BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9933

Length=1180
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAB51610.1|  ADP-glucose pyrophosphorylase large subunit            491   2e-170   Ipomoea batatas [batate]
emb|CAB52196.1|  ADP-glucose pyrophosphorylase                          495   7e-170   Ipomoea batatas [batate]
gb|AFL55396.1|  ADP-glucose pyrophosphorylase large subunit 1           494   9e-169   Ipomoea batatas [batate]
dbj|BAF47746.1|  ADP-glucose pyrophosphorylase beta subunit IbAGPb1A    494   9e-169   Ipomoea batatas [batate]
gb|AGB85109.1|  ADP-glucose pyrophosphorylase large subunit 1           493   3e-168   Ipomoea batatas [batate]
emb|CAB55496.1|  ADP-glucose pyrophosphorylase                          485   5e-167   Ipomoea batatas [batate]
emb|CAB55495.1|  ADP-glucose pyrophosphorylase                          489   9e-167   Ipomoea batatas [batate]
gb|AAC21562.1|  ADP-glucose pyrophosphorylase large subunit             484   1e-164   Ipomoea batatas [batate]
ref|XP_009621409.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    456   2e-153   Nicotiana tomentosiformis
ref|XP_009763056.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    455   3e-153   Nicotiana sylvestris
gb|AFO84074.1|  ADP glucose pyrophosphorylase                           440   9e-150   Actinidia chinensis
sp|Q00081.1|GLGL1_SOLTU  RecName: Full=Glucose-1-phosphate adenyl...    441   1e-148   Solanum tuberosum [potatoes]
gb|ABC26923.1|  ADPglucose pyrophosphorylase large subunit              443   2e-148   Solanum habrochaites
gb|AAD56405.1|AF184345_1  ADP-glucose pyrophosphorylase large sub...    443   2e-148   Solanum habrochaites
gb|AAC49941.1|  ADP-glucose pyrophosphorylase large subunit 1           443   2e-148   Solanum lycopersicum
ref|XP_011088418.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    443   2e-148   
gb|ABC26921.1|  ADPglucose pyrophosphorylase large subunit              442   3e-148   Solanum lycopersicum
ref|XP_006365120.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    442   5e-148   Solanum tuberosum [potatoes]
ref|NP_001233918.1|  ADP-glucose pyrophosphorylase large subunit        441   8e-148   
gb|KJB32481.1|  hypothetical protein B456_005G244900                    436   2e-147   Gossypium raimondii
gb|KDO42003.1|  hypothetical protein CISIN_1g0097201mg                  434   3e-147   Citrus sinensis [apfelsine]
gb|AGS94412.1|  ADP-glucose pyrophosphorylase large subunit 4           437   3e-146   Actinidia deliciosa [Chinese gooseberry]
gb|AAD56042.1|AF184598_1  ADP-glucose pyrophosphorylase large sub...    437   6e-146   Citrus unshiu [satsuma mandarin]
gb|KDO42001.1|  hypothetical protein CISIN_1g0097201mg                  432   8e-146   Citrus sinensis [apfelsine]
ref|NP_001275823.1|  glucose-1-phosphate adenylyltransferase larg...    436   1e-145   Citrus sinensis [apfelsine]
gb|KHG23571.1|  Glucose-1-phosphate adenylyltransferase large sub...    436   1e-145   Gossypium arboreum [tree cotton]
gb|KDO41998.1|  hypothetical protein CISIN_1g0097201mg                  432   2e-145   Citrus sinensis [apfelsine]
ref|XP_007042146.1|  Glucose-1-phosphate adenylyltransferase fami...    435   2e-145   
gb|KJB32482.1|  hypothetical protein B456_005G244900                    434   6e-145   Gossypium raimondii
gb|KJB32479.1|  hypothetical protein B456_005G244900                    434   7e-145   Gossypium raimondii
ref|XP_010088945.1|  Glucose-1-phosphate adenylyltransferase larg...    434   1e-144   Morus notabilis
ref|XP_006423322.1|  hypothetical protein CICLE_v10028195mg             434   1e-144   Citrus clementina [clementine]
ref|XP_003541029.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    433   1e-144   Glycine max [soybeans]
gb|KJB79161.1|  hypothetical protein B456_013G035800                    433   1e-144   Gossypium raimondii
ref|XP_012067244.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    433   2e-144   Jatropha curcas
gb|KHF99865.1|  Glucose-1-phosphate adenylyltransferase large sub...    433   2e-144   Gossypium arboreum [tree cotton]
ref|XP_009345666.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    430   2e-143   
ref|XP_003537869.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    430   3e-143   Glycine max [soybeans]
ref|XP_009345668.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    429   3e-143   Pyrus x bretschneideri [bai li]
gb|AAB91467.1|  ADP-glucose pyrophosphorylase large subunit 1           429   7e-143   Citrullus lanatus subsp. vulgaris
ref|XP_008385898.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    429   8e-143   
ref|XP_008385901.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    428   1e-142   
gb|AAF66436.1|AF249917_1  ADP-glucose pyrophosphorylase large sub...    428   2e-142   Perilla frutescens [beefsteak-mint]
ref|XP_002512925.1|  glucose-1-phosphate adenylyltransferase, put...    428   2e-142   Ricinus communis
ref|XP_002306116.2|  ADP-glucose pyrophosphorylase large subunit ...    427   3e-142   
emb|CBI37674.3|  unnamed protein product                                427   4e-142   Vitis vinifera
ref|XP_002283855.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    427   4e-142   Vitis vinifera
gb|KDO41999.1|  hypothetical protein CISIN_1g0097201mg                  424   4e-142   Citrus sinensis [apfelsine]
ref|XP_011037496.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    426   1e-141   Populus euphratica
gb|KCW55368.1|  hypothetical protein EUGRSUZ_I01281                     421   2e-141   Eucalyptus grandis [rose gum]
ref|XP_008460955.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    425   2e-141   
ref|XP_006581117.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    421   2e-141   Glycine max [soybeans]
ref|XP_007201161.1|  hypothetical protein PRUPE_ppa004192mg             425   3e-141   Prunus persica
ref|XP_002313036.1|  ADP-glucose pyrophosphorylase large subunit ...    425   3e-141   Populus trichocarpa [western balsam poplar]
dbj|BAF47747.1|  ADP-glucose pyrophosphorylase beta subunit IbAGPb1B    423   9e-141   Ipomoea batatas [batate]
emb|CDO97030.1|  unnamed protein product                                423   1e-140   Coffea canephora [robusta coffee]
gb|EYU37810.1|  hypothetical protein MIMGU_mgv1a004455mg                423   1e-140   Erythranthe guttata [common monkey flower]
ref|XP_003527197.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    423   1e-140   Glycine max [soybeans]
ref|XP_003522921.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    422   2e-140   Glycine max [soybeans]
ref|XP_007131817.1|  hypothetical protein PHAVU_011G044000g             422   3e-140   Phaseolus vulgaris [French bean]
gb|AFL55397.1|  ADP-glucose pyrophosphorylase large subunit 2           421   4e-140   Ipomoea batatas [batate]
ref|XP_010028607.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    422   4e-140   Eucalyptus grandis [rose gum]
ref|XP_011048155.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    422   5e-140   Populus euphratica
ref|XP_009378639.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    421   5e-140   
ref|XP_009378637.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    421   6e-140   Pyrus x bretschneideri [bai li]
ref|XP_009378638.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    421   7e-140   Pyrus x bretschneideri [bai li]
ref|XP_011015433.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    421   9e-140   Populus euphratica
ref|XP_008236919.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    421   1e-139   Prunus mume [ume]
ref|XP_008377280.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    417   2e-138   Malus domestica [apple tree]
gb|AGB85110.1|  ADP-glucose pyrophosphorylase large subunit 2           417   2e-138   Ipomoea batatas [batate]
ref|XP_008377281.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    417   2e-138   Malus domestica [apple tree]
gb|AHM92232.1|  AGPase large subunit protein                            417   2e-138   Hevea brasiliensis [jebe]
ref|XP_011649235.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    417   4e-138   Cucumis sativus [cucumbers]
ref|XP_004507462.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    416   8e-138   Cicer arietinum [garbanzo]
ref|XP_010254773.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    416   1e-137   Nelumbo nucifera [Indian lotus]
ref|NP_001289786.1|  glucose-1-phosphate adenylyltransferase larg...    415   2e-137   Nelumbo nucifera [Indian lotus]
ref|XP_003606943.1|  Glucose-1-phosphate adenylyltransferase            414   7e-137   Medicago truncatula
ref|XP_010060971.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    413   1e-136   Eucalyptus grandis [rose gum]
ref|XP_007136623.1|  hypothetical protein PHAVU_009G059800g             405   2e-136   Phaseolus vulgaris [French bean]
ref|NP_001284451.1|  myeloid leukemia factor 1                          411   5e-136   Cucumis melo [Oriental melon]
ref|XP_007136618.1|  hypothetical protein PHAVU_009G059800g             405   5e-136   Phaseolus vulgaris [French bean]
ref|XP_010531437.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    411   5e-136   Tarenaya hassleriana [spider flower]
ref|XP_007199332.1|  hypothetical protein PRUPE_ppa023764mg             405   6e-136   
gb|ERM94645.1|  hypothetical protein AMTR_s00011p00201790               411   6e-136   Amborella trichopoda
ref|XP_006878500.2|  PREDICTED: glucose-1-phosphate adenylyltrans...    411   7e-136   Amborella trichopoda
ref|XP_004500804.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    410   1e-135   Cicer arietinum [garbanzo]
ref|XP_007136622.1|  hypothetical protein PHAVU_009G059800g             405   1e-135   Phaseolus vulgaris [French bean]
dbj|BAC66692.1|  ADP-glucose pyrophosphorylase large subunit PvAGPL1    410   2e-135   Phaseolus vulgaris [French bean]
ref|XP_007136159.1|  hypothetical protein PHAVU_009G023100g             410   2e-135   Phaseolus vulgaris [French bean]
ref|XP_011028874.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    409   3e-135   Populus euphratica
ref|XP_011007450.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    409   3e-135   Populus euphratica
gb|EPS74142.1|  glucose-1-phosphate adenylyltransferase                 410   4e-135   Genlisea aurea
ref|XP_002300758.1|  ADP-glucose pyrophosphorylase large subunit ...    409   6e-135   Populus trichocarpa [western balsam poplar]
ref|XP_004147856.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    407   2e-134   Cucumis sativus [cucumbers]
gb|AAB91468.1|  ADP-glucose pyrophosphorylase large subunit 2           406   2e-134   Citrullus lanatus subsp. vulgaris
ref|XP_008800701.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    407   2e-134   Phoenix dactylifera
ref|XP_002307668.2|  hypothetical protein POPTR_0005s25130g             407   3e-134   Populus trichocarpa [western balsam poplar]
emb|CDP07489.1|  unnamed protein product                                407   3e-134   Coffea canephora [robusta coffee]
ref|XP_010263606.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    406   5e-134   Nelumbo nucifera [Indian lotus]
ref|XP_008388042.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    405   6e-134   
ref|XP_007136616.1|  hypothetical protein PHAVU_009G059800g             405   9e-134   Phaseolus vulgaris [French bean]
emb|CDY41275.1|  BnaA01g12640D                                          398   1e-133   Brassica napus [oilseed rape]
ref|XP_010110050.1|  Glucose-1-phosphate adenylyltransferase larg...    404   3e-133   Morus notabilis
ref|XP_009365525.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    404   3e-133   Pyrus x bretschneideri [bai li]
ref|XP_009336061.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    403   5e-133   Pyrus x bretschneideri [bai li]
ref|XP_009365102.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    403   5e-133   Pyrus x bretschneideri [bai li]
gb|AFK36497.1|  unknown                                                 404   7e-133   Lotus japonicus
ref|XP_008466540.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    403   9e-133   
ref|XP_010924297.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    402   1e-132   Elaeis guineensis
ref|XP_007017590.1|  ADPGLC-PPase large subunit isoform 1               402   2e-132   
ref|XP_010690849.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    401   6e-132   Beta vulgaris subsp. vulgaris [field beet]
emb|CAA65541.1|  ADP-glucose pyrophosphorylase                          400   8e-132   Pisum sativum [garden pea]
ref|XP_010926128.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    401   8e-132   
ref|XP_009113743.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    400   8e-132   Brassica rapa
gb|EYU45186.1|  hypothetical protein MIMGU_mgv1a004400mg                400   9e-132   Erythranthe guttata [common monkey flower]
ref|XP_004291856.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    399   2e-131   Fragaria vesca subsp. vesca
ref|XP_009759775.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    399   2e-131   Nicotiana sylvestris
gb|AES74194.2|  glucose-1-phosphate adenylyltransferase family pr...    399   3e-131   Medicago truncatula
gb|KJB58232.1|  hypothetical protein B456_009G200400                    399   3e-131   Gossypium raimondii
ref|XP_003523570.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    399   3e-131   Glycine max [soybeans]
ref|XP_003528021.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    399   3e-131   Glycine max [soybeans]
ref|NP_195632.1|  glucose-1-phosphate adenylyltransferase large s...    398   6e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009617843.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    398   7e-131   Nicotiana tomentosiformis
ref|XP_002510419.1|  glucose-1-phosphate adenylyltransferase, put...    398   8e-131   Ricinus communis
ref|XP_006303972.1|  hypothetical protein CARUB_v10008862mg             398   8e-131   Capsella rubella
dbj|BAF47748.1|  ADP-glucose pyrophosphorylase beta subunit IbAGPb2     397   1e-130   Ipomoea batatas [batate]
gb|AFL55398.1|  ADP-glucose pyrophosphorylase large subunit 3           397   2e-130   Ipomoea batatas [batate]
ref|XP_006415741.1|  hypothetical protein EUTSA_v10007379mg             397   2e-130   Eutrema salsugineum [saltwater cress]
gb|KFK36157.1|  hypothetical protein AALP_AA4G085400                    396   3e-130   Arabis alpina [alpine rockcress]
ref|XP_006282507.1|  hypothetical protein CARUB_v10007053mg             396   4e-130   Capsella rubella
ref|XP_010446453.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    396   5e-130   Camelina sativa [gold-of-pleasure]
ref|XP_008220832.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    396   5e-130   Prunus mume [ume]
ref|XP_012071900.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    396   5e-130   Jatropha curcas
ref|XP_007222521.1|  hypothetical protein PRUPE_ppa004135mg             396   5e-130   Prunus persica
gb|AJG44463.1|  ADP-glucose pyrophosphorylase large subunit             395   5e-130   Lilium davidii var. unicolor
ref|XP_010431888.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    395   8e-130   Camelina sativa [gold-of-pleasure]
ref|XP_002281223.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    395   9e-130   Vitis vinifera
ref|XP_006435035.1|  hypothetical protein CICLE_v10000842mg             395   9e-130   Citrus clementina [clementine]
gb|AIO11223.1|  AGPL1 protein                                           395   1e-129   Gladiolus hybrid cultivar
ref|XP_010437034.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    395   1e-129   Camelina sativa [gold-of-pleasure]
ref|XP_010437035.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    395   1e-129   Camelina sativa [gold-of-pleasure]
ref|XP_002890743.1|  hypothetical protein ARALYDRAFT_472972             394   2e-129   
gb|AJG44462.1|  ADP-glucose pyrophosphorylase large subunit             394   2e-129   Lilium davidii var. unicolor
ref|XP_002866835.1|  hypothetical protein ARALYDRAFT_490693             394   2e-129   
ref|XP_010431887.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    394   2e-129   Camelina sativa [gold-of-pleasure]
ref|XP_010460525.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    394   3e-129   Camelina sativa [gold-of-pleasure]
ref|XP_011074558.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    394   3e-129   Sesamum indicum [beniseed]
ref|XP_010478112.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    394   3e-129   Camelina sativa [gold-of-pleasure]
ref|XP_010478113.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    394   3e-129   Camelina sativa [gold-of-pleasure]
ref|XP_003603943.1|  Glucose-1-phosphate adenylyltransferase larg...    394   4e-129   
ref|NP_179753.1|  glucose-1-phosphate adenylyltransferase large s...    393   5e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006473534.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    393   5e-129   Citrus sinensis [apfelsine]
ref|XP_010673183.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    393   8e-129   
ref|XP_006294016.1|  hypothetical protein CARUB_v10023004mg             393   9e-129   Capsella rubella
ref|XP_010499251.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    392   1e-128   Camelina sativa [gold-of-pleasure]
ref|XP_009101892.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    392   2e-128   Brassica rapa
ref|NP_001289992.1|  glucose-1-phosphate adenylyltransferase larg...    392   2e-128   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009101891.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    392   2e-128   Brassica rapa
ref|NP_174089.1|  glucose-1-phosphate adenylyltransferase large s...    392   2e-128   Arabidopsis thaliana [mouse-ear cress]
gb|ACW82825.1|  ADP-glucose pyrophosphorylase large subunit L1 is...    391   3e-128   Lens culinaris
ref|XP_010472156.1|  PREDICTED: probable glucose-1-phosphate aden...    391   6e-128   Camelina sativa [gold-of-pleasure]
ref|XP_006411722.1|  hypothetical protein EUTSA_v10024927mg             390   7e-128   
ref|XP_010472157.1|  PREDICTED: probable glucose-1-phosphate aden...    390   7e-128   Camelina sativa [gold-of-pleasure]
emb|CDY56761.1|  BnaA06g40730D                                          392   1e-127   Brassica napus [oilseed rape]
ref|XP_006346702.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    390   1e-127   
ref|XP_010429080.1|  PREDICTED: probable glucose-1-phosphate aden...    390   2e-127   Camelina sativa [gold-of-pleasure]
ref|XP_010416916.1|  PREDICTED: probable glucose-1-phosphate aden...    389   2e-127   Camelina sativa [gold-of-pleasure]
ref|XP_010416915.1|  PREDICTED: probable glucose-1-phosphate aden...    389   2e-127   Camelina sativa [gold-of-pleasure]
gb|KDO42000.1|  hypothetical protein CISIN_1g0097201mg                  386   2e-127   Citrus sinensis [apfelsine]
gb|AGB85111.1|  ADP-glucose pyrophosphorylase large subunit 3           389   3e-127   Ipomoea batatas [batate]
gb|AEH27531.1|  putative ADP-glucose pyrophosphorylase                  389   3e-127   Amorphophallus konjac [devil's-tongue]
ref|XP_004289659.1|  PREDICTED: LOW QUALITY PROTEIN: glucose-1-ph...    388   3e-127   Fragaria vesca subsp. vesca
ref|XP_010540326.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    388   4e-127   Tarenaya hassleriana [spider flower]
ref|NP_001266081.1|  glucose-1-phosphate adenylyltransferase larg...    388   6e-127   Cicer arietinum [garbanzo]
ref|NP_001284415.1|  myeloid leukemia factor 2                          387   8e-127   Cucumis melo [Oriental melon]
emb|CDY15884.1|  BnaA04g12270D                                          388   8e-127   Brassica napus [oilseed rape]
ref|XP_002878559.1|  predicted protein                                  387   8e-127   Arabidopsis lyrata subsp. lyrata
emb|CDX72711.1|  BnaC07g47330D                                          391   1e-126   
ref|XP_010323163.1|  PREDICTED: ADP-glucose pyrophosphorylase lar...    387   1e-126   Solanum lycopersicum
ref|XP_009406290.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    387   1e-126   Musa acuminata subsp. malaccensis [pisang utan]
sp|P55242.1|GLGL2_SOLTU  RecName: Full=Glucose-1-phosphate adenyl...    387   1e-126   Solanum tuberosum [potatoes]
ref|NP_001233947.1|  ADP-glucose pyrophosphorylase large subunit        387   2e-126   
emb|CDX99581.1|  BnaC04g33380D                                          387   2e-126   
ref|XP_009140291.1|  PREDICTED: probable glucose-1-phosphate aden...    387   2e-126   Brassica rapa
ref|XP_009113739.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    386   4e-126   Brassica rapa
ref|XP_002994500.1|  hypothetical protein SELMODRAFT_138695             383   5e-126   
gb|AFO84073.1|  ADP glucose pyrophosphorylase                           385   5e-126   Actinidia deliciosa [Chinese gooseberry]
ref|XP_002970384.1|  hypothetical protein SELMODRAFT_231637             383   6e-126   
ref|XP_002968152.1|  hypothetical protein SELMODRAFT_169778             383   1e-125   
ref|XP_011007451.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    384   1e-125   Populus euphratica
ref|XP_008799957.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    385   2e-125   
gb|ABF69950.1|  ADP-glucose pyrophosphorylase (glucose-1-phosphat...    381   2e-125   Musa acuminata [banana]
emb|CDX84911.1|  BnaC05g21440D                                          384   2e-125   
gb|KDO42002.1|  hypothetical protein CISIN_1g0097201mg                  380   4e-125   Citrus sinensis [apfelsine]
ref|XP_006841529.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    384   4e-125   
gb|AEV40474.1|  ADP-glucose pyrophosphorylase 3                         383   6e-125   Spirodela polyrhiza
gb|KJB63621.1|  hypothetical protein B456_010G008700                    382   1e-124   Gossypium raimondii
ref|XP_009416548.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    382   1e-124   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGV54292.1|  ADP-glucose pyrophosphorylase large subunit             382   2e-124   Phaseolus vulgaris [French bean]
gb|AAC49942.1|  ADP-glucose pyrophosphorylase large subunit             381   3e-124   Solanum lycopersicum
ref|XP_009396671.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    380   1e-123   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006491439.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    379   3e-123   
gb|KDO86722.1|  hypothetical protein CISIN_1g043870mg                   379   3e-123   Citrus sinensis [apfelsine]
ref|XP_006444661.1|  hypothetical protein CICLE_v10023395mg             378   4e-123   
gb|AAS00542.1|  ADP-glucose pyrophosphorylase large subunit             377   4e-123   Fragaria x ananassa
gb|KEH36175.1|  glucose-1-phosphate adenylyltransferase family pr...    378   6e-123   Medicago truncatula
gb|KCW86631.1|  hypothetical protein EUGRSUZ_B03259                     369   9e-123   Eucalyptus grandis [rose gum]
ref|XP_009342671.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    377   1e-122   
gb|KJB09550.1|  hypothetical protein B456_001G149300                    377   1e-122   Gossypium raimondii
ref|XP_011083898.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    376   1e-122   Sesamum indicum [beniseed]
ref|XP_009342669.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    376   1e-122   Pyrus x bretschneideri [bai li]
ref|XP_011039886.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    376   4e-122   Populus euphratica
ref|XP_007051343.1|  ADPGLC-PPase large subunit                         375   4e-122   
gb|KHG05254.1|  Glucose-1-phosphate adenylyltransferase large sub...    375   5e-122   Gossypium arboreum [tree cotton]
ref|XP_009406289.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    376   6e-122   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002975788.1|  hypothetical protein SELMODRAFT_267891             374   7e-122   
gb|AAB82604.1|  ADP-glucose-pyrophosphorylase large subunit             366   9e-122   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002973739.1|  hypothetical protein SELMODRAFT_149205             375   1e-121   Selaginella moellendorffii
ref|XP_002515141.1|  glucose-1-phosphate adenylyltransferase, put...    374   1e-121   Ricinus communis
ref|XP_010652349.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    372   2e-121   Vitis vinifera
ref|XP_002320247.2|  hypothetical protein POPTR_0014s10560g             373   5e-121   Populus trichocarpa [western balsam poplar]
ref|XP_010323162.1|  PREDICTED: ADP-glucose pyrophosphorylase lar...    374   5e-121   Solanum lycopersicum
ref|XP_002274245.2|  PREDICTED: glucose-1-phosphate adenylyltrans...    372   6e-121   
ref|XP_010914841.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    373   6e-121   Elaeis guineensis
emb|CAN67125.1|  hypothetical protein VITISV_040166                     370   7e-121   Vitis vinifera
gb|AEV40472.1|  ADP-glucose pyrophosphorylase 2                         371   3e-120   Spirodela polyrhiza
ref|XP_003545270.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    371   3e-120   Glycine max [soybeans]
gb|KHN20962.1|  Glucose-1-phosphate adenylyltransferase large sub...    371   3e-120   Glycine soja [wild soybean]
gb|KDP28372.1|  hypothetical protein JCGZ_14143                         369   4e-120   Jatropha curcas
ref|XP_012083052.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    370   5e-120   Jatropha curcas
gb|AEV91541.1|  ADP-glucose pyrophosphorylase                           367   6e-120   Cucurbita moschata [ayote]
gb|KCW81736.1|  hypothetical protein EUGRSUZ_C03089                     365   8e-120   Eucalyptus grandis [rose gum]
ref|XP_009394804.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    370   9e-120   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003549440.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    369   2e-119   Glycine max [soybeans]
gb|KHN12692.1|  Glucose-1-phosphate adenylyltransferase large sub...    368   5e-119   Glycine soja [wild soybean]
ref|XP_006654841.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    367   5e-119   Oryza brachyantha
emb|CAA32532.1|  ADP-glucose pyrophosophorylase (1 is 2nd base in...    359   6e-119   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007160732.1|  hypothetical protein PHAVU_001G012500g             367   7e-119   Phaseolus vulgaris [French bean]
sp|P12299.2|GLGL2_WHEAT  RecName: Full=Glucose-1-phosphate adenyl...    367   8e-119   Triticum aestivum [Canadian hard winter wheat]
gb|AHA11391.1|  cytosolic ADP-glucose pyrophosphorylase large sub...    367   1e-118   Hordeum vulgare [barley]
sp|P30524.2|GLGL1_HORVU  RecName: Full=Glucose-1-phosphate adenyl...    367   1e-118   Hordeum vulgare [barley]
ref|NP_001056424.2|  Os05g0580000                                       367   1e-118   
ref|XP_008648319.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    366   2e-118   
prf||1909370A  ADP glucose pyrophosphorylase:SUBUNIT=L                  365   3e-118
ref|XP_006577921.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    364   5e-118   Glycine max [soybeans]
gb|EPS60253.1|  glucose-1-phosphate adenylyltransferase                 363   5e-118   Genlisea aurea
gb|ADE77153.1|  unknown                                                 353   1e-117   Picea sitchensis
gb|KCW46725.1|  hypothetical protein EUGRSUZ_K00547                     360   3e-117   Eucalyptus grandis [rose gum]
ref|XP_006658430.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    359   4e-117   
ref|XP_004961109.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    362   6e-117   Setaria italica
ref|XP_001784075.1|  predicted protein                                  360   6e-117   
ref|XP_001782975.1|  predicted protein                                  362   7e-117   
gb|AGT17180.1|  glucose-1-phosphate adenylyltransferase                 362   7e-117   Saccharum hybrid cultivar R570
ref|XP_010556665.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    362   9e-117   Tarenaya hassleriana [spider flower]
ref|XP_003567817.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    362   9e-117   Brachypodium distachyon [annual false brome]
ref|XP_001774318.1|  predicted protein                                  359   1e-116   
dbj|BAA23490.1|  ADP glucose pyrophosphorylase large subunit            361   1e-116   Oryza sativa Japonica Group [Japonica rice]
emb|CBI37074.3|  unnamed protein product                                360   1e-116   Vitis vinifera
ref|XP_010035362.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    361   1e-116   Eucalyptus grandis [rose gum]
ref|XP_002440313.1|  hypothetical protein SORBIDRAFT_09g029610          360   3e-116   Sorghum bicolor [broomcorn]
gb|EMT32758.1|  hypothetical protein F775_52189                         362   3e-116   
gb|AGT17354.1|  ADP-glucose pyrophosphorylase                           358   9e-116   Saccharum hybrid cultivar R570
ref|XP_002461745.1|  hypothetical protein SORBIDRAFT_02g007310          350   2e-115   
gb|AAD39597.1|AC007858_11  10A19I.12                                    358   2e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001751725.1|  predicted protein                                  358   4e-115   
gb|AFW79323.1|  ADP-glucose pyrophosphorylase large subunit             357   6e-115   
ref|XP_003561277.2|  PREDICTED: glucose-1-phosphate adenylyltrans...    357   8e-115   Brachypodium distachyon [annual false brome]
emb|CAD98749.1|  ADP-glucose pyrophosphorylase large subunit            356   2e-114   Triticum aestivum [Canadian hard winter wheat]
gb|EAZ03355.1|  hypothetical protein OsI_25494                          352   8e-114   Oryza sativa Indica Group [Indian rice]
ref|XP_004134146.2|  PREDICTED: glucose-1-phosphate adenylyltrans...    353   1e-113   Cucumis sativus [cucumbers]
gb|KHN43393.1|  Glucose-1-phosphate adenylyltransferase large sub...    353   2e-113   Glycine soja [wild soybean]
ref|XP_003553688.2|  PREDICTED: glucose-1-phosphate adenylyltrans...    353   3e-113   Glycine max [soybeans]
gb|ABR17521.1|  unknown                                                 353   3e-113   Picea sitchensis
ref|XP_008438706.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    352   4e-113   Cucumis melo [Oriental melon]
ref|XP_001767907.1|  predicted protein                                  350   4e-113   
ref|NP_001059276.1|  Os07g0243200                                       352   5e-113   
ref|XP_001759196.1|  predicted protein                                  349   7e-113   
ref|XP_004959119.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    356   8e-113   
ref|XP_010907343.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    342   1e-112   
gb|AFO84093.1|  ADP glucose pyrophosphorylase                           350   2e-112   
ref|XP_007136621.1|  hypothetical protein PHAVU_009G059800g             343   3e-112   
ref|XP_006581201.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    349   5e-112   
gb|EEE59878.1|  hypothetical protein OsJ_12478                          346   5e-112   
ref|XP_007136619.1|  hypothetical protein PHAVU_009G059800g             343   5e-112   
ref|NP_001233977.1|  ADP-glucose pyrophosphorylase large subunit        349   7e-112   
ref|XP_009603253.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    348   1e-111   
gb|AFL55399.1|  ADP-glucose pyrophosphorylase large subunit 4           349   1e-111   
ref|XP_007222671.1|  hypothetical protein PRUPE_ppa008581mg             342   1e-111   
ref|XP_006651788.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    347   1e-111   
ref|XP_007136620.1|  hypothetical protein PHAVU_009G059800g             343   1e-111   
ref|XP_009760082.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    348   1e-111   
dbj|BAF47749.1|  ADP-glucose pyrophosphorylase beta subunit IbAGPb3     348   1e-111   
ref|XP_006850725.2|  PREDICTED: glucose-1-phosphate adenylyltrans...    348   2e-111   
gb|EEE66870.1|  hypothetical protein OsJ_23681                          351   2e-111   
ref|XP_010666779.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    347   3e-111   
gb|AGB85112.1|  ADP-glucose pyrophosphorylase large subunit 4           348   3e-111   
ref|XP_010666778.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    347   3e-111   
tpg|DAA51190.1|  TPA: hypothetical protein ZEAMMB73_768829              338   3e-111   
sp|P12300.1|GLGL3_WHEAT  RecName: Full=Glucose-1-phosphate adenyl...    347   3e-111   
ref|XP_009405044.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    348   4e-111   
gb|EPS66248.1|  hypothetical protein M569_08527                         346   4e-111   
ref|NP_001051184.1|  Os03g0735000                                       347   4e-111   
ref|XP_004494490.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    347   5e-111   
gb|EEC76133.1|  hypothetical protein OsI_13419                          347   5e-111   
ref|XP_008458581.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    347   7e-111   
tpg|DAA60137.1|  TPA: glucose-1-phosphate adenylyltransferase           346   8e-111   
gb|ACL52683.1|  unknown                                                 346   9e-111   
gb|AEV40470.1|  ADP-glucose pyrophosphorylase 1                         346   9e-111   
ref|XP_004149284.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    346   1e-110   
ref|XP_007163265.1|  hypothetical protein PHAVU_001G219900g             346   1e-110   
gb|KJB38095.1|  hypothetical protein B456_006G236600                    343   2e-110   
ref|XP_002517196.1|  glucose-1-phosphate adenylyltransferase, put...    346   2e-110   
ref|XP_006644406.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    345   3e-110   
gb|KJB38094.1|  hypothetical protein B456_006G236600                    345   5e-110   
gb|AES92592.2|  glucose-1-phosphate adenylyltransferase family pr...    344   5e-110   
ref|XP_011034216.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    344   6e-110   
ref|XP_002311802.1|  ADP-glucose pyrophosphorylase family protein       344   7e-110   
gb|ACJ71342.1|  ADP-glucose pyrophosphorylase large subunit             344   8e-110   
gb|ACJ71341.1|  ADP-glucose pyrophosphorylase large subunit             344   8e-110   
gb|ACJ71335.1|  ADP-glucose pyrophosphorylase large subunit             344   8e-110   
ref|XP_010035400.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    344   9e-110   
dbj|BAD68891.1|  glucose-1-phosphate adenylyltransferase large chain    343   9e-110   
gb|ACJ71339.1|  ADP-glucose pyrophosphorylase large subunit             343   9e-110   
ref|NP_001043654.1|  Os01g0633100                                       343   9e-110   
gb|ACJ71336.1|  ADP-glucose pyrophosphorylase large subunit             343   1e-109   
ref|XP_003520778.2|  PREDICTED: glucose-1-phosphate adenylyltrans...    344   1e-109   
gb|ACJ71347.1|  ADP-glucose pyrophosphorylase large subunit             343   1e-109   
ref|XP_010551763.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    343   1e-109   
ref|XP_009120906.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    343   1e-109   
ref|XP_007034660.1|  ADP glucose pyrophosphorylase large subunit ...    339   2e-109   
gb|AAS00543.1|  ADP-glucose pyrophosphorylase large subunit             337   2e-109   
emb|CBI26204.3|  unnamed protein product                                342   2e-109   
ref|XP_001784242.1|  predicted protein                                  340   2e-109   
ref|NP_001275395.1|  glucose-1-phosphate adenylyltransferase larg...    342   2e-109   
ref|NP_001106058.1|  putative glucose-1-phosphate adenylyltransfe...    343   2e-109   
ref|NP_001266131.1|  glucose-1-phosphate adenylyltransferase larg...    343   2e-109   
dbj|BAJ90901.1|  predicted protein                                      342   2e-109   
ref|XP_002463921.1|  hypothetical protein SORBIDRAFT_01g008940          342   3e-109   
ref|XP_010039908.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    343   3e-109   
gb|AAC49729.1|  ADP-glucose pyrophosphorylase large subunit             342   3e-109   
emb|CAX51356.1|  large subunit of ADP-glucose pyrophosphorylase         342   3e-109   
ref|NP_001241391.1|  uncharacterized protein LOC100810451               342   3e-109   
ref|XP_002281069.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    342   3e-109   
gb|EMS50037.1|  Glucose-1-phosphate adenylyltransferase large sub...    340   3e-109   
gb|ABD66657.1|  plastid ADP-glucose pyrophosphorylase large subunit     342   4e-109   
gb|AGT16263.1|  plastid ADP-glucose pyrophosphorylase                   340   4e-109   
ref|XP_007153923.1|  hypothetical protein PHAVU_003G076500g             342   5e-109   
emb|CDY02573.1|  BnaC02g08620D                                          342   5e-109   
ref|NP_197423.1|  glucose-1-phosphate adenylyltransferase large s...    342   5e-109   
dbj|BAC16096.1|  putative glucose-1-phosphate adenylyltransferase...    342   5e-109   
ref|XP_006404613.1|  hypothetical protein EUTSA_v10000141mg             341   5e-109   
dbj|BAA76362.1|  glucose-1-phosphate adenylyltransferase                342   6e-109   
ref|XP_010255929.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    342   6e-109   
gb|KEH24450.1|  glucose-1-phosphate adenylyltransferase family pr...    337   6e-109   
ref|XP_002873938.1|  hypothetical protein ARALYDRAFT_488807             341   9e-109   
ref|XP_009126310.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    342   9e-109   
ref|XP_003549968.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    341   9e-109   
ref|XP_011625672.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    341   1e-108   
gb|KCW55369.1|  hypothetical protein EUGRSUZ_I01281                     340   1e-108   
gb|ACJ71334.1|  ADP-glucose pyrophosphorylase large subunit             341   1e-108   
ref|XP_011090768.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    341   1e-108   
gb|AGT17074.1|  glucose-1-phosphate adenylyltransferase                 340   1e-108   
gb|ACJ71344.1|  ADP-glucose pyrophosphorylase large subunit             340   1e-108   
gb|EEE55040.1|  hypothetical protein OsJ_02724                          342   1e-108   
emb|CDY47206.1|  BnaAnng08760D                                          341   2e-108   
gb|KCW84250.1|  hypothetical protein EUGRSUZ_B01108                     340   2e-108   
gb|ACJ71333.1|  ADP-glucose pyrophosphorylase large subunit             340   2e-108   
gb|EYU41519.1|  hypothetical protein MIMGU_mgv1a004639mg                340   2e-108   
emb|CDY68209.1|  BnaC09g54280D                                          340   2e-108   
ref|XP_004296919.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    340   2e-108   
gb|KDO74746.1|  hypothetical protein CISIN_1g013483mg                   335   3e-108   
ref|XP_001778378.1|  predicted protein                                  337   3e-108   
ref|XP_007034659.1|  ADP glucose pyrophosphorylase large subunit ...    340   3e-108   
ref|XP_003560093.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    339   3e-108   
ref|XP_007136617.1|  hypothetical protein PHAVU_009G059800g             335   3e-108   
gb|KFK26166.1|  hypothetical protein AALP_AA8G211600                    340   3e-108   
gb|ACJ71332.1|  ADP-glucose pyrophosphorylase large subunit             339   4e-108   
ref|XP_006400480.1|  hypothetical protein EUTSA_v10013265mg             339   5e-108   
ref|XP_004969255.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    339   5e-108   
ref|XP_008222970.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    339   6e-108   
ref|XP_010420717.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    339   7e-108   
ref|XP_008340932.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    339   7e-108   
ref|NP_001106017.1|  plastid ADP-glucose pyrophosphorylase large ...    338   9e-108   
gb|AIZ00993.1|  ADP-glucose pyrophosphorylase large subunit 1           338   1e-107   
ref|XP_008800702.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    338   1e-107   
ref|XP_010941806.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    339   1e-107   
ref|XP_010093993.1|  Glucose-1-phosphate adenylyltransferase larg...    338   1e-107   
ref|XP_009345065.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    337   1e-107   
ref|XP_004981865.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    340   1e-107   
dbj|BAF95166.1|  ADP-glucose pyrophsphorylase                           325   2e-107   
gb|AAK27727.1|  ADP-glucose pyrophosphorylase large subunit isoform     338   2e-107   
gb|AGT16453.1|  glucose-1-phosphate adenylyltransferase                 337   2e-107   
gb|AES82317.2|  glucose-1-phosphate adenylyltransferase family pr...    338   2e-107   
ref|XP_012069562.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    338   2e-107   
ref|XP_009364201.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    337   3e-107   
ref|XP_009338465.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    337   3e-107   
ref|XP_008390847.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    337   3e-107   
ref|XP_010492975.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    337   3e-107   
gb|AGT17259.1|  ADP-glucose pyrophosphorylase                           333   4e-107   
gb|ACJ71343.1|  ADP-glucose pyrophosphorylase large subunit             337   4e-107   
gb|KDO74743.1|  hypothetical protein CISIN_1g013483mg                   333   5e-107   
gb|KDO74742.1|  hypothetical protein CISIN_1g013483mg                   334   6e-107   
ref|XP_006289333.1|  hypothetical protein CARUB_v10002818mg             336   1e-106   
gb|ABS19875.1|  putative glucose-1-phosphate adenylyltransferase ...    335   2e-106   
ref|XP_006489328.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    335   2e-106   
ref|XP_010454187.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    335   3e-106   
emb|CDO99014.1|  unnamed protein product                                335   3e-106   
ref|XP_006419854.1|  hypothetical protein CICLE_v10004731mg             335   4e-106   
gb|EMT06319.1|  Glucose-1-phosphate adenylyltransferase large sub...    333   6e-106   
gb|AAM95945.1|  ADP-glucose pyrophosphorylase large subunit             334   7e-106   
gb|AGT17261.1|  ADP-glucose pyrophosphorylase                           333   2e-105   
ref|XP_003610395.1|  Glucose-1-phosphate adenylyltransferase            333   3e-105   
ref|XP_003626099.1|  Glucose-1-phosphate adenylyltransferase            332   7e-105   
ref|XP_002456012.1|  hypothetical protein SORBIDRAFT_03g028850          331   8e-105   
ref|XP_008673451.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    332   1e-104   
gb|AFP90368.1|  endosperm glucose-1-phosphate adenylyltransferase...    330   2e-104   
ref|XP_007034661.1|  ADP glucose pyrophosphorylase large subunit ...    325   2e-104   
gb|AHL44840.1|  glucose-1-phosphate adenylyltransferase large sub...    330   3e-104   
ref|XP_008673450.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    331   3e-104   
gb|AGT16790.1|  ADP-glucose pyrophosphorylase large subunit             329   4e-104   
ref|NP_001121104.1|  glucose-1-phosphate adenylyltransferase larg...    329   4e-104   
tpg|DAA58441.1|  TPA: shrunken2                                         333   4e-104   
tpg|DAA58443.1|  TPA: shrunken2                                         333   9e-104   
gb|KEH30449.1|  glucose-1-phosphate adenylyltransferase family pr...    323   3e-102   
gb|AAK27685.1|AF347698_1  ADP-glucose pyrophosphorylase large sub...    325   5e-102   
sp|P12298.1|GLGL1_WHEAT  RecName: Full=Glucose-1-phosphate adenyl...    316   5e-102   
gb|AHG12640.1|  ADP-glucose pyrophosphorylase large subunit             322   2e-101   
gb|KCW45645.1|  hypothetical protein EUGRSUZ_L00600                     322   2e-101   
ref|NP_001105717.1|  glucose-1-phosphate adenylyltransferase larg...    321   8e-101   
gb|EMS53815.1|  Glucose-1-phosphate adenylyltransferase large sub...    318   1e-100   
ref|XP_010042059.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    301   3e-97    
gb|AAM73733.1|  ADP-glucose pyrophosphorylase large subunit             298   7e-97    
gb|KCW45857.1|  hypothetical protein EUGRSUZ_L00275                     305   7e-97    
emb|CAA51776.1|  glucose-1-phosphate adenylyltransferase                296   6e-96    
ref|WP_006635221.1|  glucose-1-phosphate adenylyltransferase            305   8e-96    
gb|AAM73734.1|  ADP-glucose pyrophosphorylase large subunit             296   8e-96    
pir||S42545  glucose-1-phosphate adenylyltransferase (EC 2.7.7.27...    294   5e-95 
ref|WP_017306779.1|  glucose-1-phosphate adenylyltransferase            303   6e-95    
ref|XP_003056043.1|  adp-glucose pyrophosphorylase                      305   8e-95    
ref|WP_015176220.1|  Glucose-1-phosphate adenylyltransferase            302   9e-95    
gb|KJB63622.1|  hypothetical protein B456_010G008700                    303   9e-95    
emb|CAA51778.1|  glucose-1-phosphate adenylyltransferase                293   1e-94    
gb|KHN14186.1|  Glucose-1-phosphate adenylyltransferase large sub...    303   2e-94    
ref|WP_015195259.1|  Glucose-1-phosphate adenylyltransferase            301   3e-94    
ref|WP_015129202.1|  glucose-1-phosphate adenylyltransferase            300   4e-94    
gb|ERN12307.1|  hypothetical protein AMTR_s00025p00042290               293   5e-94    
ref|WP_029636857.1|  glucose-1-phosphate adenylyltransferase [          300   5e-94    
gb|KJB63623.1|  hypothetical protein B456_010G008700                    302   5e-94    
pir||S42547  glucose-1-phosphate adenylyltransferase (EC 2.7.7.27...    291   6e-94 
ref|XP_002507549.1|  adp-glucose pyrophosphorylase                      300   1e-93    
ref|WP_013322137.1|  glucose-1-phosphate adenylyltransferase            299   2e-93    
gb|KJB38096.1|  hypothetical protein B456_006G236600                    299   6e-93    
gb|AAB65844.1|  ADP-glucose pyrophosphorylase                           288   9e-93    
emb|CAA69978.1|  ADP-glucose pyrophosphorylase                          295   1e-92    
ref|WP_015200127.1|  glucose-1-phosphate adenylyltransferase            296   1e-92    
emb|CAB37841.1|  ADP-glucose pyrophosphorylase large subunit            287   2e-92    
ref|WP_019489832.1|  glucose-1-phosphate adenylyltransferase            296   2e-92    
ref|WP_012597885.1|  glucose-1-phosphate adenylyltransferase            296   2e-92    
ref|WP_035759831.1|  MULTISPECIES: glucose-1-phosphate adenylyltr...    296   2e-92    
gb|EDZ92780.1|  glucose-1-phosphate adenylyltransferase                 296   3e-92    
gb|AAB24191.2|  endosperm ADP-glucose pyrophosphorylase subunit h...    298   5e-92    
ref|WP_035156038.1|  glucose-1-phosphate adenylyltransferase            295   6e-92    
ref|WP_013192868.1|  glucose-1-phosphate adenylyltransferase            294   9e-92    
pir||S22525  glucose-1-phosphate adenylyltransferase (EC 2.7.7.27...    285   1e-91 
ref|WP_019504914.1|  glucose-1-phosphate adenylyltransferase            294   2e-91    
ref|WP_028091556.1|  glucose-1-phosphate adenylyltransferase            294   2e-91    
ref|WP_006511366.1|  glucose-1-phosphate adenylyltransferase            293   2e-91    
ref|WP_006617056.1|  glucose-1-phosphate adenylyltransferase            293   2e-91    
ref|WP_015208914.1|  glucose-1-phosphate adenylyltransferase            293   3e-91    
ref|XP_007034665.1|  ADP glucose pyrophosphorylase large subunit ...    291   3e-91    
ref|WP_009768760.1|  glucose-1-phosphate adenylyltransferase            293   3e-91    
ref|WP_010998776.1|  glucose-1-phosphate adenylyltransferase            293   4e-91    
ref|WP_006194760.1|  glucose-1-phosphate adenylyltransferase            292   5e-91    
gb|AFV14956.1|  glucose-1-phosphate adenylyltransferase                 292   7e-91    
ref|WP_015153007.1|  glucose-1-phosphate adenylyltransferase            292   8e-91    
ref|WP_011318814.1|  glucose-1-phosphate adenylyltransferase            292   8e-91    
ref|WP_015215347.1|  Glucose-1-phosphate adenylyltransferase            292   8e-91    
gb|KIE12365.1|  glucose-1-phosphate adenylyltransferase                 291   1e-90    
ref|WP_015140081.1|  glucose-1-phosphate adenylyltransferase            291   1e-90    
ref|WP_017653597.1|  glucose-1-phosphate adenylyltransferase            291   1e-90    
ref|XP_005649170.1|  glucose-1-phosphate adenylyltransferase            294   1e-90    
ref|WP_002761951.1|  glucose-1-phosphate adenylyltransferase            291   1e-90    
ref|WP_039714461.1|  glucose-1-phosphate adenylyltransferase            291   1e-90    
ref|WP_035998839.1|  glucose-1-phosphate adenylyltransferase            291   2e-90    
ref|WP_039741952.1|  glucose-1-phosphate adenylyltransferase            291   2e-90    
ref|WP_015078891.1|  glucose-1-phosphate adenylyltransferase            291   2e-90    
ref|WP_022607393.1|  glucose-1-phosphate adenylyltransferase            291   2e-90    
ref|XP_001422382.1|  predicted protein                                  292   2e-90    
ref|WP_017744505.1|  glucose-1-phosphate adenylyltransferase            290   3e-90    
ref|WP_023171254.1|  glucose-1-phosphate adenylyltransferase            290   3e-90    
ref|WP_006276382.1|  glucose-1-phosphate adenylyltransferase            290   4e-90    
ref|XP_011401140.1|  Glucose-1-phosphate adenylyltransferase larg...    291   4e-90    
ref|WP_002789937.1|  glucose-1-phosphate adenylyltransferase            290   5e-90    
ref|WP_015189052.1|  Glucose-1-phosphate adenylyltransferase            290   5e-90    
ref|WP_009341594.1|  glucose-1-phosphate adenylyltransferase            290   5e-90    
gb|KDD76751.1|  nucleotidyl transferase                                 290   6e-90    
ref|WP_015114419.1|  glucose-1-phosphate adenylyltransferase            290   7e-90    
ref|WP_012265852.1|  glucose-1-phosphate adenylyltransferase            290   7e-90    
ref|WP_028085127.1|  glucose-1-phosphate adenylyltransferase            289   1e-89    
ref|WP_002768734.1|  glucose-1-phosphate adenylyltransferase            289   1e-89    



>emb|CAB51610.1| ADP-glucose pyrophosphorylase large subunit [Ipomoea batatas]
Length=306

 Score =   491 bits (1263),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 237/244 (97%), Positives = 239/244 (98%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTLLGLPPQDARLNPYIASMGVYVF+TDVL RLLRWRYPTSNDFGSEILPAAV E
Sbjct  63    AMQVDTTLLGLPPQDARLNPYIASMGVYVFKTDVLFRLLRWRYPTSNDFGSEILPAAVME  122

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAYIFRDYWEDIGTIKSFY+ANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK
Sbjct  123   HNVQAYIFRDYWEDIGTIKSFYDANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  182

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADG V
Sbjct  183   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGKV  242

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRNAIIDKNVRIGKDVVI NKDGVQESDRPDEGFYIRSGITIIMEKATI D
Sbjct  243   PIGVGENTKIRNAIIDKNVRIGKDVVITNKDGVQESDRPDEGFYIRSGITIIMEKATIRD  302

Query  410   GTVI  399
             GTVI
Sbjct  303   GTVI  306



>emb|CAB52196.1| ADP-glucose pyrophosphorylase [Ipomoea batatas]
Length=450

 Score =   495 bits (1274),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 237/244 (97%), Positives = 241/244 (99%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTLLGLPPQDARLNPYIASMGVYVF+TDVLLRLLRWRYPTSNDFGSEILPAAV E
Sbjct  207   AMQVDTTLLGLPPQDARLNPYIASMGVYVFKTDVLLRLLRWRYPTSNDFGSEILPAAVME  266

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAYIFRDYWEDIGTIKSFY+ANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK
Sbjct  267   HNVQAYIFRDYWEDIGTIKSFYDANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  326

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLREC+VEHSIIGERSRLDCGVELKDTLMMGAD YETESEIASLLADG V
Sbjct  327   IKDAIISHGCFLRECSVEHSIIGERSRLDCGVELKDTLMMGADTYETESEIASLLADGKV  386

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ+SDRPDEGFYIRSGITIIMEKATIPD
Sbjct  387   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQDSDRPDEGFYIRSGITIIMEKATIPD  446

Query  410   GTVI  399
             GTVI
Sbjct  447   GTVI  450



>gb|AFL55396.1| ADP-glucose pyrophosphorylase large subunit 1 [Ipomoea batatas]
Length=517

 Score =   494 bits (1273),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 238/244 (98%), Positives = 240/244 (98%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTLLGLPPQDARLNPYIASMGVYVF+TDVLLRLLRWRYPTSNDFGSEILPAAV E
Sbjct  274   AMQVDTTLLGLPPQDARLNPYIASMGVYVFKTDVLLRLLRWRYPTSNDFGSEILPAAVME  333

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAYIFRDYWEDIGTIKSFY+ANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK
Sbjct  334   HNVQAYIFRDYWEDIGTIKSFYDANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  393

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADG V
Sbjct  394   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGKV  453

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRNAIIDKNVRIGKDVVI NKDGVQESDRPDEGFYIRSGITIIMEKATI D
Sbjct  454   PIGVGENTKIRNAIIDKNVRIGKDVVITNKDGVQESDRPDEGFYIRSGITIIMEKATIRD  513

Query  410   GTVI  399
             GTVI
Sbjct  514   GTVI  517



>dbj|BAF47746.1| ADP-glucose pyrophosphorylase beta subunit IbAGPb1A [Ipomoea 
batatas]
Length=517

 Score =   494 bits (1273),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 238/244 (98%), Positives = 240/244 (98%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTLLGLPPQDARLNPYIASMGVYVF+TDVLLRLLRWRYPTSNDFGSEILPAAV E
Sbjct  274   AMQVDTTLLGLPPQDARLNPYIASMGVYVFKTDVLLRLLRWRYPTSNDFGSEILPAAVME  333

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAYIFRDYWEDIGTIKSFY+ANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK
Sbjct  334   HNVQAYIFRDYWEDIGTIKSFYDANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  393

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADG V
Sbjct  394   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGKV  453

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRNAIIDKNVRIGKDVVI NKDGVQESDRPDEGFYIRSGITIIMEKATI D
Sbjct  454   PIGVGENTKIRNAIIDKNVRIGKDVVITNKDGVQESDRPDEGFYIRSGITIIMEKATIRD  513

Query  410   GTVI  399
             GTVI
Sbjct  514   GTVI  517



>gb|AGB85109.1| ADP-glucose pyrophosphorylase large subunit 1 [Ipomoea batatas]
Length=517

 Score =   493 bits (1270),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 237/244 (97%), Positives = 239/244 (98%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTLLGLPPQDARLNPYIASMGVYVF+TDVLLRLLRWRYPTSNDFGSEILPAAV E
Sbjct  274   AMQVDTTLLGLPPQDARLNPYIASMGVYVFKTDVLLRLLRWRYPTSNDFGSEILPAAVME  333

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAYIFRDYWEDIGTIKSFY+ANLALTEEFPKFEFYDPKTPFY SPRFLPPTKIDNCK
Sbjct  334   HNVQAYIFRDYWEDIGTIKSFYDANLALTEEFPKFEFYDPKTPFYASPRFLPPTKIDNCK  393

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADG V
Sbjct  394   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGKV  453

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRNAIIDKNVRIGKDVVI NKDGVQESDRPDEGFYIRSGITIIMEKATI D
Sbjct  454   PIGVGENTKIRNAIIDKNVRIGKDVVITNKDGVQESDRPDEGFYIRSGITIIMEKATIRD  513

Query  410   GTVI  399
             GTVI
Sbjct  514   GTVI  517



>emb|CAB55496.1| ADP-glucose pyrophosphorylase [Ipomoea batatas]
Length=385

 Score =   485 bits (1249),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 234/244 (96%), Positives = 236/244 (97%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTLLGLPPQDARLNPYIASMGVYVF+TDVL RLLRWRYPTSNDFGSEILPAAV E
Sbjct  142   AMQVDTTLLGLPPQDARLNPYIASMGVYVFKTDVLFRLLRWRYPTSNDFGSEILPAAVME  201

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAYIFRDYWEDIGTIKSFY+ANLALTEEFPKFEFYDPK PFYTSPRFLPPTKIDNCK
Sbjct  202   HNVQAYIFRDYWEDIGTIKSFYDANLALTEEFPKFEFYDPKIPFYTSPRFLPPTKIDNCK  261

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGAD YETESEIASLLADG V
Sbjct  262   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADTYETESEIASLLADGKV  321

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRNAIIDKNVRIGKDVVI NKDGVQESDRPDEGFYIRSGITIIMEKATI  
Sbjct  322   PIGVGENTKIRNAIIDKNVRIGKDVVITNKDGVQESDRPDEGFYIRSGITIIMEKATIRY  381

Query  410   GTVI  399
             GTVI
Sbjct  382   GTVI  385



>emb|CAB55495.1| ADP-glucose pyrophosphorylase [Ipomoea batatas]
Length=490

 Score =   489 bits (1258),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 236/244 (97%), Positives = 238/244 (98%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTLLGLPPQDARLNPYIASMGVYVF+TDVLLRLLRWRYPTSNDFGSEILPAAV E
Sbjct  247   AMQVDTTLLGLPPQDARLNPYIASMGVYVFKTDVLLRLLRWRYPTSNDFGSEILPAAVME  306

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAYIFRDYWEDIGTIKSFY+ANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK
Sbjct  307   HNVQAYIFRDYWEDIGTIKSFYDANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  366

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADG V
Sbjct  367   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGKV  426

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRNAIIDKNVRIGK VVI NKDGVQESDRPDEGFYIRSGITIIMEKATI  
Sbjct  427   PIGVGENTKIRNAIIDKNVRIGKHVVITNKDGVQESDRPDEGFYIRSGITIIMEKATIRY  486

Query  410   GTVI  399
             GTVI
Sbjct  487   GTVI  490



>gb|AAC21562.1| ADP-glucose pyrophosphorylase large subunit [Ipomoea batatas]
Length=517

 Score =   484 bits (1247),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 233/244 (95%), Positives = 236/244 (97%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTLLGLP QDARLNPYIA MGVYVF+TDVLLRLLRWRYPTSNDFGSEILPAAV E
Sbjct  274   AMQVDTTLLGLPRQDARLNPYIACMGVYVFKTDVLLRLLRWRYPTSNDFGSEILPAAVME  333

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAYIFRDYWEDIGTIKSFY+ANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK
Sbjct  334   HNVQAYIFRDYWEDIGTIKSFYDANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  393

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGAD YETESEIASLLADG V
Sbjct  394   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADTYETESEIASLLADGKV  453

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRNAIIDKNVRIGK VVI NKDGVQESDRPDEGFYIRSGITIIMEKATI D
Sbjct  454   PIGVGENTKIRNAIIDKNVRIGKHVVITNKDGVQESDRPDEGFYIRSGITIIMEKATIRD  513

Query  410   GTVI  399
             GTV+
Sbjct  514   GTVV  517



>ref|XP_009621409.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Nicotiana tomentosiformis]
Length=528

 Score =   456 bits (1173),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 211/243 (87%), Positives = 232/243 (95%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             MQVDTTL+GL PQ+A+ +PYIASMGVYVF+TDVLL+LL+WRYPT+NDFGSEI+PAA+ EH
Sbjct  286   MQVDTTLIGLSPQEAKRSPYIASMGVYVFKTDVLLKLLKWRYPTANDFGSEIIPAAINEH  345

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
             NVQAYIFRDYWEDIGTIKSFY+ANLALT EFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI
Sbjct  346   NVQAYIFRDYWEDIGTIKSFYDANLALTAEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  405

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
             KDAIISHGCFLREC+V+HSI+GERSRLDCGVELKDTLMMGAD Y+TESEIASLLA+G VP
Sbjct  406   KDAIISHGCFLRECSVDHSIVGERSRLDCGVELKDTLMMGADYYQTESEIASLLAEGKVP  465

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             IG+GENTKIRN IIDKN +IGKDVVIMNKDGVQE+DRP+EGFYIR G+TII EKATI DG
Sbjct  466   IGIGENTKIRNCIIDKNAKIGKDVVIMNKDGVQEADRPEEGFYIRGGLTIIAEKATIKDG  525

Query  407   TVI  399
             TVI
Sbjct  526   TVI  528



>ref|XP_009763056.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Nicotiana sylvestris]
Length=528

 Score =   455 bits (1171),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 233/244 (95%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTL+GL PQ+A+ +PYIASMGVYVF+TDVLL+LL+WRYPT+NDFGSEI+PAA+ E
Sbjct  285   AMQVDTTLIGLSPQEAKRSPYIASMGVYVFKTDVLLKLLKWRYPTANDFGSEIIPAAINE  344

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAYIFRDYWEDIGTIKSFY+ANLALT E PKFEFYDPKTPFYTSPRFLPPTKIDNCK
Sbjct  345   HNVQAYIFRDYWEDIGTIKSFYDANLALTAESPKFEFYDPKTPFYTSPRFLPPTKIDNCK  404

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLREC+V+HSI+GERSRLDCGVELKDTLMMGAD Y+TESEIASLLA+G V
Sbjct  405   IKDAIISHGCFLRECSVDHSIVGERSRLDCGVELKDTLMMGADYYQTESEIASLLAEGKV  464

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRN IIDKN +IGKDVVIMNKDGVQE+DRP+EGFYIR+G+TI+ EKATI D
Sbjct  465   PIGVGENTKIRNCIIDKNAKIGKDVVIMNKDGVQEADRPEEGFYIRAGLTIVAEKATIKD  524

Query  410   GTVI  399
             GTVI
Sbjct  525   GTVI  528



>gb|AFO84074.1| ADP glucose pyrophosphorylase, partial [Actinidia chinensis]
Length=344

 Score =   440 bits (1131),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 229/244 (94%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+ DTT LGL PQDA  +PYIASMGVYVF+TD+LL+LLRWRYPTSNDFGSEI+P+AV E
Sbjct  101   AMEADTTRLGLSPQDAAKSPYIASMGVYVFKTDILLKLLRWRYPTSNDFGSEIIPSAVME  160

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+FRDYWEDIGTIKSFY+ANLAL EE PKF FYDPKTPF+TSPRFLPPTKID CK
Sbjct  161   HNVQAYVFRDYWEDIGTIKSFYDANLALAEECPKFSFYDPKTPFFTSPRFLPPTKIDRCK  220

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKD+IISHGCFLREC+VEHSI+GERSRLD GVELKDTLMMGAD Y+TESEIASLLA+GN+
Sbjct  221   IKDSIISHGCFLRECSVEHSIVGERSRLDYGVELKDTLMMGADYYQTESEIASLLAEGNI  280

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G+NTKIRN IIDKN +IGKDVVI+NKDGV+E+DRPD+GFYIRSGITII+EKATI D
Sbjct  281   PIGIGKNTKIRNCIIDKNAKIGKDVVIVNKDGVEEADRPDQGFYIRSGITIILEKATITD  340

Query  410   GTVI  399
             GTVI
Sbjct  341   GTVI  344



>sp|Q00081.1|GLGL1_SOLTU RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
1; AltName: Full=ADP-glucose pyrophosphorylase; AltName: 
Full=ADP-glucose synthase; AltName: Full=AGPase S; AltName: 
Full=Alpha-D-glucose-1-phosphate adenyl transferase, partial 
[Solanum tuberosum]
 emb|CAA43490.1| ADP-glucose pyrophosphorylase large subunit [Solanum tuberosum]
Length=470

 Score =   441 bits (1135),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 204/244 (84%), Positives = 231/244 (95%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTL+GL PQDA+ +PYIASMGVYVF+TDVLL+LL+W YPTSNDFGSEI+PAA+ +
Sbjct  227   AMQVDTTLVGLSPQDAKKSPYIASMGVYVFKTDVLLKLLKWSYPTSNDFGSEIIPAAIDD  286

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAYIF+DYWEDIGTIKSFYNA+LALT+EFP+F+FYDPKTPFYTSPRFLPPTKIDNCK
Sbjct  287   YNVQAYIFKDYWEDIGTIKSFYNASLALTQEFPEFQFYDPKTPFYTSPRFLPPTKIDNCK  346

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLR+C+VEHSI+GERSRLDCGVELKDT MMGAD Y+TESEIASLLA+G V
Sbjct  347   IKDAIISHGCFLRDCSVEHSIVGERSRLDCGVELKDTFMMGADYYQTESEIASLLAEGKV  406

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+GENTKIR  IIDKN +IGK+V I+NKDGVQE+DRP+EGFYIRSGI II+EKATI D
Sbjct  407   PIGIGENTKIRKCIIDKNAKIGKNVSIINKDGVQEADRPEEGFYIRSGIIIILEKATIRD  466

Query  410   GTVI  399
             GTVI
Sbjct  467   GTVI  470



>gb|ABC26923.1| ADPglucose pyrophosphorylase large subunit [Solanum habrochaites]
Length=527

 Score =   443 bits (1140),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 231/244 (95%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTL+GL PQDA+ +PYIASMGVYVF+TDVLL+LL+W YPTSNDFGSEI+PAA+ +
Sbjct  284   AMQVDTTLVGLSPQDAKKSPYIASMGVYVFKTDVLLKLLKWSYPTSNDFGSEIIPAAIDD  343

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAYIF+DYWEDIGTIKSFYNA+LALT+EFP+F+FYDPKTPFYTSPRFLPPTKIDNCK
Sbjct  344   YNVQAYIFKDYWEDIGTIKSFYNASLALTQEFPEFQFYDPKTPFYTSPRFLPPTKIDNCK  403

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLR+C+VEHSI+GERSRLDCGVELKDT MMGAD Y+TESEIASLLA+G V
Sbjct  404   IKDAIISHGCFLRDCSVEHSIVGERSRLDCGVELKDTFMMGADYYQTESEIASLLAEGKV  463

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+GENTKIR  IIDKN +IGK+V I+NKDGVQE+DRP+EGFYIRSGITII EKATI D
Sbjct  464   PIGIGENTKIRKCIIDKNAKIGKNVSIINKDGVQEADRPEEGFYIRSGITIISEKATIRD  523

Query  410   GTVI  399
             GTVI
Sbjct  524   GTVI  527



>gb|AAD56405.1|AF184345_1 ADP-glucose pyrophosphorylase large subunit [Solanum habrochaites]
Length=520

 Score =   443 bits (1139),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 231/244 (95%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTL+GL PQDA+ +PYIASMGVYVF+TDVLL+LL+W YPTSNDFGSEI+PAA+ +
Sbjct  277   AMQVDTTLVGLSPQDAKKSPYIASMGVYVFKTDVLLKLLKWSYPTSNDFGSEIIPAAIDD  336

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAYIF+DYWEDIGTIKSFYNA+LALT+EFP+F+FYDPKTPFYTSPRFLPPTKIDNCK
Sbjct  337   YNVQAYIFKDYWEDIGTIKSFYNASLALTQEFPEFQFYDPKTPFYTSPRFLPPTKIDNCK  396

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLR+C+VEHSI+GERSRLDCGVELKDT MMGAD Y+TESEIASLLA+G V
Sbjct  397   IKDAIISHGCFLRDCSVEHSIVGERSRLDCGVELKDTFMMGADYYQTESEIASLLAEGKV  456

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+GENTKIR  IIDKN +IGK+V I+NKDGVQE+DRP+EGFYIRSGITII EKATI D
Sbjct  457   PIGIGENTKIRKCIIDKNAKIGKNVSIINKDGVQEADRPEEGFYIRSGITIISEKATIRD  516

Query  410   GTVI  399
             GTVI
Sbjct  517   GTVI  520



>gb|AAC49941.1| ADP-glucose pyrophosphorylase large subunit 1 [Solanum lycopersicum]
Length=524

 Score =   443 bits (1139),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 230/244 (94%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTL+GL PQDA+ +PYIASMGVYVF+TDVLL+LL+W YPTSNDFGSEI+PAA+ +
Sbjct  281   AMQVDTTLVGLSPQDAKKSPYIASMGVYVFKTDVLLKLLKWSYPTSNDFGSEIIPAAIDD  340

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAYIF+DYWEDIGTIKSFYNA+LALT+EFP+F+FYDPKTPFYTSPRFLPPTKIDNCK
Sbjct  341   YNVQAYIFKDYWEDIGTIKSFYNASLALTQEFPEFQFYDPKTPFYTSPRFLPPTKIDNCK  400

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLR+CTVEHSI+GERSRLDCGVELKDT MMGAD Y+TESEIASLLA+G V
Sbjct  401   IKDAIISHGCFLRDCTVEHSIVGERSRLDCGVELKDTFMMGADYYQTESEIASLLAEGKV  460

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+GENTKIR  IIDKN +IGK+V I+NKDGVQE+DRP+EGFYIRSGI II EKATI D
Sbjct  461   PIGIGENTKIRKCIIDKNAKIGKNVSIINKDGVQEADRPEEGFYIRSGIIIIAEKATIRD  520

Query  410   GTVI  399
             GTVI
Sbjct  521   GTVI  524



>ref|XP_011088418.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088419.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088420.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088421.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088422.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088423.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
Length=526

 Score =   443 bits (1139),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 207/244 (85%), Positives = 228/244 (93%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT+++GL PQ+A  +PYIASMGVY F+T+VLL+LLRW YPT+NDFGSEI+PAAVKE
Sbjct  283   AMQVDTSIIGLSPQEALRSPYIASMGVYAFKTNVLLKLLRWSYPTANDFGSEIIPAAVKE  342

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
              NVQAYIFRDYWEDIGTIKSFY+ANLALT+EFPKFEFYDPKTPFYTSPRFLPPTKIDNCK
Sbjct  343   QNVQAYIFRDYWEDIGTIKSFYDANLALTDEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  402

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLREC VEHSI+GERSRLD GVELKD+LMMGAD Y+TESEIASLLA G V
Sbjct  403   IKDAIISHGCFLRECIVEHSIVGERSRLDSGVELKDSLMMGADYYQTESEIASLLAQGKV  462

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+G+G NTKIRN IIDKN RIGKDV+I NKDGVQE+DRP+EGFYIRSGITII+EKATI D
Sbjct  463   PMGIGRNTKIRNCIIDKNARIGKDVIIKNKDGVQEADRPEEGFYIRSGITIIVEKATISD  522

Query  410   GTVI  399
             GTVI
Sbjct  523   GTVI  526



>gb|ABC26921.1| ADPglucose pyrophosphorylase large subunit [Solanum lycopersicum]
 gb|ABC26922.1| ADPglucose pyrophosphorylase large subunit [Solanum lycopersicum]
Length=524

 Score =   442 bits (1138),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 230/244 (94%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTL+GL PQDA+ +PYIASMGVYVF+TDVLL+LL+W YPTSNDFGSEI+PAA+ +
Sbjct  281   AMQVDTTLVGLSPQDAKKSPYIASMGVYVFKTDVLLKLLKWSYPTSNDFGSEIIPAAIDD  340

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAYIF+DYWEDIGTIKSFYNA+LALT+EFP+F+FYDPKTPFYTSPRFLPPTKIDNCK
Sbjct  341   YNVQAYIFKDYWEDIGTIKSFYNASLALTQEFPEFQFYDPKTPFYTSPRFLPPTKIDNCK  400

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLR+CTVEHSI+GERSRLDCGVELKDT MMGAD Y+TESEIASLLA+G V
Sbjct  401   IKDAIISHGCFLRDCTVEHSIVGERSRLDCGVELKDTFMMGADYYQTESEIASLLAEGKV  460

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+GENTKIR  IIDKN +IGK+V I+NKDGVQE+DRP+EGFYIRSGI II EKATI D
Sbjct  461   PIGIGENTKIRKCIIDKNAKIGKNVSIINKDGVQEADRPEEGFYIRSGIIIISEKATIRD  520

Query  410   GTVI  399
             GTVI
Sbjct  521   GTVI  524



>ref|XP_006365120.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Solanum tuberosum]
 ref|XP_006365121.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Solanum tuberosum]
Length=527

 Score =   442 bits (1137),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 204/244 (84%), Positives = 231/244 (95%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTL+GL PQDA+ +PYIASMGVYVF+TDVLL+LL+W YPTSNDFGSEI+PAA+ +
Sbjct  284   AMQVDTTLVGLSPQDAKKSPYIASMGVYVFKTDVLLKLLKWSYPTSNDFGSEIIPAAIDD  343

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAYIF+DYWEDIGTIKSFYNA+LALT+EFP+F+FYDPKTPFYTSPRFLPPTKIDNCK
Sbjct  344   YNVQAYIFKDYWEDIGTIKSFYNASLALTQEFPEFQFYDPKTPFYTSPRFLPPTKIDNCK  403

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLR+C+VEHSI+GERSRLDCGVELKDT MMGAD Y+TESEIASLLA+G V
Sbjct  404   IKDAIISHGCFLRDCSVEHSIVGERSRLDCGVELKDTFMMGADYYQTESEIASLLAEGKV  463

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+GENTKIR  IIDKN +IGK+V I+NKDGVQE+DRP+EGFYIRSGI II+EKATI D
Sbjct  464   PIGIGENTKIRKCIIDKNAKIGKNVSIINKDGVQEADRPEEGFYIRSGIIIILEKATIRD  523

Query  410   GTVI  399
             GTVI
Sbjct  524   GTVI  527



>ref|NP_001233918.1| ADP-glucose pyrophosphorylase large subunit [Solanum lycopersicum]
 gb|AAB40723.1| ADP-glucose pyrophosphorylase large subunit [Solanum lycopersicum]
Length=516

 Score =   441 bits (1135),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 205/255 (80%), Positives = 234/255 (92%), Gaps = 0/255 (0%)
 Frame = -3

Query  1163  SFARSLKVLI*AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDF  984
              FA + +  + AM VDT+L+GL PQDA+ +PYIASMGVYVF+TDVLL+LL+W YPTSNDF
Sbjct  262   QFAENQRFELKAMLVDTSLVGLSPQDAKKSPYIASMGVYVFKTDVLLKLLKWSYPTSNDF  321

Query  983   GSEILPAAVKEHNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPR  804
             GSEI+PAA+ ++NVQAYIF+DYWEDIGTIKSFYNA+LALT+EFP+F+FYDPKTPFYTSPR
Sbjct  322   GSEIIPAAIDDYNVQAYIFKDYWEDIGTIKSFYNASLALTQEFPEFQFYDPKTPFYTSPR  381

Query  803   FLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETES  624
             FLPPTKIDNCKIKDAIISHGCFLR+CTVEHSI+GERSRLDCGVELKDT MMGAD Y+TES
Sbjct  382   FLPPTKIDNCKIKDAIISHGCFLRDCTVEHSIVGERSRLDCGVELKDTFMMGADYYQTES  441

Query  623   EIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGI  444
             EIASLLA+G VPIG+GENTKIR  IIDKN +IGK+V I+NKDGVQE+DRP+EGFYIRSGI
Sbjct  442   EIASLLAEGKVPIGIGENTKIRKCIIDKNAKIGKNVSIINKDGVQEADRPEEGFYIRSGI  501

Query  443   TIIMEKATIPDGTVI  399
              II EKATI DGTVI
Sbjct  502   IIISEKATIRDGTVI  516



>gb|KJB32481.1| hypothetical protein B456_005G244900 [Gossypium raimondii]
Length=395

 Score =   436 bits (1120),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 229/244 (94%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DTTLLGL PQ+A  +PYIASMGVYVFRTDVLL+LLRWRYPTSNDFGSEI+PAAV E
Sbjct  152   AMQTDTTLLGLSPQEAMKSPYIASMGVYVFRTDVLLKLLRWRYPTSNDFGSEIIPAAVME  211

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             ++VQAYIF+DYWEDIGTI+SFY ANLALTEEFP+FEFYDPKTPFYTSPR+LPPTKID C+
Sbjct  212   YDVQAYIFKDYWEDIGTIRSFYEANLALTEEFPRFEFYDPKTPFYTSPRYLPPTKIDKCR  271

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLREC+V+HSI+GERSRLD GVEL+DT+M+GAD Y+TE EIASLLA+G V
Sbjct  272   IKDAIISHGCFLRECSVQHSIVGERSRLDYGVELQDTVMLGADYYQTEPEIASLLAEGKV  331

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G N+KIRN IIDKN +IGKDVVI+NKDGV+E+DRP+EGFYIRSG+TIIMEKATI D
Sbjct  332   PIGIGRNSKIRNCIIDKNAKIGKDVVIVNKDGVEEADRPEEGFYIRSGLTIIMEKATIAD  391

Query  410   GTVI  399
             GTVI
Sbjct  392   GTVI  395



>gb|KDO42003.1| hypothetical protein CISIN_1g0097201mg [Citrus sinensis]
Length=353

 Score =   434 bits (1116),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 204/244 (84%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT+LLG  PQ+AR  PY+ASMGVYVF+ DVL +LLRWRYPTSNDFGSEI+PAA+ E
Sbjct  110   AMQVDTSLLGFSPQEARKCPYVASMGVYVFKKDVLFKLLRWRYPTSNDFGSEIIPAAIME  169

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQAYIFRDYWEDIGTIKSFY AN+ALT+E P F FYDPKTPFYTSPRFLPPTKIDNC+
Sbjct  170   HDVQAYIFRDYWEDIGTIKSFYEANMALTKESPAFHFYDPKTPFYTSPRFLPPTKIDNCR  229

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLRECTVEHSI+GERSRLD GVELKDT+M+GAD Y+TESEIASLLA+G V
Sbjct  230   IKDAIISHGCFLRECTVEHSIVGERSRLDYGVELKDTVMLGADYYQTESEIASLLAEGKV  289

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG NTKIRN IIDKNV+IGKDVVI+NKD VQE+DRP+ GFYIRSGITIIMEKATI D
Sbjct  290   PIGVGRNTKIRNCIIDKNVKIGKDVVIVNKDDVQEADRPELGFYIRSGITIIMEKATIED  349

Query  410   GTVI  399
             G VI
Sbjct  350   GMVI  353



>gb|AGS94412.1| ADP-glucose pyrophosphorylase large subunit 4 [Actinidia deliciosa]
Length=524

 Score =   437 bits (1125),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 204/244 (84%), Positives = 228/244 (93%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+ DTT LGL PQDA  +PYIASMGVYVF+TD+LL+LLRWRYPTSNDFGSEI+P+AV E
Sbjct  281   AMEADTTRLGLSPQDAAQSPYIASMGVYVFKTDILLKLLRWRYPTSNDFGSEIIPSAVME  340

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+FRDYWEDIGTIKSFY+ANLAL EE PKF FYDPKTPF+TSPRFLPPTKID CK
Sbjct  341   HNVQAYVFRDYWEDIGTIKSFYDANLALAEECPKFSFYDPKTPFFTSPRFLPPTKIDRCK  400

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKD+IISHGCFLREC+VEHSI+GERSRLD GVELKDTLMMGAD Y+TESEIASLLA+GN+
Sbjct  401   IKDSIISHGCFLRECSVEHSIVGERSRLDYGVELKDTLMMGADYYQTESEIASLLAEGNI  460

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKIRN IIDKN +IGK VVI+NKDGV+E+D+PD+GFYIRSGITII+EKATI D
Sbjct  461   PIGVGKNTKIRNCIIDKNAKIGKGVVIVNKDGVEEADQPDQGFYIRSGITIILEKATITD  520

Query  410   GTVI  399
             GTVI
Sbjct  521   GTVI  524



>gb|AAD56042.1|AF184598_1 ADP-glucose pyrophosphorylase large subunit [Citrus unshiu]
Length=531

 Score =   437 bits (1124),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 204/244 (84%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT+LLG  PQ+AR +PY+ASMGVYVF+ DVLL+LLRWRYPTSNDFGSEI+PAA+ E
Sbjct  288   AMQVDTSLLGFSPQEARKSPYVASMGVYVFKKDVLLKLLRWRYPTSNDFGSEIIPAAIME  347

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQAYIFRDYWEDIGTIKSFY AN+ALT+E P F FYDPKTPFYTSPRFLPPTKIDNC+
Sbjct  348   HDVQAYIFRDYWEDIGTIKSFYEANMALTKESPAFHFYDPKTPFYTSPRFLPPTKIDNCR  407

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             +KDAIISHGCFLRECTVEHSI+GERSR+D GVELKDT+M+GAD Y+TESEIASLLA+G V
Sbjct  408   MKDAIISHGCFLRECTVEHSIVGERSRIDYGVELKDTVMLGADYYQTESEIASLLAEGKV  467

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG NTKIRN IIDKNV+IGKDVVI+NKDGVQE+DRP+ GFYIRSGITIIMEKATI D
Sbjct  468   PIGVGRNTKIRNCIIDKNVKIGKDVVIVNKDGVQEADRPELGFYIRSGITIIMEKATIED  527

Query  410   GTVI  399
             G VI
Sbjct  528   GMVI  531



>gb|KDO42001.1| hypothetical protein CISIN_1g0097201mg, partial [Citrus sinensis]
Length=419

 Score =   432 bits (1112),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 204/244 (84%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT+LLG  PQ+AR  PY+ASMGVYVF+ DVL +LLRWRYPTSNDFGSEI+PAA+ E
Sbjct  176   AMQVDTSLLGFSPQEARKCPYVASMGVYVFKKDVLFKLLRWRYPTSNDFGSEIIPAAIME  235

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQAYIFRDYWEDIGTIKSFY AN+ALT+E P F FYDPKTPFYTSPRFLPPTKIDNC+
Sbjct  236   HDVQAYIFRDYWEDIGTIKSFYEANMALTKESPAFHFYDPKTPFYTSPRFLPPTKIDNCR  295

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLRECTVEHSI+GERSRLD GVELKDT+M+GAD Y+TESEIASLLA+G V
Sbjct  296   IKDAIISHGCFLRECTVEHSIVGERSRLDYGVELKDTVMLGADYYQTESEIASLLAEGKV  355

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG NTKIRN IIDKNV+IGKDVVI+NKD VQE+DRP+ GFYIRSGITIIMEKATI D
Sbjct  356   PIGVGRNTKIRNCIIDKNVKIGKDVVIVNKDDVQEADRPELGFYIRSGITIIMEKATIED  415

Query  410   GTVI  399
             G VI
Sbjct  416   GMVI  419



>ref|NP_001275823.1| glucose-1-phosphate adenylyltransferase large subunit 1-like 
[Citrus sinensis]
 gb|ACF77017.1| ADP-glucose pyrophosphorylase large subunit [Citrus sinensis]
Length=527

 Score =   436 bits (1121),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 204/244 (84%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT+LLG  PQ+AR  PY+ASMGVYVF+ DVLL+LLRWRYPTSNDFGSEI+PAA+ E
Sbjct  284   AMQVDTSLLGFSPQEARKCPYVASMGVYVFKKDVLLKLLRWRYPTSNDFGSEIIPAAIME  343

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQAYIFRDYWEDIGTIKSFY AN+ALT+E P F FYDPKTPFYTSPRFLPPTKIDNC+
Sbjct  344   HDVQAYIFRDYWEDIGTIKSFYEANMALTKESPAFHFYDPKTPFYTSPRFLPPTKIDNCR  403

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             +KDAIISHGCFLRECTVEHSI+GERSR+D GVELKDT+M+GAD Y+TESEIASLLA+G V
Sbjct  404   MKDAIISHGCFLRECTVEHSIVGERSRIDYGVELKDTVMLGADYYQTESEIASLLAEGKV  463

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG NTKIRN IIDKNV+IGKDVVI+NKDGVQE+DRP+ GFYIRSGITIIMEKATI D
Sbjct  464   PIGVGRNTKIRNCIIDKNVKIGKDVVIVNKDGVQEADRPELGFYIRSGITIIMEKATIED  523

Query  410   GTVI  399
             G VI
Sbjct  524   GMVI  527



>gb|KHG23571.1| Glucose-1-phosphate adenylyltransferase large subunit 3, chloroplastic 
-like protein [Gossypium arboreum]
Length=526

 Score =   436 bits (1121),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 228/244 (93%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DTTLLGL PQ+A  +PYIASMGVYVFRTDVLL+LLRWRYP SNDFGSEI+PAAV E
Sbjct  283   AMQTDTTLLGLSPQEAMRSPYIASMGVYVFRTDVLLKLLRWRYPASNDFGSEIIPAAVME  342

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQAYIF+DYWEDIGTI+SFY ANLALTEEFPKFEFYDPKTPFYTSPR+LPPTKID C+
Sbjct  343   HDVQAYIFKDYWEDIGTIRSFYEANLALTEEFPKFEFYDPKTPFYTSPRYLPPTKIDKCR  402

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLREC+V+HSI+GERSRLD GVEL+DT+M+GAD Y+TE EIASLLA+G V
Sbjct  403   IKDAIISHGCFLRECSVQHSIVGERSRLDYGVELQDTVMLGADYYQTEPEIASLLAEGKV  462

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G N+KIRN IIDKN +IGKDVVI+NKDGV+E+DRP+EGFYIRSG+TIIMEKATI D
Sbjct  463   PIGIGRNSKIRNCIIDKNAKIGKDVVIVNKDGVEEADRPEEGFYIRSGLTIIMEKATIAD  522

Query  410   GTVI  399
             GTVI
Sbjct  523   GTVI  526



>gb|KDO41998.1| hypothetical protein CISIN_1g0097201mg, partial [Citrus sinensis]
Length=449

 Score =   432 bits (1112),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 204/244 (84%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT+LLG  PQ+AR  PY+ASMGVYVF+ DVL +LLRWRYPTSNDFGSEI+PAA+ E
Sbjct  206   AMQVDTSLLGFSPQEARKCPYVASMGVYVFKKDVLFKLLRWRYPTSNDFGSEIIPAAIME  265

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQAYIFRDYWEDIGTIKSFY AN+ALT+E P F FYDPKTPFYTSPRFLPPTKIDNC+
Sbjct  266   HDVQAYIFRDYWEDIGTIKSFYEANMALTKESPAFHFYDPKTPFYTSPRFLPPTKIDNCR  325

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLRECTVEHSI+GERSRLD GVELKDT+M+GAD Y+TESEIASLLA+G V
Sbjct  326   IKDAIISHGCFLRECTVEHSIVGERSRLDYGVELKDTVMLGADYYQTESEIASLLAEGKV  385

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG NTKIRN IIDKNV+IGKDVVI+NKD VQE+DRP+ GFYIRSGITIIMEKATI D
Sbjct  386   PIGVGRNTKIRNCIIDKNVKIGKDVVIVNKDDVQEADRPELGFYIRSGITIIMEKATIED  445

Query  410   GTVI  399
             G VI
Sbjct  446   GMVI  449



>ref|XP_007042146.1| Glucose-1-phosphate adenylyltransferase family protein [Theobroma 
cacao]
 gb|EOX97977.1| Glucose-1-phosphate adenylyltransferase family protein [Theobroma 
cacao]
Length=526

 Score =   435 bits (1119),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 204/244 (84%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DTTLLGL PQ+A  +PYIASMGVYVF+TDVLL+LLRWR+PTSNDFGSEI+PAAV E
Sbjct  283   AMQTDTTLLGLSPQEAMRSPYIASMGVYVFKTDVLLKLLRWRFPTSNDFGSEIIPAAVME  342

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQAYIFRDYWEDIGTIKSFY+ANLALTEE PKFEFYDPKTPFYTSPR+LPPTKID C+
Sbjct  343   HDVQAYIFRDYWEDIGTIKSFYDANLALTEELPKFEFYDPKTPFYTSPRYLPPTKIDKCQ  402

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLREC V+HSI+GERSRLD GVEL+DT+M+GAD Y+TESEIASLLA+G V
Sbjct  403   IKDAIISHGCFLRECNVQHSIVGERSRLDYGVELQDTVMLGADYYQTESEIASLLAEGKV  462

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKIR  IIDKN +IGKDVVI+NKD VQE+DRP+EGFYIRSGITII EKATI D
Sbjct  463   PIGIGRNTKIRTCIIDKNAKIGKDVVIVNKDDVQEADRPEEGFYIRSGITIIQEKATIED  522

Query  410   GTVI  399
             GTVI
Sbjct  523   GTVI  526



>gb|KJB32482.1| hypothetical protein B456_005G244900 [Gossypium raimondii]
Length=521

 Score =   434 bits (1116),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 229/244 (94%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DTTLLGL PQ+A  +PYIASMGVYVFRTDVLL+LLRWRYPTSNDFGSEI+PAAV E
Sbjct  278   AMQTDTTLLGLSPQEAMKSPYIASMGVYVFRTDVLLKLLRWRYPTSNDFGSEIIPAAVME  337

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             ++VQAYIF+DYWEDIGTI+SFY ANLALTEEFP+FEFYDPKTPFYTSPR+LPPTKID C+
Sbjct  338   YDVQAYIFKDYWEDIGTIRSFYEANLALTEEFPRFEFYDPKTPFYTSPRYLPPTKIDKCR  397

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLREC+V+HSI+GERSRLD GVEL+DT+M+GAD Y+TE EIASLLA+G V
Sbjct  398   IKDAIISHGCFLRECSVQHSIVGERSRLDYGVELQDTVMLGADYYQTEPEIASLLAEGKV  457

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G N+KIRN IIDKN +IGKDVVI+NKDGV+E+DRP+EGFYIRSG+TIIMEKATI D
Sbjct  458   PIGIGRNSKIRNCIIDKNAKIGKDVVIVNKDGVEEADRPEEGFYIRSGLTIIMEKATIAD  517

Query  410   GTVI  399
             GTVI
Sbjct  518   GTVI  521



>gb|KJB32479.1| hypothetical protein B456_005G244900 [Gossypium raimondii]
 gb|KJB32480.1| hypothetical protein B456_005G244900 [Gossypium raimondii]
Length=524

 Score =   434 bits (1116),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 229/244 (94%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DTTLLGL PQ+A  +PYIASMGVYVFRTDVLL+LLRWRYPTSNDFGSEI+PAAV E
Sbjct  281   AMQTDTTLLGLSPQEAMKSPYIASMGVYVFRTDVLLKLLRWRYPTSNDFGSEIIPAAVME  340

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             ++VQAYIF+DYWEDIGTI+SFY ANLALTEEFP+FEFYDPKTPFYTSPR+LPPTKID C+
Sbjct  341   YDVQAYIFKDYWEDIGTIRSFYEANLALTEEFPRFEFYDPKTPFYTSPRYLPPTKIDKCR  400

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLREC+V+HSI+GERSRLD GVEL+DT+M+GAD Y+TE EIASLLA+G V
Sbjct  401   IKDAIISHGCFLRECSVQHSIVGERSRLDYGVELQDTVMLGADYYQTEPEIASLLAEGKV  460

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G N+KIRN IIDKN +IGKDVVI+NKDGV+E+DRP+EGFYIRSG+TIIMEKATI D
Sbjct  461   PIGIGRNSKIRNCIIDKNAKIGKDVVIVNKDGVEEADRPEEGFYIRSGLTIIMEKATIAD  520

Query  410   GTVI  399
             GTVI
Sbjct  521   GTVI  524



>ref|XP_010088945.1| Glucose-1-phosphate adenylyltransferase large subunit 3 [Morus 
notabilis]
 gb|EXB37149.1| Glucose-1-phosphate adenylyltransferase large subunit 3 [Morus 
notabilis]
Length=535

 Score =   434 bits (1116),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
              MQ DT+LLGL  QDA  +PYIASMGVY F+T++LL+LLRWRYPTSNDFGSEI+PAAV+E
Sbjct  292   GMQADTSLLGLSKQDAMKSPYIASMGVYAFKTEILLKLLRWRYPTSNDFGSEIIPAAVEE  351

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQAY+FRDYWEDIGTIKSFY+ANLALTEEFPKFEFYDPKTPF+TSPRFLPPTKID C+
Sbjct  352   HDVQAYMFRDYWEDIGTIKSFYDANLALTEEFPKFEFYDPKTPFFTSPRFLPPTKIDKCR  411

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+ SI+GERSRLD GVELKDT+MMGAD Y+TESEIASLLA+G V
Sbjct  412   IVDAIISHGCFLRECSVQRSIVGERSRLDYGVELKDTIMMGADYYQTESEIASLLAEGKV  471

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G+NTKIRN IIDKNV+IGKDVVI NKDGV E+DRP+EGFYIRSGITII+EKATI D
Sbjct  472   PIGIGQNTKIRNCIIDKNVKIGKDVVIRNKDGVHEADRPEEGFYIRSGITIIVEKATIED  531

Query  410   GTVI  399
             GTVI
Sbjct  532   GTVI  535



>ref|XP_006423322.1| hypothetical protein CICLE_v10028195mg [Citrus clementina]
 ref|XP_006487217.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Citrus sinensis]
 gb|ESR36562.1| hypothetical protein CICLE_v10028195mg [Citrus clementina]
Length=527

 Score =   434 bits (1115),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 204/244 (84%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT+LLG  PQ+AR  PY+ASMGVYVF+ DVL +LLRWRYPTSNDFGSEI+PAA+ E
Sbjct  284   AMQVDTSLLGFSPQEARKCPYVASMGVYVFKKDVLFKLLRWRYPTSNDFGSEIIPAAIME  343

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQAYIFRDYWEDIGTIKSFY AN+ALT+E P F FYDPKTPFYTSPRFLPPTKIDNC+
Sbjct  344   HDVQAYIFRDYWEDIGTIKSFYEANMALTKESPAFHFYDPKTPFYTSPRFLPPTKIDNCR  403

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLRECTVEHSI+GERSRLD GVELKDT+M+GAD Y+TESEIASLLA+G V
Sbjct  404   IKDAIISHGCFLRECTVEHSIVGERSRLDYGVELKDTVMLGADYYQTESEIASLLAEGKV  463

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG NTKIRN IIDKNV+IGKDVVI+NKD VQE+DRP+ GFYIRSGITIIMEKATI D
Sbjct  464   PIGVGRNTKIRNCIIDKNVKIGKDVVIVNKDDVQEADRPELGFYIRSGITIIMEKATIED  523

Query  410   GTVI  399
             G VI
Sbjct  524   GMVI  527



>ref|XP_003541029.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Glycine max]
 gb|KHN25384.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Glycine 
soja]
Length=528

 Score =   433 bits (1114),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 228/244 (93%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGLPP +A+ +PYIASMGVYVF+TDVLL+LL+WRYPTSNDFGSEI+PAAV+E
Sbjct  285   AMQVDTSVLGLPPHEAKRSPYIASMGVYVFKTDVLLKLLKWRYPTSNDFGSEIIPAAVRE  344

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAY F DYWEDIGTIKSFY+ANLALTEE P F+FYDPKTP YTSPRFLPPTKID C+
Sbjct  345   NNVQAYFFNDYWEDIGTIKSFYDANLALTEENPMFKFYDPKTPIYTSPRFLPPTKIDKCR  404

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLRECTV+HSI+GERSRLD GVEL+DT+MMGAD Y+TESEIASLLA+G V
Sbjct  405   IVDAIISHGCFLRECTVQHSIVGERSRLDYGVELQDTVMMGADYYQTESEIASLLAEGKV  464

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKIRN IIDKN +IGKDV+IMNKDGVQE+DRP++GFYIRSGIT+I+EKATI D
Sbjct  465   PIGIGRNTKIRNCIIDKNAKIGKDVIIMNKDGVQEADRPEDGFYIRSGITVILEKATIED  524

Query  410   GTVI  399
             GTVI
Sbjct  525   GTVI  528



>gb|KJB79161.1| hypothetical protein B456_013G035800 [Gossypium raimondii]
 gb|KJB79162.1| hypothetical protein B456_013G035800 [Gossypium raimondii]
 gb|KJB79163.1| hypothetical protein B456_013G035800 [Gossypium raimondii]
Length=528

 Score =   433 bits (1114),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 201/244 (82%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DTTLLGL PQ+A   PYIASMGVYVF+TDVLL+LLRWR+PTSNDFGSEI+PAAVKE
Sbjct  285   AMQTDTTLLGLSPQEAASCPYIASMGVYVFKTDVLLKLLRWRFPTSNDFGSEIIPAAVKE  344

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQAYIF+DYWEDIGTIKSFY ANLALTEEFPKFEFYDPKTPFYTSPR+LPPTKID C+
Sbjct  345   HDVQAYIFKDYWEDIGTIKSFYEANLALTEEFPKFEFYDPKTPFYTSPRYLPPTKIDKCR  404

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLREC+V+HS+IGERSRLD GVEL+DT+MMGAD Y+TE EI SLLA+G V
Sbjct  405   IKDAIISHGCFLRECSVQHSVIGERSRLDSGVELQDTVMMGADYYQTELEIISLLAEGKV  464

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKI N IIDKN +IG+DV+I NKDGVQE+DR DEGFYIRSGITII++KATI D
Sbjct  465   PIGIGHNTKISNCIIDKNAKIGRDVIIANKDGVQEADRSDEGFYIRSGITIILDKATIKD  524

Query  410   GTVI  399
             GT+I
Sbjct  525   GTII  528



>ref|XP_012067244.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Jatropha curcas]
 ref|XP_012067246.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Jatropha curcas]
 gb|KDP41770.1| hypothetical protein JCGZ_26788 [Jatropha curcas]
Length=527

 Score =   433 bits (1113),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 207/260 (80%), Positives = 228/260 (88%), Gaps = 11/260 (4%)
 Frame = -3

Query  1178  GAELSSFARSLKVLI*AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYP  999
             GAEL S           MQ DTT +GL PQDA  +PYIASMGVYVFRT++LL+LLRWRYP
Sbjct  279   GAELKS-----------MQTDTTRVGLSPQDALESPYIASMGVYVFRTEILLKLLRWRYP  327

Query  998   TSNDFGSEILPAAVKEHNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPF  819
             TSNDFGSEI+PAAV EHNVQAYIF+DYWEDIGTIKSFY ANLAL EE PKFEFYDPKTPF
Sbjct  328   TSNDFGSEIIPAAVAEHNVQAYIFKDYWEDIGTIKSFYEANLALAEEPPKFEFYDPKTPF  387

Query  818   YTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADN  639
             YTSPRFLPPTK+D C+I DAIISHGCFLRECT++HS++GERSRLD GVELKDT+M+GAD 
Sbjct  388   YTSPRFLPPTKMDKCRIVDAIISHGCFLRECTIQHSVVGERSRLDYGVELKDTVMLGADY  447

Query  638   YETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFY  459
             Y+TE+EIASLLADG VPIGVG NTKI+N IIDKN +IGKDVVIMNKDGVQE+DRP+EGFY
Sbjct  448   YQTEAEIASLLADGKVPIGVGRNTKIKNCIIDKNAKIGKDVVIMNKDGVQEADRPEEGFY  507

Query  458   IRSGITIIMEKATIPDGTVI  399
             IRSGITII EKATI DG VI
Sbjct  508   IRSGITIIAEKATIEDGIVI  527



>gb|KHF99865.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Gossypium 
arboreum]
 gb|KHG27467.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Gossypium 
arboreum]
Length=528

 Score =   433 bits (1113),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DTTLLGL PQ+A   PYIASMGVYVF+TDVLL+LLRWR+PTSNDFGSEI+PAAVKE
Sbjct  285   AMQTDTTLLGLSPQEAASCPYIASMGVYVFKTDVLLKLLRWRFPTSNDFGSEIIPAAVKE  344

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQAYIF+DYWEDIGTIKSFY ANLALTEEFPKFEFYDPKTPFYTSPR+LPPTKID C+
Sbjct  345   HDVQAYIFKDYWEDIGTIKSFYEANLALTEEFPKFEFYDPKTPFYTSPRYLPPTKIDKCR  404

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLREC+V+HS+IGERSRLD GVEL+DT+MMGAD Y+TE EI SLLA+G V
Sbjct  405   IKDAIISHGCFLRECSVQHSVIGERSRLDSGVELQDTVMMGADYYQTELEIISLLAEGKV  464

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKI N IIDKN +IG+DV+I NKDGVQE+DR DEGFYIRSGIT+I++KATI D
Sbjct  465   PIGIGHNTKISNCIIDKNAKIGRDVIIANKDGVQEADRSDEGFYIRSGITVILDKATIKD  524

Query  410   GTVI  399
             GT+I
Sbjct  525   GTII  528



>ref|XP_009345666.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009345667.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Pyrus x bretschneideri]
Length=519

 Score =   430 bits (1105),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DTTLLGL PQDA   PY+ASMGVYVF+T++LL LLRWRYPTSNDFGSEI+PAAV+E
Sbjct  276   AMQADTTLLGLSPQDALKAPYVASMGVYVFKTEILLNLLRWRYPTSNDFGSEIIPAAVRE  335

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H VQAY+FRDYWEDIGTIKSFY+ANLALT+E PKFEFYDPKTP +TSPRFLPPTKID C+
Sbjct  336   HKVQAYMFRDYWEDIGTIKSFYDANLALTDEIPKFEFYDPKTPIFTSPRFLPPTKIDKCR  395

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFL+EC+V+HSI+GERSRL+ GVELKD +MMGADNY+TESEIASLLADG V
Sbjct  396   IVDAIISHGCFLQECSVQHSIVGERSRLNYGVELKDAIMMGADNYQTESEIASLLADGEV  455

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKIRN IIDKN RIGKDV+I+NKDGVQE+DRP++GFYIR GITII+EKATI D
Sbjct  456   PIGIGSNTKIRNCIIDKNARIGKDVMIVNKDGVQEADRPEDGFYIREGITIILEKATIED  515

Query  410   GTVI  399
             G +I
Sbjct  516   GMII  519



>ref|XP_003537869.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Glycine max]
 ref|XP_006590891.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Glycine max]
 gb|KHN39792.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Glycine 
soja]
Length=530

 Score =   430 bits (1106),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGLP  +A+ +PYIASMGVYVF+TDVLLRLL+WRYPTSNDFGSEI+PAAV+E
Sbjct  287   AMQVDTSVLGLPLHEAKRSPYIASMGVYVFKTDVLLRLLKWRYPTSNDFGSEIIPAAVRE  346

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAY F DYWEDIGTIKSFY+ANLALTEE P F+FYDPKTP YTSPRFLPPTKID C+
Sbjct  347   NNVQAYFFIDYWEDIGTIKSFYDANLALTEENPMFKFYDPKTPIYTSPRFLPPTKIDKCR  406

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLRECTV+HSI+GERSRLD GVEL+DT+MMGAD Y+TESEIASLLA+G V
Sbjct  407   IVDAIISHGCFLRECTVQHSIVGERSRLDYGVELQDTVMMGADYYQTESEIASLLAEGKV  466

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKIRN IIDKN +IGKDV+IMNKDGVQE+DRP++GFYIRSGIT+I+EKATI D
Sbjct  467   PIGIGRNTKIRNCIIDKNAKIGKDVIIMNKDGVQEADRPEDGFYIRSGITVILEKATIED  526

Query  410   GTVI  399
             GTVI
Sbjct  527   GTVI  530



>ref|XP_009345668.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Pyrus x bretschneideri]
Length=517

 Score =   429 bits (1104),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DTTLLGL PQDA   PY+ASMGVYVF+T++LL LLRWRYPTSNDFGSEI+PAAV+E
Sbjct  274   AMQADTTLLGLSPQDALKAPYVASMGVYVFKTEILLNLLRWRYPTSNDFGSEIIPAAVRE  333

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H VQAY+FRDYWEDIGTIKSFY+ANLALT+E PKFEFYDPKTP +TSPRFLPPTKID C+
Sbjct  334   HKVQAYMFRDYWEDIGTIKSFYDANLALTDEIPKFEFYDPKTPIFTSPRFLPPTKIDKCR  393

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFL+EC+V+HSI+GERSRL+ GVELKD +MMGADNY+TESEIASLLADG V
Sbjct  394   IVDAIISHGCFLQECSVQHSIVGERSRLNYGVELKDAIMMGADNYQTESEIASLLADGEV  453

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKIRN IIDKN RIGKDV+I+NKDGVQE+DRP++GFYIR GITII+EKATI D
Sbjct  454   PIGIGSNTKIRNCIIDKNARIGKDVMIVNKDGVQEADRPEDGFYIREGITIILEKATIED  513

Query  410   GTVI  399
             G +I
Sbjct  514   GMII  517



>gb|AAB91467.1| ADP-glucose pyrophosphorylase large subunit 1 [Citrullus lanatus 
subsp. vulgaris]
Length=526

 Score =   429 bits (1103),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDTT  GL  +++  +PYIASMGVYVF+TD+LL LL+WRYPTSNDFGSEI+PAAVKE
Sbjct  283   AMRVDTTSFGLSREESLKSPYIASMGVYVFKTDILLNLLKWRYPTSNDFGSEIIPAAVKE  342

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAYIFRDYWEDIG+IK+FY+ANLALTEEFPKFEFYDPKTP YTSPRFLPPTKID C+
Sbjct  343   HNVQAYIFRDYWEDIGSIKTFYDANLALTEEFPKFEFYDPKTPIYTSPRFLPPTKIDKCQ  402

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+GERSRLD GVELKDT+MMGAD Y+TE EIA LLA+G V
Sbjct  403   IVDAIISHGCFLRECSVQHSIVGERSRLDYGVELKDTIMMGADTYQTEPEIAGLLAEGKV  462

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKIRN IIDKN +IGKDVVIMNK+GVQE+DRP++GFYIRSGITII+EKATI D
Sbjct  463   PIGIGRNTKIRNCIIDKNAKIGKDVVIMNKEGVQEADRPEQGFYIRSGITIILEKATIED  522

Query  410   GTVI  399
             GTVI
Sbjct  523   GTVI  526



>ref|XP_008385898.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Malus domestica]
 ref|XP_008385899.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Malus domestica]
 ref|XP_008385900.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Malus domestica]
Length=519

 Score =   429 bits (1102),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DTTLLGL PQDA   PY+ASMGVYVF+T++LL LLRWRYPTSNDFGSEI+PAAV+E
Sbjct  276   AMQADTTLLGLSPQDALKTPYVASMGVYVFKTEILLNLLRWRYPTSNDFGSEIIPAAVRE  335

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H VQAY+FRDYWEDIGTIKSFY+ANLALTEE PKFEFYDPKTP +TSPRFLPPTKID C+
Sbjct  336   HKVQAYMFRDYWEDIGTIKSFYDANLALTEEIPKFEFYDPKTPIFTSPRFLPPTKIDKCR  395

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFL+EC+V+HSI+GERSRL+ GVELKD +MMGADNY+TESEIASLLADG V
Sbjct  396   IVDAIISHGCFLQECSVQHSIVGERSRLNYGVELKDAIMMGADNYQTESEIASLLADGEV  455

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKIRN IIDKN +IGKDV+I+NK+GVQE+DRP++GFYIR GITII+EKATI D
Sbjct  456   PIGIGSNTKIRNCIIDKNAKIGKDVMIVNKEGVQEADRPEDGFYIREGITIILEKATIED  515

Query  410   GTVI  399
             G +I
Sbjct  516   GMII  519



>ref|XP_008385901.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Malus domestica]
Length=517

 Score =   428 bits (1101),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DTTLLGL PQDA   PY+ASMGVYVF+T++LL LLRWRYPTSNDFGSEI+PAAV+E
Sbjct  274   AMQADTTLLGLSPQDALKTPYVASMGVYVFKTEILLNLLRWRYPTSNDFGSEIIPAAVRE  333

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H VQAY+FRDYWEDIGTIKSFY+ANLALTEE PKFEFYDPKTP +TSPRFLPPTKID C+
Sbjct  334   HKVQAYMFRDYWEDIGTIKSFYDANLALTEEIPKFEFYDPKTPIFTSPRFLPPTKIDKCR  393

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFL+EC+V+HSI+GERSRL+ GVELKD +MMGADNY+TESEIASLLADG V
Sbjct  394   IVDAIISHGCFLQECSVQHSIVGERSRLNYGVELKDAIMMGADNYQTESEIASLLADGEV  453

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKIRN IIDKN +IGKDV+I+NK+GVQE+DRP++GFYIR GITII+EKATI D
Sbjct  454   PIGIGSNTKIRNCIIDKNAKIGKDVMIVNKEGVQEADRPEDGFYIREGITIILEKATIED  513

Query  410   GTVI  399
             G +I
Sbjct  514   GMII  517



>gb|AAF66436.1|AF249917_1 ADP-glucose pyrophosphorylase large subunit [Perilla frutescens]
Length=527

 Score =   428 bits (1100),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDT+++GL P++A  +PYIASMGVY F+TDVLL+LLRWRYPTSNDFGSEI+P++VKE
Sbjct  284   AMEVDTSIIGLSPEEALKSPYIASMGVYAFKTDVLLKLLRWRYPTSNDFGSEIIPSSVKE  343

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAYIFRDYWEDIGTIKSFY+ANLALT+EFPKFEFYDPKTPFYTS RFLPPTKIDNCK
Sbjct  344   HNVQAYIFRDYWEDIGTIKSFYDANLALTDEFPKFEFYDPKTPFYTSLRFLPPTKIDNCK  403

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLREC  +HSI+GERSRLD GVELKDTLMMGAD Y TESEIASLL  G V
Sbjct  404   IKDAIISHGCFLRECVCQHSILGERSRLDSGVELKDTLMMGADYYPTESEIASLLVQGKV  463

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+G+G NTKI N IIDKN RIGKDV+I NKDGV+E+DR +EGFYIRSGITI++EKATI D
Sbjct  464   PMGIGRNTKISNCIIDKNARIGKDVIIKNKDGVEEADRSEEGFYIRSGITIVVEKATIND  523

Query  410   GTVI  399
             GT+I
Sbjct  524   GTII  527



>ref|XP_002512925.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
 gb|EEF49428.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
Length=531

 Score =   428 bits (1100),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 205/260 (79%), Positives = 228/260 (88%), Gaps = 11/260 (4%)
 Frame = -3

Query  1178  GAELSSFARSLKVLI*AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYP  999
             GAEL S           ++ DTT LGL PQDA  +PYIASMGVYVFRT++LL+LLRWR+P
Sbjct  283   GAELKS-----------LKADTTQLGLSPQDALKSPYIASMGVYVFRTEILLKLLRWRFP  331

Query  998   TSNDFGSEILPAAVKEHNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPF  819
             TSNDFGSEI+PAAV EHN+Q+Y FRDYWEDIGTIKSFY ANLALTEE P FEFYDPKTPF
Sbjct  332   TSNDFGSEIIPAAVMEHNIQSYNFRDYWEDIGTIKSFYEANLALTEEPPTFEFYDPKTPF  391

Query  818   YTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADN  639
             YTSPRFLPPTKID C+I DAIISHGCFLRECTV HS++GERSRLD GVELKDT+M+GAD 
Sbjct  392   YTSPRFLPPTKIDKCRIVDAIISHGCFLRECTVRHSVVGERSRLDYGVELKDTVMLGADY  451

Query  638   YETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFY  459
             Y+TE+EIASLLA+G VPIGVG NTKI+N IIDKN +IGKDVVI+NKDGVQE+DRP+EGFY
Sbjct  452   YQTETEIASLLAEGKVPIGVGRNTKIKNCIIDKNAKIGKDVVIVNKDGVQEADRPEEGFY  511

Query  458   IRSGITIIMEKATIPDGTVI  399
             IRSGITIIMEKATI DGTVI
Sbjct  512   IRSGITIIMEKATIEDGTVI  531



>ref|XP_002306116.2| ADP-glucose pyrophosphorylase large subunit family protein [Populus 
trichocarpa]
 gb|EEE86627.2| ADP-glucose pyrophosphorylase large subunit family protein [Populus 
trichocarpa]
Length=526

 Score =   427 bits (1099),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 201/243 (83%), Positives = 223/243 (92%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             MQVDTT LGL PQDA  + YIASMGVYVF+TD+LL+LLRWRYPTSNDFGSEI+PAAV EH
Sbjct  284   MQVDTTHLGLSPQDALKSSYIASMGVYVFKTDILLKLLRWRYPTSNDFGSEIIPAAVMEH  343

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
             NVQAYIF+DYWEDIGTIKSFY ANLAL EE PKFEFYDPKTPFYTSP FLPPTKID C+I
Sbjct  344   NVQAYIFKDYWEDIGTIKSFYEANLALAEEPPKFEFYDPKTPFYTSPGFLPPTKIDKCRI  403

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
              DAIISHGCFLRECTV+HS++GERSRLD GVELKDT+M+GAD+Y+TE+EIASLLA+G VP
Sbjct  404   VDAIISHGCFLRECTVQHSVVGERSRLDYGVELKDTVMLGADHYQTEAEIASLLAEGKVP  463

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             IGVG NTKIRN IIDKN +IGKDV+I NKDGVQE+DR ++GFYIRSGITII+EKATI DG
Sbjct  464   IGVGRNTKIRNCIIDKNAKIGKDVIITNKDGVQEADREEKGFYIRSGITIILEKATIEDG  523

Query  407   TVI  399
             TVI
Sbjct  524   TVI  526



>emb|CBI37674.3| unnamed protein product [Vitis vinifera]
Length=517

 Score =   427 bits (1097),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDTT LGL PQ+A  +PYIASMGVYVF+TD+LL LLRWRYPTSNDFGSEI+P AV E
Sbjct  274   AMKVDTTRLGLSPQEAMKSPYIASMGVYVFKTDILLNLLRWRYPTSNDFGSEIIPLAVME  333

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNV+A++FRDYWEDIGTIK+FY AN+ LTEEFPKFEFY+PKTP +TSPRFLPPTKI+ C+
Sbjct  334   HNVEAFLFRDYWEDIGTIKTFYEANMGLTEEFPKFEFYNPKTPIFTSPRFLPPTKIEQCQ  393

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + DAIISHGCFLREC+V+HSI+GERSRLD GVELKDTLMMGAD Y+TESEIASLLA+GNV
Sbjct  394   VVDAIISHGCFLRECSVKHSIVGERSRLDYGVELKDTLMMGADFYQTESEIASLLAEGNV  453

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKIRN IIDKN +IGKD VI+NKDGVQE+DRPD+GFYIRSGITII+EKATI D
Sbjct  454   PIGIGRNTKIRNCIIDKNAKIGKDAVIVNKDGVQEADRPDDGFYIRSGITIILEKATIKD  513

Query  410   GTVI  399
             GTVI
Sbjct  514   GTVI  517



>ref|XP_002283855.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Vitis vinifera]
Length=527

 Score =   427 bits (1098),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDTT LGL PQ+A  +PYIASMGVYVF+TD+LL LLRWRYPTSNDFGSEI+P AV E
Sbjct  284   AMKVDTTRLGLSPQEAMKSPYIASMGVYVFKTDILLNLLRWRYPTSNDFGSEIIPLAVME  343

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNV+A++FRDYWEDIGTIK+FY AN+ LTEEFPKFEFY+PKTP +TSPRFLPPTKI+ C+
Sbjct  344   HNVEAFLFRDYWEDIGTIKTFYEANMGLTEEFPKFEFYNPKTPIFTSPRFLPPTKIEQCQ  403

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + DAIISHGCFLREC+V+HSI+GERSRLD GVELKDTLMMGAD Y+TESEIASLLA+GNV
Sbjct  404   VVDAIISHGCFLRECSVKHSIVGERSRLDYGVELKDTLMMGADFYQTESEIASLLAEGNV  463

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKIRN IIDKN +IGKD VI+NKDGVQE+DRPD+GFYIRSGITII+EKATI D
Sbjct  464   PIGIGRNTKIRNCIIDKNAKIGKDAVIVNKDGVQEADRPDDGFYIRSGITIILEKATIKD  523

Query  410   GTVI  399
             GTVI
Sbjct  524   GTVI  527



>gb|KDO41999.1| hypothetical protein CISIN_1g0097201mg, partial [Citrus sinensis]
Length=446

 Score =   424 bits (1090),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 222/244 (91%), Gaps = 3/244 (1%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT+LLG  PQ+AR  PY+ASMGVYVF+ DVL +LLRWRYPTSNDFGSEI+PAA+ E
Sbjct  206   AMQVDTSLLGFSPQEARKCPYVASMGVYVFKKDVLFKLLRWRYPTSNDFGSEIIPAAIME  265

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQAYIFRDYWEDIGTIKSFY AN+ALT+E P F FYDPKTPFYTSPRFLPPTKIDNC+
Sbjct  266   HDVQAYIFRDYWEDIGTIKSFYEANMALTKESPAFHFYDPKTPFYTSPRFLPPTKIDNCR  325

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLRECTVEHSI+GERSRLD GVELKDT+M+GAD Y+TESEIASLLA+G V
Sbjct  326   IKDAIISHGCFLRECTVEHSIVGERSRLDYGVELKDTVMLGADYYQTESEIASLLAEGKV  385

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG NTKIRN IIDKNV+IGKDVVI+NKD   E+DRP+ GFYIRSGITIIMEKATI D
Sbjct  386   PIGVGRNTKIRNCIIDKNVKIGKDVVIVNKD---EADRPELGFYIRSGITIIMEKATIED  442

Query  410   GTVI  399
             G VI
Sbjct  443   GMVI  446



>ref|XP_011037496.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011037497.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
Length=527

 Score =   426 bits (1095),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 200/243 (82%), Positives = 223/243 (92%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             M+VDTT LGL PQDA  + YIASMGVYVF+TD+LL+LLRWRYPTSNDFGSEI+PAAV EH
Sbjct  285   MKVDTTHLGLSPQDALKSSYIASMGVYVFKTDILLKLLRWRYPTSNDFGSEIIPAAVMEH  344

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
             NVQAYIF+DYWEDIGTIKSFY ANLAL EE PKFEFYDPKTPFYTSP FLPPTKID C+I
Sbjct  345   NVQAYIFKDYWEDIGTIKSFYEANLALAEEPPKFEFYDPKTPFYTSPGFLPPTKIDKCRI  404

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
              DAIISHGCFLRECTV+HS++GERSRLD GVELKDT+M+GAD Y+TE+EIASLLA+G VP
Sbjct  405   VDAIISHGCFLRECTVQHSVVGERSRLDYGVELKDTVMLGADYYQTEAEIASLLAEGKVP  464

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             IGVG N+KIRN IIDKN +IGKDV+IMNKDGVQE+DR ++GFYIRSGITII+EKATI DG
Sbjct  465   IGVGRNSKIRNCIIDKNAKIGKDVIIMNKDGVQEADREEKGFYIRSGITIILEKATIEDG  524

Query  407   TVI  399
             TVI
Sbjct  525   TVI  527



>gb|KCW55368.1| hypothetical protein EUGRSUZ_I01281 [Eucalyptus grandis]
Length=395

 Score =   421 bits (1081),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT LGL PQ+A  +PYIASMGVY F+T+ LL LL+WRYPT+NDFGSEI+P+AV E
Sbjct  152   AMQVDTTTLGLSPQEAARSPYIASMGVYAFKTESLLNLLKWRYPTANDFGSEIIPSAVME  211

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
              +VQAYIFRDYWEDIGTIKSFY+ANLALTEE PKFEFYDPKTP +TSPRFLPPTKIDNCK
Sbjct  212   QDVQAYIFRDYWEDIGTIKSFYDANLALTEEVPKFEFYDPKTPIFTSPRFLPPTKIDNCK  271

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             +KDAIISHGCFLREC VE SI+GERSRLD GVELKDT+MMGAD Y+TESEIASLLA+G V
Sbjct  272   LKDAIISHGCFLRECRVERSIVGERSRLDSGVELKDTVMMGADYYQTESEIASLLAEGKV  331

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G+NTKIRN IIDKN +IGKDV I+NKDGV+E+DRP +GFYIR GIT+I+EKATI D
Sbjct  332   PIGIGKNTKIRNCIIDKNAKIGKDVAIVNKDGVEEADRPGDGFYIRLGITVILEKATIED  391

Query  410   GTVI  399
             GTVI
Sbjct  392   GTVI  395



>ref|XP_008460955.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cucumis melo]
 ref|XP_008460956.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cucumis melo]
Length=526

 Score =   425 bits (1093),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 194/244 (80%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDTT  GL  +++  +PYIASMGVYVF+TDVLL LL+WRYP+SNDFGSEI+PAA+K+
Sbjct  283   AMRVDTTSFGLSREESLKSPYIASMGVYVFKTDVLLNLLKWRYPSSNDFGSEIIPAAIKD  342

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQA++FRDYWEDIGTIK+FY+ANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKID C+
Sbjct  343   HNVQAFMFRDYWEDIGTIKTFYDANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDRCQ  402

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+++HSI+GERSRLD GVELKDT+MMGADNY+TE EI  LLA+G V
Sbjct  403   IVDAIISHGCFLRECSIQHSIVGERSRLDYGVELKDTIMMGADNYQTELEITGLLAEGKV  462

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+G+G NTKIR  IIDKN +IGKDV+IMNKDGVQE+DRP++GFYIRSGITI+MEKATI D
Sbjct  463   PVGIGPNTKIRKCIIDKNAKIGKDVIIMNKDGVQEADRPEQGFYIRSGITIVMEKATIED  522

Query  410   GTVI  399
             GTVI
Sbjct  523   GTVI  526



>ref|XP_006581117.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Glycine max]
Length=409

 Score =   421 bits (1082),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DT+LLGL  QDA  +PYIASMGVYVF+TDVLL LL+WRYPTSNDFGSEI+PAAV++
Sbjct  166   AMQADTSLLGLSSQDALESPYIASMGVYVFKTDVLLNLLKWRYPTSNDFGSEIIPAAVRD  225

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQ+Y F DYWEDIGTIKSFYNANLALTEE  KFEFYDPK P YTSP FLPPTKID C+
Sbjct  226   HNVQSYFFGDYWEDIGTIKSFYNANLALTEESHKFEFYDPKIPIYTSPGFLPPTKIDKCR  285

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLRECTV+HSI+GERSRLD GVE+ DT+MMGAD Y+TESEIASLLA+G V
Sbjct  286   IVDAIISHGCFLRECTVQHSIVGERSRLDYGVEVLDTVMMGADYYQTESEIASLLAEGKV  345

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKIRN IIDKN +IGKDV+I NKDGVQE+DRP++GFYIRSGITIIMEKATI D
Sbjct  346   PIGIGRNTKIRNCIIDKNAKIGKDVIIANKDGVQEADRPEDGFYIRSGITIIMEKATIED  405

Query  410   GTVI  399
             GTVI
Sbjct  406   GTVI  409



>ref|XP_007201161.1| hypothetical protein PRUPE_ppa004192mg [Prunus persica]
 gb|EMJ02360.1| hypothetical protein PRUPE_ppa004192mg [Prunus persica]
Length=524

 Score =   425 bits (1092),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 195/244 (80%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DTTLLGL PQDA  +PY+ASMGVYVF+T++LL LLRWRYPTSNDFGSEI+PAAV+E
Sbjct  281   AMQTDTTLLGLSPQDAMKSPYVASMGVYVFKTEILLNLLRWRYPTSNDFGSEIIPAAVRE  340

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H VQAY+FR+YWEDIGTIKSFY+ANLALTEEF KF+FYDPKTP +TSPRFLPPTKID C+
Sbjct  341   HKVQAYMFREYWEDIGTIKSFYDANLALTEEFSKFQFYDPKTPIFTSPRFLPPTKIDKCR  400

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+GERSRLD GVELKD +MMGAD Y+TE+EIASLLA+G V
Sbjct  401   IVDAIISHGCFLRECSVQHSIVGERSRLDYGVELKDAIMMGADYYQTETEIASLLAEGKV  460

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+G+G NTKIRN IIDKN +IGKD VI+NKDGV+E+DRP+EGFYIR GITII+EKATI D
Sbjct  461   PVGIGRNTKIRNCIIDKNAKIGKDAVIVNKDGVREADRPEEGFYIREGITIILEKATIQD  520

Query  410   GTVI  399
             G VI
Sbjct  521   GMVI  524



>ref|XP_002313036.1| ADP-glucose pyrophosphorylase large subunit family protein [Populus 
trichocarpa]
 gb|EEE86991.1| ADP-glucose pyrophosphorylase large subunit family protein [Populus 
trichocarpa]
Length=527

 Score =   425 bits (1092),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 200/243 (82%), Positives = 221/243 (91%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             M+VDTT LGL PQDA  +PYIASMGVYVF+TD+LL+LLRWRYPT+NDFGSEI+PAAV EH
Sbjct  285   MRVDTTRLGLSPQDAMKSPYIASMGVYVFKTDILLKLLRWRYPTANDFGSEIIPAAVMEH  344

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
             NVQAYIF+DYWEDIGTIKSFY ANLAL EE PKFEFYDPKTPFYTSPRF PPTK D C+I
Sbjct  345   NVQAYIFKDYWEDIGTIKSFYEANLALAEEPPKFEFYDPKTPFYTSPRFSPPTKFDKCRI  404

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
              +AIISHGCFLRECTV+HS++GERSRLD GVELKDT+M+GAD Y+TE EIASLLA+G VP
Sbjct  405   VNAIISHGCFLRECTVQHSVVGERSRLDYGVELKDTVMLGADCYQTEVEIASLLAEGEVP  464

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             IGVG NTKIRN IIDKN +IGKDV+IMNKDGVQE+DR +EGFYIRSGITII EKATI DG
Sbjct  465   IGVGRNTKIRNCIIDKNAKIGKDVIIMNKDGVQEADREEEGFYIRSGITIISEKATIEDG  524

Query  407   TVI  399
             TVI
Sbjct  525   TVI  527



>dbj|BAF47747.1| ADP-glucose pyrophosphorylase beta subunit IbAGPb1B [Ipomoea 
batatas]
Length=515

 Score =   423 bits (1088),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 207/244 (85%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT LGL P+DA+ NPYIASMG+YVFR D+LL LLRW YPT+NDFGSEI+PA + E
Sbjct  272   AMQVDTTRLGLSPEDAKRNPYIASMGLYVFRRDLLLNLLRWIYPTANDFGSEIIPAVITE  331

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY F+DYWEDIGTIK+FYNANLAL EEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK
Sbjct  332   HNVQAYFFKDYWEDIGTIKTFYNANLALAEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  391

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLREC VEHSI+GERSRLD GVELKDTLMMGAD YETESEIASLLADG V
Sbjct  392   IKDAIISHGCFLRECIVEHSIVGERSRLDFGVELKDTLMMGADYYETESEIASLLADGKV  451

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKI N IIDKNVRIGKDV+I NKDGV+E+DRP+EGFYIRSGI +IMEKA I D
Sbjct  452   PIGIGHNTKISNCIIDKNVRIGKDVIIANKDGVEEADRPEEGFYIRSGIPVIMEKAVIKD  511

Query  410   GTVI  399
             GTVI
Sbjct  512   GTVI  515



>emb|CDO97030.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   423 bits (1088),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM VDTT+LGL PQ+A  +PYIASMGVYVF+T+VLL+LL+WRYPTSNDFGSEI+P+ VKE
Sbjct  279   AMHVDTTILGLSPQEAFKSPYIASMGVYVFKTEVLLQLLKWRYPTSNDFGSEIIPSVVKE  338

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
              NV+AYIFRDYWEDIGTIKSFY++NLALT+E  KF+FYDPKTPF+TSPRFLPPTKID C+
Sbjct  339   RNVRAYIFRDYWEDIGTIKSFYDSNLALTDESAKFQFYDPKTPFFTSPRFLPPTKIDKCQ  398

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+IISHGCFLRECTVEHSI+GERSRLD GVELKDT MMGAD Y+TESEIASLLA+G V
Sbjct  399   IMDSIISHGCFLRECTVEHSIVGERSRLDYGVELKDTFMMGADYYQTESEIASLLAEGKV  458

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G+NTKIRN IIDKN +IGKDV I+NKDGVQE+DRP+EGFYIR+GIT+I+EKATI D
Sbjct  459   PIGIGQNTKIRNCIIDKNAKIGKDVAILNKDGVQEADRPEEGFYIRAGITVILEKATIND  518

Query  410   GTVI  399
              TVI
Sbjct  519   RTVI  522



>gb|EYU37810.1| hypothetical protein MIMGU_mgv1a004455mg [Erythranthe guttata]
Length=526

 Score =   423 bits (1088),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT+++GL P +A  +PYIASMGVY F+TDVLL LLRWRYPTSNDFGSEI+P+AVK+
Sbjct  283   AMQVDTSIIGLSPDEALKSPYIASMGVYAFKTDVLLNLLRWRYPTSNDFGSEIIPSAVKD  342

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAYIFRDYWEDIG IKSF++ANLAL +EFPKFEFYDPKTPF+TSPRFLPPTKID+ K
Sbjct  343   HNVQAYIFRDYWEDIGRIKSFFDANLALADEFPKFEFYDPKTPFFTSPRFLPPTKIDSSK  402

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IK+AIISHGCFLREC V+HSI+GERSRLD GVELKDTLMMGAD Y+TESEIASLLA G V
Sbjct  403   IKNAIISHGCFLRECIVDHSIVGERSRLDSGVELKDTLMMGADYYQTESEIASLLAQGKV  462

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKIRN IIDKN +IGKDV+I NKDGV+E+DRP+EGFYIRSGI I+ EKATI D
Sbjct  463   PIGIGRNTKIRNCIIDKNAKIGKDVIIKNKDGVEEADRPEEGFYIRSGIIIVPEKATIND  522

Query  410   GTVI  399
             GTVI
Sbjct  523   GTVI  526



>ref|XP_003527197.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Glycine max]
 gb|KHN20061.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Glycine 
soja]
Length=519

 Score =   423 bits (1087),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DT+LLGL  QDA  +PYIASMGVYVF+TDVLL LL+WRYPTSNDFGSEI+PAAV++
Sbjct  276   AMQADTSLLGLSSQDALESPYIASMGVYVFKTDVLLNLLKWRYPTSNDFGSEIIPAAVRD  335

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQ+Y F DYWEDIGTIKSFYNANLALTEE  KFEFYDPK P YTSP FLPPTKID C+
Sbjct  336   HNVQSYFFGDYWEDIGTIKSFYNANLALTEESHKFEFYDPKIPIYTSPGFLPPTKIDKCR  395

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLRECTV+HSI+GERSRLD GVE+ DT+MMGAD Y+TESEIASLLA+G V
Sbjct  396   IVDAIISHGCFLRECTVQHSIVGERSRLDYGVEVLDTVMMGADYYQTESEIASLLAEGKV  455

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKIRN IIDKN +IGKDV+I NKDGVQE+DRP++GFYIRSGITIIMEKATI D
Sbjct  456   PIGIGRNTKIRNCIIDKNAKIGKDVIIANKDGVQEADRPEDGFYIRSGITIIMEKATIED  515

Query  410   GTVI  399
             GTVI
Sbjct  516   GTVI  519



>ref|XP_003522921.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Glycine max]
 ref|XP_006577920.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Glycine max]
 gb|KHN33746.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Glycine 
soja]
Length=519

 Score =   422 bits (1086),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DT+LLGL PQDA  +PYIASMGVYVF+TDVLL LL+WRYPTSNDFGSEI+PAAV++
Sbjct  276   AMQADTSLLGLSPQDALKSPYIASMGVYVFKTDVLLNLLKWRYPTSNDFGSEIIPAAVRD  335

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQ+Y F DYWEDIGTIKSFY+ANLALTEE  KFEFYDPK P YTSP FLPPTKID C+
Sbjct  336   HDVQSYFFEDYWEDIGTIKSFYDANLALTEESHKFEFYDPKIPIYTSPGFLPPTKIDKCQ  395

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLRECTV+HSI+GERSRLD GVEL DT+MMGAD Y+TESEIASLLA+G V
Sbjct  396   IVDAIISHGCFLRECTVQHSIVGERSRLDYGVELLDTVMMGADYYQTESEIASLLAEGKV  455

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKIRN IIDKN +IGKDV+I NKDGVQE+DRP++GFYIRSGITIIMEKATI D
Sbjct  456   PIGIGRNTKIRNCIIDKNAKIGKDVIIANKDGVQEADRPEDGFYIRSGITIIMEKATIED  515

Query  410   GTVI  399
             GT++
Sbjct  516   GTIV  519



>ref|XP_007131817.1| hypothetical protein PHAVU_011G044000g [Phaseolus vulgaris]
 gb|ESW03811.1| hypothetical protein PHAVU_011G044000g [Phaseolus vulgaris]
Length=528

 Score =   422 bits (1085),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 194/244 (80%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++ GL P +A+ +PYIASMGVYVF+TDVLL++L+WRYPTSNDFGSEI+PAAV+E
Sbjct  285   AMQVDTSVFGLLPHEAKKSPYIASMGVYVFKTDVLLKILKWRYPTSNDFGSEIIPAAVRE  344

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNV AY++ DYWEDIGTIKSFY+ANLALTEE P F+FYDPKTP YTSPR LPPTKID C+
Sbjct  345   HNVHAYLYNDYWEDIGTIKSFYDANLALTEENPMFKFYDPKTPIYTSPRLLPPTKIDKCR  404

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC V+HSI+GERSRLD GVEL+DT+MMGAD Y+TESEIASLLA+G V
Sbjct  405   IVDAIISHGCFLRECIVQHSIVGERSRLDYGVELQDTVMMGADYYQTESEIASLLAEGKV  464

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKIRN IIDKN +IGKDV+IMNKDGVQE+DRP++GFYIRSGIT+I+EKATI D
Sbjct  465   PIGIGRNTKIRNCIIDKNAKIGKDVIIMNKDGVQEADRPEDGFYIRSGITVILEKATIED  524

Query  410   GTVI  399
             GTVI
Sbjct  525   GTVI  528



>gb|AFL55397.1| ADP-glucose pyrophosphorylase large subunit 2 [Ipomoea batatas]
Length=515

 Score =   421 bits (1083),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 206/244 (84%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT LGL P+DA+ NPYIASMG+YVFR D+LL LLRW YPT+NDFGSEI+PA + E
Sbjct  272   AMQVDTTRLGLSPEDAKRNPYIASMGLYVFRRDLLLNLLRWIYPTANDFGSEIIPAVITE  331

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY F+DYWEDIGTIK+FY+ANLAL EEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK
Sbjct  332   HNVQAYFFKDYWEDIGTIKTFYDANLALAEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  391

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLREC VEHSI+GERSRLD GVELKDTLMMGAD YETESEIASLLADG V
Sbjct  392   IKDAIISHGCFLRECIVEHSIVGERSRLDFGVELKDTLMMGADYYETESEIASLLADGKV  451

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKI N IIDKNVRIGKDV+I NKDGV+E+DRP+EGFYIRSGI +IMEKA I D
Sbjct  452   PIGIGHNTKISNCIIDKNVRIGKDVIIANKDGVEEADRPEEGFYIRSGIPVIMEKAVIKD  511

Query  410   GTVI  399
             GTVI
Sbjct  512   GTVI  515



>ref|XP_010028607.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Eucalyptus grandis]
 ref|XP_010028608.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Eucalyptus grandis]
 gb|KCW55367.1| hypothetical protein EUGRSUZ_I01281 [Eucalyptus grandis]
Length=527

 Score =   422 bits (1084),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT LGL PQ+A  +PYIASMGVY F+T+ LL LL+WRYPT+NDFGSEI+P+AV E
Sbjct  284   AMQVDTTTLGLSPQEAARSPYIASMGVYAFKTESLLNLLKWRYPTANDFGSEIIPSAVME  343

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
              +VQAYIFRDYWEDIGTIKSFY+ANLALTEE PKFEFYDPKTP +TSPRFLPPTKIDNCK
Sbjct  344   QDVQAYIFRDYWEDIGTIKSFYDANLALTEEVPKFEFYDPKTPIFTSPRFLPPTKIDNCK  403

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             +KDAIISHGCFLREC VE SI+GERSRLD GVELKDT+MMGAD Y+TESEIASLLA+G V
Sbjct  404   LKDAIISHGCFLRECRVERSIVGERSRLDSGVELKDTVMMGADYYQTESEIASLLAEGKV  463

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G+NTKIRN IIDKN +IGKDV I+NKDGV+E+DRP +GFYIR GIT+I+EKATI D
Sbjct  464   PIGIGKNTKIRNCIIDKNAKIGKDVAIVNKDGVEEADRPGDGFYIRLGITVILEKATIED  523

Query  410   GTVI  399
             GTVI
Sbjct  524   GTVI  527



>ref|XP_011048155.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
Length=540

 Score =   422 bits (1085),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 199/243 (82%), Positives = 220/243 (91%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             M+ DTT LGL PQDA  +PYIASMGVYVF+TD+LL+LLRWRYPT+NDFGSEI+PAAV EH
Sbjct  298   MRADTTRLGLSPQDAMKSPYIASMGVYVFKTDLLLKLLRWRYPTANDFGSEIIPAAVMEH  357

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
             NVQAYIF+DYWEDIGTIKSFY ANLAL EE PKFEFYDPKTPFYTSPRF PPTK D C+I
Sbjct  358   NVQAYIFKDYWEDIGTIKSFYEANLALAEEPPKFEFYDPKTPFYTSPRFSPPTKFDKCRI  417

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
              +AIISHGCFLRECTVEHS++GERSRLD GVELKDT+M+GAD Y+TE EIASLLA+G VP
Sbjct  418   VNAIISHGCFLRECTVEHSVVGERSRLDYGVELKDTVMLGADCYQTEVEIASLLAEGEVP  477

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             IGVG NTKIRN IIDKN +IGK+V+IMNKDGVQE+DR +EGFYIRSGITII EKATI DG
Sbjct  478   IGVGRNTKIRNCIIDKNAKIGKNVIIMNKDGVQEADREEEGFYIRSGITIISEKATIEDG  537

Query  407   TVI  399
             TVI
Sbjct  538   TVI  540



>ref|XP_009378639.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009378640.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009378642.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009378643.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X3 [Pyrus x bretschneideri]
Length=519

 Score =   421 bits (1083),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 194/244 (80%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DT LLGL PQDAR +PY+ASMGVYVF+T+VLL LL+WRYPTSNDFGSEI+PAAV++
Sbjct  276   AMQADTMLLGLLPQDARKSPYVASMGVYVFKTEVLLNLLKWRYPTSNDFGSEIIPAAVRD  335

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+FRDYWEDIGTIKSFY+ANLALTEE PKFEFYDPKTP +TSP FLPPTKIDNC+
Sbjct  336   HNVQAYMFRDYWEDIGTIKSFYDANLALTEEIPKFEFYDPKTPIFTSPGFLPPTKIDNCR  395

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFL++C+V+HSI+GERSRL+ GVE+KD++MMGAD Y+TESEIASLLADG V
Sbjct  396   IADAIISHGCFLQDCSVQHSIVGERSRLNYGVEIKDSIMMGADYYQTESEIASLLADGKV  455

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKI N IIDKN  IGKDV+I+NKDGVQE+DRP++GFYIR GITII+EKAT+ D
Sbjct  456   PIGIGSNTKIWNCIIDKNASIGKDVMIVNKDGVQEADRPEDGFYIREGITIILEKATVQD  515

Query  410   GTVI  399
             G VI
Sbjct  516   GMVI  519



>ref|XP_009378637.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Pyrus x bretschneideri]
Length=525

 Score =   421 bits (1083),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 194/244 (80%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DT LLGL PQDAR +PY+ASMGVYVF+T+VLL LL+WRYPTSNDFGSEI+PAAV++
Sbjct  282   AMQADTMLLGLLPQDARKSPYVASMGVYVFKTEVLLNLLKWRYPTSNDFGSEIIPAAVRD  341

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+FRDYWEDIGTIKSFY+ANLALTEE PKFEFYDPKTP +TSP FLPPTKIDNC+
Sbjct  342   HNVQAYMFRDYWEDIGTIKSFYDANLALTEEIPKFEFYDPKTPIFTSPGFLPPTKIDNCR  401

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFL++C+V+HSI+GERSRL+ GVE+KD++MMGAD Y+TESEIASLLADG V
Sbjct  402   IADAIISHGCFLQDCSVQHSIVGERSRLNYGVEIKDSIMMGADYYQTESEIASLLADGKV  461

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKI N IIDKN  IGKDV+I+NKDGVQE+DRP++GFYIR GITII+EKAT+ D
Sbjct  462   PIGIGSNTKIWNCIIDKNASIGKDVMIVNKDGVQEADRPEDGFYIREGITIILEKATVQD  521

Query  410   GTVI  399
             G VI
Sbjct  522   GMVI  525



>ref|XP_009378638.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Pyrus x bretschneideri]
Length=523

 Score =   421 bits (1083),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 194/244 (80%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DT LLGL PQDAR +PY+ASMGVYVF+T+VLL LL+WRYPTSNDFGSEI+PAAV++
Sbjct  280   AMQADTMLLGLLPQDARKSPYVASMGVYVFKTEVLLNLLKWRYPTSNDFGSEIIPAAVRD  339

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+FRDYWEDIGTIKSFY+ANLALTEE PKFEFYDPKTP +TSP FLPPTKIDNC+
Sbjct  340   HNVQAYMFRDYWEDIGTIKSFYDANLALTEEIPKFEFYDPKTPIFTSPGFLPPTKIDNCR  399

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFL++C+V+HSI+GERSRL+ GVE+KD++MMGAD Y+TESEIASLLADG V
Sbjct  400   IADAIISHGCFLQDCSVQHSIVGERSRLNYGVEIKDSIMMGADYYQTESEIASLLADGKV  459

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKI N IIDKN  IGKDV+I+NKDGVQE+DRP++GFYIR GITII+EKAT+ D
Sbjct  460   PIGIGSNTKIWNCIIDKNASIGKDVMIVNKDGVQEADRPEDGFYIREGITIILEKATVQD  519

Query  410   GTVI  399
             G VI
Sbjct  520   GMVI  523



>ref|XP_011015433.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011015434.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011015435.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
Length=527

 Score =   421 bits (1082),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 198/243 (81%), Positives = 219/243 (90%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             M+ DTT LGL PQDA  +PYIASMGVYVF+TD+LL+LLRWRYPT+NDFGSEI+PAAV EH
Sbjct  285   MRADTTRLGLSPQDAMKSPYIASMGVYVFKTDLLLKLLRWRYPTANDFGSEIIPAAVMEH  344

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
             NVQAYIF+DYWEDIGTIKSFY ANLAL EE PKFEFYDPKTPFYTSPRF PPTK D C+I
Sbjct  345   NVQAYIFKDYWEDIGTIKSFYEANLALAEEPPKFEFYDPKTPFYTSPRFSPPTKFDKCRI  404

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
              +AIISHGCFLRECTVEHS++GERSRLD GVELKDT+M+GAD Y+TE EIASLLA+G +P
Sbjct  405   VNAIISHGCFLRECTVEHSVVGERSRLDYGVELKDTVMLGADCYQTEVEIASLLAEGEIP  464

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             IGVG NTKIRN IIDKN +IG DV+IMNKDGVQE+DR +EGFYIRSGITII EKATI DG
Sbjct  465   IGVGRNTKIRNCIIDKNAKIGNDVIIMNKDGVQEADREEEGFYIRSGITIISEKATIEDG  524

Query  407   TVI  399
             TVI
Sbjct  525   TVI  527



>ref|XP_008236919.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Prunus mume]
Length=524

 Score =   421 bits (1081),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 193/244 (79%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DTTLLGL PQDA  +PY+ASMGVYVF+T++LL LLRWRYPTSNDFGSEI+PAAV+E
Sbjct  281   AMQTDTTLLGLSPQDAMKSPYVASMGVYVFKTEILLNLLRWRYPTSNDFGSEIIPAAVRE  340

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H VQA++FR+YWEDIGTIKSFY+ANLALT+EF KF FYDPKTP +TSPRFLPPTKID C+
Sbjct  341   HKVQAFMFREYWEDIGTIKSFYDANLALTKEFAKFHFYDPKTPIFTSPRFLPPTKIDKCR  400

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+GERSRLD GVELKD +MMGAD Y+TE+EIASLLA+G V
Sbjct  401   IVDAIISHGCFLRECSVQHSIVGERSRLDYGVELKDAIMMGADYYQTETEIASLLAEGKV  460

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+G+G NTKIRN IIDKN +IGKD VI+NKDGV+E+DRP+EGFYIR GITII+EKATI D
Sbjct  461   PVGIGRNTKIRNCIIDKNAKIGKDAVIVNKDGVREADRPEEGFYIREGITIILEKATIQD  520

Query  410   GTVI  399
             G VI
Sbjct  521   GMVI  524



>ref|XP_008377280.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Malus domestica]
Length=519

 Score =   417 bits (1073),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 192/244 (79%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DT +LGL PQDAR +PY+ASMGVYVF+T+VLL LLRWRYPTSNDFGSEI+PAAV++
Sbjct  276   AMQADTKILGLSPQDARKSPYVASMGVYVFKTEVLLNLLRWRYPTSNDFGSEIIPAAVRD  335

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+FRDYWEDIGTIKSFY+ANLALTEE PKFEFYDPKTP +TSP FLPPTKIDNC+
Sbjct  336   HNVQAYMFRDYWEDIGTIKSFYDANLALTEEIPKFEFYDPKTPIFTSPGFLPPTKIDNCR  395

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFL++C+V+HSI+GERSRL+ GVE+KD++MMGAD Y+TESEIA LL DG V
Sbjct  396   IADAIISHGCFLQDCSVQHSIVGERSRLNYGVEIKDSIMMGADYYQTESEIALLLVDGKV  455

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKI N IIDKN  IGKDV+I+NKDGVQE+DRP++GFYIR GIT+I+EKATI D
Sbjct  456   PIGIGSNTKIWNCIIDKNASIGKDVMIVNKDGVQEADRPEDGFYIREGITVILEKATIRD  515

Query  410   GTVI  399
             G VI
Sbjct  516   GMVI  519



>gb|AGB85110.1| ADP-glucose pyrophosphorylase large subunit 2 [Ipomoea batatas]
Length=515

 Score =   417 bits (1072),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/244 (84%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT LGL P+DA+ NPYIASMG+YVFR D+LL LLRW YPT+NDFGSEI+PA + E
Sbjct  272   AMQVDTTRLGLSPEDAKRNPYIASMGLYVFRRDLLLNLLRWIYPTANDFGSEIIPAVITE  331

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY F+DYWEDIGTIK+FY+ANLAL EEFPKFEFYDPKTPFYTSPR LPPTKIDNCK
Sbjct  332   HNVQAYFFKDYWEDIGTIKTFYDANLALAEEFPKFEFYDPKTPFYTSPRLLPPTKIDNCK  391

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLREC VEHSI+GERSRLD GVELKDTLMMGAD YETESEIASLLADG V
Sbjct  392   IKDAIISHGCFLRECIVEHSIVGERSRLDFGVELKDTLMMGADYYETESEIASLLADGKV  451

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKI N IIDKNVRIGKDV+I NKDGV+E+DRP+EGFYIRSGI +IMEK  I D
Sbjct  452   PIGIGHNTKISNCIIDKNVRIGKDVIIANKDGVEEADRPEEGFYIRSGIPVIMEKVVIKD  511

Query  410   GTVI  399
             GTVI
Sbjct  512   GTVI  515



>ref|XP_008377281.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Malus domestica]
Length=517

 Score =   417 bits (1072),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 192/244 (79%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DT +LGL PQDAR +PY+ASMGVYVF+T+VLL LLRWRYPTSNDFGSEI+PAAV++
Sbjct  274   AMQADTKILGLSPQDARKSPYVASMGVYVFKTEVLLNLLRWRYPTSNDFGSEIIPAAVRD  333

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+FRDYWEDIGTIKSFY+ANLALTEE PKFEFYDPKTP +TSP FLPPTKIDNC+
Sbjct  334   HNVQAYMFRDYWEDIGTIKSFYDANLALTEEIPKFEFYDPKTPIFTSPGFLPPTKIDNCR  393

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFL++C+V+HSI+GERSRL+ GVE+KD++MMGAD Y+TESEIA LL DG V
Sbjct  394   IADAIISHGCFLQDCSVQHSIVGERSRLNYGVEIKDSIMMGADYYQTESEIALLLVDGKV  453

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKI N IIDKN  IGKDV+I+NKDGVQE+DRP++GFYIR GIT+I+EKATI D
Sbjct  454   PIGIGSNTKIWNCIIDKNASIGKDVMIVNKDGVQEADRPEDGFYIREGITVILEKATIRD  513

Query  410   GTVI  399
             G VI
Sbjct  514   GMVI  517



>gb|AHM92232.1| AGPase large subunit protein [Hevea brasiliensis]
Length=527

 Score =   417 bits (1073),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 200/260 (77%), Positives = 225/260 (87%), Gaps = 11/260 (4%)
 Frame = -3

Query  1178  GAELSSFARSLKVLI*AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYP  999
             GAEL S           M+ DTT LGL  QDA  +PYIASMGVYVFRT++LL+LLRWRYP
Sbjct  279   GAELKS-----------MRADTTHLGLSLQDALKSPYIASMGVYVFRTEILLKLLRWRYP  327

Query  998   TSNDFGSEILPAAVKEHNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPF  819
             T NDFGSEI+PAAV EHNVQA+IFRDYWEDIGTIK+FY  NLALTEE PKFEFYDPKTPF
Sbjct  328   TPNDFGSEIIPAAVMEHNVQAHIFRDYWEDIGTIKTFYEENLALTEESPKFEFYDPKTPF  387

Query  818   YTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADN  639
             YTSPRFLPPTKID C+I DAIISHGCFLRECT++HS++GERSRLD GVELKDT+M+GAD 
Sbjct  388   YTSPRFLPPTKIDKCRIVDAIISHGCFLRECTIQHSVVGERSRLDYGVELKDTVMLGADC  447

Query  638   YETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFY  459
             Y+TE+EIASLLA+G VPIGVG +TKI+  IIDKN ++GK+VVI NKDGVQE+DRP+EGFY
Sbjct  448   YQTEAEIASLLAEGEVPIGVGRDTKIKKCIIDKNAKMGKNVVITNKDGVQEADRPEEGFY  507

Query  458   IRSGITIIMEKATIPDGTVI  399
             IRSGITII EKATI DGTVI
Sbjct  508   IRSGITIISEKATIEDGTVI  527



>ref|XP_011649235.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cucumis sativus]
 gb|KGN61813.1| hypothetical protein Csa_2G248700 [Cucumis sativus]
Length=526

 Score =   417 bits (1071),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 190/244 (78%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDTT  GL  +++  +PYIASMGVYVF+T+VLL LL+WRYPTSNDFGSEI+PAA+KE
Sbjct  283   AMRVDTTPFGLSREESLKSPYIASMGVYVFKTEVLLNLLKWRYPTSNDFGSEIIPAAIKE  342

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQA++FRDYWEDIGTIK+FY+AN+ALTEEFPKFEFYDPKTPFYTSPRFLPPTKID C+
Sbjct  343   YNVQAFMFRDYWEDIGTIKTFYDANMALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDRCQ  402

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLR+C+V+HSI+GERSRLD GVELKDT+MMGADNY+TE EI  LLA+G V
Sbjct  403   IVDAIISHGCFLRDCSVQHSIVGERSRLDYGVELKDTIMMGADNYQTELEITGLLAEGKV  462

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+G+G N+KI+  IIDKN +IGKDV+IMNKDGVQE+ RP++GFYIRSGITIIMEKAT+ D
Sbjct  463   PVGIGRNSKIKKCIIDKNAKIGKDVIIMNKDGVQEAARPEQGFYIRSGITIIMEKATVGD  522

Query  410   GTVI  399
             GTVI
Sbjct  523   GTVI  526



>ref|XP_004507462.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cicer arietinum]
Length=528

 Score =   416 bits (1069),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 195/244 (80%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT+L GL PQ+A  +PYIASMGVYVF+TDVLL+LL+WRYPTSNDFGSEI+PAAVKE
Sbjct  285   AMQVDTSLFGLSPQEALRSPYIASMGVYVFKTDVLLKLLKWRYPTSNDFGSEIIPAAVKE  344

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQA+ F DYWEDIGTIKSFY+AN+ALTEE P F+FYDPKTP +TSPRFLPPTKIDNC+
Sbjct  345   YNVQAFFFGDYWEDIGTIKSFYDANMALTEENPMFKFYDPKTPIFTSPRFLPPTKIDNCR  404

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V HSI+GERSRLD GVEL+DT+MMGAD Y+TE EIAS +A+G V
Sbjct  405   IVDAIISHGCFLRECSVHHSIVGERSRLDYGVELQDTIMMGADYYQTEPEIASQVAEGKV  464

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PI +G NTKIR  IIDKN RIGKDV+IMNKDGV+E+DR D+GFYIRSGITIIMEKATI D
Sbjct  465   PIRIGRNTKIRKCIIDKNARIGKDVIIMNKDGVEEADREDDGFYIRSGITIIMEKATIED  524

Query  410   GTVI  399
             GTVI
Sbjct  525   GTVI  528



>ref|XP_010254773.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Nelumbo nucifera]
Length=528

 Score =   416 bits (1069),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 193/244 (79%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQV+TTLLGL  Q+A   PYIASMGVYVFRT+VLL+LLRWRYPT NDFGSEI+PAAVKE
Sbjct  285   AMQVNTTLLGLSQQEAMKYPYIASMGVYVFRTEVLLKLLRWRYPTCNDFGSEIIPAAVKE  344

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKSF++ANLALTE+ P FEFYDPKTPF+TSPRFLPPTK+D C+
Sbjct  345   HNVQAYLFNDYWEDIGTIKSFFDANLALTEQPPNFEFYDPKTPFFTSPRFLPPTKVDKCR  404

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I +AIISHGCFLREC+V+HSI+G RSRL+ G ELKDT+MMGAD Y TESEIASLLA+G V
Sbjct  405   IVNAIISHGCFLRECSVQHSIVGVRSRLEYGCELKDTMMMGADYYHTESEIASLLAEGKV  464

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKIRN IIDKN +IG+DV+I NKDGVQE+DRPD+GFYIRSGI +I++ ATI D
Sbjct  465   PIGVGQNTKIRNCIIDKNAKIGRDVIIANKDGVQEADRPDDGFYIRSGIIVILKNATIKD  524

Query  410   GTVI  399
             GTVI
Sbjct  525   GTVI  528



>ref|NP_001289786.1| glucose-1-phosphate adenylyltransferase large subunit 1-like 
[Nelumbo nucifera]
 gb|AHZ08829.1| ADP-glucose pyrophosphorylase large subunit [Nelumbo nucifera]
 gb|AHZ08830.1| ADP-glucose pyrophosphorylase large subunit [Nelumbo nucifera]
Length=528

 Score =   415 bits (1067),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 193/244 (79%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQV+TTLLGL  Q+A   PYIASMGVYVFRT+VLL+LLRWRYPT NDFGSEI+PAAVKE
Sbjct  285   AMQVNTTLLGLSQQEAIKYPYIASMGVYVFRTEVLLKLLRWRYPTCNDFGSEIIPAAVKE  344

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKSF++ANLALTE+ P FEFYDPKTPF+TSPRFLPPTK+D C+
Sbjct  345   HNVQAYLFNDYWEDIGTIKSFFDANLALTEQPPNFEFYDPKTPFFTSPRFLPPTKVDKCR  404

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I +AIISHGCFLREC+V+HSI+G RSRL+ G ELKDT+MMGAD Y TESEIASLLA+G V
Sbjct  405   IVNAIISHGCFLRECSVQHSIVGVRSRLEYGCELKDTMMMGADYYHTESEIASLLAEGKV  464

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKIRN IIDKN +IG+DV+I NKDGVQE+DRPD+GFYIRSGI +I++ ATI D
Sbjct  465   PIGVGQNTKIRNCIIDKNAKIGRDVIIANKDGVQEADRPDDGFYIRSGIIVILKNATIKD  524

Query  410   GTVI  399
             GTVI
Sbjct  525   GTVI  528



>ref|XP_003606943.1| Glucose-1-phosphate adenylyltransferase [Medicago truncatula]
 gb|AES89140.1| glucose-1-phosphate adenylyltransferase family protein [Medicago 
truncatula]
Length=528

 Score =   414 bits (1063),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 191/244 (78%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DT+L GL  QDA  +PYIASMGVYVF+TDVLL+LL+WRYPTSNDFGSEI+PA+VKE
Sbjct  285   SMQADTSLFGLSNQDALRSPYIASMGVYVFKTDVLLKLLKWRYPTSNDFGSEIIPASVKE  344

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQA+ F DYWEDIGTIKSFY+AN+ALTEE P F+FYDPKTP +TSP FLPPTKID C+
Sbjct  345   YNVQAFFFGDYWEDIGTIKSFYDANMALTEESPMFKFYDPKTPIFTSPGFLPPTKIDKCR  404

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+GERSRLD GVEL+DT+MMGAD Y+TESEIAS LA+G V
Sbjct  405   IVDAIISHGCFLRECSVQHSIVGERSRLDYGVELQDTVMMGADYYQTESEIASELAEGKV  464

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G N+K+R  IIDKN RIGKDV+IMNKDGVQE+DRP++GFYIRSGITI+MEKATI D
Sbjct  465   PIGIGSNSKVRKCIIDKNARIGKDVIIMNKDGVQEADRPEDGFYIRSGITIVMEKATIED  524

Query  410   GTVI  399
             GTVI
Sbjct  525   GTVI  528



>ref|XP_010060971.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Eucalyptus grandis]
 ref|XP_010060972.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Eucalyptus grandis]
 gb|KCW67874.1| hypothetical protein EUGRSUZ_F01590 [Eucalyptus grandis]
 gb|KCW67875.1| hypothetical protein EUGRSUZ_F01590 [Eucalyptus grandis]
Length=524

 Score =   413 bits (1061),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 192/244 (79%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTLLGL  QDA   PYIASMGVYVF+TDVLL+LLRW YP+ NDFGSEI+P+AV E
Sbjct  281   AMQVDTTLLGLSKQDAVNLPYIASMGVYVFKTDVLLKLLRWSYPSCNDFGSEIIPSAVAE  340

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKSF++ANLALTE+ PKFEFYDP+TPFYTSPRFLPP+K+D C+
Sbjct  341   HNVQAYLFNDYWEDIGTIKSFFDANLALTEQPPKFEFYDPQTPFYTSPRFLPPSKVDKCR  400

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFL+EC++EHSI+G RSRLD GVE KDT+MMGAD Y+TE+EIASLLA G V
Sbjct  401   IVDAIISHGCFLQECSIEHSIVGVRSRLDYGVEFKDTMMMGADYYQTEAEIASLLAQGKV  460

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKIRN IIDKN RIGK+VVI N DGVQE+DRP+EGFYIRSGIT+I++ ATI D
Sbjct  461   PIGVGQNTKIRNCIIDKNARIGKNVVIHNTDGVQEADRPEEGFYIRSGITVILKNATIKD  520

Query  410   GTVI  399
             GTV+
Sbjct  521   GTVV  524



>ref|XP_007136623.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
 gb|ESW08617.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
Length=337

 Score =   405 bits (1041),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDTTLLGL PQ+A  +PYIASMGVYVFRT+ LL+LLRW+Y + NDFGSEI+P+AV E
Sbjct  94    AMRVDTTLLGLSPQEAEKHPYIASMGVYVFRTETLLQLLRWQYSSCNDFGSEIIPSAVSE  153

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQAY+F DYWEDIGTIKSF++ANLALTE+ PKFEFYDPKTPF+TSPRFLPPTK++ CK
Sbjct  154   HHVQAYLFNDYWEDIGTIKSFFDANLALTEQPPKFEFYDPKTPFFTSPRFLPPTKVEKCK  213

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCF+R C+V+HSI+G RSRL+ GVEL+DT+MMGAD Y+TESEIASLLA+G V
Sbjct  214   IVDAIISHGCFMRNCSVQHSIVGVRSRLESGVELQDTMMMGADYYQTESEIASLLAEGKV  273

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRN IIDKN +IG++V+I N DGVQE+DR  EGFYIRSGITI ++ ATI D
Sbjct  274   PIGVGENTKIRNCIIDKNAKIGRNVIIANADGVQEADRAKEGFYIRSGITITLKNATIKD  333

Query  410   GTVI  399
             GTVI
Sbjct  334   GTVI  337



>ref|NP_001284451.1| myeloid leukemia factor 1 [Cucumis melo]
 gb|AAB91463.1| ADP-glucose pyrophosphorylase large subunit [Cucumis melo]
Length=525

 Score =   411 bits (1057),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 219/243 (90%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             M+VDTT  GL  +++  +PYI SMGVYVF+TDVLL LL+WRYP+SNDFGSEI+PAA+K+H
Sbjct  283   MRVDTTSFGLSREESLKSPYIGSMGVYVFKTDVLLNLLKWRYPSSNDFGSEIIPAAIKDH  342

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
             NVQA++FRDYWEDIGTIK+FY+ANLAL     KFEFYDPKTPFYTSPRFLPPTKID C+I
Sbjct  343   NVQAFMFRDYWEDIGTIKTFYDANLALHGNVSKFEFYDPKTPFYTSPRFLPPTKIDRCQI  402

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
              DAIISHGCFLREC+++HSI+GERSRLD GVELKDT+MMGADNY+TESEI  LLA+G VP
Sbjct  403   VDAIISHGCFLRECSIQHSIVGERSRLDYGVELKDTIMMGADNYQTESEITGLLAEGKVP  462

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             +G+G NTKIR  IIDKN +IGKDV+IMNKDGVQE+DRP++GFYIRSGITI+MEKATI DG
Sbjct  463   VGIGPNTKIRKCIIDKNAKIGKDVIIMNKDGVQEADRPEQGFYIRSGITIVMEKATIEDG  522

Query  407   TVI  399
             TVI
Sbjct  523   TVI  525



>ref|XP_007136618.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
 gb|ESW08612.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
Length=365

 Score =   405 bits (1042),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDTTLLGL PQ+A  +PYIASMGVYVFRT+ LL+LLRW+Y + NDFGSEI+P+AV E
Sbjct  122   AMRVDTTLLGLSPQEAEKHPYIASMGVYVFRTETLLQLLRWQYSSCNDFGSEIIPSAVSE  181

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQAY+F DYWEDIGTIKSF++ANLALTE+ PKFEFYDPKTPF+TSPRFLPPTK++ CK
Sbjct  182   HHVQAYLFNDYWEDIGTIKSFFDANLALTEQPPKFEFYDPKTPFFTSPRFLPPTKVEKCK  241

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCF+R C+V+HSI+G RSRL+ GVEL+DT+MMGAD Y+TESEIASLLA+G V
Sbjct  242   IVDAIISHGCFMRNCSVQHSIVGVRSRLESGVELQDTMMMGADYYQTESEIASLLAEGKV  301

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRN IIDKN +IG++V+I N DGVQE+DR  EGFYIRSGITI ++ ATI D
Sbjct  302   PIGVGENTKIRNCIIDKNAKIGRNVIIANADGVQEADRAKEGFYIRSGITITLKNATIKD  361

Query  410   GTVI  399
             GTVI
Sbjct  362   GTVI  365



>ref|XP_010531437.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic [Tarenaya hassleriana]
 ref|XP_010531439.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic [Tarenaya hassleriana]
Length=526

 Score =   411 bits (1057),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 189/244 (77%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+ DT +LGL PQ+A  +PYIASMGVYVF+T+ LL+LL WRYPTSNDFGSEI+PAA+++
Sbjct  283   AMRTDTAMLGLSPQEATKSPYIASMGVYVFKTEALLKLLTWRYPTSNDFGSEIIPAAIRD  342

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY FRDYWEDIGTIK+FY ANLAL EE PKFEFYDP TPFYTSPRFLPP+KI+ C+
Sbjct  343   HNVQAYFFRDYWEDIGTIKTFYEANLALAEEHPKFEFYDPDTPFYTSPRFLPPSKIEMCR  402

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+IISHGCFLREC+V+ SI+GERSRLD GV+L+DT+M+GAD Y+TESEIASLLA+GNV
Sbjct  403   IVDSIISHGCFLRECSVQRSIVGERSRLDYGVDLQDTVMLGADYYQTESEIASLLAEGNV  462

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKIR  IIDKN +IGKDV+I+NKD VQE+DRPDEGFYIRSGIT+I+EKATI D
Sbjct  463   PIGIGRNTKIRKCIIDKNAKIGKDVMIVNKDDVQEADRPDEGFYIRSGITVIVEKATIED  522

Query  410   GTVI  399
             GTVI
Sbjct  523   GTVI  526



>ref|XP_007199332.1| hypothetical protein PRUPE_ppa023764mg, partial [Prunus persica]
 gb|EMJ00531.1| hypothetical protein PRUPE_ppa023764mg, partial [Prunus persica]
Length=353

 Score =   405 bits (1040),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 190/242 (79%), Positives = 217/242 (90%), Gaps = 5/242 (2%)
 Frame = -3

Query  1124  QVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEHN  945
             Q DTTLLGL PQDA  +PY+ASMGVYVF+T++LL LLRWRYPTSNDFGSEI+PAAV+EH 
Sbjct  117   QTDTTLLGLSPQDAMKSPYVASMGVYVFKTEILLNLLRWRYPTSNDFGSEIIPAAVREHK  176

Query  944   VQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKIK  765
             VQAY+FR+YWEDIGTIKSFY+ANLALTEEF     YDPKTP +TSPRFLPPTKID C+I 
Sbjct  177   VQAYMFREYWEDIGTIKSFYDANLALTEEF-----YDPKTPIFTSPRFLPPTKIDKCRIV  231

Query  764   DAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVPI  585
             DAIISHGCFLREC+V+HSI+GERSRLD GVELKD +MMGAD Y+TE+EIASLLA+G VP+
Sbjct  232   DAIISHGCFLRECSVQHSIVGERSRLDYGVELKDAIMMGADYYQTETEIASLLAEGKVPV  291

Query  584   GVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDGT  405
             G+G NTKIRN IIDKN +IGKD VI+NKDGV+E+DRP+EGFYIR GITII+EKATI DG 
Sbjct  292   GIGRNTKIRNCIIDKNAKIGKDAVIVNKDGVREADRPEEGFYIREGITIILEKATIQDGM  351

Query  404   VI  399
             VI
Sbjct  352   VI  353



>gb|ERM94645.1| hypothetical protein AMTR_s00011p00201790 [Amborella trichopoda]
Length=520

 Score =   411 bits (1056),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 189/244 (77%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT LGL  QDA+  PYIASMGVYVFRTDVLL+LLRWRYPTSNDFGSEI+P++V E
Sbjct  277   AMQVDTTRLGLSAQDAKRYPYIASMGVYVFRTDVLLKLLRWRYPTSNDFGSEIIPSSVNE  336

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAY+F DYWEDIGTIKSF++ANLALTEE PKF+FYDP TPF+TSPRFLPPTKI+ C+
Sbjct  337   YNVQAYLFNDYWEDIGTIKSFFDANLALTEEPPKFQFYDPMTPFFTSPRFLPPTKIEKCR  396

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+G RSRL+ GVEL+DT+MMGAD Y+TE+EIA+LLA+G V
Sbjct  397   ILDAIISHGCFLRECSVQHSIVGVRSRLETGVELQDTMMMGADYYQTEAEIAALLAEGKV  456

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVG+NTKIRN IIDKN +IGK+VVI N DGVQE+DRP EGFYIRSGIT+I++ +TI D
Sbjct  457   PVGVGQNTKIRNCIIDKNAKIGKNVVIANTDGVQEADRPSEGFYIRSGITVILKNSTIKD  516

Query  410   GTVI  399
             G VI
Sbjct  517   GMVI  520



>ref|XP_006878500.2| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Amborella trichopoda]
 ref|XP_011623584.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Amborella trichopoda]
Length=534

 Score =   411 bits (1057),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 189/244 (77%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT LGL  QDA+  PYIASMGVYVFRTDVLL+LLRWRYPTSNDFGSEI+P++V E
Sbjct  291   AMQVDTTRLGLSAQDAKRYPYIASMGVYVFRTDVLLKLLRWRYPTSNDFGSEIIPSSVNE  350

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAY+F DYWEDIGTIKSF++ANLALTEE PKF+FYDP TPF+TSPRFLPPTKI+ C+
Sbjct  351   YNVQAYLFNDYWEDIGTIKSFFDANLALTEEPPKFQFYDPMTPFFTSPRFLPPTKIEKCR  410

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+G RSRL+ GVEL+DT+MMGAD Y+TE+EIA+LLA+G V
Sbjct  411   ILDAIISHGCFLRECSVQHSIVGVRSRLETGVELQDTMMMGADYYQTEAEIAALLAEGKV  470

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVG+NTKIRN IIDKN +IGK+VVI N DGVQE+DRP EGFYIRSGIT+I++ +TI D
Sbjct  471   PVGVGQNTKIRNCIIDKNAKIGKNVVIANTDGVQEADRPSEGFYIRSGITVILKNSTIKD  530

Query  410   GTVI  399
             G VI
Sbjct  531   GMVI  534



>ref|XP_004500804.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cicer arietinum]
Length=518

 Score =   410 bits (1054),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTL GL PQDA  +PYIASMGVYVF+ DVLL+LL+WRYPTSNDFGSEI+P+A++E
Sbjct  275   AMQVDTTLHGLSPQDALKSPYIASMGVYVFKKDVLLKLLKWRYPTSNDFGSEIIPSAIRE  334

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNV+AY F DYWEDIGTIKSFY+ANLALTEE PKFEFYDPKTP +TSP FLPPTKIDNC+
Sbjct  335   HNVKAYFFGDYWEDIGTIKSFYDANLALTEESPKFEFYDPKTPIFTSPGFLPPTKIDNCR  394

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + DAIISHGCFLRECT++HSI+GERSRLD GVEL++T+MMGADNY+TESEIASLLA+G V
Sbjct  395   VVDAIISHGCFLRECTIQHSIVGERSRLDYGVELQETVMMGADNYQTESEIASLLAEGKV  454

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKIRN IIDKN +IGKDV+I NKDGVQE+DR ++GFYIRSGITIIMEKATI D
Sbjct  455   PIGIGRNTKIRNCIIDKNAKIGKDVIIANKDGVQEADRSEDGFYIRSGITIIMEKATIED  514

Query  410   GTVI  399
             GTVI
Sbjct  515   GTVI  518



>ref|XP_007136622.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
 gb|ESW08616.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
Length=396

 Score =   405 bits (1042),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDTTLLGL PQ+A  +PYIASMGVYVFRT+ LL+LLRW+Y + NDFGSEI+P+AV E
Sbjct  153   AMRVDTTLLGLSPQEAEKHPYIASMGVYVFRTETLLQLLRWQYSSCNDFGSEIIPSAVSE  212

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQAY+F DYWEDIGTIKSF++ANLALTE+ PKFEFYDPKTPF+TSPRFLPPTK++ CK
Sbjct  213   HHVQAYLFNDYWEDIGTIKSFFDANLALTEQPPKFEFYDPKTPFFTSPRFLPPTKVEKCK  272

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCF+R C+V+HSI+G RSRL+ GVEL+DT+MMGAD Y+TESEIASLLA+G V
Sbjct  273   IVDAIISHGCFMRNCSVQHSIVGVRSRLESGVELQDTMMMGADYYQTESEIASLLAEGKV  332

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRN IIDKN +IG++V+I N DGVQE+DR  EGFYIRSGITI ++ ATI D
Sbjct  333   PIGVGENTKIRNCIIDKNAKIGRNVIIANADGVQEADRAKEGFYIRSGITITLKNATIKD  392

Query  410   GTVI  399
             GTVI
Sbjct  393   GTVI  396



>dbj|BAC66692.1| ADP-glucose pyrophosphorylase large subunit PvAGPL1 [Phaseolus 
vulgaris]
Length=525

 Score =   410 bits (1053),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 194/244 (80%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DT+LLGL P DA  +PYIASMGVYVF+TDVLL LL+ R+PTSNDFGSEI+PAAV++
Sbjct  282   AMQADTSLLGLSPPDALKSPYIASMGVYVFKTDVLLNLLKCRHPTSNDFGSEIIPAAVRD  341

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQ+Y FRDYWEDIGTIKSFY+ANLALTEE  +FEFYDPKTP YTSP FLPPTKID  +
Sbjct  342   HNVQSYFFRDYWEDIGTIKSFYDANLALTEESHEFEFYDPKTPIYTSPGFLPPTKIDKSR  401

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLRECTV+HSI+GERSRLD GVE++DT+MMGAD Y+TESEIASLLA+G V
Sbjct  402   IVDAIISHGCFLRECTVQHSIVGERSRLDYGVEIQDTVMMGADYYQTESEIASLLAEGKV  461

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKIRN IIDKN +IGKDV+I NKD VQE+DRP++GFYIRSGITII EKATI D
Sbjct  462   PIGIGRNTKIRNCIIDKNAKIGKDVIIKNKDDVQEADRPEDGFYIRSGITIIAEKATIED  521

Query  410   GTVI  399
             GTVI
Sbjct  522   GTVI  525



>ref|XP_007136159.1| hypothetical protein PHAVU_009G023100g [Phaseolus vulgaris]
 ref|XP_007136160.1| hypothetical protein PHAVU_009G023100g [Phaseolus vulgaris]
 gb|ESW08153.1| hypothetical protein PHAVU_009G023100g [Phaseolus vulgaris]
 gb|ESW08154.1| hypothetical protein PHAVU_009G023100g [Phaseolus vulgaris]
Length=525

 Score =   410 bits (1053),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 194/244 (80%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DT+LLGL P DA  +PYIASMGVYVF+TDVLL LL+ R+PTSNDFGSEI+PAAV++
Sbjct  282   AMQADTSLLGLSPPDALKSPYIASMGVYVFKTDVLLNLLKCRHPTSNDFGSEIIPAAVRD  341

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQ+Y FRDYWEDIGTIKSFY+ANLALTEE  +FEFYDPKTP YTSP FLPPTKID  +
Sbjct  342   HNVQSYFFRDYWEDIGTIKSFYDANLALTEESHEFEFYDPKTPIYTSPGFLPPTKIDKSR  401

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLRECTV+HSI+GERSRLD GVE++DT+MMGAD Y+TESEIASLLA+G V
Sbjct  402   IVDAIISHGCFLRECTVQHSIVGERSRLDYGVEIQDTVMMGADYYQTESEIASLLAEGKV  461

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKIRN IIDKN +IGKDV+I NKD VQE+DRP++GFYIRSGITII EKATI D
Sbjct  462   PIGIGRNTKIRNCIIDKNAKIGKDVIIKNKDDVQEADRPEDGFYIRSGITIIAEKATIED  521

Query  410   GTVI  399
             GTVI
Sbjct  522   GTVI  525



>ref|XP_011028874.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Populus euphratica]
Length=528

 Score =   409 bits (1052),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 191/244 (78%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTLLGL  Q+A   PYIASMGVYVFRTDVLL+LLR  YP+ NDFGSEI+P+AVKE
Sbjct  285   AMQVDTTLLGLSKQEAMQFPYIASMGVYVFRTDVLLKLLRCSYPSCNDFGSEIIPSAVKE  344

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKS ++ANLALTE+ PKFEFYDPKTPF+TSPRFLPPTK+D C+
Sbjct  345   HNVQAYLFNDYWEDIGTIKSLFDANLALTEQPPKFEFYDPKTPFFTSPRFLPPTKVDKCR  404

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+G RSRL+ GVEL DT+MMGAD Y+TESEIASLLA+G V
Sbjct  405   IVDAIISHGCFLRECSVQHSIVGVRSRLESGVELTDTMMMGADYYQTESEIASLLAEGKV  464

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKIRN IIDKN +IGKDV+I N DGVQE DRP EGFYIRSGIT +++ ATI D
Sbjct  465   PIGVGQNTKIRNCIIDKNAKIGKDVIITNADGVQEGDRPSEGFYIRSGITAVLKNATIKD  524

Query  410   GTVI  399
             GT+I
Sbjct  525   GTII  528



>ref|XP_011007450.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Populus euphratica]
Length=528

 Score =   409 bits (1052),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/244 (77%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTLLGL  Q+A   PYIASMGVYVFRTDVLL+LLRW YP+ NDFGSEI+P+AV++
Sbjct  285   AMQVDTTLLGLSRQEAMQFPYIASMGVYVFRTDVLLKLLRWSYPSCNDFGSEIIPSAVRD  344

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGT+KSF++ANL LT++ PKFEFYDP+TPF+TSPRFLPPTK+D C+
Sbjct  345   HNVQAYLFNDYWEDIGTVKSFFDANLGLTKQPPKFEFYDPQTPFFTSPRFLPPTKVDRCR  404

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+G RSRL+ GVEL DT+MMGAD Y+TESEIASLLA+G V
Sbjct  405   IVDAIISHGCFLRECSVQHSIVGVRSRLESGVELTDTMMMGADYYQTESEIASLLAEGKV  464

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKIRN IIDKN RIGKDV+I N DGVQE+DRP EGFYIRSGIT +++ ATI D
Sbjct  465   PIGVGQNTKIRNCIIDKNARIGKDVIITNADGVQEADRPAEGFYIRSGITAVLKNATIKD  524

Query  410   GTVI  399
             GT+I
Sbjct  525   GTLI  528



>gb|EPS74142.1| glucose-1-phosphate adenylyltransferase [Genlisea aurea]
Length=543

 Score =   410 bits (1053),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 199/266 (75%), Positives = 224/266 (84%), Gaps = 22/266 (8%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ+DT+++GL  ++A  +PYIASMGVY F+TDVLL LL++RYPTSNDFGSEI+P++VKE
Sbjct  278   AMQLDTSIVGLSHEEAANSPYIASMGVYAFKTDVLLNLLKFRYPTSNDFGSEIIPSSVKE  337

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
              NVQAYIFRDYWEDIGTIKSFY+ANLALT EFPKFEFYDPKTPFYTSPRFLPPTKIDN K
Sbjct  338   QNVQAYIFRDYWEDIGTIKSFYDANLALTHEFPKFEFYDPKTPFYTSPRFLPPTKIDNSK  397

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELK----------------------DTL  657
             IKDAIISHGCFLREC VEHSIIGERSRLD GVELK                      DTL
Sbjct  398   IKDAIISHGCFLRECIVEHSIIGERSRLDIGVELKACLYTHTRMDVYVYEFAIIFSQDTL  457

Query  656   MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  477
             MMGAD+Y+TESEIASLLA G VP+G+G ++KIRN IIDKN RIGK+V+I NKDGV+E+DR
Sbjct  458   MMGADSYQTESEIASLLAQGKVPVGIGRDSKIRNCIIDKNARIGKNVIIENKDGVEEADR  517

Query  476   PDEGFYIRSGITIIMEKATIPDGTVI  399
             P+EGFYIR GITII EKATI DGTVI
Sbjct  518   PEEGFYIRGGITIISEKATINDGTVI  543



>ref|XP_002300758.1| ADP-glucose pyrophosphorylase large subunit 2 family protein 
[Populus trichocarpa]
 gb|EEE80031.1| ADP-glucose pyrophosphorylase large subunit 2 family protein 
[Populus trichocarpa]
Length=528

 Score =   409 bits (1050),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 190/244 (78%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTLLGL  Q+A   PYIASMGVYVFRTDVLL+LLR  YP+ NDFGSEI+P+AVKE
Sbjct  285   AMQVDTTLLGLSKQEAMQFPYIASMGVYVFRTDVLLKLLRCSYPSCNDFGSEIIPSAVKE  344

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKS ++ANLALTE+ PKFEFYDPKTPF+TSPRFLPPTK+D C+
Sbjct  345   HNVQAYLFNDYWEDIGTIKSLFDANLALTEQPPKFEFYDPKTPFFTSPRFLPPTKVDKCR  404

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+G RSRL+ GVEL DT+MMGAD Y+TESEIAS+LA+G V
Sbjct  405   IVDAIISHGCFLRECSVQHSIVGVRSRLESGVELTDTMMMGADYYQTESEIASVLAEGKV  464

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKIRN IIDKN +IGKDV+I N DGVQE+DRP EGFYIRSGIT +++ ATI D
Sbjct  465   PIGVGQNTKIRNCIIDKNAKIGKDVIITNADGVQEADRPSEGFYIRSGITAVLKNATIKD  524

Query  410   GTVI  399
             GT+I
Sbjct  525   GTII  528



>ref|XP_004147856.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Cucumis sativus]
 gb|KGN59984.1| hypothetical protein Csa_3G859710 [Cucumis sativus]
Length=532

 Score =   407 bits (1047),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 188/244 (77%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT+LGL  +DAR NPYIASMGVYVFRTD+LL+LL W YP  NDFGSEI+PAAVK+
Sbjct  289   AMQVDTTVLGLSDEDARKNPYIASMGVYVFRTDLLLKLLTWSYPACNDFGSEIIPAAVKD  348

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             + VQAY+F DYWEDIGT+KSF++ANLALTE+ PKFEFYDPKTPFYTSPRFLPP+K++ CK
Sbjct  349   YKVQAYLFNDYWEDIGTVKSFFDANLALTEQPPKFEFYDPKTPFYTSPRFLPPSKVEKCK  408

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLRECTVEHSI+G RSRL+ GVELKDT+MMGAD Y+TESEIASLLA+G +
Sbjct  409   IVDAIISHGCFLRECTVEHSIVGVRSRLEYGVELKDTMMMGADYYQTESEIASLLAEGKI  468

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+GENTKIRN IIDKN +IG++VVI N D VQE++RP+EGFYIRSGIT+ ++ ATI D
Sbjct  469   PIGIGENTKIRNCIIDKNAKIGRNVVIANTDDVQEAERPEEGFYIRSGITVTLKNATIKD  528

Query  410   GTVI  399
             GT+I
Sbjct  529   GTII  532



>gb|AAB91468.1| ADP-glucose pyrophosphorylase large subunit 2 [Citrullus lanatus 
subsp. vulgaris]
Length=481

 Score =   406 bits (1043),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 185/244 (76%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDTT+LGL  QDAR NPYIASMGVY+FRTD+LL+LL W YP+ NDFGSEI+P+AVK+
Sbjct  238   AMKVDTTVLGLSNQDARKNPYIASMGVYIFRTDLLLKLLTWSYPSCNDFGSEIIPSAVKD  297

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             + VQAY+F DYWEDIGT+KSF++ANLALTE+ PKFEFYDPKTPFYTSPRFLPP+K++ C+
Sbjct  298   YKVQAYLFNDYWEDIGTVKSFFDANLALTEQPPKFEFYDPKTPFYTSPRFLPPSKVEKCR  357

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+VEHSI+G RSRL+ GVELKDT+MMGAD Y+TESEIASLLA+G +
Sbjct  358   IVDAIISHGCFLRECSVEHSIVGVRSRLEYGVELKDTMMMGADYYQTESEIASLLAEGKI  417

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+GENTKIRN IIDKN RIG++VVI N D VQE+DRP++GFYIRSGIT+ ++ ATI D
Sbjct  418   PIGIGENTKIRNCIIDKNARIGRNVVIANSDDVQEADRPEDGFYIRSGITVTLKNATIKD  477

Query  410   GTVI  399
             GT+I
Sbjct  478   GTII  481



>ref|XP_008800701.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Phoenix dactylifera]
Length=525

 Score =   407 bits (1047),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 190/244 (78%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDTT L L  QDA+  PYIASMGVYVFR DVLL+LLRWRYP SNDFGSEILP++VK+
Sbjct  282   AMKVDTTFLRLSHQDAKRYPYIASMGVYVFRRDVLLKLLRWRYPKSNDFGSEILPSSVKD  341

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAY+F DYWEDIGTIK F++ANLALT++ PKF+FYDPKTPF+TSPRFLPPTKI+ C+
Sbjct  342   YNVQAYLFNDYWEDIGTIKPFFDANLALTDQPPKFQFYDPKTPFFTSPRFLPPTKIEKCR  401

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + DAIISHGCFLREC+V+HSI+G RSRLD G ELKDT+MMGADNYETE+EIASLLA+G V
Sbjct  402   VLDAIISHGCFLRECSVQHSIVGVRSRLDYGAELKDTVMMGADNYETEAEIASLLAEGKV  461

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG NTKI N IID NVRIGK++VI NKDGVQE+DRP EGFYIRSGITII++ ATI D
Sbjct  462   PIGVGRNTKISNCIIDMNVRIGKNIVIANKDGVQEADRPHEGFYIRSGITIILKNATIKD  521

Query  410   GTVI  399
             GT+I
Sbjct  522   GTII  525



>ref|XP_002307668.2| hypothetical protein POPTR_0005s25130g [Populus trichocarpa]
 gb|EEE94664.2| hypothetical protein POPTR_0005s25130g [Populus trichocarpa]
Length=528

 Score =   407 bits (1046),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTLLGL  Q+A   PYIASMGVYVFRTDVLL+LLRW YP+ NDFGSEI+P+AV++
Sbjct  285   AMQVDTTLLGLSRQEAMQFPYIASMGVYVFRTDVLLKLLRWSYPSCNDFGSEIIPSAVRD  344

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGT+KSF++ANL LT++ PKFEFYDP+TPF+TSPRFLPPTK+D C+
Sbjct  345   HNVQAYLFNDYWEDIGTVKSFFDANLGLTKQPPKFEFYDPQTPFFTSPRFLPPTKVDRCR  404

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+G RSRL+ GVEL DT+MMGAD Y+TESEIASLLA+G V
Sbjct  405   IVDAIISHGCFLRECSVQHSIVGVRSRLESGVELTDTMMMGADYYQTESEIASLLAEGKV  464

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKIRN IIDKN +IGKDV+I N DGVQE+DRP EGFYIRSGIT +++ A I D
Sbjct  465   PIGVGQNTKIRNCIIDKNAKIGKDVIITNADGVQEADRPSEGFYIRSGITAVLKNAAIKD  524

Query  410   GTVI  399
             GT+I
Sbjct  525   GTLI  528



>emb|CDP07489.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   407 bits (1045),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 188/244 (77%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT+LLGL  ++A   PYIASMGVYVFRTDVLL LLRW+YP+ NDFGSEI+P+AVK+
Sbjct  287   AMQVDTSLLGLSAKEAMKYPYIASMGVYVFRTDVLLSLLRWKYPSCNDFGSEIIPSAVKD  346

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTI+SF+++NLALTE+ PKF+F DPKTPFYTSPRFLPPTK++ C+
Sbjct  347   HNVQAYLFSDYWEDIGTIRSFFDSNLALTEQPPKFDFNDPKTPFYTSPRFLPPTKVEKCR  406

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+VEHSI+G RSRLD GVEL DT+MMGAD Y+TESEIASLLA+G V
Sbjct  407   IVDAIISHGCFLRECSVEHSIVGVRSRLDYGVELMDTMMMGADYYQTESEIASLLAEGKV  466

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKIRN IIDKN +IG+DVVI N DGV+E+DRP+EGFYIRSGI +I++ ATI D
Sbjct  467   PIGVGQNTKIRNCIIDKNTKIGRDVVITNADGVEEADRPEEGFYIRSGIIVILKNATIKD  526

Query  410   GTVI  399
             GTVI
Sbjct  527   GTVI  530



>ref|XP_010263606.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Nelumbo nucifera]
Length=528

 Score =   406 bits (1044),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 189/244 (77%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT  LGL  +++   PYIASMGVYVFRT+VLL+LLRWRYPT NDFGSEI+PAAVKE
Sbjct  285   AMQVDTAFLGLSQEESIKYPYIASMGVYVFRTEVLLKLLRWRYPTCNDFGSEIIPAAVKE  344

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKSF++ANLALTE+ PKFEFYDPKT F+TSPRFLPPTK+D C+
Sbjct  345   HNVQAYLFNDYWEDIGTIKSFFDANLALTEQPPKFEFYDPKTLFFTSPRFLPPTKVDKCR  404

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I +AIISHGCFLREC+V+HS++G RSRL+ GVEL DT+MMGAD Y+TESEIASLLA+G V
Sbjct  405   IVNAIISHGCFLRECSVQHSVVGVRSRLEYGVELMDTMMMGADYYQTESEIASLLAEGKV  464

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKIRN IIDKN +IG+DVVI NKD VQE+DRPDEGFYIRSGI +I++ ATI D
Sbjct  465   PIGVGQNTKIRNCIIDKNAKIGRDVVIENKDNVQEADRPDEGFYIRSGIVVILKNATIKD  524

Query  410   GTVI  399
             GT+I
Sbjct  525   GTII  528



>ref|XP_008388042.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Malus domestica]
Length=512

 Score =   405 bits (1042),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 188/244 (77%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT+LGL   +A  +PYIASMGVYVFRTDVLL+LLRW YP+ NDFGSEI+P+AVKE
Sbjct  269   AMQVDTTVLGLSDLEAMKSPYIASMGVYVFRTDVLLKLLRWSYPSCNDFGSEIIPSAVKE  328

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGT+KSF++ANLALTE+ PKFEF DPKTPFYTSPRFLPPTK++ C+
Sbjct  329   HNVQAYLFNDYWEDIGTVKSFFDANLALTEQPPKFEFNDPKTPFYTSPRFLPPTKVEKCR  388

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+G RSRL+ GVELKDT+MMGAD Y+TESEIASLLA G V
Sbjct  389   IMDAIISHGCFLRECSVQHSIVGVRSRLESGVELKDTMMMGADYYQTESEIASLLAQGKV  448

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVGENTKI N IIDKN +IG++VVI N DGVQE++R DEGFYIRSGIT++++ ATI D
Sbjct  449   PVGVGENTKIWNCIIDKNAKIGRNVVITNGDGVQEAERADEGFYIRSGITVVLKNATIKD  508

Query  410   GTVI  399
             GTVI
Sbjct  509   GTVI  512



>ref|XP_007136616.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
 gb|ESW08610.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
Length=528

 Score =   405 bits (1042),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDTTLLGL PQ+A  +PYIASMGVYVFRT+ LL+LLRW+Y + NDFGSEI+P+AV E
Sbjct  285   AMRVDTTLLGLSPQEAEKHPYIASMGVYVFRTETLLQLLRWQYSSCNDFGSEIIPSAVSE  344

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQAY+F DYWEDIGTIKSF++ANLALTE+ PKFEFYDPKTPF+TSPRFLPPTK++ CK
Sbjct  345   HHVQAYLFNDYWEDIGTIKSFFDANLALTEQPPKFEFYDPKTPFFTSPRFLPPTKVEKCK  404

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCF+R C+V+HSI+G RSRL+ GVEL+DT+MMGAD Y+TESEIASLLA+G V
Sbjct  405   IVDAIISHGCFMRNCSVQHSIVGVRSRLESGVELQDTMMMGADYYQTESEIASLLAEGKV  464

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRN IIDKN +IG++V+I N DGVQE+DR  EGFYIRSGITI ++ ATI D
Sbjct  465   PIGVGENTKIRNCIIDKNAKIGRNVIIANADGVQEADRAKEGFYIRSGITITLKNATIKD  524

Query  410   GTVI  399
             GTVI
Sbjct  525   GTVI  528



>emb|CDY41275.1| BnaA01g12640D [Brassica napus]
Length=322

 Score =   398 bits (1022),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 183/244 (75%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT+LGLPP++A   PYIASMGVYVFR +VLL LLR  YPTSNDFGSEI+P AVKE
Sbjct  79    AMQVDTTVLGLPPKEAAELPYIASMGVYVFRKEVLLNLLRSSYPTSNDFGSEIIPLAVKE  138

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQA++F DYWEDIGTI SF++ANLALTE+ PKF+FYDPKTPF+TSPRFLPPTK+D C+
Sbjct  139   HNVQAFLFNDYWEDIGTIGSFFDANLALTEQPPKFQFYDPKTPFFTSPRFLPPTKVDKCR  198

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT+MMGAD Y+TE+EIASLLA+G V
Sbjct  199   ILDSIVSHGCFLRECSVQHSIVGIRSRVESGVELQDTMMMGADFYQTEAEIASLLAEGKV  258

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRN IIDKN +IGK+VVI N DGV+E DRP+EG YIRSGIT++++ ATI D
Sbjct  259   PIGVGENTKIRNCIIDKNAKIGKNVVIANADGVEEGDRPEEGVYIRSGITVVLKNATIRD  318

Query  410   GTVI  399
             G V+
Sbjct  319   GLVL  322



>ref|XP_010110050.1| Glucose-1-phosphate adenylyltransferase large subunit [Morus 
notabilis]
 gb|EXC25068.1| Glucose-1-phosphate adenylyltransferase large subunit [Morus 
notabilis]
Length=524

 Score =   404 bits (1039),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGL   DA+  PYIASMGVYVF+TDVLL+LLRW YP  NDFGSEI+P+AV+E
Sbjct  281   AMQVDTSVLGLSQHDAKKFPYIASMGVYVFKTDVLLKLLRWSYPHCNDFGSEIIPSAVRE  340

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKSF++ANLALTE+ PKFEFYDPKTPFYTSPRFLPPTK++ C+
Sbjct  341   HNVQAYLFNDYWEDIGTIKSFFDANLALTEQPPKFEFYDPKTPFYTSPRFLPPTKVEKCR  400

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+G RSRL+ GVEL+D +MMGAD Y+TESEIASLLA+G V
Sbjct  401   IVDAIISHGCFLRECSVQHSIVGVRSRLEYGVELQDAMMMGADYYQTESEIASLLAEGKV  460

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKIRN IIDKN +IG+DVVI N DGV+E+DR  +GF+IRSGIT+I++ ATI D
Sbjct  461   PIGVGQNTKIRNCIIDKNAKIGRDVVITNADGVEEADRSSKGFHIRSGITVILKNATIKD  520

Query  410   GTVI  399
             GTVI
Sbjct  521   GTVI  524



>ref|XP_009365525.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Pyrus x bretschneideri]
 ref|XP_009365526.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Pyrus x bretschneideri]
 ref|XP_009365527.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Pyrus x bretschneideri]
Length=512

 Score =   404 bits (1037),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 188/244 (77%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT+LGL   +A  +PYIASMGVYVFRTDVLL+LLRW YP+ NDFGSEI+P+AVKE
Sbjct  269   AMQVDTTVLGLSDLEAMNSPYIASMGVYVFRTDVLLKLLRWSYPSCNDFGSEIIPSAVKE  328

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGT+KSF++ANLALTE+ PKFEF DPKTPFYTSPRFLPPTK++ C+
Sbjct  329   HNVQAYLFNDYWEDIGTVKSFFDANLALTEQPPKFEFNDPKTPFYTSPRFLPPTKVEECR  388

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+G RSRL+ GVELKDT+MMGAD Y+TESEIASLLA G V
Sbjct  389   IMDAIISHGCFLRECSVQHSIVGVRSRLESGVELKDTMMMGADYYQTESEIASLLAQGKV  448

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKI N IIDKN +IG++VVI N DGV+E++R DEGFYIRSGIT++++ ATI D
Sbjct  449   PIGVGENTKIWNCIIDKNAKIGRNVVISNGDGVEEAERADEGFYIRSGITVVLKNATIKD  508

Query  410   GTVI  399
             GTVI
Sbjct  509   GTVI  512



>ref|XP_009336061.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic [Pyrus x bretschneideri]
Length=512

 Score =   403 bits (1036),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 187/244 (77%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT+LGL   +A  +PYIASMGVYVFRTDVLL+LLRW YP+ NDFGSEI+P+AVKE
Sbjct  269   AMQVDTTVLGLSDLEAMKSPYIASMGVYVFRTDVLLKLLRWSYPSCNDFGSEIIPSAVKE  328

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGT+KSF++ANLALTE+ PKFEF DPKTPFYTSPRFLPPTK++ C+
Sbjct  329   HNVQAYLFNDYWEDIGTVKSFFDANLALTEQPPKFEFNDPKTPFYTSPRFLPPTKVEKCR  388

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+G RSRL+ GVELKDT+MMGAD Y+TESEIASLLA G V
Sbjct  389   IMDAIISHGCFLRECSVQHSIVGVRSRLESGVELKDTMMMGADYYQTESEIASLLAQGKV  448

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVGENTKI N IIDKN +IG++VVI N DGV+E++R DEGFYIRSGIT++++ ATI D
Sbjct  449   PVGVGENTKIWNCIIDKNAKIGRNVVITNGDGVEEAERADEGFYIRSGITVVLKNATIKD  508

Query  410   GTVI  399
             GTVI
Sbjct  509   GTVI  512



>ref|XP_009365102.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Pyrus x bretschneideri]
Length=512

 Score =   403 bits (1036),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 187/244 (77%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT+LGL   +A  +PYIASMGVYVFRTDVLL+LLRW YP+ NDFGSEI+P+AVKE
Sbjct  269   AMQVDTTVLGLSDLEAMKSPYIASMGVYVFRTDVLLKLLRWSYPSCNDFGSEIIPSAVKE  328

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGT+KSF++ANLALTE+ PKFEF DPKTPFYTSPRFLPPTK++ C+
Sbjct  329   HNVQAYLFNDYWEDIGTVKSFFDANLALTEQPPKFEFNDPKTPFYTSPRFLPPTKVEKCR  388

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+G RSRL+ GVELKDT+MMGAD Y+TESEIASLLA G V
Sbjct  389   IMDAIISHGCFLRECSVQHSIVGVRSRLESGVELKDTMMMGADYYQTESEIASLLAQGKV  448

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVGENTKI N IIDKN +IG++VVI N DGV+E++R DEGFYIRSGIT++++ ATI D
Sbjct  449   PVGVGENTKIWNCIIDKNAKIGRNVVITNGDGVEEAERADEGFYIRSGITVVLKNATIKD  508

Query  410   GTVI  399
             GTVI
Sbjct  509   GTVI  512



>gb|AFK36497.1| unknown [Lotus japonicus]
Length=535

 Score =   404 bits (1037),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 184/244 (75%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM VDTTLLGL P++A+ NPYIASMGVYVFRT+VLL+LLRW + + NDFGSEI+P+AV +
Sbjct  292   AMHVDTTLLGLSPEEAKNNPYIASMGVYVFRTEVLLKLLRWSHSSCNDFGSEIIPSAVSD  351

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKSF++ANLALTE  PKFEFYDPKTPF+TSPRFLPP+K++ CK
Sbjct  352   HNVQAYLFNDYWEDIGTIKSFFDANLALTEHPPKFEFYDPKTPFFTSPRFLPPSKVEKCK  411

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLR C V+HSI+G RSRL+ GVEL+DT+MMGAD Y+TE+EIASL+A+G V
Sbjct  412   IVDAIISHGCFLRGCNVQHSIVGIRSRLESGVELQDTMMMGADYYQTETEIASLVAEGKV  471

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRN IIDKN +IG++VVI N DGVQE++RP EGFYIRSGIT+ ++ ATI D
Sbjct  472   PIGVGENTKIRNCIIDKNAKIGRNVVIANTDGVQEAERPKEGFYIRSGITVTLKNATIKD  531

Query  410   GTVI  399
             GTVI
Sbjct  532   GTVI  535



>ref|XP_008466540.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Cucumis melo]
 gb|ADN34184.1| ADP-glucose pyrophosphorylase large subunit [Cucumis melo subsp. 
melo]
Length=533

 Score =   403 bits (1036),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 185/243 (76%), Positives = 218/243 (90%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             MQVDT +LGL  +DAR NPYIASMGVY+FRTD+LL+LL W YP  NDFGSEI+PAAVK++
Sbjct  291   MQVDTAVLGLSDEDARKNPYIASMGVYIFRTDLLLKLLTWSYPACNDFGSEIIPAAVKDY  350

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
              VQAY+F DYWEDIGT+KSF++ANLALTE+ PKFEFYDPKTPFYTSPRFLPP+K++ C+I
Sbjct  351   KVQAYLFNDYWEDIGTVKSFFDANLALTEQPPKFEFYDPKTPFYTSPRFLPPSKVEKCRI  410

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
              DAIISHGCFLRECTVEHSI+G RSRL+ GVELKDT+MMGAD Y+TESEIASLLA+G +P
Sbjct  411   VDAIISHGCFLRECTVEHSIVGVRSRLEYGVELKDTMMMGADYYQTESEIASLLAEGKIP  470

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             IG+GENTKIRN IIDKN +IG++VVI N D VQE+DRP+EGFYIRSGIT+ ++ ATI DG
Sbjct  471   IGIGENTKIRNCIIDKNAKIGRNVVIANTDDVQEADRPEEGFYIRSGITVTLKNATIKDG  530

Query  407   TVI  399
             T+I
Sbjct  531   TII  533



>ref|XP_010924297.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Elaeis guineensis]
 ref|XP_010924298.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Elaeis guineensis]
Length=520

 Score =   402 bits (1034),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDTT L L  QDA+  PYIASMGVY+FR DVLL+LLRWRYP SNDFGSEILP+++++
Sbjct  277   AMKVDTTFLRLSSQDAKRYPYIASMGVYIFRRDVLLKLLRWRYPKSNDFGSEILPSSLQD  336

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKSF++ANLALTE+ PKF+FYDP TPF+TSPRFLPPTKI+ C+
Sbjct  337   HNVQAYLFNDYWEDIGTIKSFFDANLALTEQPPKFQFYDPMTPFFTSPRFLPPTKIEKCR  396

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + DAIISHGCFLREC+V+HSI+G RSRLD G ELKDT+MMGAD YETE+EIASLLA+G V
Sbjct  397   VLDAIISHGCFLRECSVQHSIVGVRSRLDYGAELKDTVMMGADYYETEAEIASLLAEGKV  456

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKI N IID NVRIGK+V+I NK+GVQE+DRP EGFYIRSGITII++ A I D
Sbjct  457   PIGVGQNTKISNCIIDMNVRIGKNVIIANKEGVQEADRPCEGFYIRSGITIILKNAIIKD  516

Query  410   GTVI  399
             GT+I
Sbjct  517   GTII  520



>ref|XP_007017590.1| ADPGLC-PPase large subunit isoform 1 [Theobroma cacao]
 gb|EOY14815.1| ADPGLC-PPase large subunit isoform 1 [Theobroma cacao]
Length=526

 Score =   402 bits (1033),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGL  QDA   PYIASMGVYVF+TDVLL+LL   YP+ NDFGSEI+P+AVKE
Sbjct  283   AMQVDTSILGLSAQDAARYPYIASMGVYVFKTDVLLKLLTRSYPSCNDFGSEIIPSAVKE  342

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HN+QAY+F DYWEDIGTIKSF++ANLALTE+ PKFEFYDPKTPFYTSPRFLPPTK+D C+
Sbjct  343   HNLQAYLFNDYWEDIGTIKSFFDANLALTEQPPKFEFYDPKTPFYTSPRFLPPTKVDKCR  402

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAI+SHGCFLREC+V+HSI+G RSRL+ GVEL+DT+MMGAD Y+TE E+ASLLA+G V
Sbjct  403   IVDAIVSHGCFLRECSVQHSIVGVRSRLESGVELEDTMMMGADYYQTEYEVASLLAEGKV  462

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG NTKIRN IIDKN +IGKDV+I N   VQE+DRPD+GFYIRSGIT+I++ ATI D
Sbjct  463   PIGVGHNTKIRNCIIDKNAKIGKDVIISNSGAVQEADRPDDGFYIRSGITVILKNATIKD  522

Query  410   GTVI  399
             GTVI
Sbjct  523   GTVI  526



>ref|XP_010690849.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Beta vulgaris subsp. vulgaris]
Length=524

 Score =   401 bits (1030),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 189/244 (77%), Positives = 216/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDT +LGL  +DA  NPYIASMGVYVFRTDVLL+LL    P +NDFG EILP+AVK+
Sbjct  281   AMRVDTQILGLSQEDALSNPYIASMGVYVFRTDVLLKLLTQTCPKANDFGFEILPSAVKD  340

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
              N+QAY+FRDYWEDIGT+K+F++ANLALT+E P FEFYDPKTPFYTSPRFLPPTK+D C+
Sbjct  341   QNIQAYLFRDYWEDIGTLKTFFDANLALTKESPSFEFYDPKTPFYTSPRFLPPTKMDRCQ  400

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKD IIS GCFLREC VEHSI+GERSRLD GVELKDTLMMGAD Y+TESEIASLLA+G V
Sbjct  401   IKDTIISDGCFLRECKVEHSIVGERSRLDSGVELKDTLMMGADYYQTESEIASLLAEGKV  460

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NT IRN IIDKN +IGKDV+I NKDGV E+DRP++GFYIRSGIT+I+EKATI D
Sbjct  461   PIGIGRNTIIRNCIIDKNAKIGKDVIITNKDGVIEADRPEQGFYIRSGITVIVEKATIED  520

Query  410   GTVI  399
             GTVI
Sbjct  521   GTVI  524



>emb|CAA65541.1| ADP-glucose pyrophosphorylase [Pisum sativum]
Length=510

 Score =   400 bits (1028),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 194/244 (80%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT+ LGL PQDA  +PYIASMGVYVF+ DVLL+LL+WRYPTSNDFGSEI+P+A++E
Sbjct  267   AMQVDTSRLGLSPQDALKSPYIASMGVYVFKKDVLLKLLKWRYPTSNDFGSEIIPSAIRE  326

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY F DYWEDIGTIKSFY+ANLALTEE PKFEFYDPKTP +TSP FLPPTKIDN +
Sbjct  327   HNVQAYFFGDYWEDIGTIKSFYDANLALTEESPKFEFYDPKTPIFTSPGFLPPTKIDNSR  386

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + DAIISHGCFLR+CT++HSI+GERSRLD GVEL+DT+MMGAD Y+TESEIASLLA+G V
Sbjct  387   VVDAIISHGCFLRDCTIQHSIVGERSRLDYGVELQDTVMMGADYYQTESEIASLLAEGKV  446

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKI+N IIDKN +IGK+VVI NK+GVQE+DR ++GFYIRSGITIIMEKATI D
Sbjct  447   PIGIGRNTKIKNCIIDKNAKIGKEVVIANKEGVQEADRSEDGFYIRSGITIIMEKATIED  506

Query  410   GTVI  399
             GTVI
Sbjct  507   GTVI  510



>ref|XP_010926128.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Elaeis guineensis]
Length=529

 Score =   401 bits (1030),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 185/244 (76%), Positives = 214/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+ DTT L L  QDA+  PYIASMGVYVF+ DVLL+LL WRYP SNDFGSEILP+AVKE
Sbjct  286   AMKADTTFLRLSRQDAKRYPYIASMGVYVFKRDVLLKLLTWRYPKSNDFGSEILPSAVKE  345

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTI SF+NANLALT++ PKF+FYDP TPF+TSPRFLPPTKI+ C+
Sbjct  346   HNVQAYLFNDYWEDIGTINSFFNANLALTDQLPKFQFYDPMTPFFTSPRFLPPTKIEKCR  405

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+++HS++G RSRLD GVELKDT+MMGAD YETE+EIASLLA+  V
Sbjct  406   ILDAIISHGCFLRECSIQHSVVGVRSRLDYGVELKDTMMMGADYYETEAEIASLLAEDKV  465

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKI N IID N RIGK+V+I NKDGVQE+DRP EGFYIRSGI+II++ ATI D
Sbjct  466   PIGVGQNTKISNCIIDMNARIGKNVIIANKDGVQEADRPHEGFYIRSGISIILKNATIKD  525

Query  410   GTVI  399
             G +I
Sbjct  526   GAII  529



>ref|XP_009113743.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic isoform X2 [Brassica rapa]
 emb|CDY27626.1| BnaA09g27810D [Brassica napus]
Length=517

 Score =   400 bits (1028),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 184/244 (75%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT+LGLPP++A   PYIASMGVYVFR +VLL LLR  YPTSNDFGSEI+P AVKE
Sbjct  274   AMQVDTTVLGLPPKEAAELPYIASMGVYVFRKEVLLNLLRSSYPTSNDFGSEIIPLAVKE  333

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQA++F DYWEDIGTI SF++ANLALTE+ PKF+FYDPKTPF+TSPRFLPPTK+D C+
Sbjct  334   HNVQAFLFNDYWEDIGTIGSFFDANLALTEQPPKFQFYDPKTPFFTSPRFLPPTKVDKCR  393

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT+MMGAD Y+TE+EIASLLA+G V
Sbjct  394   ILDSIVSHGCFLRECSVQHSIVGIRSRVESGVELQDTMMMGADFYQTEAEIASLLAEGKV  453

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRN IIDKN +IGK+VVI N DGV+E DRP+EGFYIRSGIT++++ ATI D
Sbjct  454   PIGVGENTKIRNCIIDKNAKIGKNVVIANADGVEEGDRPEEGFYIRSGITVVLKNATIRD  513

Query  410   GTVI  399
             G V+
Sbjct  514   GLVL  517



>gb|EYU45186.1| hypothetical protein MIMGU_mgv1a004400mg [Erythranthe guttata]
Length=529

 Score =   400 bits (1029),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 185/244 (76%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQVDT++LGL PQ+A   PYIASMGVYVFRTDVLL+LLR+ YP+ NDFGSEI+P+AVK+
Sbjct  286   SMQVDTSILGLTPQEAASFPYIASMGVYVFRTDVLLKLLRFSYPSCNDFGSEIIPSAVKD  345

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKSF++ANLALTE+  KF+F DPKTPFYTSPRFLPPTK++ C+
Sbjct  346   HNVQAYLFSDYWEDIGTIKSFFDANLALTEQPSKFDFNDPKTPFYTSPRFLPPTKVEQCR  405

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+VEHSI+G RSRLD GVELKDT+MMGAD Y+TESEIASLLA G V
Sbjct  406   IVDAIISHGCFLRECSVEHSIVGVRSRLDYGVELKDTMMMGADYYQTESEIASLLAQGKV  465

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG N+KI N IIDKN +IGK+V+I NKDGV+E++R DEGFYIRSGIT+I++ +TI D
Sbjct  466   PIGVGHNSKISNCIIDKNAKIGKNVIIANKDGVEEAERADEGFYIRSGITVILKNSTIKD  525

Query  410   GTVI  399
             GT+I
Sbjct  526   GTII  529



>ref|XP_004291856.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Fragaria vesca subsp. vesca]
Length=521

 Score =   399 bits (1026),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 184/244 (75%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT +LGL   DA  NPYIASMGVYVFRTDVLLRLLR+ YP+SNDFGSE++PAAV++
Sbjct  278   AMQVDTRVLGLSELDAMKNPYIASMGVYVFRTDVLLRLLRFSYPSSNDFGSEVIPAAVRD  337

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKSF++ANLALTE+ PKFEF DPKTPFYTSPRFLPPTK++ C+
Sbjct  338   HNVQAYLFNDYWEDIGTIKSFFDANLALTEQPPKFEFNDPKTPFYTSPRFLPPTKVEKCR  397

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+G RSRL+ G ELKDT+MMGAD Y+TE EIASLLA+G V
Sbjct  398   IMDAIISHGCFLRECSVQHSIVGVRSRLEYGAELKDTMMMGADYYQTEEEIASLLANGKV  457

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVGENTKI N IIDKN +IG++VVI N DGV+E++RP++GFYIRSGIT++++ ATI D
Sbjct  458   PVGVGENTKIWNCIIDKNAKIGRNVVITNGDGVEEAERPEDGFYIRSGITVVLKNATIKD  517

Query  410   GTVI  399
             GT+I
Sbjct  518   GTII  521



>ref|XP_009759775.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana sylvestris]
 ref|XP_009759780.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana sylvestris]
 ref|XP_009759785.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana sylvestris]
 ref|XP_009759792.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana sylvestris]
Length=529

 Score =   399 bits (1026),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/244 (76%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGL  Q+A  +PYIASMGVYVFRTDVLL+LL+  YP+ NDFGSEI+P+AVK+
Sbjct  286   AMQVDTSILGLSEQEAASSPYIASMGVYVFRTDVLLKLLKSAYPSCNDFGSEIIPSAVKD  345

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGT+KSF++ANLALTE+ PKF+F DPKTPFYTSPRFLPPTK+D  +
Sbjct  346   HNVQAYLFSDYWEDIGTVKSFFDANLALTEQPPKFDFNDPKTPFYTSPRFLPPTKVDKSR  405

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCF+REC+++HSI+G RSRLD GVELKDT+MMGAD Y+T+SEIASLLA+G V
Sbjct  406   IVDAIISHGCFMRECSIQHSIVGVRSRLDYGVELKDTMMMGADYYQTDSEIASLLAEGKV  465

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG NTKIRN IIDKN +IGKDVVI NK+G++E++RP+EGFYIRSGIT+IM+ ATI D
Sbjct  466   PIGVGPNTKIRNCIIDKNAKIGKDVVIGNKEGIEEAERPEEGFYIRSGITVIMKNATIKD  525

Query  410   GTVI  399
             GTVI
Sbjct  526   GTVI  529



>gb|AES74194.2| glucose-1-phosphate adenylyltransferase family protein [Medicago 
truncatula]
Length=518

 Score =   399 bits (1025),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 194/244 (80%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT+ LGL PQDA  +PYIASMGVYVF+ DVLL+LL+W+YPTSNDFGSEI+P+A++E
Sbjct  275   AMQVDTSRLGLSPQDALNSPYIASMGVYVFKKDVLLKLLKWKYPTSNDFGSEIIPSAIRE  334

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY F DYWEDIGTIKSFY+ANLALT+E PKF+FYDPKTP +TSP FLPPTKIDNC+
Sbjct  335   HNVQAYFFGDYWEDIGTIKSFYDANLALTKESPKFQFYDPKTPIFTSPGFLPPTKIDNCR  394

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + DAIISHGCFLRECT++HSI+GERSRLD GVEL+DT+MMGAD Y+TESEIASLLA+G V
Sbjct  395   VVDAIISHGCFLRECTIQHSIVGERSRLDYGVELQDTVMMGADYYQTESEIASLLAEGKV  454

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKI+N IIDKN +IGKDVVI NKDGVQE+DRP++GFYIR+GITI+MEKATI D
Sbjct  455   PIGIGRNTKIKNCIIDKNAKIGKDVVITNKDGVQEADRPEDGFYIRAGITIVMEKATIED  514

Query  410   GTVI  399
             GTVI
Sbjct  515   GTVI  518



>gb|KJB58232.1| hypothetical protein B456_009G200400 [Gossypium raimondii]
 gb|KJB58233.1| hypothetical protein B456_009G200400 [Gossypium raimondii]
 gb|KJB58234.1| hypothetical protein B456_009G200400 [Gossypium raimondii]
Length=526

 Score =   399 bits (1025),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 185/244 (76%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGL  QDA   PYIASMGVYVF+T VLL+LL   YP+ NDFGSEI+P+AVKE
Sbjct  283   AMQVDTSILGLSAQDAARYPYIASMGVYVFKTSVLLKLLTRSYPSCNDFGSEIIPSAVKE  342

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKSF++ANLALTE+ PKFEFYDPKTPFYTSPRFLPPTK+D CK
Sbjct  343   HNVQAYLFNDYWEDIGTIKSFFDANLALTEQPPKFEFYDPKTPFYTSPRFLPPTKVDECK  402

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+IISHGCFLREC+V+HSI+G RSRL+  V+L+DT+MMGAD Y+TESEIASLLA+G V
Sbjct  403   IVDSIISHGCFLRECSVQHSIVGVRSRLESSVDLQDTMMMGADYYQTESEIASLLAEGKV  462

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKI+N IIDKN +IGKDV+I N D V+E++RP++GFYIRSGIT+IM+ ATI D
Sbjct  463   PIGVGQNTKIKNCIIDKNAKIGKDVIISNTDAVEEAERPEDGFYIRSGITVIMKNATIRD  522

Query  410   GTVI  399
             GTVI
Sbjct  523   GTVI  526



>ref|XP_003523570.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like isoform X1 [Glycine max]
 gb|KHN45868.1| Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic 
[Glycine soja]
Length=530

 Score =   399 bits (1025),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 187/244 (77%), Positives = 216/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDTTLLGL PQ+A   PYIASMGVYVFRT+ LL+LLRW   + NDFGSEI+P+AV E
Sbjct  287   AMRVDTTLLGLSPQEAEKYPYIASMGVYVFRTETLLQLLRWNGSSCNDFGSEIIPSAVNE  346

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKSF++ANLALTE+ PKFEFYDPKTPF+TSPRFLPPTK++ CK
Sbjct  347   HNVQAYLFNDYWEDIGTIKSFFDANLALTEQPPKFEFYDPKTPFFTSPRFLPPTKVEKCK  406

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+++HSI+G RSRL+ GVEL+DT+MMGAD Y+TE EIASLLA+G V
Sbjct  407   IVDAIISHGCFLRECSIQHSIVGVRSRLESGVELQDTMMMGADYYQTEYEIASLLAEGKV  466

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRN IIDKN +IG++VVI N DGVQE+DR  EGFYIRSGITI ++ ATI D
Sbjct  467   PIGVGENTKIRNCIIDKNAKIGRNVVIENIDGVQEADRAKEGFYIRSGITITLKNATIKD  526

Query  410   GTVI  399
             GTVI
Sbjct  527   GTVI  530



>ref|XP_003528021.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic isoform X1 [Glycine max]
 gb|KHN22238.1| Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic 
[Glycine soja]
Length=531

 Score =   399 bits (1025),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 184/244 (75%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDTTLLGL PQ+A  +PYIASMGVYVFRT+ LL+LLRW+  + NDFGSEI+P+AV E
Sbjct  288   AMRVDTTLLGLLPQEAEKHPYIASMGVYVFRTETLLQLLRWKCSSCNDFGSEIIPSAVNE  347

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKSF++ANLALTE+ PKFEFYDPKTPF+TSPRFLPPTK++ CK
Sbjct  348   HNVQAYLFNDYWEDIGTIKSFFDANLALTEQPPKFEFYDPKTPFFTSPRFLPPTKVEKCK  407

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+G RSRL+ GVEL+DT+MMGAD Y+TE EIASL+A+G V
Sbjct  408   IVDAIISHGCFLRECSVQHSIVGVRSRLESGVELQDTMMMGADYYQTEYEIASLVAEGKV  467

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG NTKIRN IIDKN +IG++V+I N DGVQE+DR  EGFYIRSGIT+ ++ ATI D
Sbjct  468   PIGVGANTKIRNCIIDKNAKIGRNVIIANTDGVQEADRAKEGFYIRSGITVTLKNATIKD  527

Query  410   GTVI  399
             GTVI
Sbjct  528   GTVI  531



>ref|NP_195632.1| glucose-1-phosphate adenylyltransferase large subunit 3 [Arabidopsis 
thaliana]
 sp|P55231.2|GLGL3_ARATH RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic; AltName: Full=ADP-glucose pyrophosphorylase; 
AltName: Full=ADP-glucose synthase; AltName: Full=AGPase 
S; AltName: Full=Alpha-D-glucose-1-phosphate adenyl transferase; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA77173.1| glucose-1-phosphate adenylyltransferase [Arabidopsis thaliana]
 emb|CAB43636.1| glucose-1-phosphate adenylyltransferase (APL3) [Arabidopsis thaliana]
 emb|CAB80584.1| glucose-1-phosphate adenylyltransferase (APL3) [Arabidopsis thaliana]
 gb|AAL24344.1| glucose-1-phosphate adenylyltransferase (APL3) [Arabidopsis thaliana]
 gb|AAQ56821.1| At4g39210 [Arabidopsis thaliana]
 gb|AEE87038.1| glucose-1-phosphate adenylyltransferase large subunit 3 [Arabidopsis 
thaliana]
Length=521

 Score =   398 bits (1023),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+ GL  Q+A  +PYIASMGVY F+T+ LL+LL WRYP+SNDFGSEI+PAA+K+
Sbjct  278   SMQTDTTMHGLSHQEAAKSPYIASMGVYCFKTEALLKLLTWRYPSSNDFGSEIIPAAIKD  337

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQ YI+RDYWEDIGTIKSFY AN+AL EE PKFEFYD  TPFYTSPRFLPPTK + C+
Sbjct  338   HNVQGYIYRDYWEDIGTIKSFYEANIALVEEHPKFEFYDQNTPFYTSPRFLPPTKTEKCR  397

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I +++ISHGCFL EC+++ SIIGERSRLD GVEL+DTLM+GAD+Y+TESEIASLLA+GNV
Sbjct  398   IVNSVISHGCFLGECSIQRSIIGERSRLDYGVELQDTLMLGADSYQTESEIASLLAEGNV  457

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G +TKIR  IIDKN +IGK+VVIMNKD V+E+DRP+EGFYIRSGIT+++EKATI D
Sbjct  458   PIGIGRDTKIRKCIIDKNAKIGKNVVIMNKDDVKEADRPEEGFYIRSGITVVVEKATIKD  517

Query  410   GTVI  399
             GTVI
Sbjct  518   GTVI  521



>ref|XP_009617843.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana tomentosiformis]
 ref|XP_009617844.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana tomentosiformis]
Length=529

 Score =   398 bits (1023),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 184/244 (75%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGL  Q+A  +PYIASMGVYVFRTDVLL+LL+  YP+ NDFGSEI+P+A+K+
Sbjct  286   AMQVDTSILGLSEQEAANSPYIASMGVYVFRTDVLLKLLKSAYPSCNDFGSEIIPSAIKD  345

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGT+KSF++ANLALTE+ PKF+F DPKTPFYTSPRFLPPTK+D  +
Sbjct  346   HNVQAYLFSDYWEDIGTVKSFFDANLALTEQPPKFDFNDPKTPFYTSPRFLPPTKVDKSR  405

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCF+REC+++HSI+G RSRLD GVELKDT+MMGAD Y+T+SEIASLLA+G V
Sbjct  406   IVDAIISHGCFMRECSIQHSIVGVRSRLDYGVELKDTMMMGADYYQTDSEIASLLAEGKV  465

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG NTKI+N IIDKN +IGKDVVI+NK+GV+E++RP+EGFYIRSGIT+IM+ ATI D
Sbjct  466   PIGVGPNTKIQNCIIDKNAKIGKDVVIVNKEGVEEAERPEEGFYIRSGITVIMKNATIKD  525

Query  410   GTVI  399
             GTVI
Sbjct  526   GTVI  529



>ref|XP_002510419.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
 gb|EEF52606.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
Length=523

 Score =   398 bits (1022),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 184/244 (75%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ+DT LLGL  QDA   PYIASMGVYVFRT+VL +LLRW YP+  DFGSE++P AVK+
Sbjct  280   AMQIDTKLLGLSKQDALQYPYIASMGVYVFRTEVLCKLLRWSYPSCIDFGSEVIPYAVKD  339

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKSF++ANLALTE+ PKFEFYDPKTPF+TSPRFLPPTK+D C+
Sbjct  340   HNVQAYLFNDYWEDIGTIKSFFDANLALTEQPPKFEFYDPKTPFFTSPRFLPPTKVDQCR  399

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFL+EC+++HSI+G RSRL+  VEL DT+MMGAD Y+TESEIASL A+G V
Sbjct  400   IVDAIISHGCFLQECSIKHSIVGVRSRLESAVELMDTMMMGADYYQTESEIASLQAEGKV  459

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKIRN IIDKN +IG+ VVI N DGVQE++RP+EGFYIRSGIT+IME ATI D
Sbjct  460   PIGVGQNTKIRNCIIDKNAKIGRGVVITNADGVQEAERPEEGFYIRSGITVIMENATIND  519

Query  410   GTVI  399
             GT+I
Sbjct  520   GTII  523



>ref|XP_006303972.1| hypothetical protein CARUB_v10008862mg [Capsella rubella]
 gb|EOA36870.1| hypothetical protein CARUB_v10008862mg [Capsella rubella]
Length=519

 Score =   398 bits (1022),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGLPP++A  +PYIASMGVYVFR +VLL+LLR  YPTSNDFGSEI+P AVKE
Sbjct  276   AMQVDTSILGLPPKEAAESPYIASMGVYVFRKEVLLKLLRSSYPTSNDFGSEIIPLAVKE  335

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQA++F DYWEDIGTI SF++ANLALTE+ PKF+FYDPKTPF+TSPRFLPPTK+D C+
Sbjct  336   HNVQAFLFNDYWEDIGTIGSFFDANLALTEQPPKFQFYDPKTPFFTSPRFLPPTKVDKCR  395

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT+MMGAD Y+TE+EIASLLA+G V
Sbjct  396   ILDSIVSHGCFLRECSVQHSIVGIRSRIESGVELQDTMMMGADFYQTEAEIASLLAEGKV  455

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKIRN IIDKN +IGK+VVI N DGV+E DRP+EGF+IRSGIT++++ ATI D
Sbjct  456   PIGVGQNTKIRNCIIDKNAKIGKNVVIANADGVEEGDRPEEGFHIRSGITVVLKNATIRD  515

Query  410   GTVI  399
             G  I
Sbjct  516   GLQI  519



>dbj|BAF47748.1| ADP-glucose pyrophosphorylase beta subunit IbAGPb2 [Ipomoea batatas]
Length=518

 Score =   397 bits (1020),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 189/243 (78%), Positives = 216/243 (89%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             MQVDT+LLGL   +A+  PYIASMGVYVFRT+VLL LLR +YP+ NDFGSEI+PAAVK+H
Sbjct  276   MQVDTSLLGLSENEAKKYPYIASMGVYVFRTEVLLNLLRSQYPSCNDFGSEIIPAAVKDH  335

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
             NVQAY+F DYWEDIGT+KSF++ANLALTE+ P F+F DPKTPFYTSPRFLPPTK+D CKI
Sbjct  336   NVQAYLFSDYWEDIGTVKSFFDANLALTEQPPMFDFNDPKTPFYTSPRFLPPTKVDKCKI  395

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
              DAIISHGCFLREC+V+HSI+G RSRLD GVEL+DT++MGAD Y+TESEIASLLA G VP
Sbjct  396   VDAIISHGCFLRECSVKHSIVGIRSRLDYGVELEDTMVMGADYYQTESEIASLLATGKVP  455

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             IG+G NTKIRN IIDKN RIGKDVVI NKDGV E+DR DEGFYIRSGITI+++ ATI DG
Sbjct  456   IGIGTNTKIRNCIIDKNARIGKDVVIANKDGVDEADRADEGFYIRSGITIVLKNATIRDG  515

Query  407   TVI  399
             TVI
Sbjct  516   TVI  518



>gb|AFL55398.1| ADP-glucose pyrophosphorylase large subunit 3 [Ipomoea batatas]
Length=518

 Score =   397 bits (1020),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 189/243 (78%), Positives = 216/243 (89%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             MQVDT+LLGL   +A+  PYIASMGVYVFRT+VLL LLR +YP+ NDFGSEI+PAAVK+H
Sbjct  276   MQVDTSLLGLSENEAKKYPYIASMGVYVFRTEVLLNLLRSQYPSCNDFGSEIIPAAVKDH  335

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
             NVQAY+F DYWEDIGT+KSF++ANLALTE+ P F+F DPKTPFYTSPRFLPPTK+D CKI
Sbjct  336   NVQAYLFSDYWEDIGTVKSFFDANLALTEQPPMFDFNDPKTPFYTSPRFLPPTKVDKCKI  395

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
              DAIISHGCFLREC+V+HSI+G RSRLD GVEL+DT++MGAD Y+TESEIASLLA G VP
Sbjct  396   VDAIISHGCFLRECSVKHSIVGIRSRLDYGVELEDTMVMGADYYQTESEIASLLATGKVP  455

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             IG+G NTKIRN IIDKN RIGKDVVI NKDGV E+DR DEGFYIRSGITI+++ ATI DG
Sbjct  456   IGIGTNTKIRNCIIDKNARIGKDVVIANKDGVDEADRADEGFYIRSGITIVLKNATIRDG  515

Query  407   TVI  399
             TVI
Sbjct  516   TVI  518



>ref|XP_006415741.1| hypothetical protein EUTSA_v10007379mg [Eutrema salsugineum]
 gb|ESQ34094.1| hypothetical protein EUTSA_v10007379mg [Eutrema salsugineum]
Length=518

 Score =   397 bits (1019),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/244 (75%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGLPP++A   PYIASMGVYVFR +VLL+LLR  YPTSNDFGSEI+P AVKE
Sbjct  275   AMQVDTSILGLPPKEAAEFPYIASMGVYVFRKEVLLKLLRSSYPTSNDFGSEIIPLAVKE  334

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQA++F DYWEDIGTI SF++ANLALTE+ PKF+FYDPKTPF+TSPRFLPPTK+D C+
Sbjct  335   HNVQAFLFNDYWEDIGTIGSFFDANLALTEQPPKFQFYDPKTPFFTSPRFLPPTKVDKCR  394

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT+MMGAD Y+TE+EIASLLA+  V
Sbjct  395   ILDSIVSHGCFLRECSVQHSIVGIRSRVESGVELQDTMMMGADFYQTEAEIASLLAERKV  454

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRN IIDKN +IGK+VVI N DGV+E DRP+EGFYIRSGIT++++ ATI D
Sbjct  455   PIGVGENTKIRNCIIDKNAKIGKNVVIANADGVEEGDRPEEGFYIRSGITVVVKNATIRD  514

Query  410   GTVI  399
             G V+
Sbjct  515   GFVV  518



>gb|KFK36157.1| hypothetical protein AALP_AA4G085400 [Arabis alpina]
Length=514

 Score =   396 bits (1018),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 180/241 (75%), Positives = 218/241 (90%), Gaps = 0/241 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDT++LGLPP++A  NPYIASMGVYVFR +VLL+LLR  YPTSNDFGSEI+P AV+E
Sbjct  271   AMEVDTSILGLPPKEAAENPYIASMGVYVFRKEVLLKLLRSTYPTSNDFGSEIIPLAVRE  330

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQA++F DYWEDIGTI SF++ANLALTE+ PKF+FYDPKTPF+TSPRFLPPTK+D C+
Sbjct  331   HNVQAFLFNDYWEDIGTIGSFFDANLALTEQPPKFQFYDPKTPFFTSPRFLPPTKVDKCR  390

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+I+SHGCFLREC+V+HSI+G RSRL+ GVEL+DT+MMGAD Y+TE+EIASLLA+G V
Sbjct  391   ILDSIVSHGCFLRECSVQHSIVGIRSRLESGVELQDTMMMGADFYQTEAEIASLLAEGKV  450

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKIRN IIDKN +IGK+VVI N DGV+E DRP +GFYIRSGIT++++ ATI D
Sbjct  451   PIGVGQNTKIRNCIIDKNAKIGKNVVIANADGVEEGDRPADGFYIRSGITVVLKNATIRD  510

Query  410   G  408
             G
Sbjct  511   G  511



>ref|XP_006282507.1| hypothetical protein CARUB_v10007053mg [Capsella rubella]
 gb|EOA15405.1| hypothetical protein CARUB_v10007053mg [Capsella rubella]
Length=521

 Score =   396 bits (1018),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 179/244 (73%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+LG   Q+A  +PYIASMGVY F+T+ LL+LL WRYP+SNDFGSEI+PAA+++
Sbjct  278   SMQTDTTMLGFSHQEAAKSPYIASMGVYCFKTEALLKLLTWRYPSSNDFGSEIIPAAIRD  337

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQ YI+RDYWEDIGTIKSFY ANLAL EE PKFEFYD  TPFYTSPRFLPPTK + C+
Sbjct  338   HNVQGYIYRDYWEDIGTIKSFYEANLALVEEHPKFEFYDQTTPFYTSPRFLPPTKTEKCR  397

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I ++IISHGCFL EC+V+ SIIGERSRL+ GVEL+DTLM+GAD+Y+TESEIASLLA+GNV
Sbjct  398   IVNSIISHGCFLGECSVQRSIIGERSRLEYGVELQDTLMLGADSYQTESEIASLLAEGNV  457

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G++TKIR  IIDKN +IGK+V+I+NKD V+E+DRP+EGFYIRSGIT+++EKATI D
Sbjct  458   PIGIGQDTKIRKCIIDKNAKIGKNVMILNKDDVKEADRPEEGFYIRSGITVVVEKATIKD  517

Query  410   GTVI  399
             GT+I
Sbjct  518   GTII  521



>ref|XP_010446453.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like [Camelina sativa]
 ref|XP_010446454.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like [Camelina sativa]
 ref|XP_010446456.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like [Camelina sativa]
 ref|XP_010446457.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like [Camelina sativa]
Length=522

 Score =   396 bits (1017),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+LGL  Q+A  +PYIASMGVY F+T+ LL LL WRYP+SNDFGSEI+PAA+++
Sbjct  279   SMQTDTTMLGLSHQEAAESPYIASMGVYCFKTEALLNLLTWRYPSSNDFGSEIIPAAIRD  338

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQ YI+RDYWEDIGTIKSFY ANLAL EE PKFEFYD  TPFYTSPRFLPPTK + C+
Sbjct  339   HNVQGYIYRDYWEDIGTIKSFYEANLALVEEHPKFEFYDQNTPFYTSPRFLPPTKTEKCR  398

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I ++IISHGCFL EC+V+ SIIGERSRL+ GVEL+DTLM+GAD+Y+TESEIASLLA+GNV
Sbjct  399   IVNSIISHGCFLGECSVQRSIIGERSRLEYGVELQDTLMLGADSYQTESEIASLLAEGNV  458

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G +TKIR  IIDKN +IGK+V+I+NKD V+E+DRP+EGFYIRSGIT+++EKATI D
Sbjct  459   PIGIGRDTKIRKCIIDKNAKIGKNVMILNKDDVKEADRPEEGFYIRSGITVVVEKATIKD  518

Query  410   GTVI  399
             GTVI
Sbjct  519   GTVI  522



>ref|XP_008220832.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic isoform X1 [Prunus mume]
Length=527

 Score =   396 bits (1017),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 180/244 (74%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGL   +A  +PYIASMGVYVFRTDVLL+LLRW YP+ NDFGSEI+P+AV+E
Sbjct  284   AMQVDTSILGLSELEAMKSPYIASMGVYVFRTDVLLKLLRWSYPSCNDFGSEIIPSAVRE  343

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGT+KSF++ANLALTE+ PKFEF DPKTPFYTSPRFLPPTK++ C+
Sbjct  344   HNVQAYLFNDYWEDIGTVKSFFDANLALTEQPPKFEFNDPKTPFYTSPRFLPPTKVEKCR  403

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAI+SHGCFLREC+V+HSI+G RSRL+ GVELKDT+MMGAD Y+TESEIASL+A G V
Sbjct  404   IIDAIVSHGCFLRECSVQHSIVGVRSRLESGVELKDTMMMGADYYQTESEIASLVALGKV  463

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVG NTKI N IIDKN +IG++V+I N DGV+E+DR +EGFYIRSGIT++++ ATI D
Sbjct  464   PVGVGSNTKIWNCIIDKNAKIGRNVMITNADGVEEADRAEEGFYIRSGITVVLKNATIKD  523

Query  410   GTVI  399
             GTV+
Sbjct  524   GTVV  527



>ref|XP_012071900.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Jatropha curcas]
 gb|KDP38538.1| hypothetical protein JCGZ_04463 [Jatropha curcas]
Length=527

 Score =   396 bits (1017),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 184/244 (75%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT+LGL  QDA   PYIASMGVYVF+T+VLL+LLRW YP+SNDFGSEI+P+AV  
Sbjct  284   AMQVDTTVLGLSKQDAPRFPYIASMGVYVFKTEVLLKLLRWSYPSSNDFGSEIIPSAVMH  343

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKSF++ANL+L E+ PKFEFYD KTPFYT PRFLPPTK+D CK
Sbjct  344   HNVQAYLFNDYWEDIGTIKSFFDANLSLAEQPPKFEFYDSKTPFYTCPRFLPPTKVDKCK  403

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFL+EC+++HS++G RSRL+ GVEL DT+MMGAD Y+TESEIASLLA+G V
Sbjct  404   IVDAIISHGCFLQECSIQHSVVGVRSRLESGVELIDTMMMGADYYQTESEIASLLAEGKV  463

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVG+NTKIRN IIDKN +IG+DVVI N DGV E+DRP+EGFYIRSGIT I + ATI D
Sbjct  464   PVGVGQNTKIRNCIIDKNAKIGRDVVITNADGVLEADRPEEGFYIRSGITAIPKDATIKD  523

Query  410   GTVI  399
             GT+I
Sbjct  524   GTII  527



>ref|XP_007222521.1| hypothetical protein PRUPE_ppa004135mg [Prunus persica]
 gb|EMJ23720.1| hypothetical protein PRUPE_ppa004135mg [Prunus persica]
Length=527

 Score =   396 bits (1017),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGL   +A  +PYIASMGVYVFRTDVLL+LLRW YP+ NDFGSEI+P+AV+E
Sbjct  284   AMQVDTSILGLSELEAMKSPYIASMGVYVFRTDVLLKLLRWSYPSCNDFGSEIIPSAVRE  343

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGT+KSF++ANLALTE+ PKFEF DPKTPFYTSPRFLPPTK++ C+
Sbjct  344   HNVQAYLFNDYWEDIGTVKSFFDANLALTEQPPKFEFNDPKTPFYTSPRFLPPTKVEKCR  403

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAI+SHGCFLREC+V+HSI+G RSRL+ GVELKDT+MMGAD Y+TESEIASL+A G V
Sbjct  404   IIDAIVSHGCFLRECSVQHSIVGVRSRLESGVELKDTMMMGADYYQTESEIASLVALGKV  463

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVG NTKI N IIDKN +IG++V+I N DGV+E+DR +EGFYIRSGIT++++ ATI D
Sbjct  464   PVGVGSNTKIWNCIIDKNAKIGRNVMITNTDGVEEADRAEEGFYIRSGITVVLKNATIKD  523

Query  410   GTVI  399
             GTVI
Sbjct  524   GTVI  527



>gb|AJG44463.1| ADP-glucose pyrophosphorylase large subunit [Lilium davidii var. 
unicolor]
Length=518

 Score =   395 bits (1016),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 184/244 (75%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+ DTT L L  Q+A+  PYIASMGVYVFR DVLL+LL+W YP SNDFGSEILP+AVKE
Sbjct  275   AMKADTTSLRLSYQEAKKYPYIASMGVYVFRRDVLLKLLKWSYPKSNDFGSEILPSAVKE  334

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAYIF DYWEDIG + SF+NANLALT++ PKFEFYDPKTPF+TSPRFLPPTK++ C+
Sbjct  335   HNVQAYIFNDYWEDIGKLNSFFNANLALTDQPPKFEFYDPKTPFFTSPRFLPPTKVEKCR  394

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I +AIISHGCFLREC ++ SI+G RSRLD G EL+DTLMMGADNYETE+EIASLLA+G V
Sbjct  395   ILNAIISHGCFLRECGIQRSIVGVRSRLDYGAELEDTLMMGADNYETEAEIASLLAEGKV  454

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRN IID N RIGK+VVI+NKDGVQE+DRP++GFYIRSGI ++++ ATI D
Sbjct  455   PIGVGENTKIRNCIIDMNARIGKNVVILNKDGVQEADRPEDGFYIRSGIAVVLKNATIRD  514

Query  410   GTVI  399
              T+I
Sbjct  515   ETII  518



>ref|XP_010431888.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X2 [Camelina sativa]
 ref|XP_010431889.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X2 [Camelina sativa]
 ref|XP_010431890.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X2 [Camelina sativa]
Length=522

 Score =   395 bits (1015),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 180/244 (74%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+LGL  Q+A  +PYIASMGVY F+T+ LL+LL WRYP+SNDFGSEI+PAA+++
Sbjct  279   SMQTDTTMLGLSNQEAAESPYIASMGVYCFKTEALLKLLTWRYPSSNDFGSEIIPAAIRD  338

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQ YI++DYWEDIGTIKSFY ANLAL EE PKFEFYD  TPFYTSPRFLPPTK + C+
Sbjct  339   HNVQGYIYKDYWEDIGTIKSFYEANLALVEEHPKFEFYDQNTPFYTSPRFLPPTKTEKCR  398

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I ++IISHGCFL EC+V+ SIIGERSRL+ GVEL+DTLM+GAD+Y+TESEIASLLA+GNV
Sbjct  399   IVNSIISHGCFLGECSVQRSIIGERSRLEYGVELQDTLMLGADSYQTESEIASLLAEGNV  458

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G +TKIR  IIDKN +IGK+V+I+NKD V+E+DRP+EGFYIRSGIT+++EKATI D
Sbjct  459   PIGIGRDTKIRKCIIDKNAKIGKNVMILNKDDVKEADRPEEGFYIRSGITVVVEKATIKD  518

Query  410   GTVI  399
             GTVI
Sbjct  519   GTVI  522



>ref|XP_002281223.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Vitis vinifera]
 ref|XP_010664711.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Vitis vinifera]
 emb|CBI19730.3| unnamed protein product [Vitis vinifera]
Length=524

 Score =   395 bits (1015),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+V+TTLLGL  ++A   PYIASMGVYVFRTDVLL+LL  +Y + NDFGSEI+P AVK+
Sbjct  281   AMKVNTTLLGLSEKEAEKCPYIASMGVYVFRTDVLLKLLTRKYLSCNDFGSEIIPLAVKD  340

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKSF++ANLALTE+ PKFEFYDPKTPFYTSPRFLPPTK++ C+
Sbjct  341   HNVQAYLFNDYWEDIGTIKSFFDANLALTEQPPKFEFYDPKTPFYTSPRFLPPTKVEECR  400

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+ SI+G RSRL+ GVELKDT+MMGAD Y+TESEIASLLA+G V
Sbjct  401   ILDAIISHGCFLRECSVQRSIVGVRSRLEYGVELKDTMMMGADYYQTESEIASLLAEGKV  460

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NT+IRN IIDKN +IG+DVVI N DGVQE+DRP EGFYIRSGIT+I++ ATI D
Sbjct  461   PIGVGQNTRIRNCIIDKNAKIGRDVVIANADGVQEADRPSEGFYIRSGITVILKNATIND  520

Query  410   GTVI  399
             GT+I
Sbjct  521   GTII  524



>ref|XP_006435035.1| hypothetical protein CICLE_v10000842mg [Citrus clementina]
 gb|ESR48275.1| hypothetical protein CICLE_v10000842mg [Citrus clementina]
Length=526

 Score =   395 bits (1015),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
              MQ DTTLLGL   DA   PYIASMGVY+FRTDVLL LLR  YP SNDFGSEI+PA+VK+
Sbjct  283   GMQCDTTLLGLSMPDAVKFPYIASMGVYLFRTDVLLNLLRSSYPLSNDFGSEIIPASVKD  342

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQA++F DYWEDIGTIKSF++ANLALTE+  KFEFYDPKTPFYTS RFLPPTK+D CK
Sbjct  343   HNVQAFLFNDYWEDIGTIKSFFDANLALTEQPAKFEFYDPKTPFYTSARFLPPTKVDRCK  402

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+G RSRL+ GVE +DT+MMGAD Y+TESEIASLLA+G V
Sbjct  403   IVDAIISHGCFLRECSVQHSIVGVRSRLESGVEFQDTMMMGADYYQTESEIASLLAEGKV  462

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKI+N IIDKN +IGK+V+I N +GVQE+DRP+EGFYIRSGIT+I++ ATI D
Sbjct  463   PIGVGQNTKIKNCIIDKNAKIGKNVIIANAEGVQEADRPNEGFYIRSGITVILKNATIND  522

Query  410   GTVI  399
             GTVI
Sbjct  523   GTVI  526



>gb|AIO11223.1| AGPL1 protein [Gladiolus hybrid cultivar]
Length=517

 Score =   395 bits (1014),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 213/244 (87%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM++DTT LGL  Q+A  NPYIASMGVYVFR DVLL+LLRW YP SNDFGSEILP+AV +
Sbjct  274   AMKIDTTTLGLSRQEAITNPYIASMGVYVFRRDVLLKLLRWSYPKSNDFGSEILPSAVVD  333

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKSF++ANLAL  + PKF+FYDPKTPF+TSPR+LPPTK++ C+
Sbjct  334   HNVQAYLFNDYWEDIGTIKSFFDANLALAHQVPKFQFYDPKTPFFTSPRYLPPTKMEKCR  393

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFL+ECTV +SI+G RSRLD GVEL+DTLMMGAD YETE+EIASLLA+G V
Sbjct  394   IVDAIISHGCFLQECTVHNSIVGVRSRLDYGVELEDTLMMGADVYETEAEIASLLAEGKV  453

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKIRN IID N RIG +VVI NKDGVQE+DRP EGFYIRSGITII   + I D
Sbjct  454   PIGVGKNTKIRNCIIDMNARIGANVVIANKDGVQEADRPLEGFYIRSGITIIPMNSIIKD  513

Query  410   GTVI  399
             GT+I
Sbjct  514   GTII  517



>ref|XP_010437034.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like isoform X1 [Camelina sativa]
Length=522

 Score =   395 bits (1014),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 179/244 (73%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+LGL  Q+A  +PYIASMGVY F+T+ LL+LL WRYP+SNDFGSEI+PAA+++
Sbjct  279   SMQTDTTMLGLSHQEAAESPYIASMGVYCFKTEALLKLLTWRYPSSNDFGSEIIPAAIRD  338

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQ YI++DYWEDIGTIKSFY ANLAL EE PKFEFYD  TPFYTSPRFLPPTK + C+
Sbjct  339   HNVQGYIYKDYWEDIGTIKSFYEANLALVEEHPKFEFYDQNTPFYTSPRFLPPTKTEKCR  398

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I ++IISHGCFL EC+V+ SIIGERSRL+ GVEL+DTLM+GAD+Y+TESEIASLLA+GNV
Sbjct  399   IVNSIISHGCFLGECSVQRSIIGERSRLEYGVELQDTLMLGADSYQTESEIASLLAEGNV  458

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+G+G +TKIR  IIDKN +IGK+V+I+NKD V+E+DRP+EGFYIRSGIT+++EKATI D
Sbjct  459   PVGIGRDTKIRKCIIDKNAKIGKNVMILNKDDVKEADRPEEGFYIRSGITVVVEKATIKD  518

Query  410   GTVI  399
             GTVI
Sbjct  519   GTVI  522



>ref|XP_010437035.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like isoform X2 [Camelina sativa]
Length=519

 Score =   395 bits (1014),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 179/244 (73%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+LGL  Q+A  +PYIASMGVY F+T+ LL+LL WRYP+SNDFGSEI+PAA+++
Sbjct  276   SMQTDTTMLGLSHQEAAESPYIASMGVYCFKTEALLKLLTWRYPSSNDFGSEIIPAAIRD  335

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQ YI++DYWEDIGTIKSFY ANLAL EE PKFEFYD  TPFYTSPRFLPPTK + C+
Sbjct  336   HNVQGYIYKDYWEDIGTIKSFYEANLALVEEHPKFEFYDQNTPFYTSPRFLPPTKTEKCR  395

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I ++IISHGCFL EC+V+ SIIGERSRL+ GVEL+DTLM+GAD+Y+TESEIASLLA+GNV
Sbjct  396   IVNSIISHGCFLGECSVQRSIIGERSRLEYGVELQDTLMLGADSYQTESEIASLLAEGNV  455

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+G+G +TKIR  IIDKN +IGK+V+I+NKD V+E+DRP+EGFYIRSGIT+++EKATI D
Sbjct  456   PVGIGRDTKIRKCIIDKNAKIGKNVMILNKDDVKEADRPEEGFYIRSGITVVVEKATIKD  515

Query  410   GTVI  399
             GTVI
Sbjct  516   GTVI  519



>ref|XP_002890743.1| hypothetical protein ARALYDRAFT_472972 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67002.1| hypothetical protein ARALYDRAFT_472972 [Arabidopsis lyrata subsp. 
lyrata]
Length=518

 Score =   394 bits (1013),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 178/244 (73%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGLPP++A  +PYIASMGVYVFR +VLL+LLR  YPTSNDFGSEI+P AV+E
Sbjct  275   AMQVDTSILGLPPKEAAESPYIASMGVYVFRKEVLLKLLRSSYPTSNDFGSEIIPLAVRE  334

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQA++F DYWEDIGTI SF++ANLALTE+ PKF+FYDPKTPF+TSPRFLPPTK+D C+
Sbjct  335   HNVQAFLFNDYWEDIGTIGSFFDANLALTEQPPKFQFYDPKTPFFTSPRFLPPTKVDKCR  394

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT+MMGAD Y+TE+EIASLLA+G V
Sbjct  395   ILDSIVSHGCFLRECSVQHSIVGIRSRIESGVELQDTMMMGADFYQTEAEIASLLAEGKV  454

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVG+NTKIRN IIDKN +IGK+VVI N +GV+E DRP+EGF+IRSGIT++++ ATI D
Sbjct  455   PVGVGQNTKIRNCIIDKNAKIGKNVVIANAEGVEEGDRPEEGFHIRSGITVVLKNATIRD  514

Query  410   GTVI  399
             G  I
Sbjct  515   GLHI  518



>gb|AJG44462.1| ADP-glucose pyrophosphorylase large subunit [Lilium davidii var. 
unicolor]
Length=514

 Score =   394 bits (1012),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDTT+LGL  Q+A  +PYIASMGVY+F+ DVLL+LLRWRYP SNDFGSEI+P++V E
Sbjct  271   AMKVDTTVLGLSHQEAMKSPYIASMGVYLFKRDVLLKLLRWRYPRSNDFGSEIIPSSVME  330

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQA++F DYWEDIGTIKSF++ANLALTEE PKF+FYDP TPFYTSPR+LPPTK+D C+
Sbjct  331   HNVQAHLFNDYWEDIGTIKSFFDANLALTEEPPKFQFYDPMTPFYTSPRYLPPTKVDKCQ  390

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I +AIISHGCFL +C+V+HS++G RSRL+ GVELKDT+MMGAD Y+TESE+A+LLA+G V
Sbjct  391   IVNAIISHGCFLHDCSVQHSVVGVRSRLESGVELKDTMMMGADFYQTESEVAALLAEGKV  450

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG NTKI+N IIDKN RIG+DV+I NKDGVQE+DRP++GFYIRSGITII +  TI D
Sbjct  451   PIGVGPNTKIKNCIIDKNARIGRDVIITNKDGVQEADRPEDGFYIRSGITIIPKNTTIKD  510

Query  410   GTVI  399
              TVI
Sbjct  511   ETVI  514



>ref|XP_002866835.1| hypothetical protein ARALYDRAFT_490693 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43094.1| hypothetical protein ARALYDRAFT_490693 [Arabidopsis lyrata subsp. 
lyrata]
Length=521

 Score =   394 bits (1013),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/244 (73%), Positives = 216/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+ GL  Q+A  +PYIASMGVY F+T+ LL+LL WRYP+SNDFGSEI+PAA+++
Sbjct  278   SMQTDTTMHGLSHQEAAKSPYIASMGVYCFKTEALLKLLTWRYPSSNDFGSEIIPAAIRD  337

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQ YI+RDYWEDIGTIKSFY ANLAL EE PKFEFYD  TPFYTSPRFLPPTK + C+
Sbjct  338   HNVQGYIYRDYWEDIGTIKSFYEANLALVEEHPKFEFYDQNTPFYTSPRFLPPTKTEKCR  397

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I ++IISHGCFL EC+++ SIIGERSRLD GVEL+DTLM+GAD+Y+TESEIASLLA+GNV
Sbjct  398   IVNSIISHGCFLGECSIQRSIIGERSRLDYGVELQDTLMLGADSYQTESEIASLLAEGNV  457

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G +TKIR  IIDKN +IGK+V+I+NKD V+E+DRP+EGFYIRSGIT+++EKATI D
Sbjct  458   PIGIGRDTKIRKCIIDKNAKIGKNVMILNKDDVKEADRPEEGFYIRSGITVVVEKATIKD  517

Query  410   GTVI  399
              TVI
Sbjct  518   STVI  521



>ref|XP_010431887.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X1 [Camelina sativa]
Length=534

 Score =   394 bits (1013),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/244 (74%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+LGL  Q+A  +PYIASMGVY F+T+ LL+LL WRYP+SNDFGSEI+PAA+++
Sbjct  291   SMQTDTTMLGLSNQEAAESPYIASMGVYCFKTEALLKLLTWRYPSSNDFGSEIIPAAIRD  350

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQ YI++DYWEDIGTIKSFY ANLAL EE PKFEFYD  TPFYTSPRFLPPTK + C+
Sbjct  351   HNVQGYIYKDYWEDIGTIKSFYEANLALVEEHPKFEFYDQNTPFYTSPRFLPPTKTEKCR  410

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I ++IISHGCFL EC+V+ SIIGERSRL+ GVEL+DTLM+GAD+Y+TESEIASLLA+GNV
Sbjct  411   IVNSIISHGCFLGECSVQRSIIGERSRLEYGVELQDTLMLGADSYQTESEIASLLAEGNV  470

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G +TKIR  IIDKN +IGK+V+I+NKD V+E+DRP+EGFYIRSGIT+++EKATI D
Sbjct  471   PIGIGRDTKIRKCIIDKNAKIGKNVMILNKDDVKEADRPEEGFYIRSGITVVVEKATIKD  530

Query  410   GTVI  399
             GTVI
Sbjct  531   GTVI  534



>ref|XP_010460525.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic [Camelina sativa]
Length=520

 Score =   394 bits (1012),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 178/244 (73%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGLPP++A  +PYIASMGVYVFR +VLL+LLR  YPTSNDFGSEI+P AV E
Sbjct  277   AMQVDTSILGLPPKEAAESPYIASMGVYVFRKEVLLKLLRSSYPTSNDFGSEIIPLAVGE  336

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQA++F DYWEDIGTI SF++ANLALTE+ PKF+FYDPKTPF+TSPRFLPPTK+D C+
Sbjct  337   HNVQAFLFNDYWEDIGTIGSFFDANLALTEQPPKFQFYDPKTPFFTSPRFLPPTKVDKCR  396

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT+MMGAD Y+TE+EIASLLA+G V
Sbjct  397   ILDSIVSHGCFLRECSVQHSIVGIRSRIESGVELQDTMMMGADFYQTEAEIASLLAEGKV  456

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVG+NTKIRN IIDKN +IGK+V+I N DGV+E DRP+EGF+IRSGIT++++ ATI D
Sbjct  457   PVGVGQNTKIRNCIIDKNAKIGKNVIIANADGVEEGDRPEEGFHIRSGITVVLKNATIRD  516

Query  410   GTVI  399
             G  I
Sbjct  517   GLHI  520



>ref|XP_011074558.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic-like [Sesamum indicum]
 ref|XP_011074559.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic-like [Sesamum indicum]
Length=529

 Score =   394 bits (1013),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 185/244 (76%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT+LLGLP  +A   PYIASMGVYVFRTDVLL LL+ +YP+ NDFGSEI+P+AVK+
Sbjct  286   AMQVDTSLLGLPHHEATKFPYIASMGVYVFRTDVLLDLLKSKYPSCNDFGSEIIPSAVKD  345

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKSF++ANLALTE+  KF+  DPKTPFYTSPRFLPPTK++ C+
Sbjct  346   HNVQAYLFNDYWEDIGTIKSFFDANLALTEQHLKFDLNDPKTPFYTSPRFLPPTKVEKCR  405

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+G RSRLD GVELKDT+MMGAD Y+TESEIASLLA+G V
Sbjct  406   IVDAIISHGCFLRECSVQHSIVGVRSRLDYGVELKDTMMMGADYYQTESEIASLLAEGKV  465

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG NTKI N IIDKN +IGKDVVI NKDGV+E++R DEGFYIRSGI ++++  TI D
Sbjct  466   PIGVGRNTKISNCIIDKNAKIGKDVVIANKDGVEEAERADEGFYIRSGIVVLLKNTTIKD  525

Query  410   GTVI  399
             GTVI
Sbjct  526   GTVI  529



>ref|XP_010478112.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like isoform X1 [Camelina sativa]
Length=522

 Score =   394 bits (1012),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 178/244 (73%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGLPP++A  +PYIASMGVYVFR +VLL+LLR  YPTSNDFGSEI+P AV E
Sbjct  279   AMQVDTSILGLPPKEAAESPYIASMGVYVFRKEVLLKLLRSSYPTSNDFGSEIIPLAVGE  338

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQA++F DYWEDIGTI SF++ANLALTE+ PKF+FYDPKTPF+TSPRFLPPTK+D C+
Sbjct  339   HNVQAFLFNDYWEDIGTIGSFFDANLALTEQPPKFQFYDPKTPFFTSPRFLPPTKVDKCR  398

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT+MMGAD Y+TE+EIASLLA+G V
Sbjct  399   ILDSIVSHGCFLRECSVQHSIVGIRSRIESGVELQDTMMMGADFYQTEAEIASLLAEGKV  458

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVG+NTKIRN IIDKN +IGK+V+I N DGV+E DRP+EGF+IRSGIT++++ ATI D
Sbjct  459   PVGVGQNTKIRNCIIDKNAKIGKNVIIANADGVEEGDRPEEGFHIRSGITVVLKNATIRD  518

Query  410   GTVI  399
             G  I
Sbjct  519   GLHI  522



>ref|XP_010478113.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like isoform X2 [Camelina sativa]
Length=520

 Score =   394 bits (1011),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 178/244 (73%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGLPP++A  +PYIASMGVYVFR +VLL+LLR  YPTSNDFGSEI+P AV E
Sbjct  277   AMQVDTSILGLPPKEAAESPYIASMGVYVFRKEVLLKLLRSSYPTSNDFGSEIIPLAVGE  336

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQA++F DYWEDIGTI SF++ANLALTE+ PKF+FYDPKTPF+TSPRFLPPTK+D C+
Sbjct  337   HNVQAFLFNDYWEDIGTIGSFFDANLALTEQPPKFQFYDPKTPFFTSPRFLPPTKVDKCR  396

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT+MMGAD Y+TE+EIASLLA+G V
Sbjct  397   ILDSIVSHGCFLRECSVQHSIVGIRSRIESGVELQDTMMMGADFYQTEAEIASLLAEGKV  456

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVG+NTKIRN IIDKN +IGK+V+I N DGV+E DRP+EGF+IRSGIT++++ ATI D
Sbjct  457   PVGVGQNTKIRNCIIDKNAKIGKNVIIANADGVEEGDRPEEGFHIRSGITVVLKNATIRD  516

Query  410   GTVI  399
             G  I
Sbjct  517   GLHI  520



>ref|XP_003603943.1| Glucose-1-phosphate adenylyltransferase large subunit [Medicago 
truncatula]
Length=526

 Score =   394 bits (1011),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 194/252 (77%), Positives = 226/252 (90%), Gaps = 8/252 (3%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT+ LGL PQDA  +PYIASMGVYVF+ DVLL+LL+W+YPTSNDFGSEI+P+A++E
Sbjct  275   AMQVDTSRLGLSPQDALNSPYIASMGVYVFKKDVLLKLLKWKYPTSNDFGSEIIPSAIRE  334

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY F DYWEDIGTIKSFY+ANLALT+E PKF+FYDPKTP +TSP FLPPTKIDNC+
Sbjct  335   HNVQAYFFGDYWEDIGTIKSFYDANLALTKESPKFQFYDPKTPIFTSPGFLPPTKIDNCR  394

Query  770   IK--------DAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIA  615
             ++        DAIISHGCFLRECT++HSI+GERSRLD GVEL+DT+MMGAD Y+TESEIA
Sbjct  395   VRQSIHLVVVDAIISHGCFLRECTIQHSIVGERSRLDYGVELQDTVMMGADYYQTESEIA  454

Query  614   SLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITII  435
             SLLA+G VPIG+G NTKI+N IIDKN +IGKDVVI NKDGVQE+DRP++GFYIR+GITI+
Sbjct  455   SLLAEGKVPIGIGRNTKIKNCIIDKNAKIGKDVVITNKDGVQEADRPEDGFYIRAGITIV  514

Query  434   MEKATIPDGTVI  399
             MEKATI DGTVI
Sbjct  515   MEKATIEDGTVI  526



>ref|NP_179753.1| glucose-1-phosphate adenylyltransferase large subunit [Arabidopsis 
thaliana]
 ref|NP_001031391.1| glucose-1-phosphate adenylyltransferase large subunit [Arabidopsis 
thaliana]
 sp|Q9SIK1.1|GLGL4_ARATH RecName: Full=Probable glucose-1-phosphate adenylyltransferase 
large subunit, chloroplastic; AltName: Full=ADP-glucose pyrophosphorylase; 
AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate adenyl 
transferase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD23646.1| putative ADP-glucose pyrophosphorylase large subunit [Arabidopsis 
thaliana]
 gb|AAL49924.1| putative ADP-glucose pyrophosphorylase large subunit [Arabidopsis 
thaliana]
 gb|AAM20291.1| putative ADP-glucose pyrophosphorylase large subunit [Arabidopsis 
thaliana]
 dbj|BAH19825.1| AT2G21590 [Arabidopsis thaliana]
 gb|AEC07199.1| glucose-1-phosphate adenylyltransferase large subunit [Arabidopsis 
thaliana]
 gb|AEC07200.1| glucose-1-phosphate adenylyltransferase large subunit [Arabidopsis 
thaliana]
Length=523

 Score =   393 bits (1010),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+LGL  Q+A  +PYIASMGVY F+T+ LL LL  +YP+SNDFGSE++PAA+++
Sbjct  280   SMQTDTTMLGLSHQEATDSPYIASMGVYCFKTEALLNLLTRQYPSSNDFGSEVIPAAIRD  339

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQ YIFRDYWEDIGTIK+FY ANLAL EE PKFEFYDP+TPFYTSPRFLPPTK + C+
Sbjct  340   HDVQGYIFRDYWEDIGTIKTFYEANLALVEERPKFEFYDPETPFYTSPRFLPPTKAEKCR  399

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + D+IISHGCFLREC+V+ SIIGERSRLD GVEL+DTLM+GAD Y+TESEIASLLA+G V
Sbjct  400   MVDSIISHGCFLRECSVQRSIIGERSRLDYGVELQDTLMLGADYYQTESEIASLLAEGKV  459

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G++TKIR  IIDKN +IGK+V+IMNK  VQE+DRP+EGFYIRSGIT+I+EKATI D
Sbjct  460   PIGIGKDTKIRKCIIDKNAKIGKNVIIMNKGDVQEADRPEEGFYIRSGITVIVEKATIQD  519

Query  410   GTVI  399
             GTVI
Sbjct  520   GTVI  523



>ref|XP_006473534.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Citrus sinensis]
Length=526

 Score =   393 bits (1010),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 214/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
              MQ DTTLLGL   DA   PYIASMGVY+FRTDVLL LLR  YP SNDFGSEI+PA+VK+
Sbjct  283   GMQCDTTLLGLSMPDAVKFPYIASMGVYLFRTDVLLNLLRSSYPLSNDFGSEIIPASVKD  342

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQA++F DYWEDIGTIKSF+ ANLALTE+  KFEFYDPKTPFYTS RFLPPTK+D CK
Sbjct  343   HNVQAFLFNDYWEDIGTIKSFFYANLALTEQPAKFEFYDPKTPFYTSARFLPPTKVDRCK  402

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+G RSRL+ GVE +DT+MMGAD Y+TESEIASLLA+G V
Sbjct  403   IVDAIISHGCFLRECSVQHSIVGVRSRLESGVEFQDTMMMGADYYQTESEIASLLAEGKV  462

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKI+N IIDKN +IGK+V+I N +GVQE+DRP+EGFYIRSGIT+I++ ATI D
Sbjct  463   PIGVGQNTKIKNCIIDKNAKIGKNVIIANAEGVQEADRPNEGFYIRSGITVILKNATIND  522

Query  410   GTVI  399
             GTVI
Sbjct  523   GTVI  526



>ref|XP_010673183.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic [Beta vulgaris subsp. vulgaris]
Length=522

 Score =   393 bits (1009),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT+LGL   +A  NPYIASMGVYVFRTDVL+ LL  +YP+SNDFGSEI+P+AV E
Sbjct  279   AMQVDTTVLGLSDLEAMSNPYIASMGVYVFRTDVLMELLNRKYPSSNDFGSEIIPSAVGE  338

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAY+F DYWEDIGTIKSF+++NLALT++ PKFEFYDPKTPFYTS RFLPPTK+D CK
Sbjct  339   YNVQAYLFNDYWEDIGTIKSFFDSNLALTQQPPKFEFYDPKTPFYTSARFLPPTKVDRCK  398

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+I+SHGCFL+E +++HSI+G RSRL+ GVE +DT+MMGAD Y+TESEIASLLA+G V
Sbjct  399   IVDSIVSHGCFLQESSIQHSIVGVRSRLESGVEFQDTMMMGADYYQTESEIASLLAEGKV  458

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVG+NTKI+N IIDKN +IGKDVVI N DGV+E+DRP+EGFYIRSGITII++ ATI D
Sbjct  459   PVGVGQNTKIKNCIIDKNAKIGKDVVIANTDGVEEADRPNEGFYIRSGITIILKNATIQD  518

Query  410   GTVI  399
             G VI
Sbjct  519   GLVI  522



>ref|XP_006294016.1| hypothetical protein CARUB_v10023004mg [Capsella rubella]
 gb|EOA26914.1| hypothetical protein CARUB_v10023004mg [Capsella rubella]
Length=523

 Score =   393 bits (1009),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 183/244 (75%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTTLLGL  Q+A   PYIASMGVY F+T+ LL LL  +YP+SNDFGSEI+PAA+++
Sbjct  280   SMQTDTTLLGLSDQEATDTPYIASMGVYCFKTEALLNLLTRQYPSSNDFGSEIIPAAIRD  339

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQ YIFRDYWEDIGTIK+FY ANLAL EE PKFEFYDP TPFYTSPRFLPPTK + C+
Sbjct  340   HSVQGYIFRDYWEDIGTIKTFYEANLALVEERPKFEFYDPDTPFYTSPRFLPPTKTEKCR  399

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + D+IISHGCFLREC+V+ SIIGERSRLD GVEL+DTLM+GAD Y+TESEIASLLA+G V
Sbjct  400   MVDSIISHGCFLRECSVQRSIIGERSRLDYGVELQDTLMLGADYYQTESEIASLLAEGKV  459

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G++TKIR  IIDKN +IGK+V+IMNK  VQE+DRP+EGFYIRSGIT+I+EKATI D
Sbjct  460   PIGIGKDTKIRKCIIDKNAKIGKNVIIMNKGDVQEADRPEEGFYIRSGITVIVEKATIED  519

Query  410   GTVI  399
             GTVI
Sbjct  520   GTVI  523



>ref|XP_010499251.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic [Camelina sativa]
Length=520

 Score =   392 bits (1008),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 178/244 (73%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGLPP++A  +PYIASMGVYVFR +VLL+LLR  YP SNDFGSEI+P AV E
Sbjct  277   AMQVDTSILGLPPKEAAESPYIASMGVYVFRKEVLLKLLRSSYPASNDFGSEIIPLAVGE  336

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQA++F DYWEDIGTI SF++ANLALTE+ PKF+FYDPKTPF+TSPRFLPPTK+D C+
Sbjct  337   HNVQAFLFNDYWEDIGTIGSFFDANLALTEQPPKFQFYDPKTPFFTSPRFLPPTKVDKCR  396

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT+MMGAD Y+TE+EIASLLA+G V
Sbjct  397   ILDSIVSHGCFLRECSVQHSIVGIRSRIESGVELQDTMMMGADFYQTEAEIASLLAEGKV  456

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVG+NTKIRN IIDKN +IGK+VVI N DGV+E DRP+EGF+IRSGIT++++ ATI D
Sbjct  457   PVGVGQNTKIRNCIIDKNAKIGKNVVIANADGVEEGDRPEEGFHIRSGITVVLKNATIRD  516

Query  410   GTVI  399
             G  I
Sbjct  517   GLHI  520



>ref|XP_009101892.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X2 [Brassica rapa]
Length=523

 Score =   392 bits (1007),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 180/244 (74%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+LGL  Q+A  +PYIASMGVY F+T+ LL+LL  RYP+SNDFGSEI+PAA+++
Sbjct  280   SMQSDTTMLGLSQQEAVKSPYIASMGVYCFKTEALLKLLTRRYPSSNDFGSEIIPAAIRD  339

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQ Y++RDYWEDIGTIKSFY+ANLAL EE PKFEFYD  TPFYTSPRFLPPTK + C+
Sbjct  340   HNVQGYVYRDYWEDIGTIKSFYDANLALVEEHPKFEFYDQDTPFYTSPRFLPPTKTEKCR  399

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+IISHGCFL EC+++ SIIGERSRLD GVEL+DTLM+GAD+Y+TESEIASLLA+GNV
Sbjct  400   ILDSIISHGCFLGECSIQRSIIGERSRLDYGVELQDTLMLGADSYQTESEIASLLAEGNV  459

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G +TKIR  IIDKN +IGK+V+I+N D VQE+DRP+EGFYIRSGIT+++EKATI D
Sbjct  460   PIGIGRDTKIRKCIIDKNAKIGKNVMILNSDDVQEADRPEEGFYIRSGITVVVEKATIKD  519

Query  410   GTVI  399
             GTVI
Sbjct  520   GTVI  523



>ref|NP_001289992.1| glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic 
[Beta vulgaris subsp. vulgaris]
 sp|P55233.1|GLGL1_BETVU RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic; AltName: Full=ADP-glucose 
pyrophosphorylase; AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate 
adenyl transferase; Flags: Precursor [Beta vulgaris]
 emb|CAA55516.1| ADP-glucose pyrophosphorylase [Beta vulgaris subsp. vulgaris]
Length=522

 Score =   392 bits (1007),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 216/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT+LGL   +A  NPYIASMGVYVFRTDVL+ LL  +YP+SNDFGSEI+P+AV E
Sbjct  279   AMQVDTTVLGLSDLEAMSNPYIASMGVYVFRTDVLMELLNRKYPSSNDFGSEIIPSAVGE  338

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
              NVQAY+F DYWEDIGTIKSF+++NLALT++ PKFEFYDPKTPFYTS RFLPPTK+D CK
Sbjct  339   SNVQAYLFNDYWEDIGTIKSFFDSNLALTQQPPKFEFYDPKTPFYTSARFLPPTKVDRCK  398

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+I+SHGCFL+E +++HSI+G RSRL+ GVE +DT+MMGAD Y+TESEIASLLA+G V
Sbjct  399   IVDSIVSHGCFLQESSIQHSIVGVRSRLESGVEFQDTMMMGADYYQTESEIASLLAEGKV  458

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVG+NTKI+N IIDKN +IGKDVVI N DGV+E+DRP+EGFYIRSGITII++ ATI D
Sbjct  459   PVGVGQNTKIKNCIIDKNAKIGKDVVIANTDGVEEADRPNEGFYIRSGITIILKNATIQD  518

Query  410   GTVI  399
             G VI
Sbjct  519   GLVI  522



>ref|XP_009101891.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X1 [Brassica rapa]
Length=529

 Score =   392 bits (1007),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 180/244 (74%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+LGL  Q+A  +PYIASMGVY F+T+ LL+LL  RYP+SNDFGSEI+PAA+++
Sbjct  286   SMQSDTTMLGLSQQEAVKSPYIASMGVYCFKTEALLKLLTRRYPSSNDFGSEIIPAAIRD  345

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQ Y++RDYWEDIGTIKSFY+ANLAL EE PKFEFYD  TPFYTSPRFLPPTK + C+
Sbjct  346   HNVQGYVYRDYWEDIGTIKSFYDANLALVEEHPKFEFYDQDTPFYTSPRFLPPTKTEKCR  405

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+IISHGCFL EC+++ SIIGERSRLD GVEL+DTLM+GAD+Y+TESEIASLLA+GNV
Sbjct  406   ILDSIISHGCFLGECSIQRSIIGERSRLDYGVELQDTLMLGADSYQTESEIASLLAEGNV  465

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G +TKIR  IIDKN +IGK+V+I+N D VQE+DRP+EGFYIRSGIT+++EKATI D
Sbjct  466   PIGIGRDTKIRKCIIDKNAKIGKNVMILNSDDVQEADRPEEGFYIRSGITVVVEKATIKD  525

Query  410   GTVI  399
             GTVI
Sbjct  526   GTVI  529



>ref|NP_174089.1| glucose-1-phosphate adenylyltransferase large subunit 2 [Arabidopsis 
thaliana]
 sp|P55230.2|GLGL2_ARATH RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic; AltName: Full=ADP-glucose pyrophosphorylase; 
AltName: Full=ADP-glucose synthase; AltName: Full=AGPase 
S; AltName: Full=Alpha-D-glucose-1-phosphate adenyl transferase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF24945.1|AC012375_8 T22C5.13 [Arabidopsis thaliana]
 gb|AAL36283.1| putative ADP-glucose pyrophosphorylase [Arabidopsis thaliana]
 gb|AAM14190.1| putative ADP-glucose pyrophosphorylase [Arabidopsis thaliana]
 gb|AEE30862.1| glucose-1-phosphate adenylyltransferase large subunit 2 [Arabidopsis 
thaliana]
Length=518

 Score =   392 bits (1006),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/244 (73%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGLPP++A  +PYIASMGVYVFR +VLL+LLR  YPTSNDFGSEI+P AV E
Sbjct  275   AMQVDTSILGLPPKEAAESPYIASMGVYVFRKEVLLKLLRSSYPTSNDFGSEIIPLAVGE  334

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQA++F DYWEDIGTI SF++ANLALTE+ PKF+FYD KTPF+TSPRFLPPTK+D C+
Sbjct  335   HNVQAFLFNDYWEDIGTIGSFFDANLALTEQPPKFQFYDQKTPFFTSPRFLPPTKVDKCR  394

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+I+SHGCFLREC+V+HSI+G RSRL+ GVEL+DT+MMGAD Y+TE+EIASLLA+G V
Sbjct  395   ILDSIVSHGCFLRECSVQHSIVGIRSRLESGVELQDTMMMGADFYQTEAEIASLLAEGKV  454

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVG+NTKI+N IIDKN +IGK+VVI N DGV+E DRP+EGF+IRSGIT++++ ATI D
Sbjct  455   PVGVGQNTKIKNCIIDKNAKIGKNVVIANADGVEEGDRPEEGFHIRSGITVVLKNATIRD  514

Query  410   GTVI  399
             G  I
Sbjct  515   GLHI  518



>gb|ACW82825.1| ADP-glucose pyrophosphorylase large subunit L1 isoform [Lens 
culinaris]
Length=510

 Score =   391 bits (1004),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 189/244 (77%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDT  LGL PQDA  +PYIASMGVYVF+ DVLL+LL+WRYPTSNDFGSEI+P+A+KE
Sbjct  267   AMEVDTFRLGLSPQDALKSPYIASMGVYVFKKDVLLKLLKWRYPTSNDFGSEIIPSAMKE  326

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY F +YWEDIGTIKSFY+ANLALTEE PKFEFYDPKTP +TSP FLPPTK DN +
Sbjct  327   HNVQAYFFGEYWEDIGTIKSFYDANLALTEESPKFEFYDPKTPIFTSPGFLPPTKFDNSR  386

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + DAIISHGCFLR+CT++HSI+GERSRLD GVEL+DT+MMGAD Y+TESEIASLLA+G V
Sbjct  387   VVDAIISHGCFLRDCTIQHSIVGERSRLDYGVELQDTVMMGADYYQTESEIASLLAEGKV  446

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G NTKI+N IIDKN +IGK+VVI NK+GVQE+DR ++GFYIRSGITIIME AT+ D
Sbjct  447   PIGIGRNTKIKNCIIDKNAKIGKEVVIANKEGVQEADRSEDGFYIRSGITIIMENATVDD  506

Query  410   GTVI  399
             GTV+
Sbjct  507   GTVM  510



>ref|XP_010472156.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic isoform X1 [Camelina sativa]
Length=528

 Score =   391 bits (1004),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+LGL  ++A   PYIASMGVY F+T+ LL LL  +YP+SNDFGSE++PAA+++
Sbjct  285   SMQTDTTMLGLSHEEATDTPYIASMGVYCFKTEALLNLLTRQYPSSNDFGSEVIPAAIRD  344

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQ YIFRDYWEDIGTIK+FY ANLAL EE PKFEFYDP TPFYTSPRFLPPTK + C+
Sbjct  345   HDVQGYIFRDYWEDIGTIKTFYEANLALVEERPKFEFYDPDTPFYTSPRFLPPTKTEKCR  404

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + D+IISHGCFLREC+V+ SIIGERSRLD GVEL+DTLM+GAD Y+TESEIASLLA+G V
Sbjct  405   MVDSIISHGCFLRECSVQRSIIGERSRLDYGVELQDTLMLGADYYQTESEIASLLAEGKV  464

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G++TKIR  IIDKN +IGK+VVIMNK  VQE+DRP+EGFYIRSGIT+I+EKATI D
Sbjct  465   PIGIGKDTKIRKCIIDKNAKIGKNVVIMNKGDVQEADRPEEGFYIRSGITVIVEKATIQD  524

Query  410   GTVI  399
             GTVI
Sbjct  525   GTVI  528



>ref|XP_006411722.1| hypothetical protein EUTSA_v10024927mg [Eutrema salsugineum]
 dbj|BAJ34261.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53175.1| hypothetical protein EUTSA_v10024927mg [Eutrema salsugineum]
Length=521

 Score =   390 bits (1003),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 213/244 (87%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DT +LGL  Q+A  +PYIASMGVY F+T+ LL+LL   YPTSNDFGSEI+PAA+ +
Sbjct  278   SMQTDTAMLGLSHQEAAESPYIASMGVYCFKTEALLKLLTKHYPTSNDFGSEIIPAAIVD  337

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQ YI+RDYWEDIGTIKSFY ANLAL EE PKFEFYD  TPFYTSPRFLPPTK + C+
Sbjct  338   HNVQGYIYRDYWEDIGTIKSFYEANLALVEEHPKFEFYDQNTPFYTSPRFLPPTKTEKCR  397

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
               D+IISHGCFL EC+++ SIIGERSRLD GVEL+DTLM+GAD+Y+TESEIASLLA+GNV
Sbjct  398   FVDSIISHGCFLGECSIQRSIIGERSRLDYGVELQDTLMLGADSYQTESEIASLLAEGNV  457

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G +TKIR  IIDKN +IGK+V+I+NKD VQE+DRP+EGFYIRSGIT+I+EKATI D
Sbjct  458   PIGIGRDTKIRKCIIDKNAKIGKNVMILNKDDVQEADRPEEGFYIRSGITVIVEKATIKD  517

Query  410   GTVI  399
             GTVI
Sbjct  518   GTVI  521



>ref|XP_010472157.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic isoform X2 [Camelina sativa]
Length=524

 Score =   390 bits (1003),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+LGL  ++A   PYIASMGVY F+T+ LL LL  +YP+SNDFGSE++PAA+++
Sbjct  281   SMQTDTTMLGLSHEEATDTPYIASMGVYCFKTEALLNLLTRQYPSSNDFGSEVIPAAIRD  340

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQ YIFRDYWEDIGTIK+FY ANLAL EE PKFEFYDP TPFYTSPRFLPPTK + C+
Sbjct  341   HDVQGYIFRDYWEDIGTIKTFYEANLALVEERPKFEFYDPDTPFYTSPRFLPPTKTEKCR  400

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + D+IISHGCFLREC+V+ SIIGERSRLD GVEL+DTLM+GAD Y+TESEIASLLA+G V
Sbjct  401   MVDSIISHGCFLRECSVQRSIIGERSRLDYGVELQDTLMLGADYYQTESEIASLLAEGKV  460

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G++TKIR  IIDKN +IGK+VVIMNK  VQE+DRP+EGFYIRSGIT+I+EKATI D
Sbjct  461   PIGIGKDTKIRKCIIDKNAKIGKNVVIMNKGDVQEADRPEEGFYIRSGITVIVEKATIQD  520

Query  410   GTVI  399
             GTVI
Sbjct  521   GTVI  524



>emb|CDY56761.1| BnaA06g40730D [Brassica napus]
Length=595

 Score =   392 bits (1007),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 180/244 (74%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+LGL  Q+A  +PYIASMGVY F+T+ LL+LL  RYP+SNDFGSEI+PAA+++
Sbjct  352   SMQSDTTMLGLSQQEAVKSPYIASMGVYCFKTEALLKLLTRRYPSSNDFGSEIIPAAIRD  411

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQ Y++RDYWEDIGTIKSFY+ANLAL EE PKFEFYD  TPFYTSPRFLPPTK + C+
Sbjct  412   HNVQGYVYRDYWEDIGTIKSFYDANLALVEEHPKFEFYDQDTPFYTSPRFLPPTKTEKCR  471

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+IISHGCFL EC+++ SIIGERSRLD GVEL+DTLM+GAD+Y+TESEIASLLA+GNV
Sbjct  472   IVDSIISHGCFLGECSIQRSIIGERSRLDYGVELQDTLMLGADSYQTESEIASLLAEGNV  531

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G +TKIR  IIDKN +IGK+V+I+N D VQE+DRP+EGFYIRSGIT+++EKATI D
Sbjct  532   PIGIGRDTKIRKCIIDKNAKIGKNVMILNSDDVQEADRPEEGFYIRSGITVVVEKATIKD  591

Query  410   GTVI  399
             GTVI
Sbjct  592   GTVI  595



>ref|XP_006346702.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic-like [Solanum tuberosum]
Length=521

 Score =   390 bits (1001),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 183/244 (75%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGL  Q+A   PYIASMGVYVF+TDVLL LL+  YP+ NDFGSEI+P+AVK+
Sbjct  278   AMQVDTSILGLSEQEASNFPYIASMGVYVFKTDVLLNLLKSAYPSCNDFGSEIIPSAVKD  337

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGT+KSF++ANLALT++ PKF+F DPKTPFYTS RFLPPTK+D  +
Sbjct  338   HNVQAYLFNDYWEDIGTVKSFFDANLALTKQPPKFDFNDPKTPFYTSARFLPPTKVDKSR  397

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC ++HSI+G RSRLD GVE KDT+MMGAD Y+TESEIASLLA+G V
Sbjct  398   IVDAIISHGCFLRECNIQHSIVGVRSRLDYGVEFKDTMMMGADYYQTESEIASLLAEGKV  457

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG NTKI+N IIDKN +IGKDVVI+NK+GV+E+DR  EGFYIRSGIT+IM+ ATI D
Sbjct  458   PIGVGPNTKIQNCIIDKNAKIGKDVVILNKEGVEEADRSAEGFYIRSGITVIMKNATIKD  517

Query  410   GTVI  399
             GTVI
Sbjct  518   GTVI  521



>ref|XP_010429080.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Camelina sativa]
 ref|XP_010429081.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Camelina sativa]
Length=525

 Score =   390 bits (1001),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/244 (74%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+LGL  ++A   PYIASMGVY F+T+ LL LL  +YP+SNDFGSE++PAA+++
Sbjct  282   SMQTDTTMLGLSHEEATDTPYIASMGVYCFKTEALLNLLTRQYPSSNDFGSEVIPAAIRD  341

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQ YIFRDYWEDIGTIK+FY ANLAL EE PKFEFYDP TPFYTSPRFLPPTK + C+
Sbjct  342   HDVQGYIFRDYWEDIGTIKTFYEANLALVEERPKFEFYDPDTPFYTSPRFLPPTKTEKCR  401

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + D+IISHGCFLREC+V+ SIIGERSRLD GVEL+DTLM+GAD Y+TESEIASLLA+G V
Sbjct  402   MVDSIISHGCFLRECSVQRSIIGERSRLDYGVELQDTLMLGADYYQTESEIASLLAEGKV  461

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G++TKIR  IIDKN +IGK+V+IMNK  VQE+DRP+EGFYIRSGIT+I+EKATI D
Sbjct  462   PIGIGKDTKIRKCIIDKNAKIGKNVIIMNKGDVQEADRPEEGFYIRSGITVIVEKATIQD  521

Query  410   GTVI  399
             GTVI
Sbjct  522   GTVI  525



>ref|XP_010416916.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic isoform X2 [Camelina sativa]
 ref|XP_010416917.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic isoform X2 [Camelina sativa]
Length=524

 Score =   389 bits (1000),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/244 (74%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+LGL  ++A   PYIASMGVY F+T+ LL LL  +YP+SNDFGSE++PAA+++
Sbjct  281   SMQTDTTMLGLSHEEATDTPYIASMGVYCFKTEALLNLLTRQYPSSNDFGSEVIPAAIRD  340

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQ YIFRDYWEDIGTIK+FY ANLAL EE PKFEFYDP TPFYTSPRFLPPTK + C+
Sbjct  341   HDVQGYIFRDYWEDIGTIKTFYEANLALVEERPKFEFYDPDTPFYTSPRFLPPTKTEKCR  400

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + D+IISHGCFLREC+V+ SIIGERSRLD GVEL+DTLM+GAD Y+TESEIASLLA+G V
Sbjct  401   MVDSIISHGCFLRECSVQRSIIGERSRLDYGVELQDTLMLGADYYQTESEIASLLAEGKV  460

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G++TKIR  IIDKN +IGK+V+IMNK  VQE+DRP+EGFYIRSGIT+I+EKATI D
Sbjct  461   PIGIGKDTKIRKCIIDKNAKIGKNVIIMNKGDVQEADRPEEGFYIRSGITVIVEKATIQD  520

Query  410   GTVI  399
             GTVI
Sbjct  521   GTVI  524



>ref|XP_010416915.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic isoform X1 [Camelina sativa]
Length=528

 Score =   389 bits (1000),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/244 (74%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+LGL  ++A   PYIASMGVY F+T+ LL LL  +YP+SNDFGSE++PAA+++
Sbjct  285   SMQTDTTMLGLSHEEATDTPYIASMGVYCFKTEALLNLLTRQYPSSNDFGSEVIPAAIRD  344

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQ YIFRDYWEDIGTIK+FY ANLAL EE PKFEFYDP TPFYTSPRFLPPTK + C+
Sbjct  345   HDVQGYIFRDYWEDIGTIKTFYEANLALVEERPKFEFYDPDTPFYTSPRFLPPTKTEKCR  404

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + D+IISHGCFLREC+V+ SIIGERSRLD GVEL+DTLM+GAD Y+TESEIASLLA+G V
Sbjct  405   MVDSIISHGCFLRECSVQRSIIGERSRLDYGVELQDTLMLGADYYQTESEIASLLAEGKV  464

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G++TKIR  IIDKN +IGK+V+IMNK  VQE+DRP+EGFYIRSGIT+I+EKATI D
Sbjct  465   PIGIGKDTKIRKCIIDKNAKIGKNVIIMNKGDVQEADRPEEGFYIRSGITVIVEKATIQD  524

Query  410   GTVI  399
             GTVI
Sbjct  525   GTVI  528



>gb|KDO42000.1| hypothetical protein CISIN_1g0097201mg, partial [Citrus sinensis]
Length=429

 Score =   386 bits (991),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 187/244 (77%), Positives = 205/244 (84%), Gaps = 20/244 (8%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT+LLG  PQ+AR  PY+ASMGVYVF+ DVL +LLRWRYPTSNDFGSEI+PAA+ E
Sbjct  206   AMQVDTSLLGFSPQEARKCPYVASMGVYVFKKDVLFKLLRWRYPTSNDFGSEIIPAAIME  265

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQAYIFRDYWEDIGTIKSFY AN+ALT+E P F FYDPKTPFYTSPRFLPPTKIDNC+
Sbjct  266   HDVQAYIFRDYWEDIGTIKSFYEANMALTKESPAFHFYDPKTPFYTSPRFLPPTKIDNCR  325

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLRECTVEHSI+                    D Y+TESEIASLLA+G V
Sbjct  326   IKDAIISHGCFLRECTVEHSIV--------------------DYYQTESEIASLLAEGKV  365

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG NTKIRN IIDKNV+IGKDVVI+NKD VQE+DRP+ GFYIRSGITIIMEKATI D
Sbjct  366   PIGVGRNTKIRNCIIDKNVKIGKDVVIVNKDDVQEADRPELGFYIRSGITIIMEKATIED  425

Query  410   GTVI  399
             G VI
Sbjct  426   GMVI  429



>gb|AGB85111.1| ADP-glucose pyrophosphorylase large subunit 3 [Ipomoea batatas]
Length=517

 Score =   389 bits (998),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 186/243 (77%), Positives = 214/243 (88%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             MQVDT+LLGL   +A+  PYIASMGVYVFRT+VLL LLR +YP+ NDFGSEI+PAAVK+H
Sbjct  275   MQVDTSLLGLSENEAKKYPYIASMGVYVFRTEVLLNLLRSQYPSCNDFGSEIIPAAVKDH  334

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
             NVQA++F DYWEDIGT+KSF++ANLALTE+ P F+F DPKTPFYTSPRFLPPTK+D CKI
Sbjct  335   NVQAHLFSDYWEDIGTVKSFFDANLALTEQPPMFDFNDPKTPFYTSPRFLPPTKVDKCKI  394

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
              DAIISHGCFLREC+V+HSI+G  SRLD GVEL+DT++MGAD Y+TESEIASLLA G VP
Sbjct  395   VDAIISHGCFLRECSVKHSIVGIWSRLDYGVELEDTMVMGADYYQTESEIASLLATGKVP  454

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             IG+G NTKIRN IIDKN RIGKDVVI NKD V E+DR DEGFYIRSGITI+++ ATI DG
Sbjct  455   IGIGTNTKIRNCIIDKNARIGKDVVIANKDRVDEADRADEGFYIRSGITIVLKNATIRDG  514

Query  407   TVI  399
             TVI
Sbjct  515   TVI  517



>gb|AEH27531.1| putative ADP-glucose pyrophosphorylase [Amorphophallus konjac]
Length=543

 Score =   389 bits (1000),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 177/244 (73%), Positives = 216/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDTT+ GL P +A+  PYIASMGVY FRT++LL LLRWRYPTSNDFGSEI+P+AV E
Sbjct  300   AMKVDTTIPGLSPYEAKNFPYIASMGVYAFRTEILLNLLRWRYPTSNDFGSEIIPSAVNE  359

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAY+F+DYWEDIGTIK+F+ ANLALT++ PKF+FYDP+TPFYTSPR+LPPTK+D C+
Sbjct  360   YNVQAYLFKDYWEDIGTIKTFFEANLALTDQSPKFQFYDPQTPFYTSPRYLPPTKVDKCR  419

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+IISHGCFL +C++EHSI+G+RSRL+  VELKDT+MMGAD Y+TE E A+LLA+G V
Sbjct  420   IVDSIISHGCFLDQCSIEHSIVGDRSRLEYNVELKDTMMMGADYYQTEVERAALLAEGKV  479

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+ TK+RN IIDKN +IGK+V+I NKDGVQE+DRP EGFYIRSG TII++  TI D
Sbjct  480   PIGVGQQTKMRNCIIDKNAKIGKNVIITNKDGVQEADRPSEGFYIRSGHTIILKNTTIKD  539

Query  410   GTVI  399
             GTVI
Sbjct  540   GTVI  543



>ref|XP_004289659.1| PREDICTED: LOW QUALITY PROTEIN: glucose-1-phosphate adenylyltransferase 
large subunit 1-like [Fragaria vesca subsp. vesca]
Length=507

 Score =   388 bits (997),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 205/226 (91%), Gaps = 0/226 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DTTLLG  PQDA  +PY+ASMGVYVF+TD+LL LL+  YP SNDFGSEI+PAAV+E
Sbjct  272   AMQSDTTLLGFSPQDALKSPYVASMGVYVFKTDILLELLKKTYPNSNDFGSEIIPAAVEE  331

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
              NVQAYIFRDYWEDIGTI+SFY+ANLALTEEFPKF+FYDPKTPF+TSPRFLPPTKIDN +
Sbjct  332   RNVQAYIFRDYWEDIGTIQSFYDANLALTEEFPKFQFYDPKTPFFTSPRFLPPTKIDNSR  391

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + DAIISHGCFL+EC V+ SI+GERSRLD GVELKD++MMGAD+Y+TESEIA+LLA G V
Sbjct  392   VVDAIISHGCFLQECLVQSSIVGERSRLDYGVELKDSIMMGADSYQTESEIAALLARGKV  451

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIR  453
             PIG+G NTKIR  IIDKN +IGKDV+IMNKDGVQE+DRPDEGFYIR
Sbjct  452   PIGIGRNTKIRKCIIDKNAKIGKDVIIMNKDGVQEADRPDEGFYIR  497



>ref|XP_010540326.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic [Tarenaya hassleriana]
Length=522

 Score =   388 bits (997),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 180/243 (74%), Positives = 214/243 (88%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             MQVDT++LGLP + A   PYIASMGVYVFRT+VLL+LL   YP SNDFGSEI+P+AVKEH
Sbjct  280   MQVDTSILGLPSERAVEFPYIASMGVYVFRTEVLLKLLNSTYPASNDFGSEIIPSAVKEH  339

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
             NVQAY+F DYWEDIGTI+SF++ANLALTE+ PKFEFYDPKTPFYTSPRFLPPTK+D C+I
Sbjct  340   NVQAYLFNDYWEDIGTIRSFFDANLALTEQPPKFEFYDPKTPFYTSPRFLPPTKVDRCRI  399

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
              D+I+SHGCFLREC+V+ SI+G RSRL+ GVEL+DT+MMGAD Y+TE EIASLLA G VP
Sbjct  400   LDSIVSHGCFLRECSVQRSIVGVRSRLESGVELQDTMMMGADFYQTEVEIASLLAQGKVP  459

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             IGVG +TKIRN IIDKN +IGK+V+I N DGV+E+DR +EGFYIRSGIT++++ ATI DG
Sbjct  460   IGVGPDTKIRNCIIDKNAKIGKNVIITNADGVEEADRAEEGFYIRSGITVVLKNATIRDG  519

Query  407   TVI  399
              VI
Sbjct  520   LVI  522



>ref|NP_001266081.1| glucose-1-phosphate adenylyltransferase large subunit 2, chloroplastic-like 
[Cicer arietinum]
 gb|AAK27719.1|AF356003_1 ADP-glucose pyrophosphorylase large subunit CagpL2 [Cicer arietinum]
Length=521

 Score =   388 bits (996),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 182/245 (74%), Positives = 215/245 (88%), Gaps = 1/245 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDTTLLGL P++A+  PYIASMGVYVFRT+ LL+LLR    T NDFGSEI+P+AV +
Sbjct  277   AMRVDTTLLGLSPEEAKKQPYIASMGVYVFRTETLLKLLRSNCSTCNDFGSEIIPSAVND  336

Query  950   -HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNC  774
              HNVQAY+F DYWEDIGTIKSF++ANLALT++ PKF+FYDP TPFYT PRFLPPTK++ C
Sbjct  337   DHNVQAYLFNDYWEDIGTIKSFFDANLALTDQPPKFQFYDPNTPFYTFPRFLPPTKVEKC  396

Query  773   KIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGN  594
             KI DAIISHGCFLREC+V+HSI+G RSRL+ GVEL+DT+MMGAD Y+TESEIASLLA+G 
Sbjct  397   KIVDAIISHGCFLRECSVQHSIVGIRSRLESGVELQDTMMMGADYYQTESEIASLLAEGK  456

Query  593   VPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIP  414
             VP+GVGENTKIRN IIDKN RIG++V+I N DGV+E+DR  EGFYIRSGIT I++ ATI 
Sbjct  457   VPVGVGENTKIRNCIIDKNARIGRNVIITNADGVEEADRTKEGFYIRSGITAILKNATIK  516

Query  413   DGTVI  399
             DGTVI
Sbjct  517   DGTVI  521



>ref|NP_001284415.1| myeloid leukemia factor 2 [Cucumis melo]
 gb|AAB91464.1| ADP-glucose pyrophosphorylase large subunit [Cucumis melo]
Length=518

 Score =   387 bits (995),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 180/243 (74%), Positives = 213/243 (88%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             MQVDT +LGL  +DAR NPYIASMGVY+FRTD+LL+LL W YP  NDFGSEI+PAAVK++
Sbjct  276   MQVDTAVLGLSDEDARKNPYIASMGVYIFRTDLLLKLLTWSYPACNDFGSEIIPAAVKDY  335

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
              VQAY+F DYWEDIGT+KSF++ANLALTE+ PKFEFYDPKTPFYTSPR  PP+K++ C+I
Sbjct  336   KVQAYLFNDYWEDIGTVKSFFDANLALTEQPPKFEFYDPKTPFYTSPRSCPPSKVEKCRI  395

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
              DAIISHGCFLRECTVE  I+G RSRL+ GVELKDT+MMGA  Y+TESEIASLLA+G +P
Sbjct  396   VDAIISHGCFLRECTVEPLIVGVRSRLEYGVELKDTMMMGAYYYQTESEIASLLAEGKIP  455

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             IG+GENTKIRN IIDKN +IG++VVI N D VQE+DRP+EGFYIRSGIT+ ++ ATI DG
Sbjct  456   IGIGENTKIRNCIIDKNAKIGRNVVIANTDDVQEADRPEEGFYIRSGITVTLKNATIKDG  515

Query  407   TVI  399
             T+I
Sbjct  516   TII  518



>emb|CDY15884.1| BnaA04g12270D [Brassica napus]
Length=520

 Score =   388 bits (996),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 179/254 (70%), Positives = 219/254 (86%), Gaps = 0/254 (0%)
 Frame = -3

Query  1160  FARSLKVLI*AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFG  981
             F +   V + +MQ DTT+LGL  ++A  +PYIASMGVY F+T+ LL LL  +YPTSNDFG
Sbjct  267   FEKPTGVDLKSMQTDTTMLGLSHEEATDSPYIASMGVYCFKTEALLDLLMQQYPTSNDFG  326

Query  980   SEILPAAVKEHNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRF  801
             SE++PAA+++ +VQ YIFRDYWEDIGTIK+FY ANLAL EE PKFEFYDP TPFYTSPRF
Sbjct  327   SEVIPAAIRDQDVQGYIFRDYWEDIGTIKTFYEANLALVEERPKFEFYDPDTPFYTSPRF  386

Query  800   LPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESE  621
             LPPTK + C++ D+IISHGCF+REC+V+ SIIGERSRLD GVEL+DTLM+GAD Y+TESE
Sbjct  387   LPPTKTEKCRMVDSIISHGCFMRECSVQRSIIGERSRLDYGVELQDTLMLGADYYQTESE  446

Query  620   IASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGIT  441
             IASLLA+G VPIG+G+++KIR  IIDKN +IGK+V+IMNK  VQE+DRP+EGFYIRSGIT
Sbjct  447   IASLLAEGKVPIGIGQDSKIRKCIIDKNAKIGKNVIIMNKGDVQEADRPEEGFYIRSGIT  506

Query  440   IIMEKATIPDGTVI  399
             +++EKATI DGTVI
Sbjct  507   VVVEKATIQDGTVI  520



>ref|XP_002878559.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54818.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=520

 Score =   387 bits (995),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 178/244 (73%), Positives = 214/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+LGL  Q+A  +PYIASMGVY F+T+ LL LL  +YP+SNDFGSE++PAA+++
Sbjct  277   SMQTDTTMLGLSHQEATDSPYIASMGVYCFKTEALLNLLTRQYPSSNDFGSEVIPAAIRD  336

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQ YIFRDYWEDIGTIK+FY ANLAL EE PKFEFYDP TPFYTSPRFLPPTK + C+
Sbjct  337   HDVQGYIFRDYWEDIGTIKTFYEANLALVEERPKFEFYDPDTPFYTSPRFLPPTKAEKCR  396

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + D+IISHGCFLREC+++ SIIGERSRLD GVEL+DTLM+GAD Y+TESEIASLLA+G V
Sbjct  397   MVDSIISHGCFLRECSIQRSIIGERSRLDYGVELQDTLMLGADYYQTESEIASLLAEGKV  456

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G +TK+R  IIDKN +IGK+V+IMNK  VQE+DRP+EGFYIR GIT+I+EKATI D
Sbjct  457   PIGIGRDTKVRKCIIDKNAKIGKNVIIMNKGDVQEADRPEEGFYIRLGITVIVEKATIQD  516

Query  410   GTVI  399
             GTVI
Sbjct  517   GTVI  520



>emb|CDX72711.1| BnaC07g47330D [Brassica napus]
Length=632

 Score =   391 bits (1004),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 179/244 (73%), Positives = 216/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+LGL  Q+A  +PYIASMGVY F+T+ LL+LL  RYP+SNDFGSEI+PAA+++
Sbjct  389   SMQSDTTMLGLSQQEAVKSPYIASMGVYCFKTEALLKLLTRRYPSSNDFGSEIIPAAIRD  448

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQ Y++RDYWEDIGTIKSFY ANLAL EE PKFEFYD  TPFYTSPRFLPPTK + C+
Sbjct  449   HNVQGYVYRDYWEDIGTIKSFYEANLALIEEHPKFEFYDQDTPFYTSPRFLPPTKTEKCR  508

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I ++IISHGCFL EC+++ SIIGERSRLD GVEL+DTLM+GAD+Y+TESEIASLLA+GNV
Sbjct  509   IVNSIISHGCFLGECSIQRSIIGERSRLDYGVELQDTLMLGADSYQTESEIASLLAEGNV  568

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G +TKIR  IIDKN +IGK+V+I+N D VQE+DRP+EGFYIRSGIT+++EKATI D
Sbjct  569   PIGIGRDTKIRKCIIDKNAKIGKNVMILNNDDVQEADRPEEGFYIRSGITVVVEKATIKD  628

Query  410   GTVI  399
             GTVI
Sbjct  629   GTVI  632



>ref|XP_010323163.1| PREDICTED: ADP-glucose pyrophosphorylase large subunit isoform 
X1 [Solanum lycopersicum]
 ref|XP_010323164.1| PREDICTED: ADP-glucose pyrophosphorylase large subunit isoform 
X1 [Solanum lycopersicum]
Length=518

 Score =   387 bits (994),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/244 (75%), Positives = 214/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGL  Q+A   PYIASMGVYVF+TDVLL+LL+  YP+ NDFGSEI+P+AVK+
Sbjct  275   AMQVDTSILGLSEQEASNFPYIASMGVYVFKTDVLLKLLKSAYPSCNDFGSEIIPSAVKD  334

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGT+KSF++ANLALT++ PKF+F DPKTPFYTS RFLPPTK+D  +
Sbjct  335   HNVQAYLFNDYWEDIGTVKSFFDANLALTKQPPKFDFNDPKTPFYTSARFLPPTKVDKSR  394

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC ++HSI+G RSRLD GVE KDT+MMGAD Y+TESEIASLLA+G V
Sbjct  395   IVDAIISHGCFLRECNIQHSIVGVRSRLDYGVEFKDTMMMGADYYQTESEIASLLAEGKV  454

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG NTKI+  IIDKN +IGKDVVI+NK GV+E+DR  EGFYIRSGIT+IM+ ATI D
Sbjct  455   PIGVGPNTKIQKCIIDKNAKIGKDVVILNKQGVEEADRSAEGFYIRSGITVIMKNATIKD  514

Query  410   GTVI  399
             GTVI
Sbjct  515   GTVI  518



>ref|XP_009406290.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 isoform X2 [Musa acuminata subsp. malaccensis]
Length=526

 Score =   387 bits (995),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 184/244 (75%), Positives = 210/244 (86%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+   + L L  QDA   PYIASMGVYVF+ DVL +LLRW+YP +NDFGSEILP+ VKE
Sbjct  283   AMKDGGSFLRLSRQDAMKYPYIASMGVYVFKRDVLSKLLRWKYPKANDFGSEILPSVVKE  342

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAYIF DYWEDIGTI+SF++ANLALTE+ PKF+FYDP TPF+TSPRFLPPTKI+ C+
Sbjct  343   HNVQAYIFNDYWEDIGTIRSFFDANLALTEQPPKFQFYDPMTPFFTSPRFLPPTKIEKCR  402

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+VE SI+G RSRLD   ELKDT+MMGAD YETE+EIASLLAD  V
Sbjct  403   IVDAIISHGCFLRECSVERSIVGVRSRLDFDAELKDTMMMGADIYETEAEIASLLADDKV  462

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NT+IRN IID N RIGK+VVI NKDG+QE+DRP EGFYIRSGITIIM+ +TI D
Sbjct  463   PIGVGQNTRIRNCIIDMNARIGKNVVIANKDGIQEADRPCEGFYIRSGITIIMKNSTIKD  522

Query  410   GTVI  399
             GTVI
Sbjct  523   GTVI  526



>sp|P55242.1|GLGL2_SOLTU RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic; AltName: Full=ADP-glucose 
pyrophosphorylase; AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate 
adenyl transferase; Flags: Precursor [Solanum tuberosum]
 emb|CAA52917.1| ADP-glucose-pyrophosphorylase [Solanum tuberosum]
Length=519

 Score =   387 bits (994),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/244 (75%), Positives = 214/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGL  Q+A   PYIASMGVYVF+TDVLL LL+  YP+ NDFGSEI+P+AVK+
Sbjct  276   AMQVDTSILGLSEQEASNFPYIASMGVYVFKTDVLLNLLKSAYPSCNDFGSEIIPSAVKD  335

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGT+KSF++ANLALT++ PKF+F DPKTPFYTS RFLPPTK+D  +
Sbjct  336   HNVQAYLFNDYWEDIGTVKSFFDANLALTKQPPKFDFNDPKTPFYTSARFLPPTKVDKSR  395

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC ++HSI+G RSRLD GVE KDT+MMGAD Y+TE EIASLLA+G V
Sbjct  396   IVDAIISHGCFLRECNIQHSIVGVRSRLDYGVEFKDTMMMGADYYQTECEIASLLAEGKV  455

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG NTKI+N IIDKN +IGKDVVI+NK+GV+E+DR  EGFYIRSGIT+IM+ ATI D
Sbjct  456   PIGVGPNTKIQNCIIDKNAKIGKDVVILNKEGVEEADRSAEGFYIRSGITVIMKNATIKD  515

Query  410   GTVI  399
             GTVI
Sbjct  516   GTVI  519



>ref|NP_001233947.1| ADP-glucose pyrophosphorylase large subunit [Solanum lycopersicum]
 gb|AAB40724.1| ADP-glucose pyrophosphorylase large subunit [Solanum lycopersicum]
Length=518

 Score =   387 bits (993),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 182/244 (75%), Positives = 213/244 (87%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGL  Q+A   PYIASMGVYVF+TDVLL LL+  YP+ NDFGSEI+P+AVK+
Sbjct  275   AMQVDTSILGLSEQEASNFPYIASMGVYVFKTDVLLNLLKSAYPSCNDFGSEIIPSAVKD  334

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGT+KSF++ANLALT++ PKF+F DPKTPFYTS RFLPPTK+D  +
Sbjct  335   HNVQAYLFNDYWEDIGTVKSFFDANLALTKQPPKFDFNDPKTPFYTSARFLPPTKVDKSR  394

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC ++HSI+G RSRLD GVE KDT+MMGAD Y+TESEIASLLA+G V
Sbjct  395   IVDAIISHGCFLRECNIQHSIVGVRSRLDYGVEFKDTMMMGADYYQTESEIASLLAEGKV  454

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG NTKI+  IIDKN +IGKDVVI+NK GV+E+DR  EGFYIRSGIT+IM+ ATI D
Sbjct  455   PIGVGPNTKIQKCIIDKNAKIGKDVVILNKQGVEEADRSAEGFYIRSGITVIMKNATIKD  514

Query  410   GTVI  399
             GTVI
Sbjct  515   GTVI  518



>emb|CDX99581.1| BnaC04g33380D [Brassica napus]
Length=525

 Score =   387 bits (993),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/244 (73%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+LGL  ++A  +PYIASMGVY F+T+ LL LL  +YPTSNDFGSE++PAA+++
Sbjct  282   SMQTDTTMLGLSHEEATDSPYIASMGVYCFKTEALLDLLTQQYPTSNDFGSEVIPAAIRD  341

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
              +VQ YIFRDYWEDIGTIK+FY ANLAL +E PKFEFYDP TPFYTSPRFLPPTK + C+
Sbjct  342   QDVQGYIFRDYWEDIGTIKTFYEANLALVDERPKFEFYDPDTPFYTSPRFLPPTKTEKCR  401

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + D+IISHGCF+REC+V+ SIIGERSRLD GVEL+DTLM+GAD Y+TESEIASLLA+G V
Sbjct  402   MVDSIISHGCFMRECSVQRSIIGERSRLDYGVELQDTLMLGADYYQTESEIASLLAEGKV  461

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G++TKIR  IIDKN +IGK+V+IMNK  VQE+DRP+EGFYIRSGIT+++EKATI D
Sbjct  462   PIGIGQDTKIRKCIIDKNAKIGKNVIIMNKGDVQEADRPEEGFYIRSGITVVVEKATIQD  521

Query  410   GTVI  399
             GTVI
Sbjct  522   GTVI  525



>ref|XP_009140291.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Brassica rapa]
 ref|XP_009140292.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Brassica rapa]
 ref|XP_009140293.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Brassica rapa]
 ref|XP_009140294.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Brassica rapa]
 ref|XP_009140295.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Brassica rapa]
Length=520

 Score =   387 bits (993),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/244 (73%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ DTT+LGL  ++A  +PYIASMGVY F+T+ LL LL  +YPTSNDFGSE++PAA+++
Sbjct  277   SMQTDTTMLGLSHEEATDSPYIASMGVYCFKTEALLDLLTQQYPTSNDFGSEVIPAAIRD  336

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
              +VQ YIFRDYWEDIGTIK+FY ANLAL EE PKFEFYDP TPFYTSPRFLPPTK + C+
Sbjct  337   QDVQGYIFRDYWEDIGTIKTFYEANLALVEERPKFEFYDPDTPFYTSPRFLPPTKTEKCR  396

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + D+IISHGCF+REC+V+ SIIGERSRLD GVEL+DTLM+GAD Y+TESEIASLLA+G V
Sbjct  397   MVDSIISHGCFMRECSVQRSIIGERSRLDYGVELQDTLMLGADYYQTESEIASLLAEGKV  456

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G+++KIR  IIDKN +IGK+V+IMNK  VQE+DRP+EGFYIRSGIT+++EKATI D
Sbjct  457   PIGIGQDSKIRKCIIDKNAKIGKNVIIMNKGDVQEADRPEEGFYIRSGITVVVEKATIQD  516

Query  410   GTVI  399
             GTVI
Sbjct  517   GTVI  520



>ref|XP_009113739.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic isoform X1 [Brassica rapa]
 ref|XP_009113740.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic isoform X1 [Brassica rapa]
 ref|XP_009113742.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic isoform X1 [Brassica rapa]
Length=543

 Score =   386 bits (992),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 184/270 (68%), Positives = 219/270 (81%), Gaps = 26/270 (10%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT+LGLPP++A   PYIASMGVYVFR +VLL LLR  YPTSNDFGSEI+P AVKE
Sbjct  274   AMQVDTTVLGLPPKEAAELPYIASMGVYVFRKEVLLNLLRSSYPTSNDFGSEIIPLAVKE  333

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQA++F DYWEDIGTI SF++ANLALTE+ PKF+FYDPKTPF+TSPRFLPPTK+D C+
Sbjct  334   HNVQAFLFNDYWEDIGTIGSFFDANLALTEQPPKFQFYDPKTPFFTSPRFLPPTKVDKCR  393

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT+MMGAD Y+TE+EIASLLA+G V
Sbjct  394   ILDSIVSHGCFLRECSVQHSIVGIRSRVESGVELQDTMMMGADFYQTEAEIASLLAEGKV  453

Query  590   PIGVGENTKI--------------------------RNAIIDKNVRIGKDVVIMNKDGVQ  489
             PIGVGENTKI                          RN IIDKN +IGK+VVI N DGV+
Sbjct  454   PIGVGENTKIRYLIPNKAESSVVAIHCLTSVVLFKCRNCIIDKNAKIGKNVVIANADGVE  513

Query  488   ESDRPDEGFYIRSGITIIMEKATIPDGTVI  399
             E DRP+EGFYIRSGIT++++ ATI DG V+
Sbjct  514   EGDRPEEGFYIRSGITVVLKNATIRDGLVL  543



>ref|XP_002994500.1| hypothetical protein SELMODRAFT_138695, partial [Selaginella 
moellendorffii]
 gb|EFJ04435.1| hypothetical protein SELMODRAFT_138695, partial [Selaginella 
moellendorffii]
Length=447

 Score =   383 bits (984),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 172/244 (70%), Positives = 214/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT+LGL P++A   PYIASMG+YVF+ D+LL+LLRWRYPT+NDFGSEILPA+ KE
Sbjct  204   AMQVDTTVLGLTPEEAIEKPYIASMGIYVFKKDILLKLLRWRYPTANDFGSEILPASAKE  263

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAY+F DYWEDIGTIKSFY ANLALT + PKF FYD   P YTSPR+LPPTKI+ C+
Sbjct  264   YNVQAYLFNDYWEDIGTIKSFYEANLALTCQPPKFRFYDAAKPIYTSPRYLPPTKIEKCR  323

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + D+I+SHGCFL+EC+V HS+IG RSR++ G E++DT+M+GAD YETE+EIAS++A+G V
Sbjct  324   VLDSIVSHGCFLQECSVTHSVIGIRSRVEAGAEIQDTMMLGADFYETEAEIASMVAEGKV  383

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVG+N KIRN I+DKNVRIGK+VVI NKD VQE+++P EG+YIRSGIT+I++ ATI D
Sbjct  384   PVGVGQNAKIRNCILDKNVRIGKNVVIANKDNVQEAEKPSEGYYIRSGITVILKNATIAD  443

Query  410   GTVI  399
             GTVI
Sbjct  444   GTVI  447



>gb|AFO84073.1| ADP glucose pyrophosphorylase [Actinidia deliciosa]
Length=520

 Score =   385 bits (990),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 176/243 (72%), Positives = 215/243 (88%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             M+VDT+ LGL  +DA  +PYIASMGVYVFRTDVLL+LLRWRYP+ NDFGSEI+P+A+ +H
Sbjct  278   MRVDTSFLGLSEKDAAEHPYIASMGVYVFRTDVLLKLLRWRYPSCNDFGSEIIPSALSDH  337

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
             NVQAY+F DYWEDIGTIKSF++ANLALT++ PKF+F DPKTPF TSPRFLPPTK++ C+I
Sbjct  338   NVQAYLFNDYWEDIGTIKSFFDANLALTKQPPKFDFNDPKTPFCTSPRFLPPTKMEKCRI  397

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
              DAIISHGCFL EC ++HSI+G RSRL+ GV+L+DT+MMGAD+Y+TE+EIAS LA G VP
Sbjct  398   VDAIISHGCFLHECNIKHSIVGVRSRLETGVKLQDTMMMGADDYQTEAEIASHLAWGKVP  457

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             IGVG NT IRN IID N +IG+DVVI NKDGV+E+DRP+EGFYIRSGIT++++ ATI DG
Sbjct  458   IGVGRNTNIRNCIIDMNAKIGRDVVIANKDGVEEADRPEEGFYIRSGITVVLKNATIKDG  517

Query  407   TVI  399
             T+I
Sbjct  518   TII  520



>ref|XP_002970384.1| hypothetical protein SELMODRAFT_231637 [Selaginella moellendorffii]
 gb|EFJ28514.1| hypothetical protein SELMODRAFT_231637 [Selaginella moellendorffii]
Length=460

 Score =   383 bits (984),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 172/244 (70%), Positives = 214/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT+LGL P++A   PYIASMG+YVF+ D+LL+LLRWRYPT+NDFGSEILPA+ KE
Sbjct  217   AMQVDTTVLGLTPEEAIEKPYIASMGIYVFKKDILLKLLRWRYPTANDFGSEILPASAKE  276

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAY+F DYWEDIGTIKSFY ANLALT + PKF FYD   P YTSPR+LPPTKI+ C+
Sbjct  277   YNVQAYLFNDYWEDIGTIKSFYEANLALTCQPPKFRFYDAAKPIYTSPRYLPPTKIEKCR  336

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + D+I+SHGCFL+EC+V HS+IG RSR++ G E++DT+M+GAD YETE+EIAS++A+G V
Sbjct  337   VLDSIVSHGCFLQECSVTHSVIGIRSRVEAGAEIQDTMMLGADFYETEAEIASMVAEGKV  396

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVG+N KIRN I+DKNVRIGK+VVI NKD VQE+++P EG+YIRSGIT+I++ ATI D
Sbjct  397   PVGVGQNAKIRNCILDKNVRIGKNVVIANKDNVQEAEKPSEGYYIRSGITVILKNATIAD  456

Query  410   GTVI  399
             GTVI
Sbjct  457   GTVI  460



>ref|XP_002968152.1| hypothetical protein SELMODRAFT_169778 [Selaginella moellendorffii]
 gb|EFJ30406.1| hypothetical protein SELMODRAFT_169778 [Selaginella moellendorffii]
Length=463

 Score =   383 bits (983),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 172/244 (70%), Positives = 214/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT+LGL P++A   PYIASMG+YVF+ D+LL+LLRWRYPT+NDFGSEILPA+ KE
Sbjct  220   AMQVDTTVLGLTPEEAIEKPYIASMGIYVFKKDILLKLLRWRYPTANDFGSEILPASAKE  279

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAY+F DYWEDIGTIKSFY ANLALT + PKF FYD   P YTSPR+LPPTKI+ C+
Sbjct  280   YNVQAYLFNDYWEDIGTIKSFYEANLALTCQPPKFRFYDAAKPIYTSPRYLPPTKIEKCR  339

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + D+I+SHGCFL+EC+V HS+IG RSR++ G E++DT+M+GAD YETE+EIAS++A+G V
Sbjct  340   VLDSIVSHGCFLQECSVTHSVIGIRSRVEAGAEIQDTMMLGADFYETEAEIASMVAEGKV  399

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVG+N KIRN I+DKNVRIGK+VVI NKD VQE+++P EG+YIRSGIT+I++ ATI D
Sbjct  400   PVGVGQNAKIRNCILDKNVRIGKNVVIANKDNVQEAEKPSEGYYIRSGITVILKNATIAD  459

Query  410   GTVI  399
             GTVI
Sbjct  460   GTVI  463



>ref|XP_011007451.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Populus euphratica]
Length=518

 Score =   384 bits (987),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/244 (74%), Positives = 210/244 (86%), Gaps = 10/244 (4%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTTLLGL  Q+A   PYIASMGVYVFRTDVLL+LLRW YP+ NDFGSEI+P+AV++
Sbjct  285   AMQVDTTLLGLSRQEAMQFPYIASMGVYVFRTDVLLKLLRWSYPSCNDFGSEIIPSAVRD  344

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGT+KSF++ANL LT++          TPF+TSPRFLPPTK+D C+
Sbjct  345   HNVQAYLFNDYWEDIGTVKSFFDANLGLTKQ----------TPFFTSPRFLPPTKVDRCR  394

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+G RSRL+ GVEL DT+MMGAD Y+TESEIASLLA+G V
Sbjct  395   IVDAIISHGCFLRECSVQHSIVGVRSRLESGVELTDTMMMGADYYQTESEIASLLAEGKV  454

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKIRN IIDKN RIGKDV+I N DGVQE+DRP EGFYIRSGIT +++ ATI D
Sbjct  455   PIGVGQNTKIRNCIIDKNARIGKDVIITNADGVQEADRPAEGFYIRSGITAVLKNATIKD  514

Query  410   GTVI  399
             GT+I
Sbjct  515   GTLI  518



>ref|XP_008799957.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Phoenix dactylifera]
 ref|XP_008799959.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Phoenix dactylifera]
Length=536

 Score =   385 bits (988),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 170/243 (70%), Positives = 216/243 (89%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             MQVDTT+LGLPP+DA+++ YIASMG+YVF+TDVLL+LLRWRYP++NDFGSEI+P A K++
Sbjct  294   MQVDTTVLGLPPEDAKMHKYIASMGIYVFKTDVLLKLLRWRYPSANDFGSEIIPMAAKDY  353

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
             NVQAY+F  YWEDIGTIKSF++ANLALT++ PKF F+DPK P +TSPRFLPPTKI+ C++
Sbjct  354   NVQAYLFDGYWEDIGTIKSFFDANLALTDQPPKFHFHDPKKPIFTSPRFLPPTKIEKCRV  413

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
              D+IISHGCFL +C+V+HSI+G RSRL+ G ELKDT+MMGAD Y+TE+E AS LA+G VP
Sbjct  414   VDSIISHGCFLTQCSVKHSIVGVRSRLEYGAELKDTMMMGADYYQTEAERASFLAEGKVP  473

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             +GVGENT+IRN IIDKN RIGKDV+I N D V+E+D+P +GFYIRSGIT++++ + IPDG
Sbjct  474   VGVGENTRIRNCIIDKNARIGKDVIIANADNVEEADKPSDGFYIRSGITVVLKNSVIPDG  533

Query  407   TVI  399
             T+I
Sbjct  534   TII  536



>gb|ABF69950.1| ADP-glucose pyrophosphorylase (glucose-1-phosphate adenylyltransferase) 
large subunit, putative [Musa acuminata]
Length=445

 Score =   381 bits (979),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 180/244 (74%), Positives = 207/244 (85%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM  + T L L  QDA   PYIASMGVYVF+ DVLL+LLRW YP  NDFGSEILP+AV+E
Sbjct  202   AMNDNGTFLRLSHQDAMKYPYIASMGVYVFKRDVLLKLLRWNYPKCNDFGSEILPSAVEE  261

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY F DYWEDIGTI+SF++ANLALTE+ PKF+FYDP TPF+TSPRFLPPTKI+ C+
Sbjct  262   HNVQAYAFSDYWEDIGTIRSFFDANLALTEQPPKFQFYDPMTPFFTSPRFLPPTKIEKCR  321

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + DAIISHGCFLREC+VE SI+G RSRLD GVELKDT+MMGAD YETE+EI+S LAD  V
Sbjct  322   VMDAIISHGCFLRECSVERSIVGVRSRLDFGVELKDTMMMGADIYETEAEISSHLADDKV  381

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+ TKIRN +ID N RIGK+VVI NKDGVQE+DR  EGFY+RSGI +I++ ATI D
Sbjct  382   PIGVGQKTKIRNCVIDMNARIGKNVVIANKDGVQEADRASEGFYVRSGIVVILKNATIKD  441

Query  410   GTVI  399
             GTVI
Sbjct  442   GTVI  445



>emb|CDX84911.1| BnaC05g21440D [Brassica napus]
Length=510

 Score =   384 bits (985),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 215/244 (88%), Gaps = 5/244 (2%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT+LGLPP++A   PYIASMGVYVFR +VLL+LLR  YPTSNDFGSEI+P AVKE
Sbjct  272   AMQVDTTVLGLPPKEAAELPYIASMGVYVFRKEVLLKLLRSSYPTSNDFGSEIIPLAVKE  331

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQA++F DYWEDIGTI SF++ANLALTE+ PKF+FYDPKTPF+TSPRFLPPT     K
Sbjct  332   HNVQAFLFNDYWEDIGTIGSFFDANLALTEQPPKFQFYDPKTPFFTSPRFLPPT-----K  386

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT+MMGAD Y+TE+EIASLLA+G V
Sbjct  387   ILDSIVSHGCFLRECSVQHSIVGIRSRVESGVELQDTMMMGADFYQTEAEIASLLAEGKV  446

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRN IIDKN +IGK+VVI N DGV+E DR +EGFYIRSGIT++++ ATI D
Sbjct  447   PIGVGENTKIRNCIIDKNAKIGKNVVIANADGVEEGDRQEEGFYIRSGITVVLKNATIRD  506

Query  410   GTVI  399
             G V+
Sbjct  507   GLVL  510



>gb|KDO42002.1| hypothetical protein CISIN_1g0097201mg, partial [Citrus sinensis]
Length=420

 Score =   380 bits (975),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT+LLG  PQ+AR  PY+ASMGVYVF+ DVL +LLRWRYPTSNDFGSEI+PAA+ E
Sbjct  206   AMQVDTSLLGFSPQEARKCPYVASMGVYVFKKDVLFKLLRWRYPTSNDFGSEIIPAAIME  265

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQAYIFRDYWEDIGTIKSFY AN+ALT+E P F FYDPKTPFYTSPRFLPPTKIDNC+
Sbjct  266   HDVQAYIFRDYWEDIGTIKSFYEANMALTKESPAFHFYDPKTPFYTSPRFLPPTKIDNCR  325

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLRECTVEHSI+GERSRLD GVELKDT+M+GAD Y+TESEIASLLA+G V
Sbjct  326   IKDAIISHGCFLRECTVEHSIVGERSRLDYGVELKDTVMLGADYYQTESEIASLLAEGKV  385

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKD  498
             PIGVG NTKIRN IIDKNV+IGKDVVI+NKD
Sbjct  386   PIGVGRNTKIRNCIIDKNVKIGKDVVIVNKD  416



>ref|XP_006841529.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Amborella trichopoda]
 ref|XP_011622245.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Amborella trichopoda]
 ref|XP_011622246.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Amborella trichopoda]
 ref|XP_011622247.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Amborella trichopoda]
 ref|XP_011622249.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Amborella trichopoda]
 gb|ERN03204.1| hypothetical protein AMTR_s00003p00152830 [Amborella trichopoda]
Length=531

 Score =   384 bits (985),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 171/243 (70%), Positives = 215/243 (88%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             MQVDTTLLGL P++A++ PYIASMG+Y+F+TDVLL+LL+W YPT+NDFGSEI+P A K++
Sbjct  289   MQVDTTLLGLSPKEAKMCPYIASMGIYMFKTDVLLKLLKWNYPTANDFGSEIIPMAAKDY  348

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
             NVQAY+F DYWEDIGTIKSF+ ANLALT++ PKF FYDP  P +TSPRFLPP+K++ C++
Sbjct  349   NVQAYLFNDYWEDIGTIKSFFEANLALTDQPPKFHFYDPLKPIFTSPRFLPPSKMEKCQV  408

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
              DAI+SHGCFLREC+V+H+I+G RSRL+ GVELKDT+MMGAD Y+TE+EIA+ LA G VP
Sbjct  409   VDAIVSHGCFLRECSVQHAIVGIRSRLEYGVELKDTMMMGADYYQTEAEIAACLARGEVP  468

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             IGVG+NTKIR  IIDKN +IGK+V+I N+D VQE++RP EGFYIRSGIT++++ ATI DG
Sbjct  469   IGVGQNTKIRKCIIDKNAKIGKNVIISNRDDVQEAERPTEGFYIRSGITVVLKNATIEDG  528

Query  407   TVI  399
             TVI
Sbjct  529   TVI  531



>gb|AEV40474.1| ADP-glucose pyrophosphorylase 3 [Spirodela polyrhiza]
 gb|AEV40475.1| ADP-glucose pyrophosphorylase 3 [Spirodela polyrhiza]
Length=539

 Score =   383 bits (984),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 167/244 (68%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDTT+ GLPP +A  + YIASMGVY FR D+LL+LLRWRYPTSNDFGSEI+P+AV E
Sbjct  296   AMKVDTTIFGLPPHEAADSSYIASMGVYAFRLDILLKLLRWRYPTSNDFGSEIIPSAVNE  355

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAY+F DYWEDIGTI+SF++ANLAL E+  +F+FYDP+TPFYTSPR+LPPTK+D CK
Sbjct  356   YNVQAYMFHDYWEDIGTIRSFFDANLALAEQSARFQFYDPRTPFYTSPRYLPPTKMDKCK  415

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+I+SHGCFL  C+++HSI+G+RSRL+ GV+LKD ++MGADNY+TE+E A+LLA+G V
Sbjct  416   IVDSIVSHGCFLDHCSIQHSIVGDRSRLEYGVQLKDAIVMGADNYQTEAERAALLAEGKV  475

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+G++T+I+N I+DKN RIG+DVVI N  GVQE+DRP EGFY+RSGI ++++ +TI D
Sbjct  476   PIGIGQHTRIQNCIVDKNARIGRDVVIANTAGVQEADRPSEGFYVRSGIVVLLKNSTIKD  535

Query  410   GTVI  399
             GTVI
Sbjct  536   GTVI  539



>gb|KJB63621.1| hypothetical protein B456_010G008700 [Gossypium raimondii]
Length=523

 Score =   382 bits (981),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/244 (72%), Positives = 214/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGL  +DA    YIASMGVYVF+ D+LL+LL   YP+ NDFGSEI+P+AVKE
Sbjct  280   AMQVDTSILGLSAEDAAKYSYIASMGVYVFKKDILLKLLTQSYPSCNDFGSEIIPSAVKE  339

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKSF++ANLALT++ PKFEFYDPKTPFYTSPRFLPP+KID C+
Sbjct  340   HNVQAYLFNDYWEDIGTIKSFFDANLALTDQPPKFEFYDPKTPFYTSPRFLPPSKIDQCR  399

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I +AIISHGCFLR C+V+ S++G RSRL+ GVEL+DT+MMGAD Y+TE EI SLL +G V
Sbjct  400   IVNAIISHGCFLRNCSVKRSVVGVRSRLESGVELEDTMMMGADFYQTEMEIMSLLKEGKV  459

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKI+N IIDKN +IGK+V+I N DGV+E++RP++GFYIRSGIT+IM+ ATI D
Sbjct  460   PIGVGQNTKIKNCIIDKNAKIGKNVIISNSDGVEEAERPEQGFYIRSGITVIMKNATIKD  519

Query  410   GTVI  399
             G+VI
Sbjct  520   GSVI  523



>ref|XP_009416548.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Musa acuminata subsp. malaccensis]
Length=529

 Score =   382 bits (982),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/244 (74%), Positives = 207/244 (85%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM  + T L L  QDA   PYIASMGVYVF+ DVLL+LLRW YP  NDFGSEILP+AV+E
Sbjct  286   AMNDNGTFLRLSHQDAMKYPYIASMGVYVFKRDVLLKLLRWNYPKCNDFGSEILPSAVEE  345

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY F DYWEDIGTI+SF++ANLALTE+ PKF+FYDP TPF+TSPRFLPPTKI+ C+
Sbjct  346   HNVQAYAFSDYWEDIGTIRSFFDANLALTEQPPKFQFYDPMTPFFTSPRFLPPTKIEKCR  405

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + DAIISHGCFLREC+VE SI+G RSRLD GVELKDT+MMGAD YETE+EI+S LAD  V
Sbjct  406   VMDAIISHGCFLRECSVERSIVGVRSRLDFGVELKDTMMMGADIYETEAEISSHLADDKV  465

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+ TKIRN +ID N RIGK+VVI NKDGVQE+DR  EGFY+RSGI +I++ ATI D
Sbjct  466   PIGVGQKTKIRNCVIDMNARIGKNVVIANKDGVQEADRASEGFYVRSGIVVILKNATIKD  525

Query  410   GTVI  399
             GTVI
Sbjct  526   GTVI  529



>gb|AGV54292.1| ADP-glucose pyrophosphorylase large subunit [Phaseolus vulgaris]
Length=525

 Score =   382 bits (980),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/221 (81%), Positives = 202/221 (91%), Gaps = 0/221 (0%)
 Frame = -3

Query  1061  SMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEHNVQAYIFRDYWEDIGTIKSFYN  882
             SMGVYVF+TDVLL LL+ R+PTSNDFGSEI+PAAV++HNVQ+Y FRDYWEDIGTIKSFY+
Sbjct  305   SMGVYVFKTDVLLNLLKCRHPTSNDFGSEIIPAAVRDHNVQSYFFRDYWEDIGTIKSFYD  364

Query  881   ANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIG  702
             ANLALTEE  +FEFYDPKTP YTSP FLPPTKID  +I DAIISHGCFLRECTV+HSI+G
Sbjct  365   ANLALTEESHEFEFYDPKTPIYTSPGFLPPTKIDKSRIVDAIISHGCFLRECTVQHSIVG  424

Query  701   ERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGK  522
             ERSRLD GVE++DT+MMGAD Y+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGK
Sbjct  425   ERSRLDYGVEIQDTVMMGADYYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGK  484

Query  521   DVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDGTVI  399
             DV+I NKDGVQE+DRP++GFYIRSGITII EKATI DGTVI
Sbjct  485   DVIIKNKDGVQEADRPEDGFYIRSGITIIAEKATIEDGTVI  525



>gb|AAC49942.1| ADP-glucose pyrophosphorylase large subunit [Solanum lycopersicum]
Length=518

 Score =   381 bits (979),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 180/243 (74%), Positives = 212/243 (87%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             MQVDT++LGL  Q+A   PYIASMGVYVF+TDVLL+LL+  YP+ NDFGSEI+P+AVK+H
Sbjct  276   MQVDTSILGLSEQEASNFPYIASMGVYVFKTDVLLKLLKSAYPSCNDFGSEIIPSAVKDH  335

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
             NVQAY+F DYWEDIGT+KSF++ANLALT++ PKF+F DPKTPFYTS RFLPPTK+D  +I
Sbjct  336   NVQAYLFNDYWEDIGTVKSFFDANLALTKQPPKFDFNDPKTPFYTSARFLPPTKVDKSRI  395

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
              DAIISHG FLREC ++HSI+G RSRLD GVE KDT+MMGAD Y+TESEIASLLA+G VP
Sbjct  396   VDAIISHGGFLRECNIQHSIVGVRSRLDYGVEFKDTMMMGADYYQTESEIASLLAEGKVP  455

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             IGVG NTKI+  IIDKN +IGKDVVI+NK GV+E+DR  EGFYIRSGIT+IM+ ATI DG
Sbjct  456   IGVGPNTKIQKCIIDKNAKIGKDVVILNKQGVEEADRSAEGFYIRSGITVIMKNATIKDG  515

Query  407   TVI  399
             TVI
Sbjct  516   TVI  518



>ref|XP_009396671.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Musa acuminata subsp. malaccensis]
Length=524

 Score =   380 bits (975),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 176/243 (72%), Positives = 209/243 (86%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             M+ + TL  L  QDA+  PYIASMGVYVF  + LL LLRW YP +NDFGS+ILP+AVK++
Sbjct  282   MKDENTLFRLSHQDAKKYPYIASMGVYVFNRNTLLELLRWTYPKANDFGSDILPSAVKDY  341

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
             NVQAYIF+DYWEDI TIKSFY+ANLALT++ PKF+FYDP+TP +TSPRFLPP KI+ C+I
Sbjct  342   NVQAYIFKDYWEDIQTIKSFYDANLALTDQPPKFQFYDPRTPIFTSPRFLPPNKIEQCRI  401

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
             +DAIISHGCFL EC++EHS++G RSR+  G ELK TLMMGAD+YETE+EIASLLA+G VP
Sbjct  402   RDAIISHGCFLHECSIEHSVVGMRSRVYYGAELKHTLMMGADDYETEAEIASLLAEGKVP  461

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             IGVGENTKIRN IID N RIGK+VVI N+DGVQE+DRP EGFYIRSGIT I++ AT+ DG
Sbjct  462   IGVGENTKIRNCIIDMNARIGKNVVIANRDGVQEADRPSEGFYIRSGITTILKSATVKDG  521

Query  407   TVI  399
             TVI
Sbjct  522   TVI  524



>ref|XP_006491439.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like [Citrus sinensis]
Length=526

 Score =   379 bits (972),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 165/244 (68%), Positives = 216/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ+DTT LGL  Q+AR  PYIASMG+Y+F+T+VLL++LRW YP +NDFGSE++P A K+
Sbjct  283   SMQIDTTALGLSAQEARNFPYIASMGIYLFKTEVLLKVLRWHYPEANDFGSEVIPMATKD  342

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
              NVQAY+F DYWEDIGTIKSF++ANL+LT++ PKF FYDP+ P +TSPRFLPP+KI+ C+
Sbjct  343   FNVQAYLFNDYWEDIGTIKSFFDANLSLTDKPPKFHFYDPQKPIFTSPRFLPPSKIEKCR  402

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             ++D+IISHGCFLREC+VEHSI+G RSRL+ GVELKDT+MMGAD Y+TE+EIA+LLA+G V
Sbjct  403   VQDSIISHGCFLRECSVEHSIVGIRSRLEYGVELKDTMMMGADYYQTEAEIAALLAEGKV  462

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+G+G +TKI+N IIDKN +IGK+V+I NKDGV+E++RP +GFYIRSGIT++++  TI D
Sbjct  463   PVGIGRDTKIKNCIIDKNAKIGKNVIIANKDGVEEAERPSDGFYIRSGITVVLKNTTIKD  522

Query  410   GTVI  399
             GT+I
Sbjct  523   GTII  526



>gb|KDO86722.1| hypothetical protein CISIN_1g043870mg [Citrus sinensis]
Length=526

 Score =   379 bits (972),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 165/244 (68%), Positives = 216/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ+DTT LGL  Q+AR  PYIASMG+Y+F+T+VLL++LRW YP +NDFGSE++P A K+
Sbjct  283   SMQIDTTALGLSAQEARNFPYIASMGIYLFKTEVLLKVLRWHYPEANDFGSEVIPMATKD  342

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
              NVQAY+F DYWEDIGTIKSF++ANL+LT++ PKF FYDP+ P +TSPRFLPP+KI+ C+
Sbjct  343   FNVQAYLFNDYWEDIGTIKSFFDANLSLTDKPPKFHFYDPQKPIFTSPRFLPPSKIEKCR  402

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             ++D+IISHGCFLREC+VEHSI+G RSRL+ GVELKDT+MMGAD Y+TE+EIA+LLA+G V
Sbjct  403   VQDSIISHGCFLRECSVEHSIVGIRSRLEYGVELKDTMMMGADYYQTEAEIAALLAEGKV  462

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+G+G +TKI+N IIDKN +IGK+V+I NKDGV+E++RP +GFYIRSGIT++++  TI D
Sbjct  463   PVGIGRDTKIKNCIIDKNAKIGKNVIIANKDGVEEAERPSDGFYIRSGITVVLKNTTIKD  522

Query  410   GTVI  399
             GT+I
Sbjct  523   GTII  526



>ref|XP_006444661.1| hypothetical protein CICLE_v10023395mg [Citrus clementina]
 gb|ESR57901.1| hypothetical protein CICLE_v10023395mg [Citrus clementina]
Length=526

 Score =   378 bits (971),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 165/244 (68%), Positives = 216/244 (89%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ+DTT LGL  Q+AR  PYIASMG+Y+F+T+VLL++LRW YP +NDFGSE++P A K+
Sbjct  283   SMQIDTTALGLSAQEARNFPYIASMGIYLFKTEVLLKVLRWHYPEANDFGSEVIPMATKD  342

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
              NVQAY+F DYWEDIGTIKSF++ANL+LT++ PKF FYDP+ P +TSPRFLPP+KI+ C+
Sbjct  343   FNVQAYLFNDYWEDIGTIKSFFDANLSLTDKPPKFHFYDPQKPIFTSPRFLPPSKIEKCR  402

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             ++D+IISHGCFLREC+VEHSI+G RSRL+ GVELKDT+MMGAD Y+TE+EIA+LLA+G V
Sbjct  403   VQDSIISHGCFLRECSVEHSIVGIRSRLEYGVELKDTMMMGADYYQTEAEIAALLAEGKV  462

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+G+G +TKI+N IIDKN +IGK+V+I NKDGV+E++RP +GFYIRSGIT++++  TI D
Sbjct  463   PVGIGRDTKIKNCIIDKNAKIGKNVIIANKDGVEEAERPSDGFYIRSGITVVLKNTTIKD  522

Query  410   GTVI  399
             GT+I
Sbjct  523   GTII  526



>gb|AAS00542.1| ADP-glucose pyrophosphorylase large subunit [Fragaria x ananassa]
Length=507

 Score =   377 bits (969),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DTTLLG  PQDA  +PY+ASMGVYVF+TD+LL LL+  YP SNDFGSEI+PAAV+E
Sbjct  272   AMQSDTTLLGFSPQDALKSPYVASMGVYVFKTDILLELLKKSYPNSNDFGSEIIPAAVEE  331

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
              NVQAYIF DYWEDIGTI+SFY+ANLALTEEFPKF+FYDPKTPF+TSPRFLPPTKIDN +
Sbjct  332   RNVQAYIFIDYWEDIGTIQSFYDANLALTEEFPKFQFYDPKTPFFTSPRFLPPTKIDNSR  391

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + DAIISHGCFL+EC V+ SI+GERSRLD GVELKD++MMGAD+Y+TESEIA+LLA G V
Sbjct  392   VVDAIISHGCFLQECFVQSSIVGERSRLDYGVELKDSIMMGADSYQTESEIAALLARGKV  451

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIR  453
             PIG+G NTKIR  I+D N +IGKDV+IMNKDG+QE+DRP+EGFYIR
Sbjct  452   PIGIGRNTKIRLCIVDLNAKIGKDVIIMNKDGIQEADRPEEGFYIR  497



>gb|KEH36175.1| glucose-1-phosphate adenylyltransferase family protein [Medicago 
truncatula]
Length=530

 Score =   378 bits (971),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 179/244 (73%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDTT+LGL P++A+ NPYIASMGVYVFRT+ LL LL+    T NDFGSEI+P+AV  
Sbjct  287   AMRVDTTVLGLSPEEAKKNPYIASMGVYVFRTETLLELLKLNGSTCNDFGSEIIPSAVSG  346

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQA++F DYWEDIGTI+SF++ANLALTE  PKF+FYDPKTPF+TSPRFLPPTK++ CK
Sbjct  347   HNVQAFLFNDYWEDIGTIESFFDANLALTEHAPKFQFYDPKTPFFTSPRFLPPTKVEKCK  406

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+G RSRL+ GVEL+DT+MMGAD Y+TESEIASLLA+G V
Sbjct  407   IVDAIISHGCFLRECSVQHSIVGIRSRLESGVELQDTMMMGADYYQTESEIASLLAEGKV  466

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVGENTKIRN IIDKN +IG++ +I N DGV+E+DR  EGFYIRSGIT+I++ ATI D
Sbjct  467   PVGVGENTKIRNCIIDKNAKIGRNAIITNADGVEEADRTKEGFYIRSGITVILKNATIQD  526

Query  410   GTVI  399
             GTVI
Sbjct  527   GTVI  530



>gb|KCW86631.1| hypothetical protein EUGRSUZ_B03259 [Eucalyptus grandis]
Length=286

 Score =   369 bits (947),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 175/258 (68%), Positives = 210/258 (81%), Gaps = 16/258 (6%)
 Frame = -3

Query  1124  QVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEHN  945
             QVD+TLLGL  QDA   PYIASMG+YVF+TDVLL+LLRW YP+ NDFGSEI+P+AV EHN
Sbjct  29    QVDSTLLGLSKQDAVNLPYIASMGIYVFKTDVLLKLLRWSYPSCNDFGSEIIPSAVAEHN  88

Query  944   VQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKIK  765
             VQAY+F DYWEDIGTIKSF++ NLA+TE+ PKFEFYD +TPFYTSPRFLPP+K++ C+I 
Sbjct  89    VQAYLFNDYWEDIGTIKSFFDTNLAVTEQPPKFEFYDLQTPFYTSPRFLPPSKVEKCRIV  148

Query  764   DAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVPI  585
              AIISHGCFL+EC++EHSI+G R RLD  VE KDT+MMG+D Y+TE+EIASLLA G VPI
Sbjct  149   GAIISHGCFLQECSIEHSIVGVRLRLDYDVEFKDTVMMGSDYYQTEAEIASLLAQGKVPI  208

Query  584   GVGENTKIR----------------NAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIR  453
             GVG+NTKIR                  + +KN RIGK+VVI N DGVQE+D P+EGFYIR
Sbjct  209   GVGQNTKIRIVCNPSTDKFPCFSFLKELHNKNARIGKNVVIHNTDGVQEADSPEEGFYIR  268

Query  452   SGITIIMEKATIPDGTVI  399
             SGIT+I++ ATI DGTV+
Sbjct  269   SGITVILKNATIKDGTVV  286



>ref|XP_009342671.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Pyrus x bretschneideri]
Length=509

 Score =   377 bits (967),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 201/226 (89%), Gaps = 0/226 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DTTLLGL PQDA   PY+ASMGVYVF+T++LL LLRWRYPTSNDFGSEI+PAAV+E
Sbjct  274   AMQADTTLLGLSPQDALKAPYVASMGVYVFKTEILLNLLRWRYPTSNDFGSEIIPAAVRE  333

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H VQAY+FRDYWEDIGTIKSFY+ANLALT+E PKFEFYDPKTP +TSPRFLPPTKID C+
Sbjct  334   HKVQAYMFRDYWEDIGTIKSFYDANLALTDEIPKFEFYDPKTPIFTSPRFLPPTKIDKCR  393

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFL+EC+V+HSI+GERSRL+ GVELKD +MMGADNY+TESEIASLLADG V
Sbjct  394   IVDAIISHGCFLQECSVQHSIVGERSRLNYGVELKDAIMMGADNYQTESEIASLLADGEV  453

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIR  453
             PIG+G NTKIRN IIDKN +IGKDV+I+NKD  + +D+  +  + R
Sbjct  454   PIGIGSNTKIRNCIIDKNAKIGKDVMIVNKDVKKLTDQKTDFTFAR  499



>gb|KJB09550.1| hypothetical protein B456_001G149300 [Gossypium raimondii]
 gb|KJB09551.1| hypothetical protein B456_001G149300 [Gossypium raimondii]
Length=524

 Score =   377 bits (968),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 214/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQVDTTLLGL  QDA+  PYIASMG+Y+F+TDVLL+LLRW YP +NDFGSEI+P A+K+
Sbjct  281   SMQVDTTLLGLTAQDAKKTPYIASMGIYLFKTDVLLKLLRWHYPEANDFGSEIIPMAMKD  340

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NV+AY+F  YWEDIGTIKSF++ANLALT++ PKF FYDP  P +TSPR+LPP++I+ C+
Sbjct  341   YNVKAYLFDGYWEDIGTIKSFFDANLALTDKPPKFHFYDPLKPIFTSPRYLPPSRIEQCR  400

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + D+IISHGCFLREC+V+HSI+G RSRL+ GVELKDTLMMGAD+Y+TE+EIAS +++GN+
Sbjct  401   VVDSIISHGCFLRECSVKHSIVGIRSRLEYGVELKDTLMMGADHYQTEAEIASCISEGNI  460

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+G+G NTKI N IID N RIGK+VVI NKD V+E+DRP EGFYIRSGIT++++ A I D
Sbjct  461   PLGIGRNTKIMNCIIDTNTRIGKNVVIANKDNVEEADRPSEGFYIRSGITVVVKNAVIKD  520

Query  410   GTVI  399
             GT+I
Sbjct  521   GTII  524



>ref|XP_011083898.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic-like, partial [Sesamum indicum]
Length=510

 Score =   376 bits (966),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 177/244 (73%), Positives = 209/244 (86%), Gaps = 11/244 (5%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQVDT+LLGL           +    YVFRTDVLL+LLRW YP+ NDFGSEI+P+AVK+
Sbjct  278   SMQVDTSLLGL-----------SXXXXYVFRTDVLLKLLRWTYPSCNDFGSEIIPSAVKD  326

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTIKSF++ANLALT++ PKF+F DPKTPFYTSPRFLPPTK++ C+
Sbjct  327   HNVQAYLFSDYWEDIGTIKSFFDANLALTDQSPKFDFNDPKTPFYTSPRFLPPTKVEKCR  386

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+V+HSI+G RSRLD GVELKDT+MMGAD Y+TESEIASLLA+G V
Sbjct  387   IVDAIISHGCFLRECSVQHSIVGVRSRLDYGVELKDTMMMGADYYQTESEIASLLAEGKV  446

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG NTKI N IIDKN +IGKDV+I NKD V+E+DR DEGFYIRSGIT+I++ +TI D
Sbjct  447   PIGVGHNTKISNCIIDKNAKIGKDVIIANKDCVEEADRADEGFYIRSGITVILKNSTIKD  506

Query  410   GTVI  399
             GT+I
Sbjct  507   GTII  510



>ref|XP_009342669.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009342670.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Pyrus x bretschneideri]
Length=511

 Score =   376 bits (966),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 201/226 (89%), Gaps = 0/226 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DTTLLGL PQDA   PY+ASMGVYVF+T++LL LLRWRYPTSNDFGSEI+PAAV+E
Sbjct  276   AMQADTTLLGLSPQDALKAPYVASMGVYVFKTEILLNLLRWRYPTSNDFGSEIIPAAVRE  335

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H VQAY+FRDYWEDIGTIKSFY+ANLALT+E PKFEFYDPKTP +TSPRFLPPTKID C+
Sbjct  336   HKVQAYMFRDYWEDIGTIKSFYDANLALTDEIPKFEFYDPKTPIFTSPRFLPPTKIDKCR  395

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFL+EC+V+HSI+GERSRL+ GVELKD +MMGADNY+TESEIASLLADG V
Sbjct  396   IVDAIISHGCFLQECSVQHSIVGERSRLNYGVELKDAIMMGADNYQTESEIASLLADGEV  455

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIR  453
             PIG+G NTKIRN IIDKN +IGKDV+I+NKD  + +D+  +  + R
Sbjct  456   PIGIGSNTKIRNCIIDKNAKIGKDVMIVNKDVKKLTDQKTDFTFAR  501



>ref|XP_011039886.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011039894.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011039900.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
Length=530

 Score =   376 bits (965),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 212/244 (87%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +M+VDTT+LGL  QDA   PYIASMG+Y+F+TDVLL+LLRW YPT+NDFGSEI+P + KE
Sbjct  287   SMKVDTTVLGLSAQDANKFPYIASMGIYMFKTDVLLKLLRWNYPTANDFGSEIIPMSTKE  346

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAY+F  YWEDIGTIKSF++ANLALT++ P F F+DP  P +TSPRFLPPTKI+ C+
Sbjct  347   YNVQAYLFNGYWEDIGTIKSFFDANLALTDQPPNFHFFDPLKPIFTSPRFLPPTKIEKCR  406

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             +KD+I+SHGCFLREC+VEHSI+G RSRL+ GVELKDT+M+GAD Y+TE+EIA+ LA+G V
Sbjct  407   VKDSIVSHGCFLRECSVEHSIVGIRSRLEYGVELKDTMMIGADYYQTEAEIAASLAEGRV  466

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVG++TKI N IIDKN RIGK V I NK+GVQE++RP EGFYIRSGIT++++ + I D
Sbjct  467   PVGVGKDTKIMNCIIDKNARIGKKVTIANKEGVQEAERPSEGFYIRSGITVVLKNSVIKD  526

Query  410   GTVI  399
             GT+I
Sbjct  527   GTII  530



>ref|XP_007051343.1| ADPGLC-PPase large subunit [Theobroma cacao]
 gb|EOX95500.1| ADPGLC-PPase large subunit [Theobroma cacao]
Length=524

 Score =   375 bits (964),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 211/244 (86%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQVDTT+LGL  QDAR++PYIASMG+Y+F+T+VLL+LLRW YP +NDFGSEI+P A+K+
Sbjct  281   SMQVDTTVLGLTAQDARISPYIASMGIYLFKTEVLLKLLRWHYPAANDFGSEIIPLAMKD  340

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NV+AY+F  YWEDIGTIKSF++ANLALT++ PKF FYDP  P  TSPRFLPPTKI+ C+
Sbjct  341   YNVKAYLFDGYWEDIGTIKSFFDANLALTDQPPKFHFYDPLKPIVTSPRFLPPTKIEQCR  400

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + D+IISHGC L+EC+VEHSI+G RSRL+ GVELKDTLMMGADNY+TE EIAS LA+  V
Sbjct  401   VVDSIISHGCLLKECSVEHSIVGIRSRLEYGVELKDTLMMGADNYQTEEEIASCLAESKV  460

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVG++TKI N IIDKN RIGK VVI NKD V+E+DRP EGFYIRSGI ++++ + I D
Sbjct  461   PLGVGKDTKIMNCIIDKNARIGKHVVITNKDNVKEADRPSEGFYIRSGIIVVLKNSVIKD  520

Query  410   GTVI  399
             GT+I
Sbjct  521   GTII  524



>gb|KHG05254.1| Glucose-1-phosphate adenylyltransferase large subunit 2, chloroplastic 
-like protein [Gossypium arboreum]
Length=524

 Score =   375 bits (964),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 167/244 (68%), Positives = 214/244 (88%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQVDTTLLGL  QDA+  PYIASMG+Y+F+TDVLL+LLRW YP +NDFGSEI+P A+K+
Sbjct  281   SMQVDTTLLGLTAQDAKKTPYIASMGIYLFKTDVLLKLLRWHYPEANDFGSEIIPMAMKD  340

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NV+AY+F  YWEDIGTIKSF++ANLALT++ PKF FYDP  P +TSPR+LPP++I+ C+
Sbjct  341   YNVKAYLFDGYWEDIGTIKSFFDANLALTDKPPKFHFYDPLKPIFTSPRYLPPSRIEQCR  400

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + D+IISHGCFLREC+V+HSI+G RSRL+ GVELKDTLMMGAD+Y+TE+EIAS +++GN+
Sbjct  401   VVDSIISHGCFLRECSVKHSIVGIRSRLEYGVELKDTLMMGADHYQTEAEIASCISEGNI  460

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+G+G NTKI N IID N RIGK+VVI NKD V+E++RP EGFYIRSGIT++++ A I D
Sbjct  461   PLGIGRNTKIMNCIIDTNTRIGKNVVIANKDNVEEANRPSEGFYIRSGITVVVKNAVIKD  520

Query  410   GTVI  399
             GT+I
Sbjct  521   GTII  524



>ref|XP_009406289.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 isoform X1 [Musa acuminata subsp. malaccensis]
Length=549

 Score =   376 bits (966),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 184/267 (69%), Positives = 210/267 (79%), Gaps = 23/267 (9%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+   + L L  QDA   PYIASMGVYVF+ DVL +LLRW+YP +NDFGSEILP+ VKE
Sbjct  283   AMKDGGSFLRLSRQDAMKYPYIASMGVYVFKRDVLSKLLRWKYPKANDFGSEILPSVVKE  342

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEF-----------------------PKFEF  840
             HNVQAYIF DYWEDIGTI+SF++ANLALTE+                        PKF+F
Sbjct  343   HNVQAYIFNDYWEDIGTIRSFFDANLALTEQVGISFRRTHANFMLKISSELFVQPPKFQF  402

Query  839   YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  660
             YDP TPF+TSPRFLPPTKI+ C+I DAIISHGCFLREC+VE SI+G RSRLD   ELKDT
Sbjct  403   YDPMTPFFTSPRFLPPTKIEKCRIVDAIISHGCFLRECSVERSIVGVRSRLDFDAELKDT  462

Query  659   LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  480
             +MMGAD YETE+EIASLLAD  VPIGVG+NT+IRN IID N RIGK+VVI NKDG+QE+D
Sbjct  463   MMMGADIYETEAEIASLLADDKVPIGVGQNTRIRNCIIDMNARIGKNVVIANKDGIQEAD  522

Query  479   RPDEGFYIRSGITIIMEKATIPDGTVI  399
             RP EGFYIRSGITIIM+ +TI DGTVI
Sbjct  523   RPCEGFYIRSGITIIMKNSTIKDGTVI  549



>ref|XP_002975788.1| hypothetical protein SELMODRAFT_267891 [Selaginella moellendorffii]
 gb|EFJ23417.1| hypothetical protein SELMODRAFT_267891 [Selaginella moellendorffii]
Length=498

 Score =   374 bits (960),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 208/244 (85%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT LGL  ++A+  PYIASMG+YVFR DVLL+LLRWRYPTSNDFGSEI+PAA  E
Sbjct  255   AMQVDTTALGLSREEAKKMPYIASMGIYVFRKDVLLKLLRWRYPTSNDFGSEIIPAAASE  314

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAY+F DYWEDIGTIKSF++ANLALT + PKF FYD   P +TSPRFLPPTK++ C+
Sbjct  315   YNVQAYLFNDYWEDIGTIKSFFDANLALTAQPPKFSFYDASNPIFTSPRFLPPTKMEKCR  374

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+I+SHGCFL+ C+VEHS+IG RSRL+ GVELKDT++MGAD+YETE+EIA+L A G V
Sbjct  375   IIDSIVSHGCFLKSCSVEHSLIGVRSRLESGVELKDTIIMGADSYETEAEIAALRAQGKV  434

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVGE+T +RN ++DKN RIG  V+I N DGVQE++RP EG YIRSGIT++++ + + D
Sbjct  435   PLGVGEHTTMRNCLVDKNARIGSHVIITNTDGVQEAERPSEGIYIRSGITVVVKNSIVKD  494

Query  410   GTVI  399
             GTVI
Sbjct  495   GTVI  498



>gb|AAB82604.1| ADP-glucose-pyrophosphorylase large subunit [Triticum aestivum]
Length=290

 Score =   366 bits (940),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 204/244 (84%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDT+ L     D    PYIASMGVYVF+ DVLL LL+ RY   +DFGSEILP A+ +
Sbjct  47    AMKVDTSFLNFAIDDPAKYPYIASMGVYVFKRDVLLNLLKSRYAELHDFGSEILPRALHD  106

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTI+SF++AN+AL E+ PKFEFYDPKTPF+TSPR+LPPTK D C+
Sbjct  107   HNVQAYVFTDYWEDIGTIRSFFDANMALCEQPPKFEFYDPKTPFFTSPRYLPPTKSDKCR  166

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IK+AIISHGCFLREC +EHSIIG RSRL+ G ELK+ +MMGAD+YETE EI+ L+++G V
Sbjct  167   IKEAIISHGCFLRECKIEHSIIGVRSRLNSGSELKNAMMMGADSYETEDEISRLMSEGKV  226

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKI N IID N RIG+DVVI NK+GVQE+DRP+EG+YIRSGI +I + ATI D
Sbjct  227   PIGVGENTKISNCIIDMNARIGRDVVISNKEGVQEADRPEEGYYIRSGIVVIQKNATIKD  286

Query  410   GTVI  399
             GTV+
Sbjct  287   GTVV  290



>ref|XP_002973739.1| hypothetical protein SELMODRAFT_149205 [Selaginella moellendorffii]
 gb|EFJ25399.1| hypothetical protein SELMODRAFT_149205 [Selaginella moellendorffii]
Length=533

 Score =   375 bits (962),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 208/244 (85%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT LGL  ++A+  PYIASMG+YVFR DVLL+LLRWRYPTSNDFGSEI+PAA  E
Sbjct  290   AMQVDTTALGLSREEAKKMPYIASMGIYVFRKDVLLKLLRWRYPTSNDFGSEIIPAAANE  349

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAY+F DYWEDIGTIKSF++ANLALT + PKF FYD   P +TSPRFLPPTK++ C+
Sbjct  350   YNVQAYLFNDYWEDIGTIKSFFDANLALTAQPPKFSFYDASNPIFTSPRFLPPTKMEKCR  409

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+I+SHGCFL+ C+VEHS+IG RSRL+ GVELKDT++MGAD+YETE+EIA+L A G V
Sbjct  410   IIDSIVSHGCFLKSCSVEHSLIGVRSRLESGVELKDTIIMGADSYETEAEIAALRAQGKV  469

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVGE+T +RN ++DKN RIG  V+I N DGVQE++RP EG YIRSGIT++++ + + D
Sbjct  470   PLGVGEHTTMRNCLVDKNARIGSHVIITNTDGVQEAERPSEGIYIRSGITVVVKNSILKD  529

Query  410   GTVI  399
             GTVI
Sbjct  530   GTVI  533



>ref|XP_002515141.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
 gb|EEF47125.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
Length=528

 Score =   374 bits (961),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 213/244 (87%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +M+VDT+ LGL   DAR  PYIASMG+Y+F+TDVLL+LLRW YPT+NDFGSEI+P + K+
Sbjct  285   SMRVDTSTLGLSISDARKLPYIASMGIYMFKTDVLLKLLRWHYPTANDFGSEIIPLSAKD  344

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NV+AY+F DYWEDIGTIKSF+++NLALT++ P+F+F+DP  P +TSPRFLPPTKI+ C+
Sbjct  345   YNVRAYLFNDYWEDIGTIKSFFDSNLALTDQPPEFQFFDPLKPIFTSPRFLPPTKIERCQ  404

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             +KD+IISHGCFLREC+VEHSI+G RSRL+ GVELKDT+MMGAD Y+TE+E+A+ LA G V
Sbjct  405   VKDSIISHGCFLRECSVEHSIVGVRSRLEYGVELKDTMMMGADYYQTEAEVAASLAGGKV  464

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+ TKI N IIDKN RIGK+VVI NKD V+E+DRP EGFYIRSGIT++++ + I D
Sbjct  465   PIGVGQETKIMNCIIDKNARIGKNVVIANKDHVEEADRPSEGFYIRSGITVVLKNSEIKD  524

Query  410   GTVI  399
             GT+I
Sbjct  525   GTII  528



>ref|XP_010652349.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like isoform X2 [Vitis vinifera]
Length=486

 Score =   372 bits (956),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 209/244 (86%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +M+VDTT LGL P +A+  PYIASMG+Y+F+TDVLL+LLRW YPT+NDFGSE++P A +E
Sbjct  243   SMRVDTTALGLSPVEAKKFPYIASMGIYLFKTDVLLKLLRWSYPTANDFGSEVIPMAAEE  302

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
              NVQAY+F  YWEDIGTIKSF++ANLALT++ PKF FYDP  P +TSPRFLPPTKI+ C+
Sbjct  303   CNVQAYLFNGYWEDIGTIKSFFDANLALTDQPPKFHFYDPLKPIFTSPRFLPPTKIEKCR  362

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + D+IISHGCFLREC+VEHSI+G RSRLD GVE+KDT+MMGAD Y+TE EIA+ LA+G V
Sbjct  363   VMDSIISHGCFLRECSVEHSIVGIRSRLDYGVEMKDTMMMGADYYQTEEEIAAFLAEGKV  422

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+ TKI N IIDKN RIGK+VVI NKD V+E+DRP EGFYIRSGIT++++ + I D
Sbjct  423   PIGVGKGTKIMNCIIDKNARIGKNVVITNKDKVEEADRPSEGFYIRSGITVVLKNSVIMD  482

Query  410   GTVI  399
              T+I
Sbjct  483   ETII  486



>ref|XP_002320247.2| hypothetical protein POPTR_0014s10560g [Populus trichocarpa]
 ref|XP_006375412.1| hypothetical protein POPTR_0014s10560g [Populus trichocarpa]
 gb|EEE98562.2| hypothetical protein POPTR_0014s10560g [Populus trichocarpa]
 gb|ERP53209.1| hypothetical protein POPTR_0014s10560g [Populus trichocarpa]
Length=530

 Score =   373 bits (958),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 166/244 (68%), Positives = 213/244 (87%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +M+VDTT+LGL  Q+A   PYIASMG+Y+F+TDVLL+LLRW YPT+NDFGSEI+P + KE
Sbjct  287   SMKVDTTVLGLSAQEANKFPYIASMGIYMFKTDVLLKLLRWNYPTANDFGSEIIPMSTKE  346

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAY+F  YWEDIGTIKSF++ANLALT++ P F F+DP  P +TSPRFLPPTKI+ C+
Sbjct  347   YNVQAYLFNGYWEDIGTIKSFFDANLALTDQPPNFHFFDPLKPIFTSPRFLPPTKIEKCR  406

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             +KD+I+SHGCFLREC+VE SI+G RSRL+ GVELKDT+M+GAD Y+TE+EIA+ LA+G V
Sbjct  407   VKDSIVSHGCFLRECSVERSIVGVRSRLEYGVELKDTMMIGADYYQTEAEIAASLAEGRV  466

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             P+GVG++TKI N IIDKN RIGK+V+I NK+GVQE++RP EGFYIRSGIT++++ + I D
Sbjct  467   PVGVGKDTKIMNCIIDKNARIGKNVIIANKEGVQEAERPSEGFYIRSGITVVLKNSVIKD  526

Query  410   GTVI  399
             GT+I
Sbjct  527   GTII  530



>ref|XP_010323162.1| PREDICTED: ADP-glucose pyrophosphorylase large subunit isoform 
X2 [Solanum lycopersicum]
Length=544

 Score =   374 bits (959),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 182/270 (67%), Positives = 214/270 (79%), Gaps = 26/270 (10%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDT++LGL  Q+A   PYIASMGVYVF+TDVLL+LL+  YP+ NDFGSEI+P+AVK+
Sbjct  275   AMQVDTSILGLSEQEASNFPYIASMGVYVFKTDVLLKLLKSAYPSCNDFGSEIIPSAVKD  334

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGT+KSF++ANLALT++ PKF+F DPKTPFYTS RFLPPTK+D  +
Sbjct  335   HNVQAYLFNDYWEDIGTVKSFFDANLALTKQPPKFDFNDPKTPFYTSARFLPPTKVDKSR  394

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC ++HSI+G RSRLD GVE KDT+MMGAD Y+TESEIASLLA+G V
Sbjct  395   IVDAIISHGCFLRECNIQHSIVGVRSRLDYGVEFKDTMMMGADYYQTESEIASLLAEGKV  454

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNK--------------------------DGVQ  489
             PIGVG NTKI+  IIDKN +IGKDVVI+NK                           GV+
Sbjct  455   PIGVGPNTKIQKCIIDKNAKIGKDVVILNKQASIFFLKFEIITKVNISLTDAWMLLQGVE  514

Query  488   ESDRPDEGFYIRSGITIIMEKATIPDGTVI  399
             E+DR  EGFYIRSGIT+IM+ ATI DGTVI
Sbjct  515   EADRSAEGFYIRSGITVIMKNATIKDGTVI  544



>ref|XP_002274245.2| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Vitis vinifera]
 ref|XP_010652348.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Vitis vinifera]
Length=514

 Score =   372 bits (956),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 209/244 (86%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +M+VDTT LGL P +A+  PYIASMG+Y+F+TDVLL+LLRW YPT+NDFGSE++P A +E
Sbjct  271   SMRVDTTALGLSPVEAKKFPYIASMGIYLFKTDVLLKLLRWSYPTANDFGSEVIPMAAEE  330

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
              NVQAY+F  YWEDIGTIKSF++ANLALT++ PKF FYDP  P +TSPRFLPPTKI+ C+
Sbjct  331   CNVQAYLFNGYWEDIGTIKSFFDANLALTDQPPKFHFYDPLKPIFTSPRFLPPTKIEKCR  390

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + D+IISHGCFLREC+VEHSI+G RSRLD GVE+KDT+MMGAD Y+TE EIA+ LA+G V
Sbjct  391   VMDSIISHGCFLRECSVEHSIVGIRSRLDYGVEMKDTMMMGADYYQTEEEIAAFLAEGKV  450

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+ TKI N IIDKN RIGK+VVI NKD V+E+DRP EGFYIRSGIT++++ + I D
Sbjct  451   PIGVGKGTKIMNCIIDKNARIGKNVVITNKDKVEEADRPSEGFYIRSGITVVLKNSVIMD  510

Query  410   GTVI  399
              T+I
Sbjct  511   ETII  514



>ref|XP_010914841.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Elaeis guineensis]
Length=537

 Score =   373 bits (958),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 167/243 (69%), Positives = 211/243 (87%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             MQVDTT+LGLPP+ A+   YIASMG+YVF+ DVLL+LLRW YPT+NDFGSEI+P A K++
Sbjct  295   MQVDTTVLGLPPEYAKNYKYIASMGIYVFKIDVLLKLLRWHYPTANDFGSEIIPMAAKDY  354

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
             NVQAY+F  YWEDIGTIKSF++ANL+LT++ PKF F+DPK P +TSPRFLPPTKI+ C++
Sbjct  355   NVQAYLFDGYWEDIGTIKSFFDANLSLTDQSPKFHFHDPKKPIFTSPRFLPPTKIEQCRV  414

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
              D+IISHGCFL +C++EHSI+G RSRL+ GVELKDT+MMGAD Y+TE+E AS LA+G VP
Sbjct  415   VDSIISHGCFLTQCSIEHSIVGVRSRLEYGVELKDTMMMGADYYQTEAERASFLAEGKVP  474

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             +GVGEN+KIRN IIDKN RIGK V+I N D V+E+D+P +GFYIRSGIT++++ + IPDG
Sbjct  475   VGVGENSKIRNCIIDKNGRIGKSVIIANADNVEEADKPTDGFYIRSGITVVLKNSVIPDG  534

Query  407   TVI  399
             T+I
Sbjct  535   TII  537



>emb|CAN67125.1| hypothetical protein VITISV_040166 [Vitis vinifera]
Length=452

 Score =   370 bits (950),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 169/244 (69%), Positives = 209/244 (86%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +M+VDTT LGL P +A+  PYIASMG+Y+F+TDVLL+LLRW YPT+NDFGSE++P A +E
Sbjct  209   SMRVDTTALGLSPVEAKKFPYIASMGIYLFKTDVLLKLLRWSYPTANDFGSEVIPMAAEE  268

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
              NVQAY+F  YWEDIGTIKSF++ANLALT++ PKF FYDP  P +TS RFLPPTKI+ C+
Sbjct  269   CNVQAYLFNGYWEDIGTIKSFFDANLALTDQPPKFHFYDPLKPIFTSSRFLPPTKIEKCR  328

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + D+IISHGCFLREC+VEHSI+G RSRLD GVE+KDT+MMGAD Y+TE EIA+ LA+G V
Sbjct  329   VMDSIISHGCFLRECSVEHSIVGIRSRLDYGVEMKDTMMMGADYYQTEEEIAAFLAEGKV  388

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG++TKI N IIDKN RIGK+VVI NKD V+E+DRP EGFYIRSGIT++++ + I D
Sbjct  389   PIGVGKDTKIMNCIIDKNARIGKNVVITNKDKVEEADRPSEGFYIRSGITVVLKNSVIMD  448

Query  410   GTVI  399
              T+I
Sbjct  449   ETII  452



>gb|AEV40472.1| ADP-glucose pyrophosphorylase 2 [Spirodela polyrhiza]
 gb|AEV40473.1| ADP-glucose pyrophosphorylase 2 [Spirodela polyrhiza]
Length=536

 Score =   371 bits (953),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 168/243 (69%), Positives = 210/243 (86%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             MQVDT++LGL PQDA+  PYIASMG+Y+F+TDVLL+LLR +YP SNDFGSEI+P A K++
Sbjct  294   MQVDTSVLGLSPQDAKRFPYIASMGIYLFKTDVLLKLLRSQYPHSNDFGSEIIPMAAKDY  353

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
             NVQAY+F  YWEDIGTIKSF++ANLAL ++  KF FYDP  P +TSPRFLPPTKI+ C++
Sbjct  354   NVQAYLFNGYWEDIGTIKSFFDANLALADQPAKFHFYDPSKPIFTSPRFLPPTKIEKCRV  413

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
              ++I+SHGCFL ECTVEHSIIG RSRL+ G EL DT++MGAD Y+TE+EIAS+LA+G VP
Sbjct  414   LNSIVSHGCFLNECTVEHSIIGVRSRLESGAELVDTMVMGADYYQTEAEIASILAEGKVP  473

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             IG+G NTKIRN IIDKN +IG+DVVI N + V+E++RP EGFYIRSGIT++++ ATIP+G
Sbjct  474   IGIGRNTKIRNCIIDKNAKIGRDVVIANSEKVEEAERPSEGFYIRSGITVVVKNATIPNG  533

Query  407   TVI  399
             TVI
Sbjct  534   TVI  536



>ref|XP_003545270.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Glycine max]
Length=523

 Score =   371 bits (952),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/244 (70%), Positives = 205/244 (84%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM VDTTLLGL  ++A+  PYIA MGV VFRT+ LL+LLRW  P+ NDFGSEI+P+A+++
Sbjct  280   AMHVDTTLLGLTAEEAQTYPYIAPMGVSVFRTETLLKLLRWSCPSCNDFGSEIIPSALRD  339

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H VQAY+FRDYW+DIGTIKSF+ ANL LT++ P FEFYD ++PF+TSPRFLPPTK   CK
Sbjct  340   HKVQAYMFRDYWKDIGTIKSFFEANLELTKQSPNFEFYDQESPFFTSPRFLPPTKAIKCK  399

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFL EC V+HSI+G RSRL+ G EL+DT+MMGAD Y+T+SEIA+LL +G V
Sbjct  400   IVDAIISHGCFLSECRVQHSIVGVRSRLESGSELQDTMMMGADYYQTDSEIATLLKEGKV  459

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRN IIDKN RIG++V+I N DGVQE+DRP EGFYIRSGI ++   ATI D
Sbjct  460   PIGVGENTKIRNCIIDKNARIGRNVIIANTDGVQEADRPMEGFYIRSGIVVVANNATIED  519

Query  410   GTVI  399
             GTVI
Sbjct  520   GTVI  523



>gb|KHN20962.1| Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic 
[Glycine soja]
Length=523

 Score =   371 bits (952),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/244 (70%), Positives = 205/244 (84%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM VDTTLLGL  ++A+  PYIA MGV VFRT+ LL+LLRW  P+ NDFGSEI+P+A+++
Sbjct  280   AMHVDTTLLGLTAEEAQTYPYIAPMGVSVFRTETLLKLLRWSCPSCNDFGSEIIPSALRD  339

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H VQAY+FRDYW+DIGTIKSF+ ANL LT++ P FEFYD ++PF+TSPRFLPPTK   CK
Sbjct  340   HKVQAYMFRDYWKDIGTIKSFFEANLELTKQSPNFEFYDQESPFFTSPRFLPPTKAIKCK  399

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFL EC V+HSI+G RSRL+ G EL+DT+MMGAD Y+T+SEIA+LL +G V
Sbjct  400   IVDAIISHGCFLSECRVQHSIVGVRSRLESGSELQDTMMMGADYYQTDSEIATLLKEGKV  459

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKIRN IIDKN RIG++V+I N DGVQE+DRP EGFYIRSGI ++   ATI D
Sbjct  460   PIGVGENTKIRNCIIDKNARIGRNVIIANTDGVQEADRPMEGFYIRSGIVVVANNATIED  519

Query  410   GTVI  399
             GTVI
Sbjct  520   GTVI  523



>gb|KDP28372.1| hypothetical protein JCGZ_14143 [Jatropha curcas]
Length=472

 Score =   369 bits (947),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 171/244 (70%), Positives = 209/244 (86%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +M+VDTT LGL   DAR  PYIASMG+Y+F+TDVLL LLRW +PT+NDFGSEI+P + K+
Sbjct  229   SMKVDTTALGLSASDARKFPYIASMGIYLFKTDVLLTLLRWHHPTANDFGSEIIPMSAKD  288

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAY+F  YWEDIGTIKSF++ANLALT++ PKF F+DP  P +TSPRFLPPTKI+ C+
Sbjct  289   YNVQAYLFNGYWEDIGTIKSFFDANLALTDQPPKFHFFDPLKPIFTSPRFLPPTKIEKCR  348

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I+ +IIS GCFLREC+VEHSI+G RSRL+ GVELKDT+MMG+D YETE+EIAS LA+G V
Sbjct  349   IQGSIISDGCFLRECSVEHSIVGIRSRLEYGVELKDTMMMGSDYYETEAEIASSLAEGKV  408

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKI N IIDKN RIG++VVI NKD VQE+ RP EGFYIRSGIT++M+ + I D
Sbjct  409   PIGVGKNTKIINCIIDKNARIGENVVIANKDHVQEAVRPSEGFYIRSGITVVMKNSVIKD  468

Query  410   GTVI  399
             GT+I
Sbjct  469   GTII  472



>ref|XP_012083052.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Jatropha curcas]
Length=519

 Score =   370 bits (950),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 171/244 (70%), Positives = 209/244 (86%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +M+VDTT LGL   DAR  PYIASMG+Y+F+TDVLL LLRW +PT+NDFGSEI+P + K+
Sbjct  276   SMKVDTTALGLSASDARKFPYIASMGIYLFKTDVLLTLLRWHHPTANDFGSEIIPMSAKD  335

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAY+F  YWEDIGTIKSF++ANLALT++ PKF F+DP  P +TSPRFLPPTKI+ C+
Sbjct  336   YNVQAYLFNGYWEDIGTIKSFFDANLALTDQPPKFHFFDPLKPIFTSPRFLPPTKIEKCR  395

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I+ +IIS GCFLREC+VEHSI+G RSRL+ GVELKDT+MMG+D YETE+EIAS LA+G V
Sbjct  396   IQGSIISDGCFLRECSVEHSIVGIRSRLEYGVELKDTMMMGSDYYETEAEIASSLAEGKV  455

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKI N IIDKN RIG++VVI NKD VQE+ RP EGFYIRSGIT++M+ + I D
Sbjct  456   PIGVGKNTKIINCIIDKNARIGENVVIANKDHVQEAVRPSEGFYIRSGITVVMKNSVIKD  515

Query  410   GTVI  399
             GT+I
Sbjct  516   GTII  519



>gb|AEV91541.1| ADP-glucose pyrophosphorylase [Cucurbita moschata]
Length=420

 Score =   367 bits (941),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 197/217 (91%), Gaps = 0/217 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQVDTT+LGL  QDAR NPYIASMGVYVFRTD+LL+LL W YP+ NDFGSEI+P+AVK+
Sbjct  163   AMQVDTTVLGLSDQDARKNPYIASMGVYVFRTDLLLKLLTWTYPSCNDFGSEIIPSAVKD  222

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             + VQAY+F DYWEDIGT+KSF++ANLALTE+ PKFEFYDPKTPFYTSPRFLPP+K++  +
Sbjct  223   YKVQAYLFNDYWEDIGTVKSFFDANLALTEQPPKFEFYDPKTPFYTSPRFLPPSKVEKSR  282

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLREC+VEHSI+G RSRL+ GVELKDT+MMGAD Y+TESEIASLLA+G +
Sbjct  283   IVDAIISHGCFLRECSVEHSIVGVRSRLEYGVELKDTMMMGADYYQTESEIASLLAEGKI  342

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  480
             PIG+GENTKIRN IIDKN +IGK+VVI N DGVQE+D
Sbjct  343   PIGIGENTKIRNCIIDKNAKIGKNVVIANTDGVQEAD  379



>gb|KCW81736.1| hypothetical protein EUGRSUZ_C03089 [Eucalyptus grandis]
Length=378

 Score =   365 bits (936),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 173/256 (68%), Positives = 209/256 (82%), Gaps = 16/256 (6%)
 Frame = -3

Query  1118  DTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEHNVQ  939
             D+TLLGL  QDA   PYIASMG+YVF+TDVLL+LLRW YP+ NDFGSEI+P+AV EHNVQ
Sbjct  123   DSTLLGLSKQDAVNLPYIASMGIYVFKTDVLLKLLRWSYPSCNDFGSEIIPSAVAEHNVQ  182

Query  938   AYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKIKDA  759
             AY+F DYWEDIGTIKSF++ NLA+TE+ PKFEFYD +TPFYTSPRFLPP+K++ C+I  A
Sbjct  183   AYLFNDYWEDIGTIKSFFDTNLAVTEQPPKFEFYDLQTPFYTSPRFLPPSKVEKCRIVGA  242

Query  758   IISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVPIGV  579
             IISHGCFL+EC++EHSI+G R RLD  VE KDT+MMG++ Y+TE+EIASLLA G VPIGV
Sbjct  243   IISHGCFLQECSIEHSIVGVRLRLDYDVEFKDTVMMGSNYYQTEAEIASLLAQGKVPIGV  302

Query  578   GENTKIR----------------NAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSG  447
             G+NTKIR                  + +KN RIGK+VVI N DGVQE+DRP+EGFYIRSG
Sbjct  303   GQNTKIRIVRNPSTDKFPCFSFLKELHNKNARIGKNVVIHNTDGVQEADRPEEGFYIRSG  362

Query  446   ITIIMEKATIPDGTVI  399
             IT+I++ ATI DGTV+
Sbjct  363   ITVILKNATIKDGTVV  378



>ref|XP_009394804.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Musa acuminata subsp. malaccensis]
Length=538

 Score =   370 bits (950),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 174/244 (71%), Positives = 203/244 (83%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+ + T   L  QD    PYIASMGVYVF  + LL LLRW YP +NDFG +ILP+AVK 
Sbjct  295   AMKDENTFFRLSHQDTIRYPYIASMGVYVFNRNTLLELLRWTYPKANDFGLDILPSAVKA  354

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +  QAYIF DYW+DIGTIKSFY+ANLALTE+ PKF+FYDP+TP +TSPRFLPPTKI+ C+
Sbjct  355   YKAQAYIFEDYWDDIGTIKSFYDANLALTEQPPKFQFYDPRTPIFTSPRFLPPTKIEKCR  414

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I D+IISHGCFL EC++EHSI+G RSR+D G ELKD LM+GAD YETE+E+AS+LA+G V
Sbjct  415   ILDSIISHGCFLHECSIEHSIVGVRSRIDYGAELKDALMLGADLYETEAELASILAEGKV  474

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG+NTKIRN IID N RIGK+VVI NKDGVQE+DRP EGFYIR GITIIM+ ATI D
Sbjct  475   PIGVGQNTKIRNCIIDMNARIGKNVVIANKDGVQEADRPSEGFYIRFGITIIMKNATIKD  534

Query  410   GTVI  399
             GTVI
Sbjct  535   GTVI  538



>ref|XP_003549440.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Glycine max]
Length=524

 Score =   369 bits (947),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 206/244 (84%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM VDTTLLGL  ++A+  PYIA MGV VFRT+ LL+LLRW  P+ NDFGSEI+P+A+++
Sbjct  281   AMHVDTTLLGLTAEEAQTYPYIAPMGVSVFRTETLLKLLRWSCPSCNDFGSEIIPSALRD  340

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H VQAY+FRDYW+DIGTIKSF+ ANL LT++ P FEFYD +TPF+TSPRFLPPTK   CK
Sbjct  341   HKVQAYMFRDYWKDIGTIKSFFEANLELTKQSPNFEFYDQETPFFTSPRFLPPTKAIKCK  400

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFL E  V+HSI+G RSRL+ G EL+DT+MMGAD Y+T+SEIA+LL +G V
Sbjct  401   IMDAIISHGCFLSESRVQHSIVGVRSRLESGSELQDTMMMGADYYQTDSEIATLLEEGKV  460

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENT+IRN IIDKN RIG++V+I N DGVQE+DRP EGFYIRSGI ++++ ATI D
Sbjct  461   PIGVGENTRIRNCIIDKNARIGRNVIIANTDGVQEADRPAEGFYIRSGIVVVVKNATIED  520

Query  410   GTVI  399
             GTVI
Sbjct  521   GTVI  524



>gb|KHN12692.1| Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic 
[Glycine soja]
Length=524

 Score =   368 bits (944),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 169/244 (69%), Positives = 206/244 (84%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM VDTTLLGL  ++A+  PYIA MGV VFRT+ LL+LLRW  P+ NDFGSEI+P+A+++
Sbjct  281   AMHVDTTLLGLTAEEAQTYPYIAPMGVSVFRTETLLKLLRWSCPSCNDFGSEIIPSALRD  340

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H VQAY+FRDYW+DIGTIKSF+ ANL LT++ P FEFYD ++PF+TSPRFLPPTK   CK
Sbjct  341   HKVQAYMFRDYWKDIGTIKSFFEANLELTKQSPNFEFYDQESPFFTSPRFLPPTKAIKCK  400

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFL E  V+HSI+G RSRL+ G EL+DT+MMGAD Y+T+SEIA+LL +G V
Sbjct  401   IMDAIISHGCFLSESRVQHSIVGVRSRLESGSELQDTMMMGADYYQTDSEIATLLEEGKV  460

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENT+IRN IIDKN RIG++V+I N DGVQE+DRP EGFYIRSGI ++++ ATI D
Sbjct  461   PIGVGENTRIRNCIIDKNARIGRNVIIANTDGVQEADRPAEGFYIRSGIVVVVKNATIED  520

Query  410   GTVI  399
             GTVI
Sbjct  521   GTVI  524



>ref|XP_006654841.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Oryza brachyantha]
Length=519

 Score =   367 bits (943),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 171/244 (70%), Positives = 205/244 (84%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDT+ L     D    PYIASMGVYVF+ +VLL LL+ RY   +DFGSEILP A+ E
Sbjct  276   AMKVDTSFLNFAIDDPTKYPYIASMGVYVFKREVLLNLLKSRYSELHDFGSEILPRALHE  335

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTI+SF++AN+AL E+ PKFEFYDPKTPF+TSPR+LPPTK D C+
Sbjct  336   HNVQAYVFADYWEDIGTIRSFFDANMALCEQPPKFEFYDPKTPFFTSPRYLPPTKSDKCR  395

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLRECT+EHSI+G RSRL+ G ELK+T+MMGAD YETE EI+ LL++G V
Sbjct  396   IKDAIISHGCFLRECTIEHSIVGVRSRLNSGCELKNTMMMGADLYETEDEISRLLSEGKV  455

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKI N IID N R+G++VVI N +GVQE+DRP+EG+YIRSGI +I++ ATI D
Sbjct  456   PIGVGENTKISNCIIDMNARVGRNVVIKNSEGVQEADRPEEGYYIRSGIVVILKNATIKD  515

Query  410   GTVI  399
             GTVI
Sbjct  516   GTVI  519



>emb|CAA32532.1| ADP-glucose pyrophosophorylase (1 is 2nd base in codon) [Triticum 
aestivum]
 prf||1609236B ADP glucose pyrophosphatase AGA.3
Length=296

 Score =   359 bits (922),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 167/244 (68%), Positives = 202/244 (83%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDT+ L     D    PYIASMGVYVF+ DVLL LL+ RY   +DFGSEILP A+ +
Sbjct  53    AMKVDTSFLNFAIDDPAKYPYIASMGVYVFKRDVLLNLLKSRYAELHDFGSEILPRALHD  112

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTI+SF++AN++L E+ PKFEFYDPKTPF+TSPR+LPPTK D C+
Sbjct  113   HNVQAYVFTDYWEDIGTIRSFFDANMSLCEQPPKFEFYDPKTPFFTSPRYLPPTKSDKCR  172

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IK+AII HGCFLREC +EHSIIG  SRL+ G ELK+ +MMGAD+YETE EI+ L+++G V
Sbjct  173   IKEAIILHGCFLRECKIEHSIIGVPSRLNSGSELKNAMMMGADSYETEDEISRLMSEGKV  232

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKI N IID N RIG+DVVI NK+GVQE+DRP+EG+YIRSGI +I + ATI D
Sbjct  233   PIGVGENTKISNCIIDMNARIGRDVVISNKEGVQEADRPEEGYYIRSGIVVIQKNATIKD  292

Query  410   GTVI  399
             GTV+
Sbjct  293   GTVV  296



>ref|XP_007160732.1| hypothetical protein PHAVU_001G012500g [Phaseolus vulgaris]
 gb|ESW32726.1| hypothetical protein PHAVU_001G012500g [Phaseolus vulgaris]
Length=520

 Score =   367 bits (942),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 165/243 (68%), Positives = 208/243 (86%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             M+VDT LLGL  +DA   P+I+ MGV+VFRT+VLL+LLRW  P+ ND GSE++P+++++H
Sbjct  278   MRVDTRLLGLSAEDAEKYPFISPMGVFVFRTEVLLKLLRWSCPSCNDLGSELIPSSLRDH  337

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
              VQAY+F +YW D+GTIKSF  ANL LTE+ PKFEFYDPKTPF+TSP FLPPTK+  CK+
Sbjct  338   KVQAYMFNEYWRDMGTIKSFLEANLELTEQSPKFEFYDPKTPFFTSPGFLPPTKLIKCKL  397

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
              DAIISHGCFL +C V+HSI+G+RSRL+ G EL+DT+MMGAD Y+T+SEIA+LLA+G VP
Sbjct  398   VDAIISHGCFLNKCKVQHSIVGQRSRLEAGSELQDTMMMGADYYQTDSEIATLLAEGKVP  457

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             +GVGENTKIRN IIDKN +IGK+V+I N DGVQE+D+P+EGFYIRSGI +I++ ATI DG
Sbjct  458   VGVGENTKIRNCIIDKNAKIGKNVIIANADGVQEADKPEEGFYIRSGIVVIVKNATIKDG  517

Query  407   TVI  399
             TVI
Sbjct  518   TVI  520



>sp|P12299.2|GLGL2_WHEAT RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic; AltName: Full=ADP-glucose 
pyrophosphorylase; AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate 
adenyl transferase; Flags: Precursor [Triticum aestivum]
 emb|CAA79980.1| ADP-glucose pyrophosphorylase large subunit [Triticum aestivum]
 gb|ABG88200.1| ADP-glucose pyrophosphorylase large subunit [Triticum aestivum]
Length=522

 Score =   367 bits (942),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 204/244 (84%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDT+ L     D    PYIASMGVYVF+ DVLL LL+ RY   +DFGSEILP A+ +
Sbjct  279   AMKVDTSFLNFAIDDPAKYPYIASMGVYVFKRDVLLNLLKSRYAELHDFGSEILPRALHD  338

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTI+SF++AN+AL E+ PKFEFYDPKTPF+TSPR+LPPTK D C+
Sbjct  339   HNVQAYVFTDYWEDIGTIRSFFDANMALCEQPPKFEFYDPKTPFFTSPRYLPPTKSDKCR  398

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IK+AIISHGCFLREC +EHSIIG RSRL+ G ELK+ +MMGAD+YETE EI+ L+++G V
Sbjct  399   IKEAIISHGCFLRECKIEHSIIGVRSRLNSGSELKNAMMMGADSYETEDEISRLMSEGKV  458

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKI N IID N RIG+DVVI NK+GVQE+DRP+EG+YIRSGI +I + ATI D
Sbjct  459   PIGVGENTKISNCIIDMNARIGRDVVISNKEGVQEADRPEEGYYIRSGIVVIQKNATIKD  518

Query  410   GTVI  399
             GTV+
Sbjct  519   GTVV  522



>gb|AHA11391.1| cytosolic ADP-glucose pyrophosphorylase large subunit [Hordeum 
vulgare]
Length=523

 Score =   367 bits (942),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 204/244 (84%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDT+ L     D    PYIASMGVYVF+ DVLL LL+ RY   +DFGSEILP A+ +
Sbjct  280   AMKVDTSFLNFAIDDPAKYPYIASMGVYVFKRDVLLNLLKSRYAELHDFGSEILPRALHD  339

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTI+SF++AN+AL E+ PKFEFYDPKTPF+TSPR+LPPTK D C+
Sbjct  340   HNVQAYVFTDYWEDIGTIRSFFDANMALCEQPPKFEFYDPKTPFFTSPRYLPPTKSDKCR  399

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IK+AIISHGCFLREC +EHSIIG RSRL+ G ELK+ +MMGAD+YETE EI+ L+++G V
Sbjct  400   IKEAIISHGCFLRECKIEHSIIGVRSRLNSGSELKNAMMMGADSYETEDEISRLMSEGKV  459

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKI N IID N RIG+DVVI NK+GVQE+DRP+EG+YIRSGI +I + ATI D
Sbjct  460   PIGVGENTKISNCIIDMNARIGRDVVISNKEGVQEADRPEEGYYIRSGIVVIQKNATIKD  519

Query  410   GTVI  399
             GTV+
Sbjct  520   GTVV  523



>sp|P30524.2|GLGL1_HORVU RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
1, chloroplastic/amyloplastic; AltName: Full=ADP-glucose 
pyrophosphorylase; AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate 
adenyl transferase; AltName: Full=BEPL; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA47626.1| glucose-1-phosphate adenylyltransferase [Hordeum vulgare subsp. 
vulgare]
 emb|CAX51355.1| large subunit of ADP-glucose pyrophosphorylase [Hordeum vulgare 
subsp. vulgare]
 dbj|BAK04629.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93393.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93437.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AHA11390.1| cytosolic ADP-glucose pyrophosphorylase large subunit [Hordeum 
vulgare]
Length=523

 Score =   367 bits (942),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 204/244 (84%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDT+ L     D    PYIASMGVYVF+ DVLL LL+ RY   +DFGSEILP A+ +
Sbjct  280   AMKVDTSFLNFAIDDPAKYPYIASMGVYVFKRDVLLNLLKSRYAELHDFGSEILPRALHD  339

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTI+SF++AN+AL E+ PKFEFYDPKTPF+TSPR+LPPTK D C+
Sbjct  340   HNVQAYVFTDYWEDIGTIRSFFDANMALCEQPPKFEFYDPKTPFFTSPRYLPPTKSDKCR  399

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IK+AIISHGCFLREC +EHSIIG RSRL+ G ELK+ +MMGAD+YETE EI+ L+++G V
Sbjct  400   IKEAIISHGCFLRECKIEHSIIGVRSRLNSGSELKNAMMMGADSYETEDEISRLMSEGKV  459

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKI N IID N RIG+DVVI NK+GVQE+DRP+EG+YIRSGI +I + ATI D
Sbjct  460   PIGVGENTKISNCIIDMNARIGRDVVISNKEGVQEADRPEEGYYIRSGIVVIQKNATIKD  519

Query  410   GTVI  399
             GTV+
Sbjct  520   GTVV  523



>ref|NP_001056424.2| Os05g0580000 [Oryza sativa Japonica Group]
 gb|AAU10700.1| putative glucose-1-phosphate adenylyltransferase [Oryza sativa 
Japonica Group]
 gb|EAY99171.1| hypothetical protein OsI_21129 [Oryza sativa Indica Group]
 gb|ACA50479.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 dbj|BAG94825.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64817.1| hypothetical protein OsJ_19673 [Oryza sativa Japonica Group]
 dbj|BAF18338.2| Os05g0580000 [Oryza sativa Japonica Group]
 gb|ACY56044.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56045.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56046.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56047.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56048.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56049.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56050.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56051.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56052.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56053.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56054.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56055.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56056.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56057.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
Length=519

 Score =   367 bits (941),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/244 (70%), Positives = 203/244 (83%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDT+ L     D    PYIASMGVYVF+ DVLL LL+ RY   +DFGSEILP A+ E
Sbjct  276   AMKVDTSFLNFAIDDPTKFPYIASMGVYVFKRDVLLNLLKSRYAELHDFGSEILPRALHE  335

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTI+SF++AN+AL E+ PKFEFYDPKTPF+TSPR+LPPTK D C+
Sbjct  336   HNVQAYVFADYWEDIGTIRSFFDANMALCEQPPKFEFYDPKTPFFTSPRYLPPTKSDKCR  395

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IKDAIISHGCFLRECT+EHSI+G RSRL+   ELK+T+MMGAD YETE EI+ LL++G V
Sbjct  396   IKDAIISHGCFLRECTIEHSIVGVRSRLNSACELKNTMMMGADLYETEDEISRLLSEGKV  455

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKI N IID N R+G++VVI N +GVQESDRP+EG+YIRSGI +I++ ATI D
Sbjct  456   PIGVGENTKINNCIIDMNARVGRNVVITNSEGVQESDRPEEGYYIRSGIVVILKNATIKD  515

Query  410   GTVI  399
             G VI
Sbjct  516   GKVI  519



>ref|XP_008648319.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic isoform X1 [Zea mays]
 ref|XP_008648320.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic isoform X1 [Zea mays]
 gb|ACG34981.1| glucose-1-phosphate adenylyltransferase large subunit [Zea mays]
 gb|ACN28262.1| unknown [Zea mays]
 gb|AFW79324.1| glucose-1-phosphate adenylyltransferase large subunit 2, /amyloplastic 
Precursor(ADP-glucose pyrophosphorylase) isoform 1 
[Zea mays]
 gb|AFW79325.1| glucose-1-phosphate adenylyltransferase large subunit 2, /amyloplastic 
Precursor(ADP-glucose pyrophosphorylase) isoform 2 
[Zea mays]
Length=518

 Score =   366 bits (939),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/243 (70%), Positives = 202/243 (83%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             M+VDT+ L          PYIASMGVYVF+ DVLL LL+ RY   +DFGSEILP A+ EH
Sbjct  276   MKVDTSFLNFAIDSPAEYPYIASMGVYVFKRDVLLDLLKSRYAELHDFGSEILPKALHEH  335

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
             NVQAY+F DYWEDIGTI+SF++AN+AL E+ PKFEFYDPKTPF+TSPR+LPPTK D C+I
Sbjct  336   NVQAYVFTDYWEDIGTIRSFFDANMALCEQPPKFEFYDPKTPFFTSPRYLPPTKSDKCRI  395

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
             KDAIISHGCFLREC +EHSI+G RSRL+ G ELK+T+MMGAD YETE EI+ LLA+G VP
Sbjct  396   KDAIISHGCFLRECAIEHSIVGVRSRLNSGCELKNTMMMGADLYETEDEISRLLAEGKVP  455

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             IGVGENTKI N IID N R+G++V I NK+GVQE+DRPDEG+YIRSGI ++++ ATI DG
Sbjct  456   IGVGENTKISNCIIDMNARVGRNVSITNKEGVQEADRPDEGYYIRSGIVVVLKNATIKDG  515

Query  407   TVI  399
             TVI
Sbjct  516   TVI  518



>prf||1909370A ADP glucose pyrophosphorylase:SUBUNIT=L
Length=527

 Score =   365 bits (938),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 204/244 (84%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AM+VDT+ L     D    PYIASMGVYVF+ DVLL LL+ RY   +DFGSEILP A+ +
Sbjct  284   AMKVDTSFLNFAIDDPAKYPYIASMGVYVFKRDVLLNLLKSRYAELHDFGSEILPRALHD  343

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             HNVQAY+F DYWEDIGTI+SF++AN+AL E+ PKFEFYDPKTPF+TSPR+LPPTK D C+
Sbjct  344   HNVQAYVFTDYWEDIGTIRSFFDANMALCEQPPKFEFYDPKTPFFTSPRYLPPTKSDKCR  403

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             IK+AIISHGCFLREC +EHSIIG RSRL+ G ELK+ +MMGAD+YETE EI+ L+++G V
Sbjct  404   IKEAIISHGCFLRECKIEHSIIGVRSRLNSGSELKNAMMMGADSYETEDEISRLMSEGKV  463

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVGENTKI N IID N RIG+DVVI NK+GVQE+DRP+EG+YIRSGI +I + ATI D
Sbjct  464   PIGVGENTKISNCIIDMNARIGRDVVISNKEGVQEADRPEEGYYIRSGIVVIQKNATIKD  523

Query  410   GTVI  399
             GTV+
Sbjct  524   GTVV  527



>ref|XP_006577921.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X3 [Glycine max]
Length=489

 Score =   364 bits (934),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 189/211 (90%), Gaps = 0/211 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             AMQ DT+LLGL PQDA  +PYIASMGVYVF+TDVLL LL+WRYPTSNDFGSEI+PAAV++
Sbjct  276   AMQADTSLLGLSPQDALKSPYIASMGVYVFKTDVLLNLLKWRYPTSNDFGSEIIPAAVRD  335

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             H+VQ+Y F DYWEDIGTIKSFY+ANLALTEE  KFEFYDPK P YTSP FLPPTKID C+
Sbjct  336   HDVQSYFFEDYWEDIGTIKSFYDANLALTEESHKFEFYDPKIPIYTSPGFLPPTKIDKCQ  395

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             I DAIISHGCFLRECTV+HSI+GERSRLD GVEL DT+MMGAD Y+TESEIASLLA+G V
Sbjct  396   IVDAIISHGCFLRECTVQHSIVGERSRLDYGVELLDTVMMGADYYQTESEIASLLAEGKV  455

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKD  498
             PIG+G NTKIRN IIDKN +IGKDV+I NKD
Sbjct  456   PIGIGRNTKIRNCIIDKNAKIGKDVIIANKD  486



>gb|EPS60253.1| glucose-1-phosphate adenylyltransferase, partial [Genlisea aurea]
Length=481

 Score =   363 bits (933),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 173/257 (67%), Positives = 213/257 (83%), Gaps = 13/257 (5%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +M++DT++LGL  ++A   PY ASMGVYVF+T+VLL+LL+W YP+ NDFGSEI+P AVK+
Sbjct  225   SMRIDTSVLGLSHEEAARFPYAASMGVYVFKTEVLLKLLKWEYPSCNDFGSEIIPLAVKD  284

Query  950   H-NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNC  774
             + NVQAY+F DYWEDIGTIKSF++ANLALTE+ PKF F DPKTPFYTSP +LPPTK++ C
Sbjct  285   YYNVQAYLFNDYWEDIGTIKSFFDANLALTEQSPKFSFNDPKTPFYTSPLYLPPTKVEKC  344

Query  773   K------------IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYET  630
             +            I DAI+SHGCFLREC+VE+SI+G RSRLDCGVELKDT+MMGAD Y+T
Sbjct  345   RASERKTTRERLLIIDAIVSHGCFLRECSVEYSIVGVRSRLDCGVELKDTIMMGADYYQT  404

Query  629   ESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRS  450
             ++EIASLLA G VPIGVG NTKI   IIDKN RIGKDVVI N+D V+E++R ++GFYIRS
Sbjct  405   DAEIASLLAQGKVPIGVGRNTKISKCIIDKNARIGKDVVIGNRDNVEEAERGEDGFYIRS  464

Query  449   GITIIMEKATIPDGTVI  399
             GITII++ +TI DG VI
Sbjct  465   GITIILKNSTIKDGMVI  481



>gb|ADE77153.1| unknown [Picea sitchensis]
Length=220

 Score =   353 bits (906),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = -3

Query  1058  MGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEHNVQAYIFRDYWEDIGTIKSFYNA  879
             MG+YVFRTDVLL LLRWRYPT+NDFGSEI+PA  K++NVQAY+F DYWEDIGTIKSF++A
Sbjct  1     MGIYVFRTDVLLNLLRWRYPTANDFGSEIIPACTKDYNVQAYLFNDYWEDIGTIKSFFDA  60

Query  878   NLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGE  699
             NLAL  + PKF FYDP  P +TSP+FLPPTKI+ C++ D+IISHGCFL+ECTVEHS++G 
Sbjct  61    NLALAAQPPKFHFYDPMKPIFTSPQFLPPTKIEKCQVLDSIISHGCFLQECTVEHSVVGI  120

Query  698   RSRLDCGVELKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKD  519
             RSRL+ G ELK+T+MMGAD YETE+EIASLLA+G VPIGVGENTKIRN IIDKN RIGK+
Sbjct  121   RSRLEYGAELKETMMMGADYYETEAEIASLLAEGKVPIGVGENTKIRNCIIDKNARIGKN  180

Query  518   VVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDGTVI  399
             VVI N D V+E++RP EG+YIRSGIT+I++ + I DGTVI
Sbjct  181   VVIANSDNVEEAERPSEGYYIRSGITVILKNSRIKDGTVI  220



>gb|KCW46725.1| hypothetical protein EUGRSUZ_K00547 [Eucalyptus grandis]
Length=445

 Score =   360 bits (925),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 163/244 (67%), Positives = 208/244 (85%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +M+VDT + GL  QD    PY+ASMG+Y+F+TDVLL+LLR  YPT+NDFGSE++P A ++
Sbjct  202   SMRVDTAIPGLSAQDVNRFPYLASMGIYLFKTDVLLKLLRQDYPTANDFGSEVIPMAARD  261

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             ++VQAY+F  YWEDIGTIKSF++ANLALT++ PKF FYDP+ P +TSPRFLPPTKI+ C+
Sbjct  262   YHVQAYLFDGYWEDIGTIKSFFDANLALTDQPPKFHFYDPQKPIFTSPRFLPPTKIEKCQ  321

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + D+IISHGCFLREC+V+HSI+G RSRL+ GVE+KDT+MMGAD Y+TE+E A+ LA+G V
Sbjct  322   VIDSIISHGCFLRECSVQHSIVGVRSRLEYGVEIKDTMMMGADYYQTEAERAAFLAEGQV  381

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIGVG +TKIRN IIDKN RIGK+VVI+NK  V E+DRP +GFYIRSGIT+I++ + IPD
Sbjct  382   PIGVGRDTKIRNCIIDKNARIGKNVVIVNKGNVTEADRPSDGFYIRSGITVILKNSVIPD  441

Query  410   GTVI  399
             GT I
Sbjct  442   GTTI  445



>ref|XP_006658430.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like, partial [Oryza brachyantha]
Length=426

 Score =   359 bits (922),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 164/244 (67%), Positives = 206/244 (84%), Gaps = 0/244 (0%)
 Frame = -3

Query  1130  AMQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKE  951
             +MQ+D  + GL P+ A  + Y+ASMG+YVFRTD+LLRLLR  YPT+NDFGSE++P A K+
Sbjct  183   SMQLDMGIFGLSPEIADTHKYMASMGIYVFRTDILLRLLRGHYPTANDFGSEVIPMAAKD  242

Query  950   HNVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCK  771
             +NVQAY+F  YWEDIGTIKSF+ ANLALT++ P F FYDP  P +TSP+FLPPTK++NCK
Sbjct  243   YNVQAYLFDGYWEDIGTIKSFFEANLALTDQSPNFYFYDPVKPIFTSPKFLPPTKVENCK  302

Query  770   IKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNV  591
             + ++I+SHGCFL EC+VEHS+IG RSRL+ GV+LKDT+MMGAD Y+TE+E  S L+DG V
Sbjct  303   VVNSIVSHGCFLTECSVEHSVIGVRSRLEPGVQLKDTMMMGADYYQTEAERFSELSDGKV  362

Query  590   PIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPD  411
             PIG+GENTKIRN IIDKN RIGK+V+I N + VQE++RP EGFYIRSGIT+I++ A IPD
Sbjct  363   PIGLGENTKIRNCIIDKNARIGKNVLITNSENVQEAERPLEGFYIRSGITVILKNAVIPD  422

Query  410   GTVI  399
             GTVI
Sbjct  423   GTVI  426



>ref|XP_004961109.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Setaria italica]
Length=518

 Score =   362 bits (929),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 168/243 (69%), Positives = 202/243 (83%), Gaps = 0/243 (0%)
 Frame = -3

Query  1127  MQVDTTLLGLPPQDARLNPYIASMGVYVFRTDVLLRLLRWRYPTSNDFGSEILPAAVKEH  948
             M+VDT+ L     D    PYIASMGVYVF+ DVLL LL+ RY   +DFGSEILP A+ EH
Sbjct  276   MKVDTSFLNFAIDDPSKYPYIASMGVYVFKRDVLLNLLKSRYSQLHDFGSEILPKALHEH  335

Query  947   NVQAYIFRDYWEDIGTIKSFYNANLALTEEFPKFEFYDPKTPFYTSPRFLPPTKIDNCKI  768
             NVQAY+F DYWEDIGT++SF++AN+AL E+ PKFEFYDPKTPF+TSPR+LPPTK D  +I
Sbjct  336   NVQAYVFTDYWEDIGTLRSFFDANMALCEQPPKFEFYDPKTPFFTSPRYLPPTKSDKSRI  395

Query  767   KDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMMGADNYETESEIASLLADGNVP  588
             KDAIISHGCFLRECT+EHSI+G RSRL+ G ELK+T+MMGAD YETE EI+ LL++G VP
Sbjct  396   KDAIISHGCFLRECTIEHSIVGVRSRLNSGCELKNTMMMGADLYETEDEISRLLSEGKVP  455

Query  587   IGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDG  408
             IGVGENTKI N IID N R+G++V I N +GVQE+DRP+EG+YIRSGI +I++ ATI DG
Sbjct  456   IGVGENTKISNCIIDMNARVGRNVSITNSEGVQEADRPEEGYYIRSGIVVILKNATIKDG  515

Query  407   TVI  399
             TVI
Sbjct  516   TVI  518



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3246351156509