAKEKVVKNIISIIQAEKLSHTLE-VNLIWFFWIRLESMWQSKGQ------  618

Query  605  DNDTRTYIIPEESR--------DPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNV  450
                   I+ E+SR        D I+Q + ++LS+  S+RGWAV + G A+M+K  G ++
Sbjct  619  -------ILSEQSRTQTDHLKSDRIMQGIISMLSFGSSDRGWAVIALGSADMSKANGEHM  671

Query  449  VKVLNNFDSWRHEVTDENAFIPALDKQLRGLYTK--HHCTRMVVPAAVGHYPETVACVEC  276
            ++ L  +++W+   T E  F PAL++ L G++ +  HHCT +++PA  G  PETVAC EC
Sbjct  672  LRSLREYNNWKIRPT-EIGFTPALNEYLEGVHKQAPHHCTNLILPAT-GIMPETVACAEC  729

Query  275  GRSMEKFFMYSCCLD  231
            GR ME+F M+ CC D
Sbjct  730  GRLMERFSMFRCCTD  744



>ref|XP_008389748.1| PREDICTED: uncharacterized protein LOC103452052 [Malus domestica]
Length=832

 Score =   148 bits (373),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 116/189 (61%), Gaps = 11/189 (6%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRN-SGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGE--KTLA  612
            LE+LY G+   KE++ RN    IQ E LS  L+   +IWFFW RLESMW  KG+  ++ A
Sbjct  650  LELLYVGRSKPKEKVVRNIMNIIQAEKLSHTLEW-NLIWFFWLRLESMWQSKGQQIQSEA  708

Query  611  MQDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNN  432
             +    RT  I     D ++Q + ++LS+  S+RGWAV   G ++M+K  G ++ + L  
Sbjct  709  FRSGQFRTDNI---KNDAVMQGIISMLSFGSSDRGWAVIGAGSSDMSKANGEHMHRSLRE  765

Query  431  FDSWRHEVTDENAFIPALDKQLRGLY--TKHHCTRMVVPAAVGHYPETVACVECGRSMEK  258
            F+ W   V+ E  F+PAL++ L G+Y    HHCT +++P A G  PETVAC ECGR ME+
Sbjct  766  FNLWNRRVS-EIGFVPALNEYLAGVYKEAPHHCTSLILP-ATGLMPETVACAECGRLMER  823

Query  257  FFMYSCCLD  231
            F M+ CC D
Sbjct  824  FTMFRCCTD  832



>ref|XP_009333910.1| PREDICTED: uncharacterized protein LOC103926766 [Pyrus x bretschneideri]
Length=317

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 108/187 (58%), Gaps = 19/187 (10%)
 Frame = -3

Query  782  LEMLYXGKMNV-KERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGE--KTLA  612
            L+++Y G+    KERI++ + TI+ E LS    D T  WFFW R++SM   K +  KTL 
Sbjct  147  LDLVYVGRSTATKERIRKVNKTIETENLSRFWPDYTSNWFFWSRMDSMRCSKAKHHKTL-  205

Query  611  MQDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNN  432
              DND             IL++V  +LSYDGS++GW +  RG  E  +  G   +  L++
Sbjct  206  --DNDN------------ILREVMTLLSYDGSDQGWVMVWRGSNERARANGHLTLLTLDD  251

Query  431  FDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
            FD+W+    D+  F+P L  +L   +T  HCTR+V+P      P+ +AC ECGR MEKFF
Sbjct  252  FDAWKATAADK-GFVPTLQDELGRRHTPQHCTRLVIPGFGPDIPDRIACAECGREMEKFF  310

Query  251  MYSCCLD  231
            M+ CCLD
Sbjct  311  MFRCCLD  317



>ref|XP_006439978.1| hypothetical protein CICLE_v10019109mg [Citrus clementina]
 gb|ESR53218.1| hypothetical protein CICLE_v10019109mg [Citrus clementina]
Length=698

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 104/183 (57%), Gaps = 15/183 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M Y GK N KE++ + S  + +E LS  L D T +WFFW RLESM + K +    +++
Sbjct  528  LGMAYVGKNNAKEKLGKISSIVIQENLSHTLADSTAMWFFWARLESMLYSKLQHGATVEN  587

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLA-EMTKGEGSNVVKVLNNFD  426
                         D IL++V  +LS+DGS +GWA+F +G   EM + +G      +  F+
Sbjct  588  -------------DRILKEVTTVLSFDGSEQGWAIFWKGTTHEMARAKGKVATDCMVEFE  634

Query  425  SWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
             W+ +   +N F+P L+  L  + T  HC R+++P   G  PETVAC +CGR ME FF+Y
Sbjct  635  KWKDDAY-QNGFVPGLNNYLERVRTPDHCNRLILPGIHGPIPETVACADCGRVMEMFFLY  693

Query  245  SCC  237
             CC
Sbjct  694  RCC  696



>gb|EYU22546.1| hypothetical protein MIMGU_mgv1a001374mg [Erythranthe guttata]
Length=831

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 113/189 (60%), Gaps = 18/189 (10%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPT----MIWFFWERLESMWFLKGEKTL  615
            LEMLY GK N KE+++  + TI +E LS++          +WFFW RL  +W        
Sbjct  656  LEMLYVGKRNPKEKVRSCNETIAKERLSNVFAAGDDYYDYVWFFWVRLWGLW--------  707

Query  614  AMQDNDTRTYIIPEESRDPILQQVKAILSYDGSN-RGWAVFSRGLAEMTKGEGSNVVKVL  438
                 ++R  I      D I++++  +L+YD SN +GWA FS    ++TKG    ++ VL
Sbjct  708  -----NSRKKIGMTVENDVIMREILDVLAYDSSNHQGWAAFSWSNRDITKGNAEKLMPVL  762

Query  437  NNFDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEK  258
            +N+  W ++V   + F+ ALD++L+G + +HHCTR+++PA+ G   E V C ECG++M+K
Sbjct  763  DNYAQWAYKVDRPDRFVRALDEELQGFHPEHHCTRLILPASDGQISERVVCSECGKTMDK  822

Query  257  FFMYSCCLD  231
            F +YSCC D
Sbjct  823  FVLYSCCTD  831



>ref|XP_004309998.2| PREDICTED: uncharacterized protein LOC101307854 [Fragaria vesca 
subsp. vesca]
Length=839

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 114/187 (61%), Gaps = 9/187 (5%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNS-GTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            LE+LY GK   KER+ ++    I+EE LS  + D  +IWFFW RLESMW  KG+    + 
Sbjct  659  LELLYLGKSKQKERVVKDIIRVIKEEKLSHTI-DSNLIWFFWVRLESMWQSKGQLMSELS  717

Query  605  DNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFD  426
              +   + I     D I+Q + ++LS+  ++RGWA+ +   +EM K  G ++ K LN+F 
Sbjct  718  KANFTDHNI---KNDIIMQGIVSLLSFGSTDRGWALIALPSSEMAKANGEHMSKSLNDFK  774

Query  425  SWRHEVTDENAFIPALDKQLRGLY--TKHHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
             W+ +  DE  F PAL++ L G+Y    HHCT +++P A G  PETV+C ECGR ME++ 
Sbjct  775  IWKPK-HDEVGFTPALNEYLTGVYRDAPHHCTNLILP-ATGIMPETVSCSECGRIMERYA  832

Query  251  MYSCCLD  231
            M+ CC D
Sbjct  833  MFRCCTD  839



>ref|XP_011625117.1| PREDICTED: uncharacterized protein LOC18438685 [Amborella trichopoda]
Length=614

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 106/184 (58%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            +EM+Y G  N ++RI++   TI +E LS    D   I +FW R++SMW  K      +++
Sbjct  445  IEMVYVGSSNPRKRIRKIISTIIQENLSVYWSD-NKIAYFWVRIQSMWHSKRHHGSTIEN  503

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         DPI+Q++ ++LS+DG+  GWA+ S G  +M K  G  +++ L++FD+
Sbjct  504  -------------DPIVQEIMSMLSFDGNGDGWALMSTGSTDMVKTPGKKLMECLSHFDT  550

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            WR  VT  +AF+PAL   L   +   HCT +V+P   G   E V C ECG+ MEK+ +Y 
Sbjct  551  WRANVTGVDAFVPALRDALLQHHKAEHCTHLVLPDTTGPVQEKVVCTECGKQMEKYVLYR  610

Query  242  CCLD  231
            CC+D
Sbjct  611  CCMD  614



>ref|XP_011087135.1| PREDICTED: uncharacterized protein LOC105168700 [Sesamum indicum]
Length=712

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 106/188 (56%), Gaps = 14/188 (7%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK   KER+KR +  +  + LS    DPT IW+FW R+ESM + K         
Sbjct  535  LEMVYVGKKTSKERVKRLNEMVTTDRLSHCWNDPTSIWYFWTRMESMMYSK--------I  586

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRG----LAEMTKGEGSNVVKVLN  435
            +   T    +   D IL +V  +L+Y  S++GWA+FS+G      EM + +G  ++  L 
Sbjct  587  HHGSTLATAQRPGDHILAEVLTMLTYADSHQGWALFSKGSGSRAGEMARAKGDAMLHALA  646

Query  434  NFDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKF  255
            +F SW  +   E  F+PAL+  L G +TK HC ++++P  +   PE V C EC R MEK+
Sbjct  647  DFGSWTDDAR-EKGFVPALNVYLEGHHTKDHCNQLILP-GIDDVPEMVVCSECHRPMEKY  704

Query  254  FMYSCCLD  231
            FMY CC D
Sbjct  705  FMYRCCDD  712



>ref|XP_004310159.1| PREDICTED: uncharacterized protein LOC101309120 [Fragaria vesca 
subsp. vesca]
Length=779

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 111/189 (59%), Gaps = 8/189 (4%)
 Frame = -3

Query  782  LEMLYXGKMNVKE-RIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGE--KTLA  612
            LE+LY GK   KE ++K     I+EE LS +L    +IWFFW RLESMW  KG+  K   
Sbjct  594  LELLYVGKSKAKEQKLKSIMRMIEEEKLSHVLH-WNLIWFFWIRLESMWQSKGQQLKNEL  652

Query  611  MQDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNN  432
            +  +   T        DP+L+ + ++LS+  + RGWAV   G A+M+K  G ++++ L  
Sbjct  653  LSSSQLSTTDSFSLRNDPVLKGIISLLSFGSTERGWAVIGTGSADMSKANGEHMLRSLKE  712

Query  431  FDSWRHEVTDENAFIPALDKQLRGLY--TKHHCTRMVVPAAVGHYPETVACVECGRSMEK  258
            + +W  +   E  F PAL+  L G+Y    HHCT +++PA  G  PETVAC ECGR ME+
Sbjct  713  YSAWELK-RRELGFTPALNDHLAGVYKSAPHHCTNLILPAT-GLMPETVACAECGRLMER  770

Query  257  FFMYSCCLD  231
            + M+ CC D
Sbjct  771  YTMFRCCTD  779



>ref|XP_010248720.1| PREDICTED: uncharacterized protein LOC104591548 [Nelumbo nucifera]
Length=700

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 106/187 (57%), Gaps = 18/187 (10%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            +E +Y GK   KE   + +G I  + L   L +  +IWFFW+RL+ M++ K ++      
Sbjct  529  IEFMYVGKSKPKEPQAKINGVIMSKKLGHFLSERALIWFFWDRLQRMYYSKMKQ------  582

Query  602  NDTRTYIIPEES---RDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNN  432
                    P ++    D I+Q+V  +LS+D S++ WAV SRG  EM + +G  ++K +  
Sbjct  583  --------PRKNAGEHDHIMQEVMTMLSFDSSDQEWAVISRGSFEMARAKGDQILKSIRM  634

Query  431  FDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
             + W+ +V  +  FIPAL+  L G   +HHC R+++P  V + PETV C EC R MEK+ 
Sbjct  635  HEEWKEQVGSK-GFIPALNDHLHGHPPEHHCNRLILPGTVANIPETVPCSECNRPMEKYV  693

Query  251  MYSCCLD  231
            +Y CC D
Sbjct  694  LYRCCTD  700



>ref|XP_008374367.1| PREDICTED: uncharacterized protein LOC103437653 [Malus domestica]
Length=712

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 103/185 (56%), Gaps = 15/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNV-KERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            L+++Y G+    KERI++ + TI+ E LS    + T  WFFW R++SM   K +    ++
Sbjct  542  LDLVYVGRSTATKERIRKVNKTIETENLSRCWPEYTSTWFFWSRMDSMRCSKAKHHKTLE  601

Query  605  DNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFD  426
                          D IL++V  +LSYDGS++GW +  RG  E  +  G   +  L+ FD
Sbjct  602  S-------------DNILKEVMTLLSYDGSDQGWVMVWRGSNERARANGHLTLLTLDXFD  648

Query  425  SWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
            +W+     EN F+P L  +L   +T  HCTR+V+P      P+ +AC ECG  MEKFFM+
Sbjct  649  AWK-AAAAENGFVPTLQDZLGRRHTPQHCTRLVIPGFGPDIPDRIACAECGLEMEKFFMF  707

Query  245  SCCLD  231
             CCLD
Sbjct  708  RCCLD  712



>emb|CBI34827.3| unnamed protein product [Vitis vinifera]
Length=685

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 102/182 (56%), Gaps = 14/182 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KE +  N  TI E+ LS  L+  T IW+FW R+ESM + K      ++ 
Sbjct  516  LEMVYVGKSNPKELVYTNIKTIIEDKLSHHLKGLTSIWYFWVRIESMLYSKMRLGQTVE-  574

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                        +DP +Q++  +LS+D S+ GWA+ S+G  E+TK +G + +  L  ++ 
Sbjct  575  ------------KDPTMQEILKMLSFDNSHEGWALLSKGSEEITKAKGDSFLTCLRQYNQ  622

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W   V  +  F+ AL   L  ++  HHC +  +  A G  PET+ C ECGR MEKFF+Y 
Sbjct  623  WEVHV-QKKGFLQALKDHLLQIHPPHHCNQFELLVAAGMIPETLVCSECGRKMEKFFVYR  681

Query  242  CC  237
            CC
Sbjct  682  CC  683



>ref|XP_002271950.2| PREDICTED: uncharacterized protein LOC100261056 [Vitis vinifera]
Length=713

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 102/182 (56%), Gaps = 14/182 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KE +  N  TI E+ LS  L+  T IW+FW R+ESM + K      ++ 
Sbjct  544  LEMVYVGKSNPKELVYTNIKTIIEDKLSHHLKGLTSIWYFWVRIESMLYSKMRLGQTVE-  602

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                        +DP +Q++  +LS+D S+ GWA+ S+G  E+TK +G + +  L  ++ 
Sbjct  603  ------------KDPTMQEILKMLSFDNSHEGWALLSKGSEEITKAKGDSFLTCLRQYNQ  650

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W   V  +  F+ AL   L  ++  HHC +  +  A G  PET+ C ECGR MEKFF+Y 
Sbjct  651  WEVHV-QKKGFLQALKDHLLQIHPPHHCNQFELLVAAGMIPETLVCSECGRKMEKFFVYR  709

Query  242  CC  237
            CC
Sbjct  710  CC  711



>gb|KJB21019.1| hypothetical protein B456_003G178100 [Gossypium raimondii]
Length=403

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 102/184 (55%), Gaps = 15/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N +ER+K+ +  I E+ LS   Q    +W FW  LE+M             
Sbjct  235  LEMVYVGKQNARERVKKITSLIIEKQLSRAWQYDN-VWCFWNLLENML------------  281

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
             +++ +     + D I+Q+V  +L YD S   WAVF  G  EM    G  V+  + +FD 
Sbjct  282  -NSKVHQRKTNATDGIMQEVATMLGYDDSKNEWAVFFTGSGEMVCANGEKVLSCMKSFDQ  340

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  +++ +  FIPAL KQL  +   HHCTR+++P   G  P+ V C ECGR+ME +F+Y 
Sbjct  341  W-GKLSKQRGFIPALRKQLERITEDHHCTRLLLPGNGGSIPKRVQCAECGRAMEMYFLYR  399

Query  242  CCLD  231
            CC++
Sbjct  400  CCVE  403



>gb|KHG11411.1| Ornithine aminotransferase [Gossypium arboreum]
Length=684

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 100/184 (54%), Gaps = 15/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N +ER K+ +G I E+ LS        +W FW  LE+M             
Sbjct  516  LEMVYVGKQNARERAKKVTGLIIEKQLSHAWHYDN-VWCFWNLLENML------------  562

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
             +++ +     + D I+Q+V  +L YD S   WAVF  G  EM    G  V+  + +FD 
Sbjct  563  -NSKVHQRKTNATDGIMQEVATMLGYDDSKNEWAVFFTGSGEMVSANGEKVLSCMKSFDQ  621

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  +++    FIPAL K L G+   HHCTR+++P   G  PE V C ECGR+ME +F+Y 
Sbjct  622  WG-KLSKHMGFIPALRKHLEGIMEDHHCTRLLLPGNGGRIPERVQCAECGRAMEMYFLYR  680

Query  242  CCLD  231
            CC++
Sbjct  681  CCVE  684



>ref|XP_012064671.1| PREDICTED: uncharacterized protein LOC105627966 [Jatropha curcas]
 gb|KDP47163.1| hypothetical protein JCGZ_00054 [Jatropha curcas]
Length=748

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 109/185 (59%), Gaps = 18/185 (10%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK+N++E++++ +  IQ E LS +L D  ++ FFW RLESM++ K +    ++ 
Sbjct  577  LEMLYVGKINLREKVRKINTIIQIEKLSHVLSDLALMQFFWFRLESMYYSKVKNNRTVE-  635

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLA---EMTKGEGSNVVKVLNN  432
                        +D I+Q++  +L++D + +GWAV S+G     +M K +GS +++  + 
Sbjct  636  ------------KDSIMQEIITMLTFDATEQGWAVVSKGSGGNDQMAKAKGSLILRSFDE  683

Query  431  FDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
            F SW+H + DE  F+PAL + L     K HC R+++ A   + P    C ECGR ME F 
Sbjct  684  FRSWKH-IADERGFVPALIEYLLLHQNKPHCNRLIM-AFNENLPRQQLCAECGRPMEMFM  741

Query  251  MYSCC  237
            MY CC
Sbjct  742  MYRCC  746



>ref|XP_009769433.1| PREDICTED: uncharacterized protein LOC104220293 isoform X2 [Nicotiana 
sylvestris]
Length=702

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 104/184 (57%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M+Y GK + K+R++R +  I++E LS  L D   +W+FW+RLESM++ K +    ++D
Sbjct  533  LHMIYVGKSSKKDRVRRINIIIRKENLSYCLDDVMSVWYFWKRLESMFYSKMQLGQTIKD  592

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+Q+V  +LS+DGS++GW + SRG  EM +     + K L +F  
Sbjct  593  -------------DKIMQEVLTMLSFDGSDQGWVLISRGSFEMARANSVVITKTLEDFHV  639

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  E   E  F+ AL      L+T  HC R+++P      PE + C ECGR M+KFFMY 
Sbjct  640  WE-EDAREKGFVLALIDYFLHLHTPQHCNRLILPGLDVDIPEMITCAECGRPMDKFFMYR  698

Query  242  CCLD  231
            CC D
Sbjct  699  CCTD  702



>ref|XP_009769432.1| PREDICTED: uncharacterized protein LOC104220293 isoform X1 [Nicotiana 
sylvestris]
Length=706

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 104/184 (57%), Gaps = 14/184 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M+Y GK + K+R++R +  I++E LS  L D   +W+FW+RLESM++ K +    ++D
Sbjct  537  LHMIYVGKSSKKDRVRRINIIIRKENLSYCLDDVMSVWYFWKRLESMFYSKMQLGQTIKD  596

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+Q+V  +LS+DGS++GW + SRG  EM +     + K L +F  
Sbjct  597  -------------DKIMQEVLTMLSFDGSDQGWVLISRGSFEMARANSVVITKTLEDFHV  643

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  E   E  F+ AL      L+T  HC R+++P      PE + C ECGR M+KFFMY 
Sbjct  644  WE-EDAREKGFVLALIDYFLHLHTPQHCNRLILPGLDVDIPEMITCAECGRPMDKFFMYR  702

Query  242  CCLD  231
            CC D
Sbjct  703  CCTD  706



>ref|XP_004299166.1| PREDICTED: uncharacterized protein LOC101294943 [Fragaria vesca 
subsp. vesca]
Length=703

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 100/185 (54%), Gaps = 15/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNV-KERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            LE++Y G+    KE++ + +  I+ E LS    D T  WFFW RL+SM   K +    + 
Sbjct  533  LELVYAGRSTASKEKLWKLNKIIEAENLSRTWSDYTSTWFFWSRLDSMRCSKAKHHKTID  592

Query  605  DNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFD  426
            D             D IL++V ++LSYDGS+ GW +   G A+  +  G      L++F+
Sbjct  593  D-------------DTILREVMSLLSYDGSDHGWVMLWLGSADTVRANGHLTTSTLDDFE  639

Query  425  SWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
            +W+     E  F+P L  QL+  +  HHCTR+++P      P+ V C ECGR MEKFFM+
Sbjct  640  AWK-PAAAELGFLPELKNQLKQRHEPHHCTRLIIPGFGPDIPDKVVCTECGREMEKFFMF  698

Query  245  SCCLD  231
             CC D
Sbjct  699  RCCTD  703



>ref|XP_007211100.1| hypothetical protein PRUPE_ppa023699mg [Prunus persica]
 gb|EMJ12299.1| hypothetical protein PRUPE_ppa023699mg [Prunus persica]
Length=693

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 103/185 (56%), Gaps = 15/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNV-KERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            LE+LY G+    +ERI++ +  I+ E LS    D T  WFFW R++SM   K +    ++
Sbjct  523  LELLYVGRSTATRERIRKVNKVIETENLSRFWPDYTSNWFFWSRMDSMRCSKAKHHRTVE  582

Query  605  DNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFD  426
            +             D IL++V  +LSYDGS++GW +  RG  E  +  G   +  L+ F+
Sbjct  583  N-------------DEILKEVMTLLSYDGSDQGWVMVWRGSNETARANGQLTLHTLDEFE  629

Query  425  SWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
            +W+++   E+ F+P L  +L+  +   HCTR+++P      P+ V C ECG  MEKFFM+
Sbjct  630  AWKNKAA-ESGFVPTLSDELKRRHKPQHCTRLIIPGFGPDIPDRVECAECGSEMEKFFMF  688

Query  245  SCCLD  231
             CC D
Sbjct  689  RCCTD  693



>ref|XP_006378262.1| hypothetical protein POPTR_0010s060501g, partial [Populus trichocarpa]
 gb|ERP56059.1| hypothetical protein POPTR_0010s060501g, partial [Populus trichocarpa]
Length=357

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 103/182 (57%), Gaps = 26/182 (14%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N +E++++N+  I  E LS +L D T+IWFFW RLESMW  K +    +++
Sbjct  200  LEMLYVGKSNPREKVRKNNSIITTEKLSHVLPDLTLIWFFWVRLESMWHSKVQHKRTVEN  259

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+Q++  +L +DGS++GWAV SRG A+M K +G  ++K   +F+ 
Sbjct  260  -------------DVIMQEIITMLIFDGSDQGWAVISRGSADMAKAKGETILKSFVDFER  306

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSME--KFFM  249
            W+ +   EN F+PAL   L       H  R+    A G  PE V C ECGR  E   + +
Sbjct  307  WK-DGAKENGFLPALIDYL-------HELRI---GATGSIPERVVCAECGRPKENLSYIL  355

Query  248  YS  243
            YS
Sbjct  356  YS  357



>ref|XP_008239364.1| PREDICTED: uncharacterized protein LOC103337969 [Prunus mume]
Length=707

 Score =   132 bits (333),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 103/185 (56%), Gaps = 15/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNV-KERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            LE+LY G+    +E+I++ +  I+ E LS    D T  WFFW R++SM   K +    ++
Sbjct  537  LELLYVGRSTATREQIRKVNKVIKTENLSRFWPDYTSNWFFWSRMDSMRCSKAKHHKTVE  596

Query  605  DNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFD  426
            +             D IL++V  +LSYDGS++GW +  RG  E  +  G   +  L+ F+
Sbjct  597  N-------------DEILKEVMTLLSYDGSDQGWVMVWRGSNETARANGQLTLHTLDEFE  643

Query  425  SWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
            +W+++   E+ F+P L  +L+  +   HCTR+++P      P+ V C ECG  MEKFFM+
Sbjct  644  AWKNKAA-ESGFVPTLSDELKQRHKPQHCTRLIIPGFGPDIPDRVECAECGNEMEKFFMF  702

Query  245  SCCLD  231
             CC D
Sbjct  703  RCCTD  707



>ref|XP_002324001.2| hypothetical protein POPTR_0017s10720g [Populus trichocarpa]
 gb|EEF04134.2| hypothetical protein POPTR_0017s10720g [Populus trichocarpa]
Length=716

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 101/185 (55%), Gaps = 16/185 (9%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK   +E+I+R  GTI  E LS   QD TMIWFFW RLESM F K +  L   D
Sbjct  543  LEMVYVGKSRKREQIRRVMGTINVEKLSYAWQDLTMIWFFWTRLESMLFSKIQ--LGKVD  600

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +            DP++Q +K +LSYD    GWAV S+G + +  G G+ V+  L  +D 
Sbjct  601  D-----------HDPMMQAIKKLLSYDREG-GWAVLSKGSSVVVNGHGTTVLPTLVEYDL  648

Query  422  WRHEVTDENAFIPALDKQLRGLY-TKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
            W+ +V  +  F  A  +    L+   H C+R   P   G  PET+ C EC RSMEKF  +
Sbjct  649  WKEQVPVK-GFDLAFQEHHGNLHDIVHPCSRFEFPMTAGRIPETLKCPECNRSMEKFTTF  707

Query  245  SCCLD  231
             CC D
Sbjct  708  LCCHD  712



>ref|XP_006440671.1| hypothetical protein CICLE_v10019121mg [Citrus clementina]
 gb|ESR53911.1| hypothetical protein CICLE_v10019121mg [Citrus clementina]
Length=581

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 99/181 (55%), Gaps = 15/181 (8%)
 Frame = -3

Query  776  MLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQDND  597
            M Y GK N K+R++  S  I +E  S I+ D T +WFFW RLE M + K +  ++++   
Sbjct  413  MAYVGKKNAKKRLEEISSIITKEDSSHIVIDGTAMWFFWARLERMLYSKLQHGMSVE---  469

Query  596  TRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRG-LAEMTKGEGSNVVKVLNNFDSW  420
                      +D I+++V  +LS+DGS++GWA+F RG   E    +G+  +  +  F  W
Sbjct  470  ----------KDNIMREVMTLLSFDGSDQGWAIFWRGKTQETASAKGTAAIDCMEKFHEW  519

Query  419  RHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYSC  240
            +++ + +  FI  L+  L  + T  HC R+++    G  P  V C +CG  ME FFMY C
Sbjct  520  QNDAS-QTGFIEGLNNYLHKIRTGKHCNRLILAGVNGAIPGRVPCADCGHDMEMFFMYRC  578

Query  239  C  237
            C
Sbjct  579  C  579



>ref|XP_006369945.1| hypothetical protein POPTR_0001s35850g [Populus trichocarpa]
 gb|ERP66514.1| hypothetical protein POPTR_0001s35850g [Populus trichocarpa]
Length=722

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 100/185 (54%), Gaps = 14/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + +E+I+R   TI  E LS + QD TMIWFFW RLESM + K +  L   D
Sbjct  544  LEMVYVGKSSKREKIRRVIATITVEKLSYVWQDLTMIWFFWTRLESMLYSKIQ--LGRLD  601

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +            DP++Q++K +LSYD    GWAV S+G   +  G  + V++ L  +D 
Sbjct  602  D-----------HDPMMQEIKKLLSYDREG-GWAVLSKGSNVVANGHRTTVLQTLLEYDM  649

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +V  +   +   D Q R       C R   P   G  PET+ C EC R+MEKF  + 
Sbjct  650  WKDQVPVKGFDLAFQDHQGRIHDISRPCCRFDFPMTTGRIPETMKCPECNRTMEKFSTFL  709

Query  242  CCLDE  228
            CC DE
Sbjct  710  CCHDE  714



>gb|EYU17767.1| hypothetical protein MIMGU_mgv1a002070mg [Erythranthe guttata]
Length=719

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 106/189 (56%), Gaps = 14/189 (7%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK   KER+KR + T+   GLS    DPT IW+FW R+ESM   K       + 
Sbjct  540  LEMVYIGKNATKERMKRLNETVTSNGLSHCWTDPTSIWYFWTRIESMMHSKYSHNKGAKI  599

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDG-SNRGWAVFSRGL----AEMTKGEGSNVVKVL  438
            +D       +   D I ++V  +L++ G  +RGWA+FS+G      E+ + +G  ++  L
Sbjct  600  DD-------DGDVDHIRREVLTMLTFGGDGDRGWAMFSQGSGAGPGEVARAKGDAMLSGL  652

Query  437  NNFDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEK  258
             +F++W  E T    F+ AL+  L G  +  HC R+V+ + V   PETV C EC + MEK
Sbjct  653  KDFETWAPEAT-RIGFVAALNDYLAGNMSGEHCNRLVL-SGVDDVPETVVCAECRKPMEK  710

Query  257  FFMYSCCLD  231
            +FMY CC D
Sbjct  711  YFMYRCCDD  719



>ref|XP_011010496.1| PREDICTED: uncharacterized protein LOC105115342 [Populus euphratica]
Length=713

 Score =   129 bits (323),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 101/185 (55%), Gaps = 16/185 (9%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK   +E+I+R  GTI  E LS   QD TM+WFFW RLESM + K +  L   D
Sbjct  543  LEMVYVGKSREREQIQRVMGTINVEKLSYAWQDLTMMWFFWTRLESMLYSKIQ--LGKLD  600

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +            DP++Q++K +LSYD    GWAV S+G   +  G G+ V+  L  +D 
Sbjct  601  D-----------HDPMMQEIKKLLSYDREG-GWAVLSKGSRVVVNGHGTTVLPTLVEYDL  648

Query  422  WRHEVTDENAFIPALDKQLRGLY-TKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
            W+ +V  +  F  A  +    L+   H C+R   P   G  PET+ C EC RSMEKF  +
Sbjct  649  WQEQVPVK-GFDLAFQEHHENLHDIVHPCSRFEFPMTAGRIPETLKCPECHRSMEKFTTF  707

Query  245  SCCLD  231
             CC D
Sbjct  708  LCCHD  712



>ref|XP_006440672.1| hypothetical protein CICLE_v10019121mg [Citrus clementina]
 gb|ESR53912.1| hypothetical protein CICLE_v10019121mg [Citrus clementina]
Length=693

 Score =   128 bits (322),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 99/181 (55%), Gaps = 15/181 (8%)
 Frame = -3

Query  776  MLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQDND  597
            M Y GK N K+R++  S  I +E  S I+ D T +WFFW RLE M + K +  ++++   
Sbjct  525  MAYVGKKNAKKRLEEISSIITKEDSSHIVIDGTAMWFFWARLERMLYSKLQHGMSVE---  581

Query  596  TRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRG-LAEMTKGEGSNVVKVLNNFDSW  420
                      +D I+++V  +LS+DGS++GWA+F RG   E    +G+  +  +  F  W
Sbjct  582  ----------KDNIMREVMTLLSFDGSDQGWAIFWRGKTQETASAKGTAAIDCMEKFHEW  631

Query  419  RHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYSC  240
            +++ + +  FI  L+  L  + T  HC R+++    G  P  V C +CG  ME FFMY C
Sbjct  632  QNDAS-QTGFIEGLNNYLHKIRTGKHCNRLILAGVNGAIPGRVPCADCGHDMEMFFMYRC  690

Query  239  C  237
            C
Sbjct  691  C  691



>ref|XP_008449999.1| PREDICTED: uncharacterized protein LOC103491716 [Cucumis melo]
Length=714

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 100/191 (52%), Gaps = 20/191 (10%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + +ER+K+   TI  E L    QD TMIWFFW R+ESM + K +   A   
Sbjct  540  LEMVYVGKSSKRERVKKIITTITTEKLGYCWQDLTMIWFFWTRIESMLYSKIQLGKA---  596

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                      +  DP++Q++K +LSYD    GWAV S+G   +  G  + V+  L +FDS
Sbjct  597  ----------DDCDPLMQEIKKLLSYDKEG-GWAVLSKGSNVILNGHSTTVLPTLGSFDS  645

Query  422  WRHEVTDEN---AFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
            W+ E  D+    AF    D +L+G+   H C R   P   G  PE   C EC R MEK  
Sbjct  646  WKQEAADKGFDIAFKNHHD-ELQGI--THPCCRFEFPHTSGRIPENFKCPECDRQMEKLT  702

Query  251  MYSCCLDEYEN  219
             + CC DE  N
Sbjct  703  TFLCCHDENSN  713



>ref|XP_006477599.1| PREDICTED: uncharacterized protein LOC102631158 [Citrus sinensis]
Length=693

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 99/181 (55%), Gaps = 15/181 (8%)
 Frame = -3

Query  776  MLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQDND  597
            M Y GK N K+R++  S  I +E  S I+ D T +WFFW RLE M + K +  ++++   
Sbjct  525  MAYVGKKNAKKRLEEISSIITKEDSSHIVIDGTAMWFFWARLERMLYSKLQHGMSVE---  581

Query  596  TRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRG-LAEMTKGEGSNVVKVLNNFDSW  420
                      +D I+++V  +LS+DGS++GWA+F RG   E    +G+  +  +  F  W
Sbjct  582  ----------KDNIMREVMTLLSFDGSDQGWAIFWRGKTQETASAKGTAAIDCMEKFHEW  631

Query  419  RHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYSC  240
            +++ + +  FI  ++  L  + T  HC R+++    G  P  V C +CG  ME FFMY C
Sbjct  632  QNDAS-QTGFIEGINNYLHKIRTGKHCNRLILAGVNGAIPGRVPCADCGHDMEMFFMYRC  690

Query  239  C  237
            C
Sbjct  691  C  691



>ref|XP_002298572.2| hypothetical protein POPTR_0001s35880g [Populus trichocarpa]
 gb|EEE83377.2| hypothetical protein POPTR_0001s35880g [Populus trichocarpa]
Length=723

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 98/185 (53%), Gaps = 14/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + +E+I+R   TI  E LS + QD TMIWFFW RLESM +           
Sbjct  545  LEMVYVGKSSKREKIRRVIATITVEKLSYVWQDLTMIWFFWTRLESMLY-----------  593

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
              +R  +   +  DP++Q++K +LSYD    GWAV S G   +  G  +  ++ L  +D 
Sbjct  594  --SRIQLGKLDDHDPMMQEIKKLLSYDREG-GWAVLSNGSNVVVNGHKTTALQTLLEYDL  650

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +V  +   +   D Q R       C R   P  +G  PET+ C EC R+MEKF  + 
Sbjct  651  WKEQVPVKGFDLAYRDHQGRIHDISRPCCRFDFPMTMGRIPETMKCPECNRTMEKFSSFL  710

Query  242  CCLDE  228
            CC DE
Sbjct  711  CCHDE  715



>ref|XP_002298571.2| hypothetical protein POPTR_0001s35870g [Populus trichocarpa]
 gb|EEE83376.2| hypothetical protein POPTR_0001s35870g [Populus trichocarpa]
Length=723

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 99/185 (54%), Gaps = 14/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + +E+I+R   TI  E LS + QD TMIWFFW RLESM + K +  L   D
Sbjct  545  LEMVYVGKSSKREKIRRVIATITVEKLSYVWQDLTMIWFFWTRLESMLYSKIQ--LGKLD  602

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +            DP++Q++K +LSYD    GWAV S G   +  G  +  ++ L  +D 
Sbjct  603  D-----------HDPMMQEIKKLLSYDREG-GWAVLSNGSNVVVNGHKTTALQTLLEYDL  650

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +V  +   +   D Q R       C R   P  +G  PET+ C EC R+MEKF  + 
Sbjct  651  WKEQVPVKGFDLAYRDHQGRIHDISRPCCRFDFPMTMGRIPETMKCPECNRTMEKFSTFL  710

Query  242  CCLDE  228
            CC DE
Sbjct  711  CCHDE  715



>ref|XP_008239602.1| PREDICTED: uncharacterized protein LOC103338194 [Prunus mume]
Length=603

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 100/185 (54%), Gaps = 15/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNV-KERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            LE+LY G+    +ERI++ +  I+ E LS    D T  WFFW R++SM   K +    ++
Sbjct  433  LELLYVGRSTATRERIRKVNKVIETENLSRFWPDYTSNWFFWSRMDSMRCSKAKHHKTVK  492

Query  605  DNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFD  426
            +             D IL++V  +LSYDGS  GW +  RG  E  +  G   +  L++F+
Sbjct  493  N-------------DEILKEVMTLLSYDGSGGGWVMVWRGSNETARANGPLTLLTLDDFE  539

Query  425  SWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
            +W++E   ++ F+P L  +L+  +T  HC R+++P      P+ V C +CGR MEKF   
Sbjct  540  AWKNEAA-KSGFVPTLKDELKRRHTPDHCIRLIIPGFGPDIPDRVECPDCGREMEKFLKI  598

Query  245  SCCLD  231
             CC D
Sbjct  599  RCCTD  603



>ref|XP_006378260.1| hypothetical protein POPTR_0010s060301g, partial [Populus trichocarpa]
 gb|ERP56057.1| hypothetical protein POPTR_0010s060301g, partial [Populus trichocarpa]
Length=105

 Score =   116 bits (291),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 68/106 (64%), Gaps = 1/106 (1%)
 Frame = -3

Query  548  QVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDSWRHEVTDENAFIPALDKQ  369
            ++  +LS+DGS++GWAV SRG A+M   +G  ++K   +F+ W+ E   E  F+PAL   
Sbjct  1    EIMTMLSFDGSDQGWAVISRGPADMANAKGETILKSFADFEIWK-EGAQEKGFLPALIDH  59

Query  368  LRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYSCCLD  231
            L  L+T  HC R+++P A G  PE V C ECGR MEKF MY CC D
Sbjct  60   LHELHTPFHCNRLILPGATGSIPERVVCAECGRPMEKFIMYRCCTD  105



>ref|XP_004145690.1| PREDICTED: uncharacterized protein LOC101221710 [Cucumis sativus]
 gb|KGN58227.1| hypothetical protein Csa_3G597260 [Cucumis sativus]
Length=714

 Score =   125 bits (314),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 100/191 (52%), Gaps = 20/191 (10%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + +ER+K+   TI  E L    QD TMIWFFW R+ESM + K +   A   
Sbjct  540  LEMVYVGKSSKRERVKKIITTITTEKLGYCWQDLTMIWFFWTRIESMLYSKIQLGKA---  596

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                      +  DP++Q++K +LSYD    GWAV S+G   +  G  + ++  L +FDS
Sbjct  597  ----------DDCDPLMQEIKKLLSYDKEG-GWAVLSKGSNVILNGHSTTMLPTLGSFDS  645

Query  422  WRHEVTDEN---AFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
            W+ E TD+    AF    D +L+G+   H C R   P   G  PE   C  C R MEK  
Sbjct  646  WKQEATDKGFDIAFKNHHD-ELQGI--THPCCRFEFPHTSGRIPENFKCPGCDRQMEKLT  702

Query  251  MYSCCLDEYEN  219
             + CC DE  N
Sbjct  703  TFLCCHDENSN  713



>ref|XP_006369946.1| hypothetical protein POPTR_0001s35860g [Populus trichocarpa]
 gb|ERP66515.1| hypothetical protein POPTR_0001s35860g [Populus trichocarpa]
Length=722

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 98/185 (53%), Gaps = 14/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + +E+I+R   TI  E LS + QD TMIWFFW RLESM + K +  L   D
Sbjct  544  LEMVYVGKSSKREKIRRVIATITVEKLSYVWQDLTMIWFFWTRLESMVYSKIQ--LGRLD  601

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +            DP++Q++K +LSYD    GWAV S G   +  G  + V++ L  +D 
Sbjct  602  D-----------HDPMMQEIKKLLSYDREG-GWAVLSNGSNVVANGHRTTVLQTLLEYDL  649

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +V  +   +   D Q         C R   P   G  PET+ C EC R+MEKF  + 
Sbjct  650  WKAQVPVKGFDLAFRDHQGSIHDISRPCCRFDFPMTTGRIPETMKCPECNRTMEKFSTFL  709

Query  242  CCLDE  228
            CC DE
Sbjct  710  CCHDE  714



>ref|XP_012071596.1| PREDICTED: uncharacterized protein LOC105633578 [Jatropha curcas]
 gb|KDP46378.1| hypothetical protein JCGZ_10218 [Jatropha curcas]
Length=688

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 100/185 (54%), Gaps = 18/185 (10%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEMLY GK N K+R+ RN  TI  E LS + +D T IW+FW R+ESMW  K +     +D
Sbjct  518  LEMLYVGKSNPKKRVARNIETIIWENLSHLWEDKTYIWYFWVRIESMWRSKNQLGGKTKD  577

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAE--MTKGEGSNVVKVLNNF  429
                         DPI++++  +LS+D S  GWA+F++G     + +  G+ ++  L N+
Sbjct  578  -------------DPIMKKIMKVLSFD-SEAGWAIFAKGFDNQIVVEARGNIILSCLENY  623

Query  428  DSWRHEVTDENAFIPAL-DKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
              W+ + T +  FI A+ D     +  +HHC R+  P   G   E + C +C   ME+F 
Sbjct  624  TKWKSDGTQQKEFIAAVKDAVEDAVKEQHHCNRLTFPPDDGKTSE-IPCADCDNIMERFI  682

Query  251  MYSCC  237
            +Y CC
Sbjct  683  LYKCC  687



>gb|KJB75975.1| hypothetical protein B456_012G066400 [Gossypium raimondii]
Length=865

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 97/186 (52%), Gaps = 17/186 (9%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N +E++K+ +G I  E LS+  QD  M+WFFW RLESM F K +  L   D
Sbjct  688  LEMVYVGKSNKREQVKKVTGIINAEKLSNAWQDQAMVWFFWSRLESMLFSKIQ--LGRGD  745

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +           +DP+LQQ+K +LSY G   GWAV SRG      G  S V+  L  +D 
Sbjct  746  D-----------QDPMLQQIKKLLSY-GREGGWAVLSRGSNIAVNGHSSTVLPALGGYDE  793

Query  422  WRHEVTDENAFIPALDKQLRGLY-TKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
            W+  V  E  F  A       L+   H C R   P  +   PE + C EC R MEK+  +
Sbjct  794  WKINVA-EKGFDGAFKDYHDKLHDAAHPCCRFEFPNTI-RIPENMRCPECPRLMEKYTAF  851

Query  245  SCCLDE  228
             CC DE
Sbjct  852  LCCHDE  857



>ref|XP_006369948.1| hypothetical protein POPTR_0001s35900g [Populus trichocarpa]
 gb|ERP66517.1| hypothetical protein POPTR_0001s35900g [Populus trichocarpa]
Length=722

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 101/187 (54%), Gaps = 18/187 (10%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + +E+I+R   TI  E LS + QD TM+WFFW RLESM + K +  L   D
Sbjct  544  LEMVYVGKSSKREKIRRVIATITVEKLSYVWQDLTMMWFFWTRLESMLYSKIQ--LGKLD  601

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +            DP++Q++K +LSY G   GWAV S G   +  G  + V++ L  +D 
Sbjct  602  D-----------HDPMMQEIKKLLSY-GREGGWAVLSNGSNVVVNGHKTTVLQTLLEYDL  649

Query  422  WRHEVTDENAFIPALDK--QLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFM  249
            W+ +V  +   +   D   QLRG+     C R   P   G  PET+ C EC  +MEKF  
Sbjct  650  WKEQVPVKGFDMAFQDHHFQLRGI--ARPCCRFDFPMTTGRIPETMKCPECNSTMEKFST  707

Query  248  YSCCLDE  228
            + CC DE
Sbjct  708  FLCCHDE  714



>ref|XP_011046122.1| PREDICTED: uncharacterized protein LOC105140824 [Populus euphratica]
Length=639

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 97/185 (52%), Gaps = 14/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + +E+I+R   TI  E LSS+  D TMIWFFW RLESM +           
Sbjct  461  LEMVYVGKSSKREKIRRVIATITAEKLSSVWPDLTMIWFFWTRLESMLY-----------  509

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
              +R  +   +  DP++Q++K +LSYD    GWAV S G   +  G  ++V++ L  +D 
Sbjct  510  --SRIQLGKLDDHDPMMQEIKKLLSYDREG-GWAVLSNGSNVVATGHRTSVLQTLLEYDL  566

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  V  +   +   D Q     T   C R   P   G  PET+ C EC  +MEKF  + 
Sbjct  567  WKELVPVKGFDLAFRDHQGIIHDTARPCCRFDFPMTTGRIPETMKCPECNHTMEKFSSFL  626

Query  242  CCLDE  228
            CC DE
Sbjct  627  CCHDE  631



>gb|ERN10511.1| hypothetical protein AMTR_s00166p00027900 [Amborella trichopoda]
Length=125

 Score =   115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 72/111 (65%), Gaps = 0/111 (0%)
 Frame = -3

Query  563  DPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDSWRHEVTDENAFIP  384
            DPI+Q++ ++LS+DG+  GWA+ S G  +M K  G  +++ L++FD+WR  VT  +AF+P
Sbjct  15   DPIVQEIMSMLSFDGNGDGWALMSTGSTDMVKTPGKKLMECLSHFDTWRANVTGVDAFVP  74

Query  383  ALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYSCCLD  231
            AL   L   +   HCT +V+P   G   E V C ECG+ MEK+ +Y CC+D
Sbjct  75   ALRDALLQHHKAEHCTHLVLPDTTGPVQEKVVCTECGKQMEKYVLYRCCMD  125



>ref|XP_011013170.1| PREDICTED: uncharacterized protein LOC105117262 [Populus euphratica]
Length=722

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 97/185 (52%), Gaps = 14/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + +E+I++   TI  E LSS+  D TMIWFFW RLESM +           
Sbjct  545  LEMVYVGKSSKREKIRQVIATITAEKLSSVWPDLTMIWFFWTRLESMLY-----------  593

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
              +R  +   +  DP++Q++K +LSYD    GWAV S G   +  G  ++V++ L  +D 
Sbjct  594  --SRIQLGKVDDHDPMMQEIKKLLSYDREG-GWAVLSNGSNVVATGHRTSVLQTLLEYDL  650

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  V  E   +   D Q     T   C R   P   G  PET+ C EC  +MEKF  + 
Sbjct  651  WKELVPVEGFDLAFRDHQGIIHDTARPCCRFDFPMTTGRIPETMKCPECNHTMEKFSSFL  710

Query  242  CCLDE  228
            CC DE
Sbjct  711  CCHDE  715



>ref|XP_011014132.1| PREDICTED: uncharacterized protein LOC105117991 [Populus euphratica]
Length=723

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 102/187 (55%), Gaps = 18/187 (10%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LE++Y GK + +E+I+R   TI  E LS + QD TM+WFFW RLESM + K +  L   D
Sbjct  545  LEIVYVGKSSKREKIRRVIATITVEKLSYVWQDLTMMWFFWTRLESMLYSKIQ--LGKLD  602

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +            DP++Q++K +LSY G   GWAV S+G   +  G  + V++ L  +D 
Sbjct  603  D-----------HDPMMQEIKKLLSY-GREGGWAVLSKGSNVVVNGHKTTVLQTLLEYDL  650

Query  422  WRHEVTDENAFIPALDK--QLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFM  249
            W+ +V  +   +   D   QLRG+     C R   P   G  PET+ C EC  +MEKF  
Sbjct  651  WKEQVPVKGFDMAFQDHHFQLRGI--ARPCCRFDFPMTTGRIPETMKCPECNSAMEKFST  708

Query  248  YSCCLDE  228
            + CC DE
Sbjct  709  FLCCHDE  715



>ref|XP_011016134.1| PREDICTED: uncharacterized protein LOC105119666 [Populus euphratica]
Length=724

 Score =   123 bits (309),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 102/187 (55%), Gaps = 18/187 (10%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + +E+I++   TI  E LS + QD TM+WFFW RLESM + K +  L   D
Sbjct  546  LEMVYVGKSSKREKIRQVIATITVEKLSYVWQDLTMMWFFWTRLESMLYSKIQ--LGKLD  603

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +            DP++Q++K +LSY G   GWAV S+G   +  G  + V++ L  +D 
Sbjct  604  D-----------HDPMMQEIKKLLSY-GREGGWAVLSKGSNVVVNGHKTTVLQTLLEYDL  651

Query  422  WRHEVTDENAFIPALDK--QLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFM  249
            W+ +V  +   +   D   QLRG+     C R   P   G  PET+ C EC  +MEKF  
Sbjct  652  WKEQVPVKGFDMAFQDHHFQLRGI--ARPCCRFDFPMTTGRIPETMKCPECNSTMEKFST  709

Query  248  YSCCLDE  228
            + CC DE
Sbjct  710  FLCCHDE  716



>ref|XP_010029070.1| PREDICTED: uncharacterized protein LOC104419194 [Eucalyptus grandis]
 gb|KCW55911.1| hypothetical protein EUGRSUZ_I01709 [Eucalyptus grandis]
Length=720

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 71/194 (37%), Positives = 102/194 (53%), Gaps = 18/194 (9%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + +E++++   TI  E LSS  QD T++W+FW RL+SM F K +  L   D
Sbjct  545  LEMIYVGKSSKREKVRQVIATINVEKLSSTWQDLTLVWYFWTRLDSMLFSKIQ--LGKAD  602

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
             D           DP++QQ+K ILS+D +  GWA+ SRG A    G G+ V+  L  +D 
Sbjct  603  ED-----------DPMMQQIKRILSFDKTG-GWALLSRGSAIAVNGHGTTVLPALVEYDL  650

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  V  +   +   D   +       C R    +A G  PE + C EC R MEK   ++
Sbjct  651  WKEHVVTKGYDVAFKDHHDKIRDVTLPCCRFEFQSAGGRIPEGMRCPECQRRMEKLTTFA  710

Query  242  CCLDEYEN*ILPQI  201
            CC DE    ++P I
Sbjct  711  CCHDE----VVPTI  720



>ref|XP_011013023.1| PREDICTED: uncharacterized protein LOC105117152 [Populus euphratica]
Length=724

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 101/187 (54%), Gaps = 18/187 (10%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + +E+I++   TI  E LS + QD TM+WFFW RLESM  L  +  L   D
Sbjct  546  LEMVYVGKSSKREKIRQVIATITVEKLSYVWQDLTMMWFFWTRLESM--LNSKIQLGKLD  603

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +            DP++Q++K +LSY G   GWAV S+G   +  G  + V++ L  +D 
Sbjct  604  D-----------HDPMMQEIKKLLSY-GREGGWAVLSKGSNVVVNGHKTTVLQTLLEYDL  651

Query  422  WRHEVTDENAFIPALDK--QLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFM  249
            W+ +V  +   +   D   QLRG+     C R   P   G  PET+ C EC  +MEKF  
Sbjct  652  WKEQVPVKGFDMAFQDHHFQLRGI--ARPCCRFDFPMTTGRIPETMKCPECNSAMEKFST  709

Query  248  YSCCLDE  228
            + CC DE
Sbjct  710  FLCCHDE  716



>ref|XP_010496280.1| PREDICTED: uncharacterized protein LOC104773381 [Camelina sativa]
Length=827

 Score =   123 bits (308),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 103/187 (55%), Gaps = 5/187 (3%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N K  I+    TI++E LS  L D   IWFFW R+ESMW  K ++ L  + 
Sbjct  643  LEMVYVGKRNPKNGIQPIINTIRDENLSHTLPDLFQIWFFWTRIESMWESK-QRMLKARG  701

Query  602  NDTRTYI---IPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNN  432
               R      + EE +D +LQ+V A+L Y G   GW + S+    M + +G+   + L  
Sbjct  702  TKGREGFKDGLKEEEKDLVLQEVVAMLGYGGEGDGWGLVSKASDLMVRAKGNLFSRGLAE  761

Query  431  FDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
            +D W   +  +  F+PAL+  L      HHCTR ++P   G  P  V C EC R+MEK++
Sbjct  762  YDEWEVNIPTK-GFLPALNDHLLMRLPPHHCTRFMLPETAGIIPNEVECTECRRTMEKYY  820

Query  251  MYSCCLD  231
            +Y CCL+
Sbjct  821  LYQCCLE  827



>ref|XP_010435651.1| PREDICTED: uncharacterized protein LOC104719421 [Camelina sativa]
Length=827

 Score =   123 bits (308),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 103/187 (55%), Gaps = 5/187 (3%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N K  I+    TI++E LS  L D   IWFFW R+ESMW  K ++ L  + 
Sbjct  643  LEMVYVGKRNPKNGIQPIINTIRDENLSHTLPDLFQIWFFWTRIESMWESK-QRMLKARG  701

Query  602  NDTRTYI---IPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNN  432
               R      + EE +D +LQ+V A+L Y G   GW + S+    M + +G+   + L  
Sbjct  702  TKGREGFKDGLKEEEKDLVLQEVVAMLGYGGEGDGWGLVSKASDLMVRAKGNLFSRGLAE  761

Query  431  FDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
            +D W   +  +  F+PAL+  L      HHCTR ++P   G  P  V C EC R+MEK++
Sbjct  762  YDEWEVNIPTK-GFLPALNDHLLMRLPPHHCTRFMLPETAGIIPNEVECTECRRTMEKYY  820

Query  251  MYSCCLD  231
            +Y CCL+
Sbjct  821  LYQCCLE  827



>ref|XP_010485384.1| PREDICTED: uncharacterized protein LOC104763723 [Camelina sativa]
Length=827

 Score =   123 bits (308),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 103/187 (55%), Gaps = 5/187 (3%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N K  I+    TI++E LS  L D   IWFFW R+ESMW  K ++ L  + 
Sbjct  643  LEMVYVGKRNPKNGIQPIINTIRDENLSHTLPDLFQIWFFWTRIESMWESK-QRMLKARG  701

Query  602  NDTRTYI---IPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNN  432
               R      + EE +D +LQ+V A+L Y G   GW + S+    M + +G+   + L  
Sbjct  702  TKGREGFKDGLKEEEKDLVLQEVVAMLGYGGEGDGWGLVSKASDLMVRAKGNLFSRGLAE  761

Query  431  FDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
            +D W   +  +  F+PAL+  L      HHCTR ++P   G  P  V C EC R+MEK++
Sbjct  762  YDEWEVNIPTK-GFLPALNDHLLMRLPPHHCTRFMLPETAGIIPNEVECTECRRTMEKYY  820

Query  251  MYSCCLD  231
            +Y CCL+
Sbjct  821  LYQCCLE  827



>ref|XP_011014351.1| PREDICTED: uncharacterized protein LOC105118161 [Populus euphratica]
Length=722

 Score =   122 bits (307),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 97/185 (52%), Gaps = 14/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + +E+I+R   TI  E LS   QD TMIWFFW RLESM + K +  L   D
Sbjct  544  LEMVYVGKSSKREKIRRVIATITGEKLSYFWQDLTMIWFFWTRLESMLYSKIQ--LGKLD  601

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +            DP++Q++K +LSYD    GWAV S G   +  G  +  ++ L  +D 
Sbjct  602  D-----------HDPLMQEIKKLLSYDREG-GWAVLSNGSNVVANGHKTTALQTLLEYDL  649

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +V  +   +   D Q         C+R   P   G  PET+ C EC R+MEKF  + 
Sbjct  650  WKGQVPVKGFDLAFRDHQGLIHDIARPCSRFDFPITTGRIPETMKCPECHRTMEKFSTFL  709

Query  242  CCLDE  228
            CC DE
Sbjct  710  CCHDE  714



>ref|XP_011013686.1| PREDICTED: uncharacterized protein LOC105117652 [Populus euphratica]
Length=723

 Score =   122 bits (307),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 95/188 (51%), Gaps = 20/188 (11%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESM---WFLKGEKTLA  612
            LEM+Y GK + +E+I+R   TI  E LSS+  D TMIWFFW RLESM   W   G+    
Sbjct  545  LEMVYVGKSSKREKIRRVIATITAEKLSSVWPDLTMIWFFWTRLESMLYSWIQLGKL---  601

Query  611  MQDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNN  432
                         +  DP++Q++K +LSYD    GWAV S G   +  G  +  ++ L  
Sbjct  602  -------------DDHDPMMQEIKKLLSYDREG-GWAVLSNGSNVVANGHKTTALQTLLE  647

Query  431  FDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
            +D W+ +V  +   +   D Q         C R   P   G  PET+ C EC R+MEKF 
Sbjct  648  YDLWKEQVPVKGFDLAFRDHQGMIHGIARPCCRFDFPMTTGRIPETMKCPECNRTMEKFS  707

Query  251  MYSCCLDE  228
             + CC DE
Sbjct  708  TFLCCHDE  715



>ref|XP_011014801.1| PREDICTED: uncharacterized protein LOC105118522 isoform X2 [Populus 
euphratica]
Length=722

 Score =   122 bits (307),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 95/188 (51%), Gaps = 20/188 (11%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESM---WFLKGEKTLA  612
            LEM+Y GK + +E+I+R   TI  E LSS+  D TMIWFFW RLESM   W   G+    
Sbjct  544  LEMVYVGKSSKREKIRRVIATITAEKLSSVWPDLTMIWFFWTRLESMLYSWIQLGKL---  600

Query  611  MQDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNN  432
                         +  DP++Q++K +LSYD    GWAV S G   +  G  +  ++ L  
Sbjct  601  -------------DDHDPMMQEIKKLLSYDREG-GWAVLSNGSNVVANGHKTTALQTLLE  646

Query  431  FDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
            +D W+ +V  +   +   D Q         C R   P   G  PET+ C EC R+MEKF 
Sbjct  647  YDLWKEQVPVKGFDLAFRDHQGMIHGIARPCCRFDFPMTTGRIPETMKCPECNRTMEKFS  706

Query  251  MYSCCLDE  228
             + CC DE
Sbjct  707  TFLCCHDE  714



>ref|XP_007031665.1| Uncharacterized protein TCM_017020 [Theobroma cacao]
 gb|EOY02591.1| Uncharacterized protein TCM_017020 [Theobroma cacao]
Length=814

 Score =   122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 97/188 (52%), Gaps = 21/188 (11%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + +E++++ +  I  E LS   QD  M+WFFW RLESM F K +   A   
Sbjct  637  LEMVYVGKSSKREQVRKVTAIINAEKLSYAWQDQAMVWFFWTRLESMLFSKIQLGRA---  693

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                      +  DP++QQ+K +LSYD    GWAVFSRG   M  G  S V+  L  +D 
Sbjct  694  ----------DDHDPMMQQIKKLLSYDREG-GWAVFSRGSNTMVNGHSSTVLPALGGYDE  742

Query  422  WRHEVTD---ENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
            W+ +V +   E+AF    D   R     H C R   P      PE + C EC R MEK+ 
Sbjct  743  WKVKVPEIGFESAFKEYHD---RLHDVAHPCCRFEFPTTT-RIPENMRCPECRRFMEKYT  798

Query  251  MYSCCLDE  228
             + CC DE
Sbjct  799  TFLCCHDE  806



>ref|XP_010029072.1| PREDICTED: uncharacterized protein LOC104419195 [Eucalyptus grandis]
 gb|KCW55916.1| hypothetical protein EUGRSUZ_I01714 [Eucalyptus grandis]
Length=722

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 100/194 (52%), Gaps = 18/194 (9%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N +E++++   TI  E LSS  QDPT++W+FW RLESM F K +   A   
Sbjct  547  LEMVYVGKSNKREKVRQVIATINVEKLSSTWQDPTLVWYFWTRLESMLFSKIQLGKA---  603

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                      +  D ++QQ+K +LS+D +  GWAV SRG A    G G+ V+  L  +D 
Sbjct  604  ----------DEEDHMMQQIKRLLSFDKAG-GWAVLSRGSAITVNGHGTTVLPALLEYDL  652

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  V  +   +   +   +     H C R    +  G  PE + C +C R MEK   + 
Sbjct  653  WKEHVATKGYDVAFKEHHDKIHDVTHPCCRFEFQSMGGRIPEGMRCPDCQRRMEKLTTFV  712

Query  242  CCLDEYEN*ILPQI  201
            CC DE    ++P I
Sbjct  713  CCHDE----VVPTI  722



>gb|KCW55913.1| hypothetical protein EUGRSUZ_I01711 [Eucalyptus grandis]
Length=591

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 100/190 (53%), Gaps = 24/190 (13%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N +E++++   TI  E LS   QDPT++W+FW R+ESM F K +  L   D
Sbjct  414  LEMVYVGKSNKREKVRQVIATINVEKLSYTWQDPTLVWYFWTRIESMLFSKIQ--LGKVD  471

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
             D           DP++QQ+K +LS+D +  GWA+ S+G +    G G+ V+  L  +D 
Sbjct  472  ED-----------DPMMQQIKRLLSFDKAG-GWAILSKGSSITVNGHGTTVLPALLEYDQ  519

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHH-----CTRMVVPAAVGHYPETVACVECGRSMEK  258
            W+  V+ +       D   +  + K H     C R      +G  PE++ C EC R MEK
Sbjct  520  WKEHVSTK-----GFDVTFKEHHDKIHNETQPCCRFEFSTMMGRIPESMRCPECQRLMEK  574

Query  257  FFMYSCCLDE  228
               + CC D+
Sbjct  575  LTTFVCCHDD  584



>ref|XP_011014800.1| PREDICTED: uncharacterized protein LOC105118522 isoform X1 [Populus 
euphratica]
Length=722

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 97/185 (52%), Gaps = 14/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + +E+I+R   TI  E LS   QD TMIWFFW RLESM + K +  L   D
Sbjct  544  LEMVYVGKSSKREKIRRVIATITGEKLSYAWQDLTMIWFFWTRLESMLYSKIQ--LGKLD  601

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +            DP++Q++K +LSYD    GWAV S G   +  G  +  ++ L  +D 
Sbjct  602  D-----------HDPMMQEIKKLLSYDREG-GWAVLSNGSNVVANGHKTTALQTLLEYDL  649

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +V  +   +   D Q         C+R   P   G  PET+ C EC R+MEKF  + 
Sbjct  650  WKGQVPVKGFDLAFRDHQGLIHDIARPCSRFDFPMTTGRIPETMKCPECHRTMEKFSTFL  709

Query  242  CCLDE  228
            CC DE
Sbjct  710  CCHDE  714



>dbj|BAF01938.1| hypothetical protein [Arabidopsis thaliana]
Length=227

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 99/184 (54%), Gaps = 3/184 (2%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M+Y GK N K  I+    TI+EE LS  L D   IWFFW R+ESMW  K ++ L    
Sbjct  47   LVMVYVGKRNPKNGIQPIINTIREENLSHTLPDLFQIWFFWTRVESMWESK-QRMLKAHG  105

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
               R     EE +D +LQ+V A+L Y G   GW + S+    M + +G+   + L  F+ 
Sbjct  106  IKGREGF-KEEEKDLVLQEVVAMLGYGGEGDGWGLVSKASDMMVRAKGNLFSRGLAEFNE  164

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W   +  +  F+ AL+  L      HHCTR ++P   G  P  V C EC R+MEK+++Y 
Sbjct  165  WEVNIPTK-GFLTALNDHLLMRLPPHHCTRFMLPETAGIIPNEVECTECRRTMEKYYLYQ  223

Query  242  CCLD  231
            CCL+
Sbjct  224  CCLE  227



>emb|CBI34825.3| unnamed protein product [Vitis vinifera]
Length=694

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 96/185 (52%), Gaps = 14/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N +E++++   +I  + LS   QD TM+WFFW RLESM F K +  L   D
Sbjct  517  LEMVYVGKSNKREQVRKCITSITTDNLSYCWQDLTMVWFFWTRLESMLFSKIQ--LGRGD  574

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +D           D +L+++K +LSYD    GWAV S+G      G  S V+     ++ 
Sbjct  575  DD-----------DSMLREIKKLLSYDKEG-GWAVLSKGSFVFVNGHSSTVLPTFTEYNL  622

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +V  +   I  +D   +       C R   P+ VG  PE + C EC R MEK+  + 
Sbjct  623  WKDDVPPKGFDIACMDFHSKLHSDSQPCCRFEFPSEVGRIPEKIRCPECLRIMEKYITFG  682

Query  242  CCLDE  228
            CC DE
Sbjct  683  CCHDE  687



>ref|XP_010029069.1| PREDICTED: uncharacterized protein LOC104419193 [Eucalyptus grandis]
Length=705

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 100/190 (53%), Gaps = 24/190 (13%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N +E++++   TI  E LS   QDPT++W+FW R+ESM F K +  L   D
Sbjct  528  LEMVYVGKSNKREKVRQVIATINVEKLSYTWQDPTLVWYFWTRIESMLFSKIQ--LGKVD  585

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
             D           DP++QQ+K +LS+D +  GWA+ S+G +    G G+ V+  L  +D 
Sbjct  586  ED-----------DPMMQQIKRLLSFDKAG-GWAILSKGSSITVNGHGTTVLPALLEYDQ  633

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHH-----CTRMVVPAAVGHYPETVACVECGRSMEK  258
            W+  V+ +       D   +  + K H     C R      +G  PE++ C EC R MEK
Sbjct  634  WKEHVSTK-----GFDVTFKEHHDKIHNETQPCCRFEFSTMMGRIPESMRCPECQRLMEK  688

Query  257  FFMYSCCLDE  228
               + CC D+
Sbjct  689  LTTFVCCHDD  698



>ref|XP_003633822.1| PREDICTED: uncharacterized protein LOC100249294 [Vitis vinifera]
Length=752

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 96/185 (52%), Gaps = 14/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N +E++++   +I  + LS   QD TM+WFFW RLESM F K +  L   D
Sbjct  575  LEMVYVGKSNKREQVRKCITSITTDNLSYCWQDLTMVWFFWTRLESMLFSKIQ--LGRGD  632

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +D           D +L+++K +LSYD    GWAV S+G      G  S V+     ++ 
Sbjct  633  DD-----------DSMLREIKKLLSYDKEG-GWAVLSKGSFVFVNGHSSTVLPTFTEYNL  680

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +V  +   I  +D   +       C R   P+ VG  PE + C EC R MEK+  + 
Sbjct  681  WKDDVPPKGFDIACMDFHSKLHSDSQPCCRFEFPSEVGRIPEKIRCPECLRIMEKYITFG  740

Query  242  CCLDE  228
            CC DE
Sbjct  741  CCHDE  745



>emb|CDX74311.1| BnaA03g27360D [Brassica napus]
Length=831

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 99/184 (54%), Gaps = 1/184 (1%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            +EM+Y GK N K  I+    TI++E LS  L D   IWFFW R+ESMW  K     A + 
Sbjct  649  IEMVYVGKRNPKNGIQPIINTIRDENLSHTLPDLFQIWFFWARVESMWESKQRMLKAQRT  708

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
               R     EE +D +LQ++ A+L + G   GW + S+    M + +G+   + L  F+ 
Sbjct  709  KGGRQGFKEEEEKDLVLQEIVALLGFGGEGDGWGLVSKTADLMVRAKGNLFSQGLAEFNE  768

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W   +   + F+ AL   L      HHCTR ++P   G  P+ V C EC R+MEK+++Y 
Sbjct  769  WEVNIP-AHGFLKALSDHLMMRLPPHHCTRFMLPETSGIIPDEVECTECRRTMEKYYLYQ  827

Query  242  CCLD  231
            CCL+
Sbjct  828  CCLE  831



>ref|XP_009134596.1| PREDICTED: uncharacterized protein LOC103858898 [Brassica rapa]
Length=832

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 99/184 (54%), Gaps = 1/184 (1%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            +EM+Y GK N K  I+    TI++E LS  L D   IWFFW R+ESMW  K     A + 
Sbjct  650  IEMVYVGKRNPKNGIQPIINTIRDENLSHTLPDLFQIWFFWARVESMWESKQRMLKAQRT  709

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
               R     EE +D +LQ++ A+L + G   GW + S+    M + +G+   + L  F+ 
Sbjct  710  KGGRQGFKEEEEKDLVLQEIVALLGFGGEGDGWGLVSKTADLMVRAKGNLFSQGLAEFNE  769

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W   +   + F+ AL   L      HHCTR ++P   G  P+ V C EC R+MEK+++Y 
Sbjct  770  WEVNIP-AHGFLKALSDHLMMRLPPHHCTRFMLPETSGIIPDEVECTECRRTMEKYYLYQ  828

Query  242  CCLD  231
            CCL+
Sbjct  829  CCLE  832



>gb|KJB75974.1| hypothetical protein B456_012G066300 [Gossypium raimondii]
Length=807

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 96/186 (52%), Gaps = 17/186 (9%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK   +E +K+  G I  E LS   QDPTM+WFFW RLESM F K +   A   
Sbjct  630  LEMVYVGKSRKREHVKKVVGIINAEKLSYAWQDPTMVWFFWTRLESMLFSKIQLGRA---  686

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                      + +DP++QQ+K +LSY G   GWAV SRG   +  G  + V+  L  +D 
Sbjct  687  ----------DDQDPMMQQIKKLLSY-GREGGWAVLSRGSNIVVNGHSTTVLPTLGGYDE  735

Query  422  WRHEVTDENAFIPALDKQLRGLY-TKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
            W+  +  E  F  A  +    L+   H C R   P  +   PE + C EC R ME++  +
Sbjct  736  WKVNIA-ELGFDMAFKEYHDKLHDVAHPCCRFQFPTII-RTPENMRCPECHRVMERYTSF  793

Query  245  SCCLDE  228
             CC D+
Sbjct  794  ICCHDD  799



>ref|XP_011457422.1| PREDICTED: uncharacterized protein LOC101309418 [Fragaria vesca 
subsp. vesca]
Length=752

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 74/190 (39%), Positives = 104/190 (55%), Gaps = 9/190 (5%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRN-SGTIQEEGLSSILQDPTMIWFFWERLESMWFLKG---EKTL  615
            LE+LY G    KER  +N    IQ+E LS  ++   +I FFW RLESMW  KG   +  L
Sbjct  566  LELLYVGNNKAKERAVKNIMRIIQDENLSHTIE-WHLISFFWTRLESMWESKGHQLQNKL  624

Query  614  AMQDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLN  435
                    T  +  +  D I+Q + ++LS+  S+ GWAV     AEM+K  G  ++K L 
Sbjct  625  KKSSELGSTDSVAMKKDDAIMQGIISMLSFGSSDHGWAVIGTCSAEMSKANGELMLKSLR  684

Query  434  NFDSWRHEVTDENAFIPALDKQLRGLYTK--HHCTRMVVPAAVGHYPETVACVECGRSME  261
             F+ W+     E  F  AL++ L G+  +  HHC+ + +P   G  PETVAC ECGR ME
Sbjct  685  EFNVWKTRHI-EIGFTAALNEYLAGVSKQAPHHCSSLTLPVT-GLMPETVACAECGRIME  742

Query  260  KFFMYSCCLD  231
            +F ++ CC D
Sbjct  743  RFNLFRCCND  752



>ref|XP_003633800.1| PREDICTED: uncharacterized protein LOC100244128 [Vitis vinifera]
Length=825

 Score =   120 bits (302),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 96/185 (52%), Gaps = 14/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N +E++++   +I  E LS   QD TM+WFFW RLESM F K +  L   D
Sbjct  648  LEMVYVGKSNKREQVRKCITSITTENLSYCWQDLTMVWFFWTRLESMLFSKIQ--LGRGD  705

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +D           D +L+++K +LSYD    GWAV S+G      G  S V+     ++ 
Sbjct  706  DD-----------DSMLREIKKLLSYDKEG-GWAVLSKGSFVFVNGHSSTVLPTFTEYNL  753

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +V  +   I  +D   +       C R   P+ VG  PE + C EC + MEK+  + 
Sbjct  754  WKDDVPPKGFDIACMDFHSKLHSDSQPCCRFEFPSEVGRIPEKIRCPECLQIMEKYITFG  813

Query  242  CCLDE  228
            CC DE
Sbjct  814  CCHDE  818



>emb|CDX91934.1| BnaC03g32360D [Brassica napus]
Length=830

 Score =   120 bits (300),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 101/189 (53%), Gaps = 13/189 (7%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMW-----FLKGEKT  618
            +EM+Y GK N K  I+    TI++E LS  L D   IWFFW R+ESMW      LK  +T
Sbjct  650  IEMVYVGKRNPKNGIQPIINTIRDENLSHTLPDLFQIWFFWARVESMWESKQRMLKARRT  709

Query  617  LAMQDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVL  438
               Q          EE +D +LQ++ A+L + G   GW + S+    M + +G+   + L
Sbjct  710  KGRQG-------FKEEEKDLVLQEIVALLGFGGEGDGWGLVSKTADLMVRAKGNLFSQGL  762

Query  437  NNFDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEK  258
              F+ W   +   + F+ AL+  L      HHCTR ++P   G  P+ V C EC R+MEK
Sbjct  763  AEFNEWEVNIP-AHGFLKALNDHLMMRLPPHHCTRFMLPETAGIIPDEVECTECRRTMEK  821

Query  257  FFMYSCCLD  231
            +++Y CCL+
Sbjct  822  YYLYQCCLE  830



>ref|XP_006408536.1| hypothetical protein EUTSA_v10020071mg [Eutrema salsugineum]
 gb|ESQ49989.1| hypothetical protein EUTSA_v10020071mg [Eutrema salsugineum]
Length=833

 Score =   120 bits (300),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 99/186 (53%), Gaps = 3/186 (2%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGE--KTLAM  609
            LEM+Y GK N K  I+    TI+E+ LS  L D   IWFFW R+ESMW  K    K    
Sbjct  649  LEMVYVGKRNPKNGIQPIINTIKEDNLSHTLPDLFQIWFFWTRIESMWESKQRMLKAHGT  708

Query  608  QDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNF  429
            +  +       EE +D +LQ++ A+L + G   GW + S+    M + +G+   K L  F
Sbjct  709  KGRERSKEGFKEEEKDLVLQEIVAMLGFGGEGDGWGLVSKASDLMVRAKGNLFSKGLAEF  768

Query  428  DSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFM  249
            + W   +   + F+ AL+  L      HHCTR ++P   G  P  V C EC R+MEK+++
Sbjct  769  NEWEANIP-THGFLKALNDHLLMHLPPHHCTRFMLPETAGIIPNEVECTECRRTMEKYYL  827

Query  248  YSCCLD  231
            Y CCL+
Sbjct  828  YQCCLE  833



>ref|XP_006432374.1| hypothetical protein CICLE_v10000431mg [Citrus clementina]
 gb|ESR45614.1| hypothetical protein CICLE_v10000431mg [Citrus clementina]
Length=716

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 95/186 (51%), Gaps = 13/186 (7%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK   +E+++R   T+  E L    QD TM+WFFW RLESM   K +   A   
Sbjct  538  LEMVYVGKSTKREQVRRIMATLAVEKLGHFWQDLTMVWFFWTRLESMLLSKIQLGRA---  594

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                     ++  DP++ Q+K +LSYD  + GWA+ S+G   +  G G+ V+  L  +D 
Sbjct  595  ---------DDHHDPMVPQIKKLLSYD-RDGGWALLSKGSQVLVNGHGTTVLPTLLEYDI  644

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +V  +      +D   +     H C R    A  G  P ++ C EC R MEKF  + 
Sbjct  645  WKEQVPIKGFDDSFIDHHQKIHGVAHPCCRFEFSAHSGRIPASMTCPECHRYMEKFTTFC  704

Query  242  CCLDEY  225
            CC D++
Sbjct  705  CCHDDH  710



>ref|XP_012071551.1| PREDICTED: uncharacterized protein LOC105633544 [Jatropha curcas]
 gb|KDP46373.1| hypothetical protein JCGZ_10213 [Jatropha curcas]
Length=718

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 97/190 (51%), Gaps = 24/190 (13%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK   +++++R   TI  E LS + QD TMIWFFW RL+SM + K +  L   D
Sbjct  541  LEMVYVGKSCKRDKVQRIISTITVEKLSYVWQDLTMIWFFWTRLQSMLYSKIQ--LGKID  598

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         DP++Q++K +LSYD    GWAV SRG   +  G  + V+  L  +D 
Sbjct  599  E-----------HDPMMQEIKKLLSYDKEG-GWAVLSRGSNIVVNGHSTTVLPTLLEYDI  646

Query  422  WRHEVTDENAFIPALDKQLRGLYTK-----HHCTRMVVPAAVGHYPETVACVECGRSMEK  258
            W+     EN  +   D   +  + K     H C R   P+  G  PE + C EC R+MEK
Sbjct  647  WK-----ENVSLKGFDLSFKEHHDKLHGIAHPCCRFEFPSTTGRIPERLKCPECNRNMEK  701

Query  257  FFMYSCCLDE  228
               + CC +E
Sbjct  702  HITFLCCHEE  711



>ref|NP_566145.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL24327.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP68236.1| At3g01670 [Arabidopsis thaliana]
 gb|ADN32813.1| sieve element occlusion a [Arabidopsis thaliana]
 gb|AEE73701.1| uncharacterized protein AT3G01670 [Arabidopsis thaliana]
Length=822

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 100/184 (54%), Gaps = 3/184 (2%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N K  I+    TI+EE LS  L D   IWFFW R+ESMW  K ++ L    
Sbjct  642  LEMVYVGKRNPKNGIQPIINTIREENLSHTLPDLFQIWFFWTRVESMWESK-QRMLKAHG  700

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
               R     EE +D +LQ+V A+L Y G   GW + S+    M + +G+   + L  F+ 
Sbjct  701  IKGREGF-KEEEKDLVLQEVVAMLGYGGEGDGWGLVSKASDMMVRAKGNLFSRGLAEFNE  759

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W   +  +  F+ AL+  L      HHCTR ++P   G  P  V C EC R+MEK+++Y 
Sbjct  760  WEVNIPTK-GFLTALNDHLLMRLPPHHCTRFMLPETAGIIPNEVECTECRRTMEKYYLYQ  818

Query  242  CCLD  231
            CCL+
Sbjct  819  CCLE  822



>gb|AAF01550.1|AC009325_20 unknown protein [Arabidopsis thaliana]
Length=846

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 100/184 (54%), Gaps = 3/184 (2%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N K  I+    TI+EE LS  L D   IWFFW R+ESMW  K ++ L    
Sbjct  666  LEMVYVGKRNPKNGIQPIINTIREENLSHTLPDLFQIWFFWTRVESMWESK-QRMLKAHG  724

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
               R     EE +D +LQ+V A+L Y G   GW + S+    M + +G+   + L  F+ 
Sbjct  725  IKGREGF-KEEEKDLVLQEVVAMLGYGGEGDGWGLVSKASDMMVRAKGNLFSRGLAEFNE  783

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W   +  +  F+ AL+  L      HHCTR ++P   G  P  V C EC R+MEK+++Y 
Sbjct  784  WEVNIPTK-GFLTALNDHLLMRLPPHHCTRFMLPETAGIIPNEVECTECRRTMEKYYLYQ  842

Query  242  CCLD  231
            CCL+
Sbjct  843  CCLE  846



>emb|CDX77078.1| BnaC04g38730D [Brassica napus]
Length=822

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 102/184 (55%), Gaps = 6/184 (3%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N K+ I+    TI+E+ LS  L D   IWFFW R+ESMW     K   ++ 
Sbjct  645  LEMVYVGKRNPKKGIEPIINTIREDNLSHTLPDLFQIWFFWTRIESMW---ESKQRMLKA  701

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            + T+ +   EE +D +LQ++ A+L + G   GW + S+    M + +G+     L  ++ 
Sbjct  702  HGTKGF--KEEEKDLVLQEIVALLGFGGEGDGWGLVSKTSDLMVRAKGNLFSNALAEYNE  759

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W   +   + F+ AL+  L      HHCTR ++P   G  P  V C EC R+MEK+++Y 
Sbjct  760  WEVNIP-AHGFLKALNDHLLMRIPPHHCTRFMLPETAGIIPNEVECTECRRTMEKYYLYQ  818

Query  242  CCLD  231
            CCL+
Sbjct  819  CCLE  822



>ref|XP_010660833.1| PREDICTED: uncharacterized protein LOC100245845 [Vitis vinifera]
Length=712

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 96/186 (52%), Gaps = 14/186 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK   +E+++R   +I  E LS   QD TM+WFFW RLESM F K +  L   D
Sbjct  535  LEMVYVGKSTKREQVRRCIASITAEKLSHCWQDLTMVWFFWTRLESMLFSKIQ--LGQAD  592

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +           +DP++ ++K +LSYD    GWAV S+G      G G+ ++  L  ++ 
Sbjct  593  D-----------QDPMMHEIKKLLSYDKEG-GWAVLSKGSFTFVNGHGTTILPTLLAYEE  640

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  V  +   I  +D   +       C R    +  G  P+ + C EC R+MEK+  + 
Sbjct  641  WQEHVVTKGFDIACMDYHSKVHSDSRPCCRFEFLSTSGRIPDKMKCPECIRNMEKYITFL  700

Query  242  CCLDEY  225
            CC D++
Sbjct  701  CCHDDH  706



>gb|KFK37629.1| hypothetical protein AALP_AA3G008100 [Arabis alpina]
Length=831

 Score =   118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 99/187 (53%), Gaps = 5/187 (3%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            +EM+Y GK N K  I+    TI+EE LS  L D   IWFFW R+ESMW  K ++ L    
Sbjct  647  VEMVYVGKRNPKNGIQPIINTIREENLSHTLPDLFQIWFFWTRIESMWESK-QRMLKAHG  705

Query  602  NDTRTYII---PEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNN  432
               R        EE +D +LQ++ A+L Y G   GW + S+    M + +G+     L  
Sbjct  706  TKGREGFKEGHKEEEKDLVLQEIVAMLGYGGEGDGWGLVSKASDLMVRAKGTLFSTGLAE  765

Query  431  FDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
            F+ W   +   N F+ AL+  L      HHCTR ++P   G  P  V C EC R+MEK++
Sbjct  766  FNQWEVNIP-TNGFLKALNDHLLMRLPPHHCTRFMLPETAGIIPNEVECTECRRTMEKYY  824

Query  251  MYSCCLD  231
            +Y CCL+
Sbjct  825  LYQCCLE  831



>emb|CAN65452.1| hypothetical protein VITISV_003896 [Vitis vinifera]
Length=721

 Score =   118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 94/185 (51%), Gaps = 14/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N +E++++   +I    LS   QD TM+WFFW RLESM F K +  L   D
Sbjct  544  LEMVYVGKSNKREQVRKCITSITTXNLSYCWQDLTMVWFFWTRLESMLFSKIQ--LGRGD  601

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +D           D +L+++K +LSYD    GWAV S+G      G  S V+     ++ 
Sbjct  602  DD-----------DSMLREIKKLLSYDKEG-GWAVLSKGSFVFVNGHSSTVLPTFTEYNL  649

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +V  +   I  +D   +       C R   P+ VG  PE + C EC   MEK+  + 
Sbjct  650  WKDDVPPKGFDIACMDFHSKLHSDSQPCCRFEFPSEVGRIPEKIRCPECLXIMEKYITFG  709

Query  242  CCLDE  228
            CC DE
Sbjct  710  CCHDE  714



>emb|CAN61289.1| hypothetical protein VITISV_032473 [Vitis vinifera]
Length=723

 Score =   117 bits (292),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 94/185 (51%), Gaps = 14/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y G+   +E++++ +  I  E LS   QD TM+WFFW RLESM F K      +Q 
Sbjct  546  LEMVYVGQSKKREQVRKCTTAITVEKLSYCWQDLTMVWFFWTRLESMMFSK------IQL  599

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
              T          DP+L+++K ++SYD    GWAV S G      G  S V+     +++
Sbjct  600  GSTVDV-------DPMLREIKKLISYDKEG-GWAVLSNGSFVFVNGHSSTVLLTFTEYNA  651

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +V  +   I  +D   +       C R   P+ VG  PE + C EC R MEK+  + 
Sbjct  652  WKDDVPPKGFDIAYMDFHSKLHSDSRPCCRFEFPSEVGRIPENIKCPECLRIMEKYITFG  711

Query  242  CCLDE  228
            CC DE
Sbjct  712  CCHDE  716



>ref|XP_010660831.1| PREDICTED: uncharacterized protein LOC100264492 [Vitis vinifera]
Length=697

 Score =   117 bits (292),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 94/185 (51%), Gaps = 14/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y G+   +E++++ +  I  E LS   QD TM+WFFW RLESM F K      +Q 
Sbjct  520  LEMVYVGQSKKREQVRKCTTAITVEKLSYCWQDLTMVWFFWTRLESMMFSK------IQL  573

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
              T          DP+L+++K ++SYD    GWAV S G      G  S V+     +++
Sbjct  574  GSTVDV-------DPMLREIKKLISYDKEG-GWAVLSNGSFVFVNGHSSTVLLTFTEYNA  625

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +V  +   I  +D   +       C R   P+ VG  PE + C EC R MEK+  + 
Sbjct  626  WKDDVPPKGFDIAYMDFHSKLHSDSRPCCRFEFPSEVGRIPENIKCPECLRIMEKYITFG  685

Query  242  CCLDE  228
            CC DE
Sbjct  686  CCHDE  690



>ref|XP_006471327.1| PREDICTED: uncharacterized protein LOC102619778 [Citrus sinensis]
Length=716

 Score =   117 bits (292),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 94/186 (51%), Gaps = 13/186 (7%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK   +E+++R    +  E L    QD TM+WFFW RLESM   K +   A   
Sbjct  538  LEMVYVGKSTKREQVRRIMAALAVEKLGHFWQDLTMVWFFWTRLESMLLSKIQLGRA---  594

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                     ++  DP++ Q+K +LSYD  + GWA+ S+G   +  G G+ V+  L  +D 
Sbjct  595  ---------DDHHDPMVPQIKKLLSYD-RDGGWALLSKGSQVLVNGHGTTVLPTLLEYDI  644

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +V  +      +D   +     H C R    A  G  P ++ C EC R MEKF  + 
Sbjct  645  WKEQVPIKGFDDSFIDHHQKIHGVAHPCCRFEFSAYSGRIPASMTCPECHRYMEKFTTFC  704

Query  242  CCLDEY  225
            CC D++
Sbjct  705  CCHDDH  710



>ref|XP_010660832.1| PREDICTED: uncharacterized protein LOC100268167 [Vitis vinifera]
Length=743

 Score =   117 bits (292),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 94/185 (51%), Gaps = 14/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y G+   +E++++ +  I  E LS   QD TM+WFFW RLESM F K      +Q 
Sbjct  566  LEMVYVGQSKKREQVRKCTTAITVEKLSYCWQDLTMVWFFWTRLESMMFSK------IQL  619

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
              T          DP+L+++K ++SYD    GWAV S G      G  S V+     +++
Sbjct  620  GSTVDV-------DPMLREIKKLISYDKEG-GWAVLSNGSFVFVNGHSSTVLLTFTEYNA  671

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+ +V  +   I  +D   +       C R   P+ VG  PE + C EC R MEK+  + 
Sbjct  672  WKDDVPPKGFDIAYMDFHSKLHSDSRPCCRFEFPSEVGRIPENIKCPECLRIMEKYITFG  731

Query  242  CCLDE  228
            CC DE
Sbjct  732  CCHDE  736



>ref|XP_002271723.2| PREDICTED: uncharacterized protein LOC100242213 [Vitis vinifera]
Length=715

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 94/185 (51%), Gaps = 14/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK   +E++++ +  I  E LS   QD  M+WFFW RLESM F K      +Q 
Sbjct  538  LEMVYVGKSTKREQVRKCTTAITAEKLSYCWQDLAMVWFFWTRLESMMFSK------IQL  591

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
              T          DP+L+++K +LSYD    GWAV S+G      G  S+V+   N +D+
Sbjct  592  GSTVDV-------DPMLREIKKLLSYDKEG-GWAVLSKGSFVFVNGHSSSVLPTFNEYDA  643

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  V  +   +   D           C R    + VG  P+T+ C EC R+MEK+  + 
Sbjct  644  WKEYVPSKGFDMACSDYHNNLRPDARPCCRFEFSSTVGRIPDTMKCPECLRNMEKYMAFL  703

Query  242  CCLDE  228
            CC DE
Sbjct  704  CCHDE  708



>ref|XP_002526962.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35449.1| conserved hypothetical protein [Ricinus communis]
Length=1068

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 98/183 (54%), Gaps = 15/183 (8%)
 Frame = -3

Query  782   LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
             LEMLY GK N  ER+ RN  TI+ E LS  L+  ++IW FW R++SMW            
Sbjct  899   LEMLYVGKSNPNERVMRNMETIKTEKLSHCLEQRSLIWLFWYRIQSMW------------  946

Query  602   NDTRTYIIPEESRDPILQQVKAILSYDGSNR-GWAVFSRGLAEMTKGEGSNVVKVLNNFD  426
              ++R  +  +   D I+Q++ ++LS+DG +  GWA+  +   EM K  GS+ +  L N+ 
Sbjct  947   -NSRYQLGKKIEDDQIMQELTSLLSFDGIDECGWALICKETTEMVKARGSDFLNCLLNYS  1005

Query  425   SWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
              W+     +  F+ A  ++L G      C ++V+P +V +   +V C +C   ME+F  +
Sbjct  1006  EWKKNAL-QKGFLAAFQEKLVGSSAPEECYQLVLPESVENTLGSVDCSQCHYPMERFIAF  1064

Query  245   SCC  237
              CC
Sbjct  1065  RCC  1067


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 67/139 (48%), Gaps = 14/139 (10%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK    E+++R+  TI   GLS  +      W FW+R+ +M             
Sbjct  517  LEMVYVGKREPSEQVQRHITTITSGGLSHSMTREEQ-WRFWKRIVNM-------------  562

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
              +R  +      DPI+Q++ ++L+ D +   WA F      + K +G+ ++  L +F  
Sbjct  563  GHSRMQLGKTIYEDPIMQEIISLLNLDATAGVWAAFGHKSDLIIKAKGNEILNSLIHFVE  622

Query  422  WRHEVTDENAFIPALDKQL  366
            W+  V  ++ F+PAL   L
Sbjct  623  WKGSVETKDRFVPALQDSL  641



>ref|XP_002884267.1| hypothetical protein ARALYDRAFT_477348 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60526.1| hypothetical protein ARALYDRAFT_477348 [Arabidopsis lyrata subsp. 
lyrata]
Length=822

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 101/184 (55%), Gaps = 3/184 (2%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N K  I     TI++E +S  L D   IWFFW R+ESMW  K ++ L  + 
Sbjct  642  LEMVYVGKRNPKNGILPIINTIRDENISHTLPDLFQIWFFWTRIESMWESK-QRMLKARG  700

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
               R     EE +D +LQ+V A+L Y G   GW + S+    M + +G+   + L+ F+ 
Sbjct  701  IKGREGF-KEEEKDLVLQEVVAMLGYGGEGDGWGLVSKASDLMVRAKGNLFSRGLSEFNE  759

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W   +  +  F+ AL+  L      HHCTR ++P   G  P  V C EC R+MEK+++Y 
Sbjct  760  WEVNIPTK-GFLTALNDHLLMRLPPHHCTRFMLPETAGIIPNEVECTECRRTMEKYYLYQ  818

Query  242  CCLD  231
            CCL+
Sbjct  819  CCLE  822



>ref|XP_012071576.1| PREDICTED: uncharacterized protein LOC105633559 [Jatropha curcas]
 gb|KDP46376.1| hypothetical protein JCGZ_10216 [Jatropha curcas]
Length=1116

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 100/184 (54%), Gaps = 16/184 (9%)
 Frame = -3

Query  782   LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
             LEMLY GK N+  R  RN  + +EE LS + +D   + +FW R++SMW            
Sbjct  945   LEMLYVGKSNLNHRGWRNIESFEEEELSHVWRDRLGLIWFWYRIKSMWL-----------  993

Query  602   NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAE--MTKGEGSNVVKVLNNF  429
               +R  I+     D I+Q++  +LS+D S  GWA+ ++G     + K +GS+ +  L+NF
Sbjct  994   --SRYQIVKTIEGDEIMQELTTLLSFDSSECGWAIMNKGSKPGVIAKAKGSDFLDCLSNF  1051

Query  428   DSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFM  249
             ++W+ E + +  F+P L ++L  L+    C ++V+P       ET  C  C RSM++F  
Sbjct  1052  ENWKEEAS-QKGFVPTLKEKLTHLHKPEDCFQLVLPELAETKLETGECCHCHRSMQRFIT  1110

Query  248   YSCC  237
             + CC
Sbjct  1111  FKCC  1114



>gb|KHG01411.1| hypothetical protein F383_21965 [Gossypium arboreum]
Length=741

 Score =   115 bits (287),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 95/185 (51%), Gaps = 15/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N +E++K+ +  I+E  LS   +DP M+WFFW RLESM F K +  L   D
Sbjct  562  LEMVYVGKSNKREQVKKVAAIIKERKLSHCWEDPAMVWFFWTRLESMMFSKIQ--LGRAD  619

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            +            DPI+Q +K +LSY G   GWAV S G   +  G  + V+  L ++  
Sbjct  620  D-----------LDPIVQGIKKLLSY-GREGGWAVLSEGSNILVNGHSTTVLPTLVDYVK  667

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            WR  V ++   +  ++   +     H C R     A    PE++ C EC R MEK   + 
Sbjct  668  WRGNVAEKGFNLSFIEYHDQLHNVAHPCCRFEF-LATTKAPESIRCPECHRVMEKHTAFV  726

Query  242  CCLDE  228
            CC DE
Sbjct  727  CCHDE  731



>gb|KJB70882.1| hypothetical protein B456_011G093700 [Gossypium raimondii]
Length=784

 Score =   115 bits (287),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 94/185 (51%), Gaps = 15/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N +E++K+ +  I+E  LS   +DP M+WFFW RLESM F K +   A   
Sbjct  605  LEMVYVGKSNKREQVKKVAAIIKERKLSHCWEDPAMVWFFWTRLESMMFSKIQLGRA---  661

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                      +  DPI+Q +K +LSY G   GWAV S G   +  G  + V+  L ++  
Sbjct  662  ----------DDLDPIVQGIKKLLSY-GREGGWAVLSEGSNILVNGHSTTVLPTLVDYVK  710

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            WR  V ++   +  ++   +     H C R     A    PE++ C EC R MEK   + 
Sbjct  711  WRGNVAEKGFNLSFIEYHDQLHNVAHPCCRFEF-LATTKAPESIRCPECHRVMEKHTAFV  769

Query  242  CCLDE  228
            CC DE
Sbjct  770  CCHDE  774



>ref|XP_010550172.1| PREDICTED: uncharacterized protein LOC104821100 [Tarenaya hassleriana]
Length=805

 Score =   114 bits (286),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 99/184 (54%), Gaps = 8/184 (4%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N K  ++     I+EE +S  L D   IWFFW R+ESMW     K   ++ 
Sbjct  630  LEMVYVGKRNPKNGLQPIIDRIREERISHTLVDIFQIWFFWTRIESMW---ESKQRVLKQ  686

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
              TR     EE  D +LQ++ ++L Y G   GW + SR    M + +G+     L  FD 
Sbjct  687  RTTRK----EEREDIVLQEITSLLGYGGEGGGWGLVSRASELMVRAKGNVFEIALTEFDQ  742

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  E+  +  F+ AL   L      HHCTR ++P + G  P +V C EC R+M+KF+++ 
Sbjct  743  WSGEIPSK-GFLRALYDHLMARRPPHHCTRFMLPESSGIIPNSVECTECRRTMDKFYLFQ  801

Query  242  CCLD  231
            CCL+
Sbjct  802  CCLE  805



>ref|XP_010524284.1| PREDICTED: uncharacterized protein LOC104802389 [Tarenaya hassleriana]
Length=814

 Score =   114 bits (285),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 101/184 (55%), Gaps = 9/184 (5%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N K  ++     I++E +S  L D   IWFFW R+ESMW  + ++ +    
Sbjct  640  LEMVYVGKRNPKNGLQPIIDRIRQEQISHTLVDLFQIWFFWTRIESMW--ESKQRVLKHK  697

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            N+TR      E +D +L ++ ++L Y G   GW + SR    M + +G+     L  FD 
Sbjct  698  NNTR------EDKDNVLMEITSLLGYGGEGGGWGLVSRASELMVRAKGNVFEIALTEFDQ  751

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W  E+  +  F+ AL   L      HHCTR ++P + G  P +V C EC R+M+KF+++ 
Sbjct  752  WNGEIPSK-GFLRALYDHLMAPRPPHHCTRFMLPESAGIIPNSVECTECRRTMDKFYLFQ  810

Query  242  CCLD  231
            CCL+
Sbjct  811  CCLE  814



>ref|XP_009124043.1| PREDICTED: uncharacterized protein LOC103848960 [Brassica rapa]
Length=818

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 99/184 (54%), Gaps = 11/184 (6%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N K+ I+    TI+E+ LS  L D   IWFFW R+ESMW     K   ++ 
Sbjct  646  LEMVYVGKRNPKKGIQPIINTIREDNLSHTLPDLFQIWFFWTRIESMW---ESKQRMLKA  702

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            + T+        +D +LQ++ A+L + G   GW + S+    M + +G+     L  ++ 
Sbjct  703  HGTK-------EKDLVLQEIVAMLGFGGEGDGWGLVSKTSDLMVRAKGNLFSNALAEYNE  755

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W   +   + F+ AL+  L      HHCTR ++P   G  P  V C EC R+MEK+++Y 
Sbjct  756  WEVNIP-AHGFLKALNDHLLMRIPPHHCTRFMLPETAGIIPNEVECTECRRTMEKYYLYQ  814

Query  242  CCLD  231
            CCL+
Sbjct  815  CCLE  818



>emb|CDY37507.1| BnaA05g33720D [Brassica napus]
Length=818

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 99/184 (54%), Gaps = 11/184 (6%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N K+ I+    TI+E+ LS  L D   IWFFW R+ESMW     K   ++ 
Sbjct  646  LEMVYVGKRNPKKGIQPIINTIREDNLSHTLPDLFQIWFFWTRIESMW---ESKQRMLKA  702

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            + T+        +D +LQ++ A+L + G   GW + S+    M + +G+     L  ++ 
Sbjct  703  HGTK-------EKDLVLQEIVAMLGFGGEGDGWGLVSKTSDLMVRAKGNLFSNALAEYNE  755

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W   +   + F+ AL+  L      HHCTR ++P   G  P  V C EC R+MEK+++Y 
Sbjct  756  WEVNIP-AHGFLKALNDHLLMRIPPHHCTRFMLPETAGIIPNEVECTECRRTMEKYYLYQ  814

Query  242  CCLD  231
            CCL+
Sbjct  815  CCLE  818



>ref|XP_012071641.1| PREDICTED: uncharacterized protein LOC105633625 [Jatropha curcas]
 gb|KDP46382.1| hypothetical protein JCGZ_10222 [Jatropha curcas]
Length=714

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/213 (30%), Positives = 102/213 (48%), Gaps = 45/213 (21%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y G+ N KER+K+   TI+ E LS  LQD  +IW+FW R+ SMW+ K +     ++
Sbjct  515  LEMVYVGRRNSKERVKKIIETIESEKLSRSLQDQRLIWYFWVRIASMWYSKNQLKKTTEN  574

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLA--------EMTKGE-----  462
                         DP ++++  +L +D S  GWA+F++ L         EM   E     
Sbjct  575  -------------DPTMKEIMKMLIFD-SESGWAIFTQRLKKDQGMKDNEMKDNEMKENV  620

Query  461  ----------------GSNVVKVLNNFDSWRHEVTDENAFIPALDKQLRG--LYTKHHCT  336
                            G+ ++  L N+  W+  +  +  F+ AL  +++      K HC 
Sbjct  621  MKGKEMKDSEIRVEAKGNIILTCLENYSRWKDLIQKKGGFVQALRGEIQKEVKAAKSHCN  680

Query  335  RMVVPAAVGHYPETVACVECGRSMEKFFMYSCC  237
            R+ +P   G  P+ + C +C ++MEK  MY CC
Sbjct  681  RLALPNDEGKLPQKIVCADCPKNMEKMIMYRCC  713



>ref|XP_010029073.1| PREDICTED: uncharacterized protein LOC104419196 [Eucalyptus grandis]
 gb|KCW55917.1| hypothetical protein EUGRSUZ_I01715 [Eucalyptus grandis]
Length=721

 Score =   112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 92/185 (50%), Gaps = 14/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + +E+++R   TI  E LS    D  M+WFFW RLESM F K +  L   D
Sbjct  544  LEMVYVGKNSKREKVRRVIETINFEKLSHTWVDLAMVWFFWTRLESMLFSKIQ--LGKVD  601

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D ++QQ+K +LS+D    GWA+ S+G +    G G+ V+  L  +D 
Sbjct  602  ES-----------DDLMQQIKRLLSFDKVG-GWAILSKGSSITVNGHGTTVLPTLLEYDL  649

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            WR  V  +   +   +   +     H C R    +  G  PE++ C EC R MEK   + 
Sbjct  650  WREHVPTKGYDVAFKEHHDKIHDITHPCCRFEFQSTAGRIPESMRCPECQRKMEKLTTFV  709

Query  242  CCLDE  228
            CC DE
Sbjct  710  CCHDE  714



>emb|CAN62582.1| hypothetical protein VITISV_034667 [Vitis vinifera]
Length=802

 Score =   112 bits (280),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 93/190 (49%), Gaps = 24/190 (13%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK   +E++++ +  I  E LS    D  M+WFFW RLESM F K      +Q 
Sbjct  625  LEMVYVGKSKKREQVRKCTTAITLEKLSYCWPDLAMVWFFWIRLESMMFSK------IQL  678

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
              T          DP+L+++K +LSYD    GWAV S+G      G  S V+     +++
Sbjct  679  GSTVDV-------DPMLREIKKLLSYDKEG-GWAVLSKGSFVFVNGHSSTVLPTFTEYNA  730

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHH-----CTRMVVPAAVGHYPETVACVECGRSMEK  258
            W+ +V  +       D+     + K H     C R   P+  G  PE + C EC R MEK
Sbjct  731  WKDDVPPK-----GFDRACMDFHNKLHGESQPCCRFEFPSEFGRIPENIKCPECLRIMEK  785

Query  257  FFMYSCCLDE  228
            +  + CC DE
Sbjct  786  YITFGCCHDE  795



>gb|KCW55914.1| hypothetical protein EUGRSUZ_I01712 [Eucalyptus grandis]
Length=449

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 96/182 (53%), Gaps = 14/182 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + +E+++R   TI +E LSS  QD T++W+FW RLESM+F K    + +  
Sbjct  272  LEMVYVGKSSKREQVQRAIDTINDEKLSSTWQDLTLVWYFWTRLESMFFSK----IQLGK  327

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
             D    +I         QQ+K +LS+D +  GWA+ S+G + +  G  + V+  L  +D 
Sbjct  328  VDEHGLLI---------QQLKRLLSFDKAG-GWAILSKGSSIVVNGHRNTVLPALLEYDL  377

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  V  +   +   +   +     H C R    +A G  PE++ C EC R MEK   + 
Sbjct  378  WKEHVPTKGYDVAFKEHYEKIRDVAHPCCRFEFQSAGGRIPESLRCPECQRLMEKLTTFV  437

Query  242  CC  237
            CC
Sbjct  438  CC  439



>ref|XP_002526959.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35446.1| conserved hypothetical protein [Ricinus communis]
Length=718

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 97/186 (52%), Gaps = 17/186 (9%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + +++++     I  E LS    DPTMIWFFW R+ESM F K +  L   D
Sbjct  542  LEMVYAGKSSKRDKVQSIIAAIPVEKLSQ-YWDPTMIWFFWTRVESMLFSKIQ--LGKID  598

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         DP++Q++K +LSYD    GWAV SRG   +  G  S ++  +  +D 
Sbjct  599  ET-----------DPMMQEIKKLLSYDKEG-GWAVLSRGSNVVVNGYSSTMLLTMIEYDL  646

Query  422  WRHEVTDENAFIPALDKQLRGLY-TKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
            W+ +V   N F  +  +    L+   H C R+   +  G  PE + C EC RSMEK+  +
Sbjct  647  WKDKVP-VNGFDLSFKEHHNKLHDLAHPCCRLEFHSTTGRIPERLKCPECLRSMEKYITF  705

Query  245  SCCLDE  228
             CC +E
Sbjct  706  RCCHEE  711



>ref|XP_003633839.2| PREDICTED: uncharacterized protein LOC100254392 [Vitis vinifera]
Length=766

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 92/190 (48%), Gaps = 24/190 (13%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y G    +E++++ +  I  E LS    D  M+WFFW RLESM F K      +Q 
Sbjct  589  LEMVYVGNSKKREQVRKCTTAITLEKLSYCWPDLAMVWFFWIRLESMMFSK------IQL  642

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
              T          DP+L+++K +LSYD    GWAV S+G      G  S V+     +++
Sbjct  643  GSTVDV-------DPMLREIKKLLSYDKEG-GWAVLSKGSFVFVNGHSSTVLPTFTEYNA  694

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHH-----CTRMVVPAAVGHYPETVACVECGRSMEK  258
            W+ +V  +       D+     + K H     C R   P+  G  PE + C EC R MEK
Sbjct  695  WKDDVPPK-----GFDRACMDFHNKLHGESQPCCRFEFPSEFGRIPENIKCPECLRIMEK  749

Query  257  FFMYSCCLDE  228
            +  + CC DE
Sbjct  750  YITFGCCHDE  759



>ref|XP_010029068.1| PREDICTED: uncharacterized protein LOC104419192 [Eucalyptus grandis]
Length=722

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 96/182 (53%), Gaps = 14/182 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + +E+++R   TI +E LSS  QD T++W+FW RLESM+F K    + +  
Sbjct  545  LEMVYVGKSSKREQVQRAIDTINDEKLSSTWQDLTLVWYFWTRLESMFFSK----IQLGK  600

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
             D    +I         QQ+K +LS+D +  GWA+ S+G + +  G  + V+  L  +D 
Sbjct  601  VDEHGLLI---------QQLKRLLSFDKAG-GWAILSKGSSIVVNGHRNTVLPALLEYDL  650

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  V  +   +   +   +     H C R    +A G  PE++ C EC R MEK   + 
Sbjct  651  WKEHVPTKGYDVAFKEHYEKIRDVAHPCCRFEFQSAGGRIPESLRCPECQRLMEKLTTFV  710

Query  242  CC  237
            CC
Sbjct  711  CC  712



>ref|XP_002526960.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35447.1| conserved hypothetical protein [Ricinus communis]
Length=685

 Score =   108 bits (270),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 96/189 (51%), Gaps = 25/189 (13%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            +EM+Y GK   K+++++ + TI +E L     DPTMIWFFW RL+SM F K +    + +
Sbjct  516  VEMVYLGKSYKKDKVRKIAKTITDEKLGHSW-DPTMIWFFWTRLDSMLFSKIQ-LRKIDE  573

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
            NDT T+            ++K ++SYD    GWA+ S+G   +  G  + V++ L  +D 
Sbjct  574  NDTLTH------------EIKKLISYD-KEMGWALLSKGPNIVVNGHSTTVLRALTEYDK  620

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHH-----CTRMVVPAAVGHYPETVACVECGRSMEK  258
            W+     EN  +   D   +  + K       C R   P+  G  PE + C EC RSMEK
Sbjct  621  WK-----ENVPVKGFDLSFKEHHDKLQNTNGPCCRFEFPSTFGEIPEHLKCPECLRSMEK  675

Query  257  FFMYSCCLD  231
               + CC D
Sbjct  676  HMAFRCCHD  684



>ref|XP_010030737.1| PREDICTED: uncharacterized protein LOC104420628 [Eucalyptus grandis]
Length=667

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 93/185 (50%), Gaps = 14/185 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK   +E+ +    TI  E LS   QDPTM+W FW RLESM F           
Sbjct  490  LEMVYVGKSTKREQAQHVITTINNEKLSHTWQDPTMVWLFWTRLESMLF-----------  538

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
              ++  +   +  +P++QQ+K +LS+D +  GWA+ SRG      G G+ V+  L  +D 
Sbjct  539  --SKIQLGKVDEHNPMMQQIKRLLSFDKAG-GWAMLSRGSTITMDGHGTTVLPALLEYDL  595

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYS  243
            W+  V  +   +   +   +   + H C R+ + + VG  P ++ C +C   ME+   + 
Sbjct  596  WKENVATKGYGMAFKEHHDKIQDSMHLCCRLDLQSTVGEIPASMRCPDCQSLMEELTTFF  655

Query  242  CCLDE  228
            C  DE
Sbjct  656  CRHDE  660



>ref|XP_010040606.1| PREDICTED: uncharacterized protein LOC104429454 [Eucalyptus grandis]
Length=394

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 92/190 (48%), Gaps = 25/190 (13%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M+Y G  N  ER++  +  I+ E LS    D T  WFFW RLESM + K ++ ++ + 
Sbjct  226  LGMIYVGMSNAMERVQTTAAAIRTESLSDCWGDIT-CWFFWGRLESMLYSKLQQGMSTE-  283

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLA-EMTKGEGSNVVKVLNNFD  426
                         DP+L ++  ILSYD S++GWA+F  G    M + +G  V++ +  FD
Sbjct  284  ------------TDPVLDEIMTILSYDASDQGWALFCHGPGPPMARAKGVEVLQSMEEFD  331

Query  425  SWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEK--FF  252
             W+    D+  F+ AL   LR          +  P A       + C ECGR+ E   F 
Sbjct  332  KWKGN-ADQKGFVYALQDHLRQ-------KELETPQARSGISMMIVCAECGRAHEATLFK  383

Query  251  MYSCCLDEYE  222
             YSCC +  E
Sbjct  384  TYSCCTEYAE  393



>ref|XP_008239606.1| PREDICTED: uncharacterized protein LOC103338199 [Prunus mume]
Length=557

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 88/187 (47%), Gaps = 45/187 (24%)
 Frame = -3

Query  782  LEMLYXGKMNV-KERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            LE+LY G+    +ERI++ +  I+ E LS    D T  WFFW R++SM   K +    ++
Sbjct  413  LELLYVGRSTATRERIRKVNKVIETENLSRFWPDYTSNWFFWSRMDSMRCSKAKHHKTVE  472

Query  605  DNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFD  426
            +             D IL++V  +LSYDGS++GW +  RG  E  +  G           
Sbjct  473  N-------------DEILKEVMTLLSYDGSDQGWVMVWRGSNETARANG-----------  508

Query  425  SWRHEVTDENAFIPALDKQLRGL--YTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
                              QL  +  +T HHC R+++P      P+ V C ECGR MEKF 
Sbjct  509  ------------------QLTSIQRHTPHHCIRLIIPGFGPDIPDRVECSECGREMEKFI  550

Query  251  MYSCCLD  231
            +Y CC D
Sbjct  551  IYRCCHD  557



>ref|XP_011040448.1| PREDICTED: uncharacterized protein LOC105136707 [Populus euphratica]
Length=733

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 97/186 (52%), Gaps = 19/186 (10%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
             E++Y GK N  + ++    TI+EE LS    D + IWFFW RLESM +LK ++   +++
Sbjct  566  FELVYVGKKNAIKEVENIIKTIEEENLSRCWNDLSSIWFFWTRLESMLYLKMQQCKNLKN  625

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+Q+V  +LSYD S+RGWA+F +G +EM   +G   +K +  F  
Sbjct  626  -------------DRIMQEVTTLLSYDDSDRGWALFCKGSSEMALAQGDVALKSIKEFS-  671

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYP-ETVACVECGRSMEKFFMY  246
               E  D + F  AL   ++       C+R+++       P + ++   C  S+EK F+Y
Sbjct  672  ---ERKDADLF-QALSNYIKKSQKIQRCSRIILSGNRQEIPSKKLSSDGCECSIEKSFVY  727

Query  245  SCCLDE  228
             CC D+
Sbjct  728  RCCADK  733



>ref|NP_001239838.1| uncharacterized protein LOC100801064 [Glycine max]
 gb|ADN32797.1| sieve element occlusion m [Glycine max]
Length=727

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 97/191 (51%), Gaps = 24/191 (13%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSS-ILQDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            LEM+Y GK N +E++++   TI  + L++    + +MIWFFW RL+SM F K +  L   
Sbjct  539  LEMVYVGKSNKREQVQKIIDTIIRDKLNTQYWSEQSMIWFFWTRLQSMLFSKLQ--LKQT  596

Query  605  DNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFD  426
            D+D           D ++Q++K +LSYD    GW V +RG   +  G  +  ++ L  +D
Sbjct  597  DDD-----------DHVMQEIKKLLSYDKQG-GWIVLARGSHIVVNGHATTGLQTLVEYD  644

Query  425  SWRHEVTDENAFIPALDKQLRGLYTKHH-----CTRMVVPAAVGHYPETVACVECGRSME  261
            +   E+ D + F PA     +  Y K H     C R     ++G  PE + C EC R+M 
Sbjct  645  AVWKELADRDGFEPAF----KNHYDKVHSIVSPCCRFEFSHSMGRIPERLTCPECRRNMH  700

Query  260  KFFMYSCCLDE  228
                + CC DE
Sbjct  701  VLTTFQCCHDE  711



>gb|KHN27576.1| hypothetical protein glysoja_018688 [Glycine soja]
Length=727

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 96/187 (51%), Gaps = 16/187 (9%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSS-ILQDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            LEM+Y GK N +E++++   TI  + L++    + +MIWFFW RL+SM F K +  L   
Sbjct  539  LEMVYVGKSNKREQVQKIIDTIIRDKLNTQYWSEQSMIWFFWTRLQSMLFSKLQ--LKQT  596

Query  605  DNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFD  426
            D+D           D ++Q++K +LSYD    GW V +RG   +  G  +  ++ L  +D
Sbjct  597  DDD-----------DHVMQEIKKLLSYDKQG-GWIVLARGSHIVVNGHATTGLQTLVEYD  644

Query  425  SWRHEVTDENAFIPALDKQLRGLYT-KHHCTRMVVPAAVGHYPETVACVECGRSMEKFFM  249
            +   E+ D + F PA       +++    C R     ++G  PE + C EC R+M     
Sbjct  645  AVWKELADRDGFEPAFKNHYDMVHSIVSPCCRFEFSHSMGRIPERLTCPECRRNMHVLTT  704

Query  248  YSCCLDE  228
            + CC DE
Sbjct  705  FQCCHDE  711



>ref|XP_006446667.1| hypothetical protein CICLE_v10015478mg [Citrus clementina]
 gb|ESR59907.1| hypothetical protein CICLE_v10015478mg [Citrus clementina]
Length=403

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 79/135 (59%), Gaps = 15/135 (11%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M+Y GK N K+R++RN+ TI  E LS I QD T IW+FW RLESMW+           
Sbjct  283  LGMVYVGKSNPKDRVRRNNDTIASENLSHIWQDLTSIWYFWVRLESMWY-----------  331

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
              ++  +      D ++Q++  +L+YD S  GWAVF+RG AEM   +G+  +  +  +++
Sbjct  332  --SKVQLGRNAETDHVMQEIMRMLTYDSSEGGWAVFARGSAEMASAKGAIFLTCMQEYNT  389

Query  422  -WRHEVTDENAFIPA  381
             W+ +V +   F+PA
Sbjct  390  VWKDQV-EPKGFMPA  403



>ref|XP_010694662.1| PREDICTED: uncharacterized protein LOC104907427 [Beta vulgaris 
subsp. vulgaris]
Length=819

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 94/186 (51%), Gaps = 15/186 (8%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            +EM+Y G+ + KE +++    I  E LS   QDPT +W+FW R+ESM F K +       
Sbjct  632  MEMVYVGRSHNKELVRKVGEAIMVEQLSHCWQDPTQVWYFWTRIESMIFSKIQLGRVHDH  691

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
             D             ILQ+++ I S+D S+ GWA+ ++G   M  G+G  V+  L   + 
Sbjct  692  GDV------------ILQEIQRIHSHDKSHGGWAILAKGSTIMVHGQGKLVLFTLQELEL  739

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHH-CTRMVVPAAVGHYPETVACVECGRSMEKFFMY  246
            W+ +  + + F        R L+ K   C R+  PA +   P+++ C +C R M+ F  +
Sbjct  740  WKEKALN-DGFEVGYGNHYRELHRKEFPCHRIEFPATI-RVPQSMLCPDCRRHMKNFNSF  797

Query  245  SCCLDE  228
             CC ++
Sbjct  798  ICCHED  803



>ref|XP_006299972.1| hypothetical protein CARUB_v10016185mg [Capsella rubella]
 gb|EOA32870.1| hypothetical protein CARUB_v10016185mg [Capsella rubella]
Length=1488

 Score =   100 bits (249),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 86/187 (46%), Gaps = 38/187 (20%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N K  I+    TI++E LS  L D   IWFFW R+ESMW  K ++ L  + 
Sbjct  615  LEMVYVGKRNPKNGIQPIINTIRDENLSHTLPDLFQIWFFWTRIESMWESK-QRMLKARG  673

Query  602  NDTRTYI---IPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNN  432
               R      + EE +D +LQ+V A+L Y G                             
Sbjct  674  AKGREGFKDGLKEEEKDHVLQEVVAMLGYGGE----------------------------  705

Query  431  FDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFF  252
                         F+PAL+  L      HHCTR ++P   G  P  V C EC R+MEK++
Sbjct  706  ------GDGWGLGFLPALNDHLLMRLPPHHCTRFMLPETSGIIPNEVECTECRRTMEKYY  759

Query  251  MYSCCLD  231
            +Y CCLD
Sbjct  760  LYQCCLD  766


 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 98/218 (45%), Gaps = 47/218 (22%)
 Frame = -3

Query  782   LEMLYXGKMNV--KERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAM  609
             LEM Y GK N   +E+I+R    I+ E LS    +P ++WFFW RLESM + K +   A 
Sbjct  1302  LEMAYVGKRNHSHREQIRRIGEVIRSENLSHSWAEPPLMWFFWTRLESMLYSKIQLGKA-  1360

Query  608   QDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNF  429
                         +  D ++Q +K ILSYD    GWA+ S+G   +    G+ + + +  +
Sbjct  1361  ------------DDHDEVMQGIKKILSYDKLG-GWALLSKGPEIIMIVHGA-IERTMTVY  1406

Query  428   D-SWRHEVTDENAFIPALDKQLRGLYTKHH----------CTR--MVVPAAVGHYPETVA  288
             D +W+  V  +           + +Y  HH          C      + A  G  PE + 
Sbjct  1407  DRTWKTHVPTKG--------YTKAMYDHHHDEVLRETGKPCGHFDFHITARSGRIPEKMN  1458

Query  287   CVECGRSMEKFFMYSCCLDEYEN*ILPQIKCHPDRSAN  174
             C EC R MEK+  ++CC DE         K H D + N
Sbjct  1459  CFECQRPMEKYMSFACCHDE---------KLHEDENYN  1487



>ref|XP_006376885.1| hypothetical protein POPTR_0012s09220g [Populus trichocarpa]
 gb|ERP54682.1| hypothetical protein POPTR_0012s09220g [Populus trichocarpa]
Length=733

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 97/186 (52%), Gaps = 19/186 (10%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
             E++Y GK N  + ++    TI +E LS    D + IWFFW RLESM +LK ++   +++
Sbjct  566  FELVYVGKNNAIKEVENIIKTIDDENLSRYWNDLSSIWFFWTRLESMLYLKMQQCKNLKN  625

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+Q+V  +LSYD S+RGWA+F +G +EM   +G   +K +  F +
Sbjct  626  -------------DRIMQEVTTLLSYDDSDRGWALFCKG-SEMALAQGDVALKSMKEFST  671

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYP-ETVACVECGRSMEKFFMY  246
             R    D + F  A+   ++       C+R+++       P + ++   C  SMEK F+Y
Sbjct  672  ERK---DADLF-QAVSNYIKKSQKIQRCSRIILSGDRQEIPSKKLSSDGCECSMEKCFVY  727

Query  245  SCCLDE  228
             CC D+
Sbjct  728  RCCADK  733



>ref|XP_010087773.1| hypothetical protein L484_016343 [Morus notabilis]
 gb|EXB29854.1| hypothetical protein L484_016343 [Morus notabilis]
Length=686

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/151 (30%), Positives = 80/151 (53%), Gaps = 17/151 (11%)
 Frame = -3

Query  689  QDPTMIWFFWERLESMWFLKGEKTLAMQDNDTRTYIIPEESRDPILQQVKAILSYDGSNR  510
            +D  ++  FW  +ES++F K                + ++  DP+ Q+++ +LSY   + 
Sbjct  543  EDLGILGRFWTSIESLFFTK----------------VHQQKADPVTQEIQKLLSYKNES-  585

Query  509  GWAVFSRGLAEMTKGEGSNVVKVLNNFDSWRHEVTDENAFIPALDKQLRGLYTKHHCTRM  330
            GWAV S+G + +  G G  +++V+  FD W+  V D+   +  ++   + + +  HC R+
Sbjct  586  GWAVLSKGQSVIVAGHGFTILRVVEEFDKWKEFVKDKGFEVVFMEHHSKVIQSVRHCCRL  645

Query  329  VVPAAVGHYPETVACVECGRSMEKFFMYSCC  237
             +P+  G  PET+ C EC R+ME F  Y CC
Sbjct  646  DIPSVTGKVPETMQCPECPRTMETFIAYKCC  676



>ref|XP_010694661.1| PREDICTED: uncharacterized protein LOC104907426 [Beta vulgaris 
subsp. vulgaris]
Length=759

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 95/188 (51%), Gaps = 17/188 (9%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            +EM+Y G+ + KE +++    I  E LS   QDPTM+W+FW R+ESM F K +       
Sbjct  564  IEMVYVGRSHNKELVRKVCAAIIVEQLSHCWQDPTMVWYFWTRIESMIFSKFQLEKVHDH  623

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
             D             ILQ+++ + S+D S+ GWA+ ++G   +  G+G   +  L   + 
Sbjct  624  GDI------------ILQEIQRLHSHDKSHAGWAILAKGSTIVVHGQGKLALTTLQEMEI  671

Query  422  WR-HEVTDENAFIPALDKQLRGLYTKHH-CTRMVVPAAVGHYPETVACVECGRSMEKFFM  249
            W+ H + D   F        R L+ + + C R+  P+ V   P ++ C EC R M ++  
Sbjct  672  WKEHALRD--GFETGYGSHYRELHMREYPCHRIEFPSNV-RIPNSMLCPECRRHMHRYNS  728

Query  248  YSCCLDEY  225
            + CC +++
Sbjct  729  FICCHEDF  736



>ref|XP_009628800.1| PREDICTED: uncharacterized protein LOC104119093 [Nicotiana tomentosiformis]
Length=678

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 81/144 (56%), Gaps = 14/144 (10%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M+Y GK N KER+++ +  +  E LS  L D T +W+FW R+ESM++ K +    +Q+
Sbjct  548  LLMMYVGKSNNKERVQKINDMVTAENLSYCLMDLTSVWYFWTRIESMFYSKMQLGKTIQE  607

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                         D I+Q V  +LS+DGS++GWA+ SRG  EM + +   + K L+++  
Sbjct  608  -------------DKIMQDVLTMLSFDGSDQGWALISRGSFEMARAKSVIITKTLDDYTV  654

Query  422  WRHEVTDENAFIPALDKQLRGLYT  351
            W  +   E  F+PAL    + L+T
Sbjct  655  WEKD-AREKGFVPALIDYYQQLHT  677



>ref|XP_007140863.1| hypothetical protein PHAVU_008G147900g [Phaseolus vulgaris]
 gb|ESW12857.1| hypothetical protein PHAVU_008G147900g [Phaseolus vulgaris]
Length=727

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 94/191 (49%), Gaps = 24/191 (13%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSS-ILQDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            LEM+Y GK N +E++++   TI  + L++    + +MIWFFW RL+SM F K +  L   
Sbjct  539  LEMVYVGKSNKREQVQKIIDTIIRDKLNTQYWSEQSMIWFFWTRLQSMLFSKLQ--LKQS  596

Query  605  DNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFD  426
            D+D           D ++Q++K +LSYD    GW V +RG   +  G  +   + L  +D
Sbjct  597  DDD-----------DHVMQEIKKLLSYDKQG-GWIVLARGSHIVVNGHATTGFQTLVEYD  644

Query  425  SWRHEVTDENAFIPALDKQLRGLYTKHH-----CTRMVVPAAVGHYPETVACVECGRSME  261
            +   +  D   F    +   +  Y K H     C+R     A+G  PE + C EC R+M 
Sbjct  645  AVWKDHADREGF----ESAFKNHYDKVHSVVSPCSRFEFSHAMGRIPERLTCPECRRNMH  700

Query  260  KFFMYSCCLDE  228
                + CC DE
Sbjct  701  VLTTFQCCHDE  711



>emb|CAN65453.1| hypothetical protein VITISV_003897 [Vitis vinifera]
Length=689

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 84/161 (52%), Gaps = 14/161 (9%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK N KE +  N  TI E+ LS  L+  T IW+FW R+ESM + K      ++ 
Sbjct  514  LEMVYVGKSNPKELVYTNIKTIIEDKLSHHLKGLTSIWYFWVRIESMLYSKMRLGQTVE-  572

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDS  423
                        +DP +Q++  +LS+D S+ G A+ S+G  E+TK +G + +  L  ++ 
Sbjct  573  ------------KDPTMQEILKMLSFDNSHEGXALLSKGSEEITKAKGDSFLTCLRQYNQ  620

Query  422  WRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYP  300
            W   V  +  F+ AL   L  ++  HHC +  +  A G  P
Sbjct  621  WEVHV-QKKGFLQALKDHLLQIHPPHHCNQFELLVAAGMIP  660



>ref|XP_010268430.1| PREDICTED: uncharacterized protein LOC104605382 [Nelumbo nucifera]
Length=676

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 99/189 (52%), Gaps = 19/189 (10%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            +E +Y G    KER+++    I+ E LS +  + T I  FW R+E++ + K     A  +
Sbjct  502  METIYVGTKRRKERLQKILNCIRNEKLSRVWDEKT-IGSFWHRIENISYSKMAHCNAYLE  560

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEM--TKGEGSNVVKVLNNF  429
                         D I++++  I SYD +  GWA+   G +++   +  G  +  ++ +F
Sbjct  561  -------------DAIMKELMIISSYDDNEDGWALMLGGSSDLKTVRFSGRQLSLLIKDF  607

Query  428  DSW-RHEVTDENAFIPALDKQLRGLYT-KHHCTRMVVP-AAVGHYPETVACVECGRSMEK  258
            + W    +     F+ AL++ +RG +T + HC R++VP  A  + PETV C EC RSMEK
Sbjct  608  EKWGSRAIGGHEDFLTALNEYVRGSHTCRAHCIRLIVPMGAANNIPETVKCSECDRSMEK  667

Query  257  FFMYSCCLD  231
            + +Y CC +
Sbjct  668  YLLYKCCTE  676



>ref|XP_004516128.1| PREDICTED: uncharacterized protein LOC101508220 [Cicer arietinum]
Length=729

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 94/187 (50%), Gaps = 16/187 (9%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGL-SSILQDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            LEM+Y GK N +E+++R   TI  E L S    + +MIWFFW RL+SM F K +    + 
Sbjct  541  LEMVYLGKSNKREQVQRVVDTIIRENLYSHSWSEQSMIWFFWTRLQSMLFSKIQLK-QVD  599

Query  605  DNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFD  426
            DND             ++Q++K +LSYD    GW V +RG   +  G  +  ++ L  ++
Sbjct  600  DNDI------------VMQEIKKLLSYDKQG-GWFVLARGSQIVVNGHAATGLQALVEYE  646

Query  425  SWRHEVTDENAFIPALDKQLRGLYT-KHHCTRMVVPAAVGHYPETVACVECGRSMEKFFM  249
                +  D + F PA  +    L++  + C R     ++G  P+ + C EC R+M     
Sbjct  647  LKWKQHADRDGFEPAFKEYYGKLHSVANPCCRFEFSHSMGRIPDRLTCPECRRNMHVLTT  706

Query  248  YSCCLDE  228
            + CC D+
Sbjct  707  FQCCHDD  713



>ref|XP_002526961.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35448.1| conserved hypothetical protein [Ricinus communis]
Length=677

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 92/190 (48%), Gaps = 25/190 (13%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSIL-QDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            LE++Y G  + +++IK+   +I+++ L++    D T IW+FW RLESM F K +     +
Sbjct  496  LELVYVGNRSKRDKIKQIIDSIEKDKLNTYFWHDLTAIWYFWTRLESMLFCKIQLGNKFE  555

Query  605  DNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFD  426
            +ND             I+Q++K +LSY+   R WA+ +RG   M  G G+ V+  L  +D
Sbjct  556  ENDG------------IMQELKKLLSYEKEGR-WAMLTRGSNIMVNGAGAKVLHALTEYD  602

Query  425  SWRHEVTDENAFIPALDKQLRGLYTK-------HHCTRMVVPAAVGHYPETVACVECGRS  267
                 + D N+         +  Y K       H C R   P A   +P+   C EC R 
Sbjct  603  P----LNDLNSPNQDFGLSFKDHYNKINTGTSVHSCCRFSFPTAARRFPKRTTCPECHRI  658

Query  266  MEKFFMYSCC  237
            M K  + SCC
Sbjct  659  MAKQIVLSCC  668



>ref|XP_002884266.1| hypothetical protein ARALYDRAFT_477347 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60525.1| hypothetical protein ARALYDRAFT_477347 [Arabidopsis lyrata subsp. 
lyrata]
Length=740

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/218 (32%), Positives = 101/218 (46%), Gaps = 47/218 (22%)
 Frame = -3

Query  782  LEMLYXGKMNV--KERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAM  609
            LEM Y GK N   +E+I+R S  I+ E LS    +P ++WFFW RLESM + K +   A 
Sbjct  554  LEMAYVGKRNHSHREQIRRISEAIRSENLSHSWAEPALMWFFWTRLESMLYSKIQLGKA-  612

Query  608  QDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNF  429
                        + +D ++Q +K ILSYD    GWA+ S+G   +    G+ V + ++ +
Sbjct  613  ------------DDQDDVMQGIKKILSYDKVG-GWALLSKGPEIVMIAHGA-VERTMSAY  658

Query  428  D-SWRHEVTDENAFIPALDKQLRGLYTKHH----------CTR--MVVPAAVGHYPETVA  288
            D +W+  V  +           + +Y  HH          C      + A  G  PE + 
Sbjct  659  DRTWKTHVPTKG--------YTKAMYDHHHDEVLRETGKPCGHFDFHITARSGQIPEKMM  710

Query  287  CVECGRSMEKFFMYSCCLDEYEN*ILPQIKCHPDRSAN  174
            C EC R MEK+  +SCC DE         K H D + N
Sbjct  711  CFECQRPMEKYMSFSCCHDE---------KLHEDENYN  739



>emb|CDY17992.1| BnaC03g30640D [Brassica napus]
Length=354

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 93/193 (48%), Gaps = 24/193 (12%)
 Frame = -3

Query  782  LEMLYXGKMNV--KERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAM  609
            LEM Y GK N   +E+I+R S  ++ E LS    +P ++WFFW RLESM + K +  L  
Sbjct  167  LEMAYVGKRNHSHREQIRRISEAVRAENLSHSWAEPALMWFFWARLESMLYSKIQ--LGK  224

Query  608  QDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRG--LAEMTKGEGSNVVKVLN  435
             D+            D ++Q +K ILSYD    GWA+ S+G  +  +T G     V V +
Sbjct  225  SDD-----------HDEVMQGIKKILSYDKLG-GWALLSKGAEIVMITHGVIERTVTVYD  272

Query  434  NFDSWRHEVTDENAFIPALDKQLRGLY--TKHHCTR--MVVPAAVGHYPETVACVECGRS  267
               +W+  V  +       D     +   T H C      + A  G  PE + C EC R 
Sbjct  273  R--TWKTHVPTKGYSKAMYDHHHDEVLRETGHPCAHFDFHITARSGRIPEKMNCFECHRP  330

Query  266  MEKFFMYSCCLDE  228
            MEK+  ++CC DE
Sbjct  331  MEKYMSFACCHDE  343



>emb|CBI16824.3| unnamed protein product [Vitis vinifera]
Length=650

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 64/103 (62%), Gaps = 20/103 (19%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLK----GEKTL  615
            LEMLY GK N++E++++N+ +I +E LS +L D + +WFFW RLESMW  K    GE   
Sbjct  539  LEMLYVGKSNLREKVRKNNDSIAQENLSHVLPDLSSVWFFWARLESMWHSKVQHGGENA-  597

Query  614  AMQDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRG  486
                            RDPI+Q++ ++LS+DG + GWAVF RG
Sbjct  598  ---------------ERDPIMQEIVSMLSFDGGDHGWAVFGRG  625



>gb|KDP46380.1| hypothetical protein JCGZ_10220 [Jatropha curcas]
Length=779

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 92/184 (50%), Gaps = 16/184 (9%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            ++MLY G  N+ +R   N   I EE LS   ++  +IW FW RL+S+W    +   +M+D
Sbjct  607  VQMLYVGMSNLNKRCSSNIVKITEEELSHCWKERVLIWSFWSRLQSIWHTGYQIGKSMKD  666

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGL--AEMTKGEGSNVVKVLNNF  429
                         DPI++++  +LS+D    GWA+ S+G     +   +GS++++ L  +
Sbjct  667  -------------DPIMKELTTLLSFDSRECGWALMSKGSGPGALVTAKGSDILECLLKY  713

Query  428  DSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFM  249
            +    E   +N F+P L ++L   +    C ++V+P       ET  C  C  ++EK   
Sbjct  714  EEEWKEQALKNGFLPTLKEKLVDYHKLDKCFQLVLPEFATTNLETAECSHCRGTVEK-LT  772

Query  248  YSCC  237
            + CC
Sbjct  773  FQCC  776


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 73/143 (51%), Gaps = 20/143 (14%)
 Frame = -3

Query  782  LEMLYXGKMNV-KERIKRNSGTIQEEGLS---SILQDPTMIWFFWERLESMWFLKGEKTL  615
            LEM+Y GK    K+R +RN+ TI+ E L    S+ ++  M   FW+RLE+M    G   +
Sbjct  232  LEMIYLGKWKPNKQRQRRNTATIEREDLKLKYSLTEEKQM--KFWKRLENM----GHSRM  285

Query  614  AMQDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLN  435
             +     R Y       D I+Q + ++L+   S  GWAV  RG     K +G +++  L 
Sbjct  286  QL---GKRIY------EDLIMQDIISLLNMGSSRGGWAVICRGSDFRIKAKGKHILDSLV  336

Query  434  NFDSWRHEVTDENAFIPALDKQL  366
            NF  W+  +  ++ F+ AL+  L
Sbjct  337  NFCEWKDNIRRQD-FLGALEHYL  358



>ref|XP_009124045.1| PREDICTED: uncharacterized protein LOC103848961 isoform X2 [Brassica 
rapa]
Length=739

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 98/196 (50%), Gaps = 30/196 (15%)
 Frame = -3

Query  782  LEMLYXGKMNV--KERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAM  609
            LEM Y GK N   +E+I+R S  ++ E LS    +P ++WFFW RLESM + K +  L  
Sbjct  552  LEMAYVGKRNHSHREQIRRISEAVRAENLSHSWAEPALMWFFWARLESMLYSKIQ--LGK  609

Query  608  QDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRG--LAEMTKGEGSNVVKVLN  435
             D+            D ++Q +K ILSYD    GWA+ S+G  +  +T G     V V +
Sbjct  610  SDD-----------HDEVMQGIKKILSYDKLG-GWALLSKGAEIVMITHGVIERTVTVYD  657

Query  434  NFDSWRHEVTDENAFIPAL-----DKQLRGLYTKHHCTR--MVVPAAVGHYPETVACVEC  276
               +W+  V  +  +  A+     D+ LR   T H C      + A  G  PE + C EC
Sbjct  658  R--TWKTHVPTK-GYSKAMYDHHHDEVLRE--TGHPCAHFDFHITARSGRIPEKMNCFEC  712

Query  275  GRSMEKFFMYSCCLDE  228
             R MEK+  ++CC DE
Sbjct  713  HRPMEKYMSFACCHDE  728



>emb|CDY37506.1| BnaA05g33710D [Brassica napus]
Length=739

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 99/195 (51%), Gaps = 28/195 (14%)
 Frame = -3

Query  782  LEMLYXGKMNV--KERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAM  609
            LEM Y GK N   +E+I+R S  ++ E LS    +P ++WFFW RLESM + K +  L  
Sbjct  552  LEMAYVGKRNHSHREQIRRISEAVRAENLSHSWAEPALMWFFWARLESMLYSKIQ--LGK  609

Query  608  QDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNF  429
             D+            D ++Q +K ILSYD    GWA+ S+G AE+       + + +  +
Sbjct  610  SDD-----------HDEVMQGIKKILSYDKLG-GWALLSKG-AEIVMITHGVIERTVTVY  656

Query  428  D-SWRHEVTDENAFIPAL-----DKQLRGLYTKHHCTR--MVVPAAVGHYPETVACVECG  273
            D +W+  V  +  +  A+     D+ LR   T H C      + A  G  PE + C EC 
Sbjct  657  DRTWKTHVPTK-GYSKAMYDHHHDEVLRE--TGHPCAHFDFHITARSGRIPEKMNCFECH  713

Query  272  RSMEKFFMYSCCLDE  228
            R MEK+  ++CC DE
Sbjct  714  RPMEKYMSFACCHDE  728



>ref|XP_009124044.1| PREDICTED: uncharacterized protein LOC103848961 isoform X1 [Brassica 
rapa]
Length=741

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 99/195 (51%), Gaps = 28/195 (14%)
 Frame = -3

Query  782  LEMLYXGKMNV--KERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAM  609
            LEM Y GK N   +E+I+R S  ++ E LS    +P ++WFFW RLESM + K +  L  
Sbjct  554  LEMAYVGKRNHSHREQIRRISEAVRAENLSHSWAEPALMWFFWARLESMLYSKIQ--LGK  611

Query  608  QDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNF  429
             D+            D ++Q +K ILSYD    GWA+ S+G AE+       + + +  +
Sbjct  612  SDD-----------HDEVMQGIKKILSYDKLG-GWALLSKG-AEIVMITHGVIERTVTVY  658

Query  428  D-SWRHEVTDENAFIPAL-----DKQLRGLYTKHHCTR--MVVPAAVGHYPETVACVECG  273
            D +W+  V  +  +  A+     D+ LR   T H C      + A  G  PE + C EC 
Sbjct  659  DRTWKTHVPTK-GYSKAMYDHHHDEVLRE--TGHPCAHFDFHITARSGRIPEKMNCFECH  715

Query  272  RSMEKFFMYSCCLDE  228
            R MEK+  ++CC DE
Sbjct  716  RPMEKYMSFACCHDE  730



>emb|CDX77080.1| BnaC04g38750D [Brassica napus]
Length=739

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 98/196 (50%), Gaps = 30/196 (15%)
 Frame = -3

Query  782  LEMLYXGKMNV--KERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAM  609
            LEM Y GK N   +E+I+R S  ++ E LS    +P ++WFFW RLESM + K +  L  
Sbjct  552  LEMAYVGKRNHSHREQIRRISEAVRAENLSHSWAEPALMWFFWARLESMLYSKIQ--LGK  609

Query  608  QDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRG--LAEMTKGEGSNVVKVLN  435
             D+            D ++Q +K ILSYD    GWA+ S+G  +  +T G     V V +
Sbjct  610  SDD-----------HDEVMQGIKKILSYDKLG-GWALLSKGAEIVMITHGVIERTVTVYD  657

Query  434  NFDSWRHEVTDENAFIPAL-----DKQLRGLYTKHHCTR--MVVPAAVGHYPETVACVEC  276
               +W+  V  +  +  A+     D+ LR   T H C      + A  G  PE + C EC
Sbjct  658  R--TWKTHVPTK-GYSKAMYDHHHDEVLRE--TGHPCAHFDFHITARSGRIPEKMNCFEC  712

Query  275  GRSMEKFFMYSCCLDE  228
             R MEK+  ++CC DE
Sbjct  713  HRPMEKYMSFACCHDE  728



>ref|XP_012071626.1| PREDICTED: uncharacterized protein LOC105633603 [Jatropha curcas]
Length=1093

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 92/184 (50%), Gaps = 16/184 (9%)
 Frame = -3

Query  782   LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
             ++MLY G  N+ +R   N   I EE LS   ++  +IW FW RL+S+W    +   +M+D
Sbjct  921   VQMLYVGMSNLNKRCSSNIVKITEEELSHCWKERVLIWSFWSRLQSIWHTGYQIGKSMKD  980

Query  602   NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGL--AEMTKGEGSNVVKVLNNF  429
                          DPI++++  +LS+D    GWA+ S+G     +   +GS++++ L  +
Sbjct  981   -------------DPIMKELTTLLSFDSRECGWALMSKGSGPGALVTAKGSDILECLLKY  1027

Query  428   DSWRHEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFM  249
             +    E   +N F+P L ++L   +    C ++V+P       ET  C  C  ++EK   
Sbjct  1028  EEEWKEQALKNGFLPTLKEKLVDYHKLDKCFQLVLPEFATTNLETAECSHCRGTVEK-LT  1086

Query  248   YSCC  237
             + CC
Sbjct  1087  FQCC  1090


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 73/143 (51%), Gaps = 20/143 (14%)
 Frame = -3

Query  782  LEMLYXGKMNV-KERIKRNSGTIQEEGLS---SILQDPTMIWFFWERLESMWFLKGEKTL  615
            LEM+Y GK    K+R +RN+ TI+ E L    S+ ++  M   FW+RLE+M    G   +
Sbjct  546  LEMIYLGKWKPNKQRQRRNTATIEREDLKLKYSLTEEKQM--KFWKRLENM----GHSRM  599

Query  614  AMQDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLN  435
             +     R Y       D I+Q + ++L+   S  GWAV  RG     K +G +++  L 
Sbjct  600  QL---GKRIY------EDLIMQDIISLLNMGSSRGGWAVICRGSDFRIKAKGKHILDSLV  650

Query  434  NFDSWRHEVTDENAFIPALDKQL  366
            NF  W+  +  ++ F+ AL+  L
Sbjct  651  NFCEWKDNIRRQD-FLGALEHYL  672



>ref|XP_010550173.1| PREDICTED: uncharacterized protein LOC104821101 [Tarenaya hassleriana]
Length=732

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 97/194 (50%), Gaps = 26/194 (13%)
 Frame = -3

Query  782  LEMLYXGKMNV--KERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAM  609
            LEM Y GK N   +E+I+R S T++   LS    DP M+WFFW RLESM + K +   A 
Sbjct  545  LEMAYVGKRNHSHREQIRRISETVKARDLSYSWTDPAMMWFFWTRLESMLYSKIQLGKA-  603

Query  608  QDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNF  429
                        +  D ++Q +K ILSYD    GWA+ S+G   +    G+ + + ++ +
Sbjct  604  ------------DDHDDVMQGIKKILSYDKIG-GWALLSKGEEIVMIAHGA-IDRTVSEY  649

Query  428  D-SWRHEVT----DENAFIPALDKQLRGLYTKHHCTR--MVVPAAVGHYPETVACVECGR  270
            D +W+ +V      +  +    D  LR   T   C+     + A  G  P+ + C EC R
Sbjct  650  DRTWKTDVATKGYKQAIYDHYFDVILRD--TGKPCSHFDFHITARSGRIPDKMNCFECHR  707

Query  269  SMEKFFMYSCCLDE  228
             MEK+  ++CC DE
Sbjct  708  PMEKYLSFACCHDE  721



>gb|KDO40196.1| hypothetical protein CISIN_1g046837mg [Citrus sinensis]
Length=658

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 78/180 (43%), Gaps = 42/180 (23%)
 Frame = -3

Query  776  MLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQDND  597
            M Y GK N K+R++  S +I +   S I+ D T +WFFW RLE M + K      +Q   
Sbjct  519  MAYVGKKNAKKRLEEISSSITKTESSHIVIDATKMWFFWARLERMLYWK------LQHGM  572

Query  596  TRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFDSWR  417
             +T                                    E  + +G+  +  +  F  W+
Sbjct  573  GKT-----------------------------------QETARAKGTAAIDCMEKFHEWQ  597

Query  416  HEVTDENAFIPALDKQLRGLYTKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFMYSCC  237
             +    N FI AL+  L+ ++   HC R+++    G  P TV C +CGR ME FFMY CC
Sbjct  598  DDAL-RNGFIQALNNYLQKIHPGKHCNRLILAGVNGAIPGTVQCADCGRDMEMFFMYHCC  656



>ref|XP_012085724.1| PREDICTED: uncharacterized protein LOC105644841 [Jatropha curcas]
Length=375

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 82/153 (54%), Gaps = 23/153 (15%)
 Frame = -3

Query  671  WFFWERLESMWFLKGEKT--LAMQDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAV  498
            W FW RLES+ F  G K   +A QDN              I++ V A+LS++GS +GWA+
Sbjct  239  WRFWTRLESI-FSSGLKNGKIAKQDN--------------IMKDVMALLSFNGSFKGWAI  283

Query  497  FSR--GLAEMTKGEGSNVVKVLNNFDSWRHEVTDENAFIPALDKQL--RGLYTKHHCTRM  330
            F +     ++ K  G  ++++L N  +W+   T  ++F+ A++ Q+  +     HHC  +
Sbjct  284  FGQFGSHQKIAKATGDVILQILRNIKTWK-PGTSIDSFLTAINHQIEQQNAVQAHHCNHI  342

Query  329  VVPAAVGHYP-ETVACVECGRSMEKFFMYSCCL  234
            V+PA +   P E + C  C R M K+ MY CC+
Sbjct  343  VLPATIPEVPDEMMTCAICDRKMSKYLMYRCCV  375



>ref|XP_008224076.1| PREDICTED: uncharacterized protein LOC103323832 [Prunus mume]
Length=685

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 82/153 (54%), Gaps = 24/153 (16%)
 Frame = -3

Query  686  DPTMIWFFWERLESMWFLKGEKTLAMQDNDTRTYIIPEESRDPILQQVKAILSYDGSNRG  507
            D  ++  FW  +ES++F KG K +                 DP+ Q+++ +LSY   + G
Sbjct  545  DHGILGHFWSGIESLFFTKGHKQV-----------------DPVTQEIQKLLSYKNES-G  586

Query  506  WAVFSRGLAEMTKGEGSNVVKVLNNFDSWRHEVTDENAF---IPALDKQLRGLYTKHHCT  336
            WAV S+G + +  G G ++++V+ +FD W+  V  E  F     A  +++R L T+  C 
Sbjct  587  WAVLSKGSSVLLTGHGVSILRVIEDFDKWKDHVK-EKGFEFCFKAYHEKVR-LATRP-CC  643

Query  335  RMVVPAAVGHYPETVACVECGRSMEKFFMYSCC  237
            R+ +P + G  P+T+ C +C RSME F  Y CC
Sbjct  644  RLDIPGSTGKVPDTMKCPDCHRSMETFISYKCC  676



>ref|XP_007225119.1| hypothetical protein PRUPE_ppa002624mg [Prunus persica]
 gb|EMJ26318.1| hypothetical protein PRUPE_ppa002624mg [Prunus persica]
Length=651

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 82/153 (54%), Gaps = 24/153 (16%)
 Frame = -3

Query  686  DPTMIWFFWERLESMWFLKGEKTLAMQDNDTRTYIIPEESRDPILQQVKAILSYDGSNRG  507
            D  ++  FW  +ES++F KG K +                 DP+ Q+++ +LSY   + G
Sbjct  511  DHGILGHFWSGIESLFFTKGHKQV-----------------DPVTQEIQKLLSYKNES-G  552

Query  506  WAVFSRGLAEMTKGEGSNVVKVLNNFDSWRHEVTDENAF---IPALDKQLRGLYTKHHCT  336
            WAV S+G + +  G G ++++V+ +FD W+  V  E  F     A  +++R L T+  C 
Sbjct  553  WAVLSKGSSVLLTGHGVSILRVIEDFDKWKDHVK-EKGFEFCFKAYHEKVR-LATRP-CC  609

Query  335  RMVVPAAVGHYPETVACVECGRSMEKFFMYSCC  237
            R+ +P + G  P+T+ C +C RSME F  Y CC
Sbjct  610  RLDIPGSTGKVPDTMKCPDCHRSMETFISYKCC  642



>ref|NP_186817.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF01551.1|AC009325_21 unknown protein [Arabidopsis thaliana]
 gb|AAP37684.1| At3g01680 [Arabidopsis thaliana]
 dbj|BAF00055.1| hypothetical protein [Arabidopsis thaliana]
 gb|ADN32814.1| sieve element occlusion b [Arabidopsis thaliana]
 gb|AEE73702.1| uncharacterized protein AT3G01680 [Arabidopsis thaliana]
Length=740

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 104/217 (48%), Gaps = 45/217 (21%)
 Frame = -3

Query  782  LEMLYXGKMNV--KERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAM  609
            LEM Y GK N   +E+I+R S  I+ E LS    +P ++WFFW RLESM + K +   A 
Sbjct  554  LEMAYVGKRNHSHREQIRRISEVIRSENLSHSWAEPALMWFFWTRLESMLYSKIQLGKA-  612

Query  608  QDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNF  429
                        +  D ++Q +K ILSYD    GWA+ S+G   +    G+ + + ++ +
Sbjct  613  ------------DDHDDVMQGIKKILSYDKLG-GWALLSKGPEIVMIAHGA-IERTMSVY  658

Query  428  D-SWRHEVTDENAFIPAL-----DKQLR------GLYTKHHCTRMVVPAAVGHYPETVAC  285
            D +W+  V  +  +  A+     D+ LR      G +  H      + A  G  PE + C
Sbjct  659  DRTWKTHVPTK-GYTKAMSDHHHDEVLRETGKPCGHFDFH------ITARSGRIPEKMNC  711

Query  284  VECGRSMEKFFMYSCCLDEYEN*ILPQIKCHPDRSAN  174
             EC R MEK+  +SCC DE         K H D + N
Sbjct  712  FECQRPMEKYMSFSCCHDE---------KLHEDENYN  739



>ref|XP_010435652.1| PREDICTED: uncharacterized protein LOC104719422 [Camelina sativa]
Length=740

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 67/218 (31%), Positives = 100/218 (46%), Gaps = 47/218 (22%)
 Frame = -3

Query  782  LEMLYXGKMNV--KERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAM  609
            LEM Y GK N   +E+ +R S  I+ E LS    +P ++WFFW RLESM + K +   A 
Sbjct  554  LEMAYVGKRNHSHREQTRRISEVIRSENLSHSWAEPPLMWFFWTRLESMLYSKIQLGKA-  612

Query  608  QDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNF  429
                        +  D ++Q +K ILSYD    GWA+ S+G   +    G+ + + +N +
Sbjct  613  ------------DDHDEVMQGIKKILSYDKLG-GWALLSKGPEIIMIVHGA-IERTVNVY  658

Query  428  D-SWRHEVTDENAFIPALDKQLRGLYTKHH----------CTR--MVVPAAVGHYPETVA  288
            D +W+  V  +           + +Y  HH          C+     + A  G  PE + 
Sbjct  659  DRTWKTHVPTKG--------YTKAMYDHHHDEILLETGKPCSHFDFHITARSGRIPEKMN  710

Query  287  CVECGRSMEKFFMYSCCLDEYEN*ILPQIKCHPDRSAN  174
            C EC R MEK+  ++CC DE         K H D + N
Sbjct  711  CFECQRPMEKYMSFACCHDE---------KLHEDENYN  739



>gb|KCW45067.1| hypothetical protein EUGRSUZ_L01341 [Eucalyptus grandis]
Length=499

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 84/159 (53%), Gaps = 20/159 (13%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M+Y GK N KER++R + TI  E LS    DP   W FW RLESM             
Sbjct  52   LGMVYVGKSNSKERVRRTAATITSEKLSYCWNDPRFFWLFWARLESM-------------  98

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLA-EMTKGEGSNVVKVLNNFD  426
              ++ ++      DP+L +++ IL++  S+ GWAVF +G+  +M + EG+ V++ L  FD
Sbjct  99   LHSKVHLGNSIENDPLLPRIQTILNFGLSDEGWAVFCQGVGPDMVEAEGNIVLENLEEFD  158

Query  425  SWRHEVTDENAFIPAL-----DKQLRGLYTKHHCTRMVV  324
             W+ +  ++  F+ AL      K+L  L+ + H   + +
Sbjct  159  KWKDD-ANQKGFVNALRDHLIQKRLMRLFDEIHLDNLTM  196


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 61/117 (52%), Gaps = 15/117 (13%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + KER++R +  I  E LS    DPT  W FW RLES+   K    +    
Sbjct  390  LEMVYVGKSDSKERVQRIAAMITSEKLSYCWNDPTFFWLFWARLESILHSKAHHGI----  445

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNN  432
              TR         DP++ ++  I +YD + +GWA+  +G A M  G   + + +L++
Sbjct  446  --TRN--------DPVIDEIMKIRTYDKTAQGWAILCQG-AGMEMGTARSDIALLDS  491



>ref|XP_009124817.1| PREDICTED: uncharacterized protein LOC103849857 [Brassica rapa]
Length=745

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/201 (31%), Positives = 93/201 (46%), Gaps = 40/201 (20%)
 Frame = -3

Query  782  LEMLYXGKMNV--KERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAM  609
            LEM Y GK N   +E I+R S  ++ E LS    +P ++WFFW RLESM + K +   A 
Sbjct  558  LEMAYVGKRNHSHREHIRRISEAVRAENLSHSWAEPALMWFFWTRLESMLYSKIQLGKA-  616

Query  608  QDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRG--LAEMTKGEGSNVVKVLN  435
                        +  D ++Q +K ILSYD    GWA+ S+G  +  +T G     V V +
Sbjct  617  ------------DDHDEVMQGIKKILSYDKLG-GWALLSKGPEIVMITHGAIERTVTVYD  663

Query  434  NFDSWRHEVTDENAFIPALDKQLRGLYTKHH----------CTR--MVVPAAVGHYPETV  291
               +W+  V  +           + +Y  HH          C+     + A  G  PE +
Sbjct  664  R--TWKTHVPTKG--------YTKAMYDHHHDEILRETGKPCSHFDFHITARSGRIPEKM  713

Query  290  ACVECGRSMEKFFMYSCCLDE  228
             C +C R MEK+  ++CC D+
Sbjct  714  NCFDCHRPMEKYMSFACCHDD  734



>ref|XP_003622294.1| hypothetical protein MTR_7g032660 [Medicago truncatula]
 gb|ABD32254.1| hypothetical protein MtrDRAFT_AC149040g7v2 [Medicago truncatula]
 gb|ADN32809.1| sieve element occlusion e [Medicago truncatula]
 gb|AES78512.1| sieve element occlusion protein [Medicago truncatula]
Length=729

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 93/187 (50%), Gaps = 16/187 (9%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGL-SSILQDPTMIWFFWERLESMWFLKGEKTLAMQ  606
            LEM+Y GK N ++++++   TI  E L +    + +MIWFFW RL+SM F K +  L   
Sbjct  540  LEMVYVGKSNKRDQVQKVCDTIIREKLYTHSWSEQSMIWFFWTRLQSMLFSKIQ--LKQV  597

Query  605  DNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNFD  426
            D++ R           ++Q++K +LSYD    GW V ++G   +  G  S  ++ L  +D
Sbjct  598  DDNDR-----------VMQEIKKLLSYDKQG-GWIVLAKGSQIVVNGHASTGLQSLIEYD  645

Query  425  SWRHEVTDENAFIPALDKQLRGLY-TKHHCTRMVVPAAVGHYPETVACVECGRSMEKFFM  249
                E  + + F  A  +    L+   + C R     ++G  P+ + C EC R+M     
Sbjct  646  LMWKEHAERDGFETAFKEHYGKLHAVDNPCCRFEFSHSMGRIPDRLTCPECRRNMHVLTT  705

Query  248  YSCCLDE  228
            + CC D+
Sbjct  706  FQCCHDD  712



>ref|XP_010040608.1| PREDICTED: uncharacterized protein LOC104429456 [Eucalyptus grandis]
Length=633

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 84/159 (53%), Gaps = 20/159 (13%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M+Y GK N KER++R + TI  E LS    DP   W FW RLESM             
Sbjct  157  LGMVYVGKSNSKERVRRTAATITSEKLSYCWNDPRFFWLFWARLESM-------------  203

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLA-EMTKGEGSNVVKVLNNFD  426
              ++ ++      DP+L +++ IL++  S+ GWAVF +G+  +M + EG+ V++ L  FD
Sbjct  204  LHSKVHLGNSIENDPLLPRIQTILNFGLSDEGWAVFCQGVGPDMVEAEGNIVLENLEEFD  263

Query  425  SWRHEVTDENAFIPAL-----DKQLRGLYTKHHCTRMVV  324
             W+ +  ++  F+ AL      K+L  L+ + H   + +
Sbjct  264  KWKDD-ANQKGFVNALRDHLIQKRLMRLFDEIHLDNLTM  301


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 61/118 (52%), Gaps = 15/118 (13%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            LEM+Y GK + KER++R +  I  E LS    DPT  W FW RLES+   K    +    
Sbjct  524  LEMVYVGKSDSKERVQRIAAMITSEKLSYCWNDPTFFWLFWARLESILHSKAHHGI----  579

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLAEMTKGEGSNVVKVLNNF  429
              TR         DP++ ++  I +YD + +GWA+  +G A M  G   + + +L++ 
Sbjct  580  --TRN--------DPVIDEIMKIRTYDKTAQGWAILCQG-AGMEMGTARSDIALLDSM  626



>gb|KCW83210.1| hypothetical protein EUGRSUZ_B001512, partial [Eucalyptus grandis]
Length=373

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 20/159 (13%)
 Frame = -3

Query  782  LEMLYXGKMNVKERIKRNSGTIQEEGLSSILQDPTMIWFFWERLESMWFLKGEKTLAMQD  603
            L M+Y GK N K+ ++R + TI  E LS    DP   W FW RLESM     E  L M  
Sbjct  52   LGMVYVGKSNSKQGVQRTAATITSEELSYCWNDPMFFWLFWARLESM--FHSEVHLGMSI  109

Query  602  NDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRGLA-EMTKGEGSNVVKVLNNFD  426
             +           DP+L  ++ IL++D SN+ WAVF + +  +M   EG+ V++ +  FD
Sbjct  110  EN-----------DPLLHVIQTILNFDRSNKRWAVFCQSVGPDMVAAEGNIVLESIEEFD  158

Query  425  SWRHEVTDENAFIPAL-----DKQLRGLYTKHHCTRMVV  324
             W  +  ++N F+ AL      K L  L+ + H   + +
Sbjct  159  KWEDD-ANQNGFLKALFDRLIQKHLIRLFDEIHLDNLTI  196



>gb|ADN32815.1| sieve element occlusion a [Malus domestica]
Length=681

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 76/146 (52%), Gaps = 24/146 (16%)
 Frame = -3

Query  665  FWERLESMWFLKGEKTLAMQDNDTRTYIIPEESRDPILQQVKAILSYDGSNRGWAVFSRG  486
            FW  +ES++F K  K                   D + ++V+ +LSY     GWAV ++G
Sbjct  547  FWNGIESLFFTKVNK-----------------QTDTVTKEVQKLLSYKNEG-GWAVLTKG  588

Query  485  LAEMTKGEGSNVVKVLNNFDSWRHEVTD---ENAFIPALDKQLRGLYTKHHCTRMVVPAA  315
               +  G G  ++KVL++FD+W++ + +   E +F    +K ++   T  HC R+ +P+ 
Sbjct  589  STVVVSGHGFTILKVLDDFDTWKNFIKEKGFEFSFKAYYEKVIQ---TMRHCCRLDIPSV  645

Query  314  VGHYPETVACVECGRSMEKFFMYSCC  237
             G  PET+ C EC R+ME F  Y CC
Sbjct  646  AGKVPETMKCPECPRTMETFVSYKCC  671



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1572839714856