BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9924

Length=868
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009587048.1|  PREDICTED: B-cell receptor-associated protei...    325   4e-108   Nicotiana tomentosiformis
ref|XP_004231615.1|  PREDICTED: B-cell receptor-associated protei...    315   2e-104   Solanum lycopersicum
ref|XP_006350475.1|  PREDICTED: B-cell receptor-associated protei...    314   1e-103   Solanum tuberosum [potatoes]
ref|XP_011096040.1|  PREDICTED: B-cell receptor-associated protei...    285   2e-92    Sesamum indicum [beniseed]
ref|XP_009797812.1|  PREDICTED: uncharacterized protein LOC104244159    283   1e-91    Nicotiana sylvestris
gb|EYU27763.1|  hypothetical protein MIMGU_mgv1a012919mg                281   8e-91    Erythranthe guttata [common monkey flower]
ref|XP_009629450.1|  PREDICTED: uncharacterized protein LOC104119606    281   1e-90    Nicotiana tomentosiformis
ref|XP_006348141.1|  PREDICTED: B-cell receptor-associated protei...    277   2e-89    Solanum tuberosum [potatoes]
ref|XP_004233786.1|  PREDICTED: uncharacterized protein LOC101255462    277   3e-89    Solanum lycopersicum
ref|XP_010252455.1|  PREDICTED: uncharacterized protein LOC104594039    276   6e-89    Nelumbo nucifera [Indian lotus]
ref|XP_002262807.2|  PREDICTED: B-cell receptor-associated protei...    277   6e-89    
emb|CBI23212.3|  unnamed protein product                                274   3e-88    Vitis vinifera
emb|CDP04423.1|  unnamed protein product                                274   4e-88    Coffea canephora [robusta coffee]
ref|XP_006389583.1|  hypothetical protein POPTR_0021s00340g             272   2e-87    Populus trichocarpa [western balsam poplar]
ref|XP_006449764.1|  hypothetical protein CICLE_v10016599mg             272   3e-87    
gb|KDO78297.1|  hypothetical protein CISIN_1g021727mg                   271   5e-87    Citrus sinensis [apfelsine]
ref|XP_006467408.1|  PREDICTED: B-cell receptor-associated protei...    271   8e-87    
ref|XP_011008025.1|  PREDICTED: uncharacterized protein LOC105113519    270   2e-86    Populus euphratica
gb|KDO78296.1|  hypothetical protein CISIN_1g021727mg                   271   5e-86    Citrus sinensis [apfelsine]
ref|XP_007026129.1|  B-cell receptor-associated 31-like                 266   4e-85    
ref|XP_006467407.1|  PREDICTED: B-cell receptor-associated protei...    266   1e-84    Citrus sinensis [apfelsine]
ref|XP_010244479.1|  PREDICTED: B-cell receptor-associated protei...    265   1e-84    Nelumbo nucifera [Indian lotus]
ref|XP_004134773.1|  PREDICTED: uncharacterized protein LOC101221743    258   4e-82    Cucumis sativus [cucumbers]
ref|XP_008440020.1|  PREDICTED: B-cell receptor-associated protei...    258   9e-82    Cucumis melo [Oriental melon]
gb|AFK47348.1|  unknown                                                 255   8e-81    Lotus japonicus
ref|XP_003534595.1|  PREDICTED: B-cell receptor-associated protei...    255   1e-80    Glycine max [soybeans]
ref|XP_011046959.1|  PREDICTED: B-cell receptor-associated protei...    254   1e-80    Populus euphratica
ref|XP_007212007.1|  hypothetical protein PRUPE_ppa011145mg             254   3e-80    Prunus persica
ref|XP_008224696.1|  PREDICTED: B-cell receptor-associated protei...    253   4e-80    Prunus mume [ume]
ref|XP_006383887.1|  hypothetical protein POPTR_0004s00930g             253   6e-80    Populus trichocarpa [western balsam poplar]
gb|KJB68573.1|  hypothetical protein B456_010G251300                    252   1e-79    Gossypium raimondii
gb|ACU14586.1|  unknown                                                 251   3e-79    Glycine max [soybeans]
ref|XP_011086195.1|  PREDICTED: B-cell receptor-associated protei...    250   8e-79    Sesamum indicum [beniseed]
ref|NP_001236308.1|  uncharacterized protein LOC100526943               250   9e-79    Glycine max [soybeans]
gb|KHG15358.1|  B-cell receptor-associated 31                           249   3e-78    Gossypium arboreum [tree cotton]
ref|XP_002518447.1|  bcr-associated protein, bap, putative              248   4e-78    Ricinus communis
ref|XP_012091317.1|  PREDICTED: uncharacterized protein LOC105649311    247   1e-77    Jatropha curcas
ref|XP_004486174.1|  PREDICTED: B-cell receptor-associated protei...    247   1e-77    
ref|XP_002270301.1|  PREDICTED: B-cell receptor-associated protei...    246   3e-77    Vitis vinifera
gb|KEH36901.1|  B-cell receptor-associated-like protein                 246   4e-77    Medicago truncatula
ref|XP_010099186.1|  B-cell receptor-associated protein 31              244   1e-76    
ref|XP_004293309.1|  PREDICTED: B-cell receptor-associated protei...    244   1e-76    Fragaria vesca subsp. vesca
gb|AFK46642.1|  unknown                                                 244   2e-76    Medicago truncatula
ref|XP_008784370.1|  PREDICTED: B-cell receptor-associated protei...    241   3e-75    Phoenix dactylifera
ref|XP_009390004.1|  PREDICTED: B-cell receptor-associated protei...    241   4e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010057913.1|  PREDICTED: B-cell receptor-associated protei...    239   2e-74    Eucalyptus grandis [rose gum]
ref|XP_007147709.1|  hypothetical protein PHAVU_006G148100g             238   4e-74    Phaseolus vulgaris [French bean]
ref|XP_010689493.1|  PREDICTED: B-cell receptor-associated protei...    238   6e-74    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003605958.1|  hypothetical protein MTR_4g049540                  236   3e-73    Medicago truncatula
gb|AFK33681.1|  unknown                                                 235   5e-73    Medicago truncatula
ref|XP_008780367.1|  PREDICTED: uncharacterized protein LOC103700158    234   2e-72    Phoenix dactylifera
gb|KHG10853.1|  B-cell receptor-associated 31                           233   2e-72    Gossypium arboreum [tree cotton]
gb|ACJ84514.1|  unknown                                                 234   2e-72    Medicago truncatula
gb|KJB69262.1|  hypothetical protein B456_011G013000                    233   3e-72    Gossypium raimondii
ref|XP_009610364.1|  PREDICTED: uncharacterized protein LOC104104077    233   4e-72    Nicotiana tomentosiformis
gb|KDP20721.1|  hypothetical protein JCGZ_21192                         232   4e-72    Jatropha curcas
ref|XP_009795967.1|  PREDICTED: uncharacterized protein LOC104242589    233   4e-72    Nicotiana sylvestris
ref|XP_004506274.1|  PREDICTED: B-cell receptor-associated protei...    232   9e-72    Cicer arietinum [garbanzo]
ref|XP_009357471.1|  PREDICTED: uncharacterized protein LOC103948199    231   3e-71    Pyrus x bretschneideri [bai li]
ref|XP_010916117.1|  PREDICTED: uncharacterized protein LOC105041025    230   5e-71    
ref|XP_004251523.1|  PREDICTED: uncharacterized protein LOC101250189    230   7e-71    Solanum lycopersicum
ref|XP_010926189.1|  PREDICTED: uncharacterized protein LOC105048548    229   2e-70    Elaeis guineensis
ref|XP_009358864.1|  PREDICTED: B-cell receptor-associated protei...    228   4e-70    Pyrus x bretschneideri [bai li]
ref|XP_010046363.1|  PREDICTED: B-cell receptor-associated protei...    228   4e-70    Eucalyptus grandis [rose gum]
ref|XP_008371075.1|  PREDICTED: B-cell receptor-associated protei...    228   4e-70    
ref|XP_003539858.1|  PREDICTED: B-cell receptor-associated protei...    227   7e-70    
gb|KHN21219.1|  hypothetical protein glysoja_006698                     227   8e-70    Glycine soja [wild soybean]
ref|XP_006351969.1|  PREDICTED: B-cell receptor-associated protei...    227   9e-70    Solanum tuberosum [potatoes]
ref|XP_010549208.1|  PREDICTED: B-cell receptor-associated protei...    226   1e-69    Tarenaya hassleriana [spider flower]
emb|CDP10783.1|  unnamed protein product                                221   1e-67    Coffea canephora [robusta coffee]
gb|KHN41234.1|  hypothetical protein glysoja_017278                     220   4e-67    Glycine soja [wild soybean]
ref|NP_001239654.1|  uncharacterized protein LOC100798727               220   4e-67    Glycine max [soybeans]
ref|XP_010533802.1|  PREDICTED: uncharacterized protein LOC104809492    219   1e-66    Tarenaya hassleriana [spider flower]
ref|XP_008384089.1|  PREDICTED: B-cell receptor-associated protei...    218   3e-66    
ref|XP_010546686.1|  PREDICTED: uncharacterized protein LOC104818690    217   7e-66    Tarenaya hassleriana [spider flower]
ref|XP_010494193.1|  PREDICTED: B-cell receptor-associated protei...    217   8e-66    Camelina sativa [gold-of-pleasure]
ref|XP_009123682.1|  PREDICTED: uncharacterized protein LOC103848551    217   8e-66    Brassica rapa
ref|NP_568607.1|  B-cell receptor-associated 31-like protein            217   8e-66    Arabidopsis thaliana [mouse-ear cress]
emb|CDY34821.1|  BnaA09g47470D                                          217   9e-66    Brassica napus [oilseed rape]
ref|XP_002524828.1|  bcr-associated protein, bap, putative              216   1e-65    
ref|XP_009118164.1|  PREDICTED: uncharacterized protein LOC103843216    216   1e-65    Brassica rapa
dbj|BAB09328.1|  unnamed protein product                                217   2e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403381.1|  hypothetical protein EUTSA_v10003268mg             216   2e-65    Eutrema salsugineum [saltwater cress]
gb|AAM62748.1|  unknown                                                 216   2e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010481979.1|  PREDICTED: B-cell receptor-associated protei...    216   2e-65    Camelina sativa [gold-of-pleasure]
ref|XP_007149980.1|  hypothetical protein PHAVU_005G115800g             216   2e-65    Phaseolus vulgaris [French bean]
ref|XP_003540294.1|  PREDICTED: B-cell receptor-associated protei...    215   4e-65    Glycine max [soybeans]
ref|XP_004287957.1|  PREDICTED: B-cell receptor-associated protei...    215   4e-65    Fragaria vesca subsp. vesca
ref|XP_009403539.1|  PREDICTED: uncharacterized protein LOC103987073    215   4e-65    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006281077.1|  hypothetical protein CARUB_v10027105mg             214   5e-65    Capsella rubella
ref|XP_006447584.1|  hypothetical protein CICLE_v10016648mg             214   7e-65    Citrus clementina [clementine]
emb|CDY68895.1|  BnaCnng60970D                                          214   8e-65    Brassica napus [oilseed rape]
gb|KFK32917.1|  hypothetical protein AALP_AA6G305900                    214   1e-64    Arabis alpina [alpine rockcress]
ref|XP_007215939.1|  hypothetical protein PRUPE_ppa011161mg             213   4e-64    Prunus persica
ref|XP_008348138.1|  PREDICTED: B-cell receptor-associated protei...    213   4e-64    
ref|XP_004151895.1|  PREDICTED: B-cell receptor-associated protei...    212   4e-64    Cucumis sativus [cucumbers]
ref|XP_008342021.1|  PREDICTED: B-cell receptor-associated protei...    212   5e-64    
ref|XP_002863762.1|  hypothetical protein ARALYDRAFT_494776             211   1e-63    Arabidopsis lyrata subsp. lyrata
ref|XP_003543392.1|  PREDICTED: B-cell receptor-associated protei...    211   2e-63    Glycine max [soybeans]
ref|XP_006417293.1|  hypothetical protein EUTSA_v10008726mg             210   3e-63    Eutrema salsugineum [saltwater cress]
ref|XP_008229967.1|  PREDICTED: B-cell receptor-associated protei...    210   4e-63    Prunus mume [ume]
ref|XP_010442176.1|  PREDICTED: B-cell receptor-associated protei...    209   6e-63    Camelina sativa [gold-of-pleasure]
ref|XP_009353295.1|  PREDICTED: B-cell receptor-associated protei...    209   1e-62    Pyrus x bretschneideri [bai li]
ref|XP_007132530.1|  hypothetical protein PHAVU_011G102200g             208   1e-62    Phaseolus vulgaris [French bean]
ref|XP_010686812.1|  PREDICTED: B-cell receptor-associated protei...    208   2e-62    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009419329.1|  PREDICTED: B-cell receptor-associated protei...    206   6e-62    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003580219.1|  PREDICTED: B-cell receptor-associated protei...    206   8e-62    Brachypodium distachyon [annual false brome]
gb|KFK35240.1|  hypothetical protein AALP_AA5G258500                    206   9e-62    Arabis alpina [alpine rockcress]
emb|CDY34616.1|  BnaC08g41750D                                          205   3e-61    Brassica napus [oilseed rape]
gb|KFK40615.1|  hypothetical protein AALP_AA2G019200                    204   5e-61    Arabis alpina [alpine rockcress]
ref|XP_004952370.1|  PREDICTED: B-cell receptor-associated protei...    204   9e-61    Setaria italica
ref|XP_009347127.1|  PREDICTED: B-cell receptor-associated protei...    204   1e-60    Pyrus x bretschneideri [bai li]
ref|XP_008649481.1|  PREDICTED: uncharacterized protein LOC103630179    202   3e-60    Zea mays [maize]
ref|XP_002889902.1|  hypothetical protein ARALYDRAFT_334480             202   6e-60    
ref|NP_849648.4|  B-cell receptor-associated protein 31-like protein    201   8e-60    Arabidopsis thaliana [mouse-ear cress]
gb|EMT11422.1|  hypothetical protein F775_31561                         199   5e-59    
ref|NP_001170289.1|  LOC100384252                                       199   7e-59    Zea mays [maize]
ref|XP_010476134.1|  PREDICTED: uncharacterized protein LOC104755448    197   5e-58    Camelina sativa [gold-of-pleasure]
ref|XP_010458605.1|  PREDICTED: uncharacterized protein LOC104739838    196   6e-58    Camelina sativa [gold-of-pleasure]
ref|XP_006654198.1|  PREDICTED: B-cell receptor-associated protei...    196   7e-58    Oryza brachyantha
ref|NP_001055067.1|  Os05g0272900                                       194   3e-57    
dbj|BAK02060.1|  predicted protein                                      193   1e-56    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007046390.1|  B-cell receptor-associated 31-like                 193   2e-56    Theobroma cacao [chocolate]
ref|XP_010493468.1|  PREDICTED: uncharacterized protein LOC104770706    192   2e-56    Camelina sativa [gold-of-pleasure]
gb|KHN44866.1|  hypothetical protein glysoja_040795                     191   9e-56    Glycine soja [wild soybean]
ref|XP_010234160.1|  PREDICTED: uncharacterized protein LOC100839925    191   1e-55    Brachypodium distachyon [annual false brome]
dbj|BAJ86435.1|  predicted protein                                      189   3e-55    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006847259.2|  PREDICTED: B-cell receptor-associated protei...    188   1e-54    
gb|ERN08840.1|  hypothetical protein AMTR_s00015p00062110               188   1e-54    Amborella trichopoda
ref|XP_010089483.1|  hypothetical protein L484_011937                   189   1e-54    
ref|XP_011624427.1|  PREDICTED: B-cell receptor-associated protei...    188   1e-54    Amborella trichopoda
ref|XP_009779153.1|  PREDICTED: B-cell receptor-associated protei...    184   5e-54    Nicotiana sylvestris
ref|XP_011047243.1|  PREDICTED: B-cell receptor-associated protei...    186   5e-54    Populus euphratica
ref|XP_006303826.1|  hypothetical protein CARUB_v10012392mg             186   1e-53    Capsella rubella
ref|XP_002320470.1|  hypothetical protein POPTR_0014s15290g             184   2e-53    Populus trichocarpa [western balsam poplar]
gb|ADE75913.1|  unknown                                                 184   3e-53    Picea sitchensis
gb|EAY85610.1|  hypothetical protein OsI_06982                          182   2e-52    Oryza sativa Indica Group [Indian rice]
ref|XP_003563854.1|  PREDICTED: B-cell receptor-associated protei...    182   2e-52    Brachypodium distachyon [annual false brome]
ref|NP_001046689.1|  Os02g0321800                                       181   5e-52    
ref|XP_002453641.1|  hypothetical protein SORBIDRAFT_04g009770          181   9e-52    Sorghum bicolor [broomcorn]
dbj|BAJ87002.1|  predicted protein                                      180   2e-51    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACU19065.1|  unknown                                                 177   9e-51    Glycine max [soybeans]
ref|XP_003596956.1|  hypothetical protein MTR_2g088060                  177   2e-50    Medicago truncatula
ref|XP_006647215.1|  PREDICTED: B-cell receptor-associated protei...    177   3e-50    Oryza brachyantha
ref|NP_001154328.1|  B-cell receptor-associated protein 31-like p...    173   7e-49    Arabidopsis thaliana [mouse-ear cress]
gb|KHG00718.1|  separin                                                 167   2e-47    Gossypium arboreum [tree cotton]
ref|XP_012089876.1|  PREDICTED: uncharacterized protein LOC105648175    161   2e-45    Jatropha curcas
ref|NP_001057612.2|  Os06g0367500                                       160   3e-44    
gb|ACN36491.1|  unknown                                                 155   1e-42    Zea mays [maize]
gb|AAC17626.1|  Contains similarity to BAP31 protein gb|X81816 fr...    150   3e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006830526.1|  PREDICTED: B-cell receptor-associated protei...    150   6e-40    Amborella trichopoda
ref|XP_010247234.1|  PREDICTED: B-cell receptor-associated protei...    149   2e-39    Nelumbo nucifera [Indian lotus]
ref|XP_009778813.1|  PREDICTED: uncharacterized protein LOC104228107    145   2e-39    Nicotiana sylvestris
ref|XP_009802750.1|  PREDICTED: uncharacterized protein LOC104248228    144   8e-39    Nicotiana sylvestris
gb|KHN36526.1|  ATP-dependent helicase rhp16                            155   2e-38    Glycine soja [wild soybean]
gb|EMS49195.1|  hypothetical protein TRIUR3_29235                       145   2e-38    Triticum urartu
ref|XP_009381320.1|  PREDICTED: B-cell receptor-associated protei...    145   2e-38    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009599718.1|  PREDICTED: uncharacterized protein LOC104095323    143   3e-38    Nicotiana tomentosiformis
gb|ACG43219.1|  B-cell receptor-associated protein 31-like contai...    143   2e-37    Zea mays [maize]
gb|EMT32966.1|  hypothetical protein F775_31670                         142   2e-37    
ref|XP_002266257.2|  PREDICTED: B-cell receptor-associated protei...    143   2e-37    Vitis vinifera
ref|XP_002463520.1|  hypothetical protein SORBIDRAFT_01g001290          143   3e-37    Sorghum bicolor [broomcorn]
ref|XP_004248701.1|  PREDICTED: uncharacterized protein LOC101261860    140   3e-37    Solanum lycopersicum
ref|XP_006365288.1|  PREDICTED: uncharacterized protein LOC102597522    140   4e-37    Solanum tuberosum [potatoes]
ref|XP_010274041.1|  PREDICTED: B-cell receptor-associated protei...    142   5e-37    Nelumbo nucifera [Indian lotus]
ref|NP_001141677.1|  uncharacterized protein LOC100273803 precursor     142   5e-37    
ref|XP_012085075.1|  PREDICTED: B-cell receptor-associated protei...    141   1e-36    Jatropha curcas
ref|XP_008809940.1|  PREDICTED: B-cell receptor-associated protei...    140   2e-36    Phoenix dactylifera
ref|XP_006479253.1|  PREDICTED: B-cell receptor-associated protei...    140   4e-36    Citrus sinensis [apfelsine]
ref|XP_004981056.1|  PREDICTED: B-cell receptor-associated protei...    139   9e-36    Setaria italica
ref|XP_004963921.1|  PREDICTED: B-cell receptor-associated protei...    135   1e-35    
ref|XP_009410623.1|  PREDICTED: B-cell receptor-associated protei...    138   2e-35    
ref|XP_010099686.1|  hypothetical protein L484_025117                   137   3e-35    Morus notabilis
gb|KHG09837.1|  hypothetical protein F383_09194                         137   3e-35    Gossypium arboreum [tree cotton]
ref|XP_011011172.1|  PREDICTED: uncharacterized protein LOC105115831    137   4e-35    Populus euphratica
ref|XP_003562352.1|  PREDICTED: B-cell receptor-associated protei...    136   6e-35    Brachypodium distachyon [annual false brome]
ref|XP_008380294.1|  PREDICTED: uncharacterized protein LOC103443257    134   6e-35    
ref|XP_009361097.1|  PREDICTED: uncharacterized protein LOC103951454    134   7e-35    Pyrus x bretschneideri [bai li]
ref|NP_001143481.1|  hypothetical protein                               134   7e-35    Zea mays [maize]
gb|KJB10919.1|  hypothetical protein B456_001G232500                    136   8e-35    Gossypium raimondii
ref|XP_009370674.1|  PREDICTED: B-cell receptor-associated protei...    136   8e-35    Pyrus x bretschneideri [bai li]
ref|XP_008794596.1|  PREDICTED: B-cell receptor-associated protei...    136   1e-34    Phoenix dactylifera
ref|XP_003532279.1|  PREDICTED: B-cell receptor-associated protei...    135   2e-34    Glycine max [soybeans]
ref|XP_007140653.1|  hypothetical protein PHAVU_008G130500g             135   2e-34    Phaseolus vulgaris [French bean]
emb|CDP03896.1|  unnamed protein product                                135   2e-34    Coffea canephora [robusta coffee]
ref|XP_009371858.1|  PREDICTED: B-cell receptor-associated protei...    135   2e-34    Pyrus x bretschneideri [bai li]
ref|XP_008382607.1|  PREDICTED: B-cell receptor-associated protei...    135   2e-34    
gb|EAZ03537.1|  hypothetical protein OsI_25672                          135   3e-34    Oryza sativa Indica Group [Indian rice]
ref|XP_002863915.1|  hypothetical protein ARALYDRAFT_494932             135   3e-34    
ref|NP_001136567.1|  uncharacterized LOC100216689 precursor             134   3e-34    Zea mays [maize]
ref|XP_007049723.1|  B-cell receptor-associated protein 31-like         134   3e-34    Theobroma cacao [chocolate]
ref|XP_008385961.1|  PREDICTED: uncharacterized protein LOC103448478    132   4e-34    
ref|XP_006452411.1|  hypothetical protein CICLE_v10009874mg             131   5e-34    Citrus clementina [clementine]
ref|XP_010927692.1|  PREDICTED: B-cell receptor-associated protei...    134   5e-34    Elaeis guineensis
emb|CDP15777.1|  unnamed protein product                                131   6e-34    Coffea canephora [robusta coffee]
ref|XP_009151666.1|  PREDICTED: uncharacterized protein LOC103874978    134   6e-34    Brassica rapa
emb|CDX86287.1|  BnaA06g30040D                                          134   7e-34    
ref|XP_008372494.1|  PREDICTED: B-cell receptor-associated protei...    134   8e-34    Malus domestica [apple tree]
ref|XP_007215894.1|  hypothetical protein PRUPE_ppa010667mg             134   9e-34    Prunus persica
ref|XP_010069636.1|  PREDICTED: B-cell receptor-associated protei...    133   1e-33    Eucalyptus grandis [rose gum]
ref|XP_008235454.1|  PREDICTED: B-cell receptor-associated protei...    133   1e-33    Prunus mume [ume]
emb|CDX85356.1|  BnaC07g26670D                                          133   1e-33    
ref|XP_003552124.1|  PREDICTED: B-cell receptor-associated protei...    132   2e-33    Glycine max [soybeans]
ref|XP_008229970.1|  PREDICTED: B-cell receptor-associated protei...    133   3e-33    Prunus mume [ume]
ref|XP_002303054.2|  hypothetical protein POPTR_0002s24670g             132   3e-33    Populus trichocarpa [western balsam poplar]
gb|KJB26032.1|  hypothetical protein B456_004G226500                    132   3e-33    Gossypium raimondii
gb|ACG37455.1|  B-cell receptor-associated protein 31-like contai...    132   3e-33    Zea mays [maize]
ref|XP_008226862.1|  PREDICTED: uncharacterized protein LOC103326424    130   3e-33    Prunus mume [ume]
ref|XP_002437063.1|  hypothetical protein SORBIDRAFT_10g020520          129   7e-33    Sorghum bicolor [broomcorn]
ref|XP_006657620.1|  PREDICTED: B-cell receptor-associated protei...    130   1e-32    Oryza brachyantha
ref|XP_008802267.1|  PREDICTED: B-cell receptor-associated protei...    130   1e-32    Phoenix dactylifera
ref|XP_009388739.1|  PREDICTED: uncharacterized protein LOC103975489    128   1e-32    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006650891.1|  PREDICTED: B-cell receptor-associated protei...    130   2e-32    Oryza brachyantha
ref|XP_002521067.1|  bcr-associated protein, bap, putative              131   3e-32    
ref|XP_006281079.1|  hypothetical protein CARUB_v10027107mg             129   3e-32    Capsella rubella
gb|KDO62065.1|  hypothetical protein CISIN_1g045614mg                   126   3e-32    Citrus sinensis [apfelsine]
ref|XP_004987306.1|  PREDICTED: uncharacterized protein LOC101775823    127   4e-32    Setaria italica
ref|XP_010685051.1|  PREDICTED: B-cell receptor-associated protei...    129   4e-32    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001051893.1|  Os03g0848400                                       127   2e-31    
ref|XP_011089080.1|  PREDICTED: uncharacterized protein LOC105170143    127   2e-31    Sesamum indicum [beniseed]
gb|EAY92582.1|  hypothetical protein OsI_14323                          126   4e-31    Oryza sativa Indica Group [Indian rice]
gb|EYU27354.1|  hypothetical protein MIMGU_mgv1a015673mg                124   4e-31    Erythranthe guttata [common monkey flower]
ref|XP_007134124.1|  hypothetical protein PHAVU_010G021100g             126   6e-31    Phaseolus vulgaris [French bean]
ref|XP_002317336.1|  hypothetical protein POPTR_0011s09140g             123   8e-31    Populus trichocarpa [western balsam poplar]
ref|XP_004295837.1|  PREDICTED: uncharacterized protein LOC101305253    123   1e-30    Fragaria vesca subsp. vesca
ref|XP_010063029.1|  PREDICTED: uncharacterized protein LOC104450...    122   2e-30    Eucalyptus grandis [rose gum]
ref|XP_006452412.1|  hypothetical protein CICLE_v10009874mg             121   4e-30    
ref|XP_006340009.1|  PREDICTED: B-cell receptor-associated protei...    123   5e-30    Solanum tuberosum [potatoes]
gb|EMS47744.1|  hypothetical protein TRIUR3_06470                       125   5e-30    Triticum urartu
gb|EMS58132.1|  hypothetical protein TRIUR3_00710                       122   5e-30    Triticum urartu
ref|XP_004247073.1|  PREDICTED: uncharacterized protein LOC101251810    123   6e-30    Solanum lycopersicum
gb|KHN11907.1|  hypothetical protein glysoja_019880                     121   6e-30    Glycine soja [wild soybean]
gb|KHN38264.1|  hypothetical protein glysoja_003929                     121   9e-30    Glycine soja [wild soybean]
ref|XP_009775442.1|  PREDICTED: uncharacterized protein LOC104225364    122   1e-29    Nicotiana sylvestris
ref|XP_008460368.1|  PREDICTED: B-cell receptor-associated protei...    122   1e-29    Cucumis melo [Oriental melon]
ref|XP_004290194.1|  PREDICTED: B-cell receptor-associated protei...    122   1e-29    Fragaria vesca subsp. vesca
gb|EMT23366.1|  hypothetical protein F775_19324                         123   3e-29    
ref|XP_011024634.1|  PREDICTED: uncharacterized protein LOC105125752    121   4e-29    Populus euphratica
ref|XP_009610381.1|  PREDICTED: uncharacterized protein LOC104104089    121   4e-29    Nicotiana tomentosiformis
gb|KJB26033.1|  hypothetical protein B456_004G226500                    120   5e-29    Gossypium raimondii
ref|XP_011013138.1|  PREDICTED: uncharacterized protein LOC105117241    117   1e-28    Populus euphratica
ref|XP_010552045.1|  PREDICTED: B-cell receptor-associated protei...    119   1e-28    Tarenaya hassleriana [spider flower]
ref|XP_004491413.1|  PREDICTED: uncharacterized protein LOC101509893    117   1e-28    Cicer arietinum [garbanzo]
ref|XP_004491710.1|  PREDICTED: B-cell receptor-associated protei...    118   5e-28    Cicer arietinum [garbanzo]
ref|XP_012070866.1|  PREDICTED: uncharacterized protein LOC105632986    115   6e-28    Jatropha curcas
emb|CDY66080.1|  BnaCnng49520D                                          117   9e-28    Brassica napus [oilseed rape]
ref|XP_006452413.1|  hypothetical protein CICLE_v10009874mg             114   1e-27    
ref|XP_008458888.1|  PREDICTED: uncharacterized protein LOC103498158    114   1e-27    Cucumis melo [Oriental melon]
ref|NP_199677.1|  B-cell receptor-associated protein 31-like protein    117   2e-27    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395148.1|  hypothetical protein EUTSA_v10004894mg             117   2e-27    Eutrema salsugineum [saltwater cress]
ref|XP_004144386.1|  PREDICTED: uncharacterized protein LOC101213598    116   2e-27    Cucumis sativus [cucumbers]
emb|CDY51050.1|  BnaA02g30380D                                          116   2e-27    Brassica napus [oilseed rape]
ref|XP_009129743.1|  PREDICTED: uncharacterized protein LOC103854553    116   3e-27    Brassica rapa
ref|XP_008674143.1|  PREDICTED: B-cell receptor-associated protei...    117   4e-27    
ref|XP_010493705.1|  PREDICTED: B-cell receptor-associated protei...    115   8e-27    Camelina sativa [gold-of-pleasure]
ref|XP_011095414.1|  PREDICTED: uncharacterized protein LOC105174881    112   9e-27    Sesamum indicum [beniseed]
ref|XP_002884632.1|  hypothetical protein ARALYDRAFT_478041             113   3e-26    
gb|KFK38172.1|  hypothetical protein AALP_AA3G078300                    113   4e-26    Arabis alpina [alpine rockcress]
gb|EPS63018.1|  hypothetical protein M569_11771                         110   7e-26    Genlisea aurea
ref|XP_010464329.1|  PREDICTED: uncharacterized protein LOC104744901    112   1e-25    Camelina sativa [gold-of-pleasure]
gb|KEH22623.1|  B-cell receptor-associated-like protein                 110   3e-25    Medicago truncatula
gb|EYU40619.1|  hypothetical protein MIMGU_mgv1a013665mg                110   3e-25    Erythranthe guttata [common monkey flower]
ref|XP_011655362.1|  PREDICTED: uncharacterized protein LOC101213...    106   1e-24    Cucumis sativus [cucumbers]
ref|XP_006407860.1|  hypothetical protein EUTSA_v10021483mg             108   2e-24    Eutrema salsugineum [saltwater cress]
ref|NP_187375.1|  B-cell receptor-associated protein 31-like protein    108   2e-24    Arabidopsis thaliana [mouse-ear cress]
gb|KDO62066.1|  hypothetical protein CISIN_1g046403mg                   105   2e-24    Citrus sinensis [apfelsine]
ref|XP_010913045.1|  PREDICTED: B-cell receptor-associated protei...    108   3e-24    Elaeis guineensis
ref|XP_010486262.1|  PREDICTED: B-cell receptor-associated protei...    108   3e-24    Camelina sativa [gold-of-pleasure]
ref|XP_010449720.1|  PREDICTED: B-cell receptor-associated protei...    108   3e-24    Camelina sativa [gold-of-pleasure]
ref|XP_008467068.1|  PREDICTED: uncharacterized protein LOC103504505    104   7e-24    
ref|XP_007201384.1|  hypothetical protein PRUPE_ppa012189mg             105   2e-23    
gb|EPS57633.1|  hypothetical protein M569_17183                         105   2e-23    Genlisea aurea
ref|XP_009145629.1|  PREDICTED: uncharacterized protein LOC103869321    100   4e-22    Brassica rapa
emb|CBI29413.3|  unnamed protein product                              99.4    6e-22    Vitis vinifera
emb|CDY29829.1|  BnaC05g31610D                                        99.0    9e-22    Brassica napus [oilseed rape]
ref|XP_010666200.1|  PREDICTED: uncharacterized protein LOC104883381  98.2    2e-21    Beta vulgaris subsp. vulgaris [field beet]
gb|KDP22731.1|  hypothetical protein JCGZ_01833                       99.8    3e-21    Jatropha curcas
ref|XP_007142305.1|  hypothetical protein PHAVU_008G269400g           98.6    4e-21    Phaseolus vulgaris [French bean]
ref|XP_008455897.1|  PREDICTED: B-cell receptor-associated protei...  95.9    7e-21    Cucumis melo [Oriental melon]
ref|XP_006298783.1|  hypothetical protein CARUB_v10014885mg           95.5    2e-20    
gb|KFK39354.1|  hypothetical protein AALP_AA3G233700                  94.7    3e-20    
gb|KDP39157.1|  hypothetical protein JCGZ_00914                       93.2    5e-20    
ref|XP_010466234.1|  PREDICTED: uncharacterized protein LOC104746450  94.4    5e-20    
gb|AFW70952.1|  hypothetical protein ZEAMMB73_233499                  94.4    7e-20    
ref|XP_010488019.1|  PREDICTED: uncharacterized protein LOC104765923  93.2    1e-19    
ref|XP_006406381.1|  hypothetical protein EUTSA_v10021737mg           93.2    1e-19    
ref|XP_010508923.1|  PREDICTED: uncharacterized protein LOC104785412  93.2    1e-19    
ref|XP_002885374.1|  hypothetical protein ARALYDRAFT_479569           92.8    1e-19    
ref|XP_002862714.1|  hypothetical protein ARALYDRAFT_497321           92.8    1e-19    
ref|XP_007020770.1|  F-box family protein with a domain of Unchar...  97.8    2e-19    
gb|ACU15885.1|  unknown                                               90.5    6e-19    
ref|XP_007212356.1|  hypothetical protein PRUPE_ppa014571mg           89.0    1e-18    
ref|XP_010545515.1|  PREDICTED: uncharacterized protein LOC104817861  90.1    1e-18    
ref|NP_566662.1|  B-cell receptor-associated protein 31-like protein  90.1    1e-18    
gb|AAM67164.1|  unknown                                               89.4    2e-18    
ref|XP_002529922.1|  bcr-associated protein, bap, putative            90.9    5e-18    
ref|XP_007216855.1|  hypothetical protein PRUPE_ppa021600mg           89.7    6e-18    
gb|AFW71006.1|  hypothetical protein ZEAMMB73_389553                  81.6    6e-16    
gb|EYU39202.1|  hypothetical protein MIMGU_mgv1a024213mg              81.3    5e-15    
ref|XP_009795272.1|  PREDICTED: uncharacterized protein LOC104241998  81.6    9e-15    
ref|XP_010063030.1|  PREDICTED: uncharacterized protein LOC104450...  77.0    2e-14    
emb|CAN62540.1|  hypothetical protein VITISV_031161                   77.8    3e-14    
gb|EMT13188.1|  hypothetical protein F775_28124                       78.2    5e-14    
ref|XP_006443576.1|  hypothetical protein CICLE_v100221651mg          76.3    9e-14    
ref|XP_003617596.1|  hypothetical protein MTR_5g093360                75.5    1e-13    
ref|XP_006409380.1|  hypothetical protein EUTSA_v10022940mg           73.9    3e-13    
ref|XP_006375655.1|  hypothetical protein POPTR_0014s18870g           73.9    5e-13    
emb|CBI28815.3|  unnamed protein product                              73.2    6e-13    
ref|XP_004240151.1|  PREDICTED: uncharacterized protein LOC101249367  75.1    2e-12    
emb|CBI23214.3|  unnamed protein product                              71.6    3e-12    
ref|XP_009616881.1|  PREDICTED: uncharacterized protein LOC104109325  74.3    5e-12    
ref|XP_011655363.1|  PREDICTED: uncharacterized protein LOC101213...  68.6    4e-11    
ref|XP_006342256.1|  PREDICTED: uncharacterized protein LOC102584894  71.2    5e-11    
gb|KJB13716.1|  hypothetical protein B456_002G090900                  68.6    7e-11    
ref|XP_002985711.1|  hypothetical protein SELMODRAFT_229134           68.9    2e-10    
ref|XP_006375656.1|  hypothetical protein POPTR_0014s18880g           66.6    3e-10    
ref|XP_010096876.1|  hypothetical protein L484_008070                 65.1    4e-10    
ref|XP_002974412.1|  hypothetical protein SELMODRAFT_271069           67.0    8e-10    
ref|XP_006443575.1|  hypothetical protein CICLE_v100221652mg          62.0    9e-09    
ref|XP_006479254.1|  PREDICTED: B-cell receptor-associated protei...  62.8    9e-09    
ref|XP_008353105.1|  PREDICTED: uncharacterized protein LOC103416652  60.8    4e-08    
ref|XP_010466235.1|  PREDICTED: uncharacterized protein LOC104746451  60.1    6e-08    
gb|EMT13189.1|  hypothetical protein F775_28125                       58.5    2e-07    
ref|NP_001175145.1|  Os07g0291200                                     58.9    2e-07    
gb|AFW77085.1|  hypothetical protein ZEAMMB73_955327                  55.5    1e-06    
ref|XP_008646901.1|  PREDICTED: uncharacterized protein LOC103628485  54.7    4e-06    
gb|AFW77084.1|  hypothetical protein ZEAMMB73_955327                  54.7    4e-06    
gb|AFW77083.1|  hypothetical protein ZEAMMB73_955327                  54.3    6e-06    
ref|XP_011460000.1|  PREDICTED: uncharacterized protein LOC105350198  56.6    1e-05    
ref|XP_008230042.1|  PREDICTED: uncharacterized protein LOC103329358  52.4    3e-05    
gb|KJB13713.1|  hypothetical protein B456_002G090600                  50.8    1e-04    
ref|XP_001766710.1|  predicted protein                                50.4    7e-04    



>ref|XP_009587048.1| PREDICTED: B-cell receptor-associated protein 31 [Nicotiana tomentosiformis]
Length=222

 Score =   325 bits (833),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 187/223 (84%), Positives = 208/223 (93%), Gaps = 1/223 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF LIFAEMALI IFVF+TPLRKLVI+GLDRVKRGRG I+VKTVAGT+FVVMLSTI
Sbjct  1    MIQLLFTLIFAEMALIVIFVFKTPLRKLVIMGLDRVKRGRGPIIVKTVAGTLFVVMLSTI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++ S+R RW+ DEGGDITPTDQILLAQHLLEASLMGFSLFL  MIDRLHHYIREL MRR
Sbjct  61   YSIASIRTRWM-DEGGDITPTDQILLAQHLLEASLMGFSLFLAFMIDRLHHYIRELSMRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEAVKKQNRA ++GK+G SEEIK+LEE+AS+LR +IKQLESE++EK+KEAS +EANA+
Sbjct  120  KTMEAVKKQNRAFEDGKSGASEEIKTLEEEASALRGKIKQLESELQEKAKEASGAEANAV  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            ALKKQSEGFLLEYDRLLEENQ+LRSQLQSLDR LS SDSKKVS
Sbjct  180  ALKKQSEGFLLEYDRLLEENQNLRSQLQSLDRTLSRSDSKKVS  222



>ref|XP_004231615.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
lycopersicum]
Length=222

 Score =   315 bits (808),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 187/223 (84%), Positives = 205/223 (92%), Gaps = 1/223 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF LIFAEMALI IFVF+TPLRKLVI+GLDRVKRGRG I+VKTVAGTVFVVM+STI
Sbjct  1    MIQLLFTLIFAEMALIIIFVFKTPLRKLVIMGLDRVKRGRGPIIVKTVAGTVFVVMMSTI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+V S+  RW+ DEGGDITPTDQILLAQHLLEASLMGFSLFL  MIDRLHHYIREL MRR
Sbjct  61   YSVASIHTRWV-DEGGDITPTDQILLAQHLLEASLMGFSLFLAFMIDRLHHYIRELSMRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEAVKKQNRA ++GK G SEEIK+LE +AS+LRE+I+QLE E+EEK+KEASS+EANA 
Sbjct  120  KTMEAVKKQNRAFEDGKNGASEEIKTLEGEASALREKIRQLELELEEKAKEASSAEANAG  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            ALKKQSEGFLLEYDRLLEENQ+LRSQLQSLDR LS SDSKKVS
Sbjct  180  ALKKQSEGFLLEYDRLLEENQNLRSQLQSLDRTLSRSDSKKVS  222



>ref|XP_006350475.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
tuberosum]
Length=222

 Score =   314 bits (804),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 206/223 (92%), Gaps = 1/223 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF LIFAEMALI IFVF+TPLRKLVI+GLDRVKRGRG I++KTVAGTVFVVM+STI
Sbjct  1    MIQLLFTLIFAEMALIIIFVFKTPLRKLVIMGLDRVKRGRGPIIMKTVAGTVFVVMMSTI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+V S+  RW+ DEGGDITPTDQILLAQHLLEASLMGFSLFL  MID+LHHYIREL +RR
Sbjct  61   YSVASIHTRWV-DEGGDITPTDQILLAQHLLEASLMGFSLFLAFMIDKLHHYIRELSIRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEAVKKQNRA ++GK+G SEEIK+LE +AS+LRE+I+QLE E+EEK+KEASS+EANA 
Sbjct  120  KTMEAVKKQNRAFEDGKSGASEEIKTLEGEASALREKIRQLELELEEKAKEASSAEANAG  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            ALKKQSEGFLLEYDRLLEENQ+LRSQLQSLDR LS SDSKKVS
Sbjct  180  ALKKQSEGFLLEYDRLLEENQNLRSQLQSLDRTLSRSDSKKVS  222



>ref|XP_011096040.1| PREDICTED: B-cell receptor-associated protein 31 [Sesamum indicum]
Length=221

 Score =   285 bits (728),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 161/222 (73%), Positives = 194/222 (87%), Gaps = 2/222 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF LIFAEM LI +FVF+TPLRKLVI+GLDRVKRGRG +VVKTVA T+FVVM++++
Sbjct  1    MIQLLFTLIFAEMTLIVVFVFKTPLRKLVIMGLDRVKRGRGPVVVKTVAATIFVVMMASV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN ++++ RWI+D  G+  PTDQIL A H+LEASLMGF+LFL LMIDRLHHYIRELR+RR
Sbjct  61   YNAVAIQRRWIQD--GEANPTDQILFANHILEASLMGFALFLALMIDRLHHYIRELRIRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEAVKKQ+R  ++ K   +EEIK+LEE+  +LR RIK LE+++EEK+KE+ S+EANA+
Sbjct  119  KTMEAVKKQSRVFEDSKPPATEEIKALEEETIALRGRIKDLETQLEEKNKESGSAEANAM  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKV  113
            ALKKQSEGFLLEYDRLLEENQ+LRSQLQSLDRK S SD KKV
Sbjct  179  ALKKQSEGFLLEYDRLLEENQNLRSQLQSLDRKFSLSDGKKV  220



>ref|XP_009797812.1| PREDICTED: uncharacterized protein LOC104244159 [Nicotiana sylvestris]
Length=220

 Score =   283 bits (724),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 198/221 (90%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQ+LF +IFAEMALI +FVF+TPLRK+VI+GLDR+KRGRG IVVKT+ GT+F+VMLSTI
Sbjct  1    MIQVLFSVIFAEMALIVLFVFKTPLRKVVIMGLDRIKRGRGPIVVKTIGGTIFMVMLSTI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+V+S+R RWI DE G+ITPTDQIL+AQHLLEASLMGFSLFL LM+DRLHHYIRELRMRR
Sbjct  61   YSVVSIRKRWI-DEDGNITPTDQILMAQHLLEASLMGFSLFLALMVDRLHHYIRELRMRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEAV KQNR  ++GK G S+++KSLEE+AS+LR +IK+LE  +EEK++E S +EAN++
Sbjct  120  KSMEAVNKQNRGFEDGKNGASDDMKSLEEEASALRLKIKKLELCLEEKARETSDAEANSV  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            ALKKQSE F LE D LLE+NQ+LR+QLQ+LD++LS SDSKK
Sbjct  180  ALKKQSENFRLENDYLLEDNQNLRAQLQALDQRLS-SDSKK  219



>gb|EYU27763.1| hypothetical protein MIMGU_mgv1a012919mg [Erythranthe guttata]
Length=236

 Score =   281 bits (720),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 170/241 (71%), Positives = 197/241 (82%), Gaps = 23/241 (10%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF LIF EMALI +FVF+TP+RKLVI+GLDRVKRGRG IVVKTVAGTVFVVM++T+
Sbjct  1    MIQLLFALIFTEMALIVVFVFKTPVRKLVIMGLDRVKRGRGPIVVKTVAGTVFVVMMATV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YNV+ ++ RWI+D   ++ PTDQ+LLA+HLLEASLMGFSLFL LMIDRLHHYIRELR+RR
Sbjct  61   YNVVKIQRRWIQD--VEVNPTDQVLLAKHLLEASLMGFSLFLALMIDRLHHYIRELRIRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekske---------  266
            K MEAVKKQNR  ++GK     EIK LEE+  SLR RIKQLE+++E+K+           
Sbjct  119  KNMEAVKKQNRIFEDGKPL---EIKLLEEEKISLRGRIKQLEAQLEDKTTSLHDRINQLG  175

Query  265  ---------assseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKV  113
                     ASSSE NAIALKKQSEGFLLEYDRLLEENQHLRSQLQ+LDRKLS+SDSKKV
Sbjct  176  TQLEEKTKEASSSETNAIALKKQSEGFLLEYDRLLEENQHLRSQLQTLDRKLSYSDSKKV  235

Query  112  S  110
            +
Sbjct  236  T  236



>ref|XP_009629450.1| PREDICTED: uncharacterized protein LOC104119606 [Nicotiana tomentosiformis]
Length=221

 Score =   281 bits (718),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 160/223 (72%), Positives = 198/223 (89%), Gaps = 2/223 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQ+LF +IFAEMALI +FVF+TPLRKLVI+GLDR+KRGRG IVVKT+ GT+FVVMLSTI
Sbjct  1    MIQVLFSVIFAEMALIVMFVFKTPLRKLVIMGLDRIKRGRGPIVVKTIGGTIFVVMLSTI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+V+S+R RWI DE G+ITPTDQIL+AQHLLEASLMGFSLFL LM+DRLHHYIRELR+RR
Sbjct  61   YSVVSIRKRWI-DEDGNITPTDQILMAQHLLEASLMGFSLFLALMVDRLHHYIRELRIRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEAV KQNR  ++GK G  +++KSLEE+AS+LR +IK+LE  +EEK++E S +EAN++
Sbjct  120  KSMEAVNKQNRGFEDGKNGACDDMKSLEEEASALRLKIKKLELCLEEKARETSDAEANSV  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            ALKKQSE F LE D LLE+NQ+LR+QLQ+LD++LS SD+KK S
Sbjct  180  ALKKQSENFGLENDSLLEDNQNLRAQLQALDQRLS-SDTKKDS  221



>ref|XP_006348141.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
tuberosum]
Length=222

 Score =   277 bits (709),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/223 (71%), Positives = 195/223 (87%), Gaps = 1/223 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQ+LF +IFAEMALI + +F+TPLRKLVI+GLDRVKRGRG IVVKT  GT+F+VMLS+I
Sbjct  1    MIQVLFTVIFAEMALILLLIFKTPLRKLVIMGLDRVKRGRGPIVVKTTGGTIFIVMLSSI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+V+S+  RWI DE G++TPTDQIL+AQHLLEASLMGFSLFL LMIDRLHHYIRELRMRR
Sbjct  61   YSVVSIHKRWI-DEDGNVTPTDQILMAQHLLEASLMGFSLFLALMIDRLHHYIRELRMRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEAV KQNR  ++GK G S+++KSLEE+AS+LR +IK+LE+ VEEK+KE+S +EAN +
Sbjct  120  KSMEAVNKQNRGFEDGKNGASDDMKSLEEEASALRLKIKKLEATVEEKAKESSDAEANVV  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            ALKKQSE FL E D L E+NQ+LR+Q+QSLD++ S+SD KK S
Sbjct  180  ALKKQSEHFLRENDSLHEDNQNLRAQVQSLDQRSSNSDVKKAS  222



>ref|XP_004233786.1| PREDICTED: uncharacterized protein LOC101255462 [Solanum lycopersicum]
Length=222

 Score =   277 bits (708),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 158/223 (71%), Positives = 196/223 (88%), Gaps = 1/223 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQ+LF +IFAE+A+I + +F+TPLRKL+I+GLDRVKRGRG IVVKT  GT+FVVMLS+I
Sbjct  1    MIQVLFTVIFAEVAVILLLIFKTPLRKLIIMGLDRVKRGRGPIVVKTTGGTIFVVMLSSI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+V+S+  RWI DE G++TPTDQIL+AQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR
Sbjct  61   YSVVSIHKRWI-DEDGNVTPTDQILMAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEAV KQNR  ++GK G S+++KSLEE+A +LR +IK+LE+ VEEK+KE+S +EAN +
Sbjct  120  KSMEAVNKQNRGFEDGKNGASDDMKSLEEEAGALRLKIKKLEATVEEKAKESSDAEANVV  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            ALKKQSE FL E D L EENQ+LR+QLQSLD++LS+SD +K S
Sbjct  180  ALKKQSEHFLRENDSLHEENQNLRAQLQSLDQRLSNSDVRKAS  222



>ref|XP_010252455.1| PREDICTED: uncharacterized protein LOC104594039 [Nelumbo nucifera]
Length=222

 Score =   276 bits (706),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 153/223 (69%), Positives = 193/223 (87%), Gaps = 1/223 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF LIFAEMALI +F+F+TPLRKL+I+GLDRVKRGRG ++VKTV GT+ VV+LS++
Sbjct  1    MIQLLFTLIFAEMALILLFLFKTPLRKLIIMGLDRVKRGRGPVMVKTVCGTILVVLLSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  ++NR + D  G + PTDQ+L+A+HLLEASLMGFSLFL LMIDRLHHYIRELR+ R
Sbjct  61   YSMTKIQNRSM-DSAGIVNPTDQVLMAKHLLEASLMGFSLFLALMIDRLHHYIRELRLLR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEAVKKQNR  ++GK G  E+ K+LEE+ +SLR ++K+LES+ E K+KE  ++EANA 
Sbjct  120  KSMEAVKKQNRGFEDGKNGGPEDTKALEEERASLRAKVKELESKFEAKTKETKAAEANAE  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            ALKKQSEGFLLEYDRLLE+NQ LR+QLQS+DRK+SHSDSKK +
Sbjct  180  ALKKQSEGFLLEYDRLLEDNQSLRNQLQSIDRKVSHSDSKKST  222



>ref|XP_002262807.2| PREDICTED: B-cell receptor-associated protein 31 [Vitis vinifera]
Length=248

 Score =   277 bits (708),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 156/242 (64%), Positives = 204/242 (84%), Gaps = 4/242 (2%)
 Frame = -1

Query  841  QSRTPCYPQISAVQ*LQLRSIMIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRG  662
            ++R+      +AV+    RS MIQLLF +IFAEMA+I + +F+TPLRKLVI+GLDRVKRG
Sbjct  9    ETRSKVSLSFAAVR--SRRSEMIQLLFTVIFAEMAMIMVLLFKTPLRKLVIMGLDRVKRG  66

Query  661  RGSIvvktvagtvfvVMLSTIYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFS  482
            RG I+VKTVA TV VV++S++Y+++ +R R I+D+   + PTDQ+L+A+HLLE SLMGF+
Sbjct  67   RGPIMVKTVAATVLVVLISSVYSMMKIRKRGIDDDV--VNPTDQVLMAKHLLETSLMGFT  124

Query  481  LFLGLMIDRLHHYIRELRMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIK  302
            LFL LMIDRLHHYIRELR+RRK+MEA+KKQNR  ++GK G S EIK++EE+ ++L  ++K
Sbjct  125  LFLALMIDRLHHYIRELRLRRKSMEAIKKQNRGFEDGKTGGSAEIKAMEEEMAALGAKLK  184

Query  301  QLeseveekskeassseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDS  122
            QLESE+E K+KEA ++E NA+AL+KQSEGFLLEYDRLLEENQ+LR+QLQSLDR+LSHS S
Sbjct  185  QLESEIETKTKEAKAAETNAVALRKQSEGFLLEYDRLLEENQNLRNQLQSLDRRLSHSGS  244

Query  121  KK  116
            KK
Sbjct  245  KK  246



>emb|CBI23212.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   274 bits (701),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 194/221 (88%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +IFAEMA+I + +F+TPLRKLVI+GLDRVKRGRG I+VKTVA TV VV++S++
Sbjct  1    MIQLLFTVIFAEMAMIMVLLFKTPLRKLVIMGLDRVKRGRGPIMVKTVAATVLVVLISSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ +R R I+D+   + PTDQ+L+A+HLLE SLMGF+LFL LMIDRLHHYIRELR+RR
Sbjct  61   YSMMKIRKRGIDDDV--VNPTDQVLMAKHLLETSLMGFTLFLALMIDRLHHYIRELRLRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEA+KKQNR  ++GK G S EIK++EE+ ++L  ++KQLESE+E K+KEA ++E NA+
Sbjct  119  KSMEAIKKQNRGFEDGKTGGSAEIKAMEEEMAALGAKLKQLESEIETKTKEAKAAETNAV  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFLLEYDRLLEENQ+LR+QLQSLDR+LSHS SKK
Sbjct  179  ALRKQSEGFLLEYDRLLEENQNLRNQLQSLDRRLSHSGSKK  219



>emb|CDP04423.1| unnamed protein product [Coffea canephora]
Length=218

 Score =   274 bits (700),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 159/222 (72%), Positives = 191/222 (86%), Gaps = 5/222 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI+LLF LIFAEMALI IFVF+TPLRKLVI+G+DRVKRGRG  VVK VAGT+ VVM+S+ 
Sbjct  1    MIRLLFSLIFAEMALIVIFVFKTPLRKLVIMGIDRVKRGRGPTVVKAVAGTLSVVMMSSG  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN +++ NRW +D   DI PTDQIL A +LLEASLMGFSLFL  MIDRLHHYIRELR+RR
Sbjct  61   YNAVAIHNRWSQD--ADINPTDQILFANYLLEASLMGFSLFLAFMIDRLHHYIRELRIRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEA KKQNR  D+GK G   + K+LEE++++LR ++K LE+E++EK+KEASS+EAN +
Sbjct  119  KSMEAGKKQNRISDDGKNG---DFKALEEESAALRAKVKNLEAELDEKTKEASSAEANKL  175

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKV  113
            ALKKQSEGFLLEYDRLLEENQ LRSQLQSLDR++S SDSKK+
Sbjct  176  ALKKQSEGFLLEYDRLLEENQSLRSQLQSLDRRISRSDSKKI  217



>ref|XP_006389583.1| hypothetical protein POPTR_0021s00340g [Populus trichocarpa]
 gb|ABK95443.1| unknown [Populus trichocarpa]
 gb|ERP48497.1| hypothetical protein POPTR_0021s00340g [Populus trichocarpa]
Length=219

 Score =   272 bits (695),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 195/221 (88%), Gaps = 4/221 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +IF+EMA+I +FVF+TPLRKL+I+ LDRVKRGRG ++VKTVAGTVFVV++S++
Sbjct  1    MIQLLFTVIFSEMAMILLFVFKTPLRKLLIMSLDRVKRGRGPVMVKTVAGTVFVVLMSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ RWI+D GG + PTDQ+LLA+HLLEA+LMG  LFLGLMIDRLHHYIRELRMRR
Sbjct  61   YSMVKIQKRWIDD-GGAVNPTDQVLLAKHLLEATLMGSILFLGLMIDRLHHYIRELRMRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTME VKKQNR+ ++GK    EE K+LE +AS+LRE++KQLESE+E K+KE ++SEANA+
Sbjct  120  KTMEDVKKQNRSFEDGKV---EETKALEAEASTLREKLKQLESELEIKTKEVNTSEANAV  176

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL KQSEGFLLEYDRLLEENQ+LRSQLQSLD + S S SKK
Sbjct  177  ALSKQSEGFLLEYDRLLEENQNLRSQLQSLDLRFSRSTSKK  217



>ref|XP_006449764.1| hypothetical protein CICLE_v10016599mg [Citrus clementina]
 gb|ESR63004.1| hypothetical protein CICLE_v10016599mg [Citrus clementina]
Length=223

 Score =   272 bits (695),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 194/223 (87%), Gaps = 0/223 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M QLLF ++F+EMALI + +F+TPLRKL+I+ LDRVKRGRG +VVKTVAGTV V+++S++
Sbjct  1    MQQLLFTVMFSEMALIIVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN++ ++ RWI+DEG  + PTDQ+LLA HLLEA+LMG SLFL  MIDRLHHYIRELR+RR
Sbjct  61   YNIMIIQKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRR  120

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEA+K Q+R  ++GKA  SEEIK+LE+Q ++L+ ++K+LESE+E KSKEA+++E NA+
Sbjct  121  KTMEAIKNQSRGFEDGKAAGSEEIKALEDQMTTLKSKLKELESELETKSKEANAAETNAV  180

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            AL+KQSEGFL EYDRLLEENQ+LR+QLQSLD +LSHS SKK S
Sbjct  181  ALRKQSEGFLFEYDRLLEENQNLRNQLQSLDWRLSHSGSKKDS  223



>gb|KDO78297.1| hypothetical protein CISIN_1g021727mg [Citrus sinensis]
Length=223

 Score =   271 bits (693),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 193/223 (87%), Gaps = 0/223 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M QLLF ++F+EMALI + +F+TPLRKL+I+ LDRVKRGRG +VVKTVAGTV V+++S++
Sbjct  1    MQQLLFTVMFSEMALIMVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN++ ++ RWI+DEG  + PTDQ+LLA HLLEA+LMG SLFL  MIDRLHHYIRELR+RR
Sbjct  61   YNIMMIQKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRR  120

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEA+K Q+R  ++GKA  SEEIK+LE+Q ++L+ ++K LESE+E KSKEA+++E NA+
Sbjct  121  KTMEAIKNQSRGFEDGKAASSEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAV  180

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            AL+KQSEGFL EYDRLLEENQ+LR+QLQSLD +LSHS SKK S
Sbjct  181  ALRKQSEGFLFEYDRLLEENQNLRNQLQSLDWRLSHSGSKKDS  223



>ref|XP_006467408.1| PREDICTED: B-cell receptor-associated protein 31-like isoform 
X2 [Citrus sinensis]
Length=223

 Score =   271 bits (692),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 193/223 (87%), Gaps = 0/223 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M QLLF ++F+EMALI + +F+TPLRKL+I+ LDRVKRGRG +VVKTVAGTV V+++S++
Sbjct  1    MQQLLFTVMFSEMALIMVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN++ ++ RWI+DEG  + PTDQ+LLA HLLEA+LMG SLFL  MIDRLHHYIRELR+RR
Sbjct  61   YNIMIIQKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRR  120

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEA+K Q+R  ++GKA  SEEIK+LE+Q ++L+ ++K LESE+E KSKEA+++E NA+
Sbjct  121  KTMEAIKNQSRGFEDGKAASSEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAV  180

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            AL+KQSEGFL EYDRLLEENQ+LR+QLQSLD +LSHS SKK S
Sbjct  181  ALRKQSEGFLFEYDRLLEENQNLRNQLQSLDWRLSHSGSKKDS  223



>ref|XP_011008025.1| PREDICTED: uncharacterized protein LOC105113519 [Populus euphratica]
Length=219

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 195/221 (88%), Gaps = 4/221 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +IF+EMA+I +FVF+TPLRKL+I+ LDRVKRGRG ++VKTVAGTVFVV++S++
Sbjct  1    MIQLLFTVIFSEMAMILLFVFKTPLRKLLIMSLDRVKRGRGPVMVKTVAGTVFVVLMSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ RWI+D GG + PTDQ+LLA+HLLEA+LMG  LFLGLMIDRLHHYIRELR+RR
Sbjct  61   YSMVKIQKRWIDD-GGAVNPTDQVLLAKHLLEATLMGSILFLGLMIDRLHHYIRELRVRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTME VKKQNR+ ++GK    EE K+LE +AS+LRE+++QLESE+E K+KE ++SEANAI
Sbjct  120  KTMEDVKKQNRSFEDGKV---EETKALEAEASTLREKLQQLESELEIKTKEVNTSEANAI  176

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL KQSEGFLLEYDRLLEENQ+LRSQLQSLD + S S SKK
Sbjct  177  ALSKQSEGFLLEYDRLLEENQNLRSQLQSLDLRFSRSTSKK  217



>gb|KDO78296.1| hypothetical protein CISIN_1g021727mg [Citrus sinensis]
Length=308

 Score =   271 bits (694),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 192/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M QLLF ++F+EMALI + +F+TPLRKL+I+ LDRVKRGRG +VVKTVAGTV V+++S++
Sbjct  1    MQQLLFTVMFSEMALIMVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN++ ++ RWI+DEG  + PTDQ+LLA HLLEA+LMG SLFL  MIDRLHHYIRELR+RR
Sbjct  61   YNIMMIQKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRR  120

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEA+K Q+R  ++GKA  SEEIK+LE+Q ++L+ ++K LESE+E KSKEA+++E NA+
Sbjct  121  KTMEAIKNQSRGFEDGKAASSEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAV  180

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKV  113
            AL+KQSEGFL EYDRLLEENQ+LR+QLQSLD +LSHSD + V
Sbjct  181  ALRKQSEGFLFEYDRLLEENQNLRNQLQSLDWRLSHSDFRTV  222



>ref|XP_007026129.1| B-cell receptor-associated 31-like [Theobroma cacao]
 gb|EOY28751.1| B-cell receptor-associated 31-like [Theobroma cacao]
Length=221

 Score =   266 bits (680),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 191/221 (86%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF ++F+EMA+I +  F+TPLRKLVI+GLDRVKRGRG ++VKTVAGTV VVM+S++
Sbjct  1    MIQLLFLVVFSEMAVIVVLSFKTPLRKLVIMGLDRVKRGRGPVMVKTVAGTVSVVMMSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ RWI+D  G   PTDQ+L+A+HLLEA+LMG SLFL LMIDRLHHYIRELR+RR
Sbjct  61   YSMMKIQKRWIDD--GAANPTDQVLMAKHLLEATLMGASLFLALMIDRLHHYIRELRLRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEA KKQ R  ++ K G S E+K+LEE+ ++LRE+ KQLES++E K+KE +++EANA+
Sbjct  119  KNMEAAKKQGRGFEDVKPGGSNEVKALEEEVTALREKFKQLESDLETKTKEMNAAEANAV  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFLLEYDRLLEENQ+LR+QLQSLD++LS S SKK
Sbjct  179  ALRKQSEGFLLEYDRLLEENQNLRNQLQSLDQRLSRSGSKK  219



>ref|XP_006467407.1| PREDICTED: B-cell receptor-associated protein 31-like isoform 
X1 [Citrus sinensis]
Length=242

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 190/218 (87%), Gaps = 0/218 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M QLLF ++F+EMALI + +F+TPLRKL+I+ LDRVKRGRG +VVKTVAGTV V+++S++
Sbjct  1    MQQLLFTVMFSEMALIMVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN++ ++ RWI+DEG  + PTDQ+LLA HLLEA+LMG SLFL  MIDRLHHYIRELR+RR
Sbjct  61   YNIMIIQKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRR  120

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEA+K Q+R  ++GKA  SEEIK+LE+Q ++L+ ++K LESE+E KSKEA+++E NA+
Sbjct  121  KTMEAIKNQSRGFEDGKAASSEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAV  180

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSD  125
            AL+KQSEGFL EYDRLLEENQ+LR+QLQSLD +LSHS+
Sbjct  181  ALRKQSEGFLFEYDRLLEENQNLRNQLQSLDWRLSHSE  218



>ref|XP_010244479.1| PREDICTED: B-cell receptor-associated protein 31-like [Nelumbo 
nucifera]
Length=222

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 193/221 (87%), Gaps = 1/221 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +IF+EMALI +F+F+TPLRKLVI+GLDRVKRGRG ++VKTVAGTVFVV+LS++
Sbjct  1    MIQLLFTIIFSEMALILLFLFKTPLRKLVIMGLDRVKRGRGPVMVKTVAGTVFVVLLSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ R + D    + PTDQ+L+A+HLLEASLMGFSLFL LMIDRLHHYIRELR+ R
Sbjct  61   YSMMKIQKRSM-DAAVVVNPTDQVLMAKHLLEASLMGFSLFLALMIDRLHHYIRELRLLR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEA+KKQNR  ++GK G++EE K+LEE+ ++LR ++KQLESE E ++KE  ++EAN +
Sbjct  120  KGMEAIKKQNRGFEDGKNGVAEETKALEEEMANLRGKVKQLESECEVQTKELKTAEANTV  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEG LLEYDRL+E+NQ+LR+QLQS+DR+LS SDSKK
Sbjct  180  ALRKQSEGILLEYDRLMEDNQNLRNQLQSIDRRLSRSDSKK  220



>ref|XP_004134773.1| PREDICTED: uncharacterized protein LOC101221743 [Cucumis sativus]
 gb|KGN49093.1| hypothetical protein Csa_6G513570 [Cucumis sativus]
Length=221

 Score =   258 bits (660),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 144/223 (65%), Positives = 191/223 (86%), Gaps = 2/223 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +I +EM LI +F F+TPLRKLVIL +DR+KRGRG I+VKTVAGTV +V+LS++
Sbjct  1    MIQLLFTVIISEMVLILLFSFKTPLRKLVILAVDRMKRGRGPIMVKTVAGTVLIVLLSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++++++ RWI+D  G I PTDQ+L+ +HLLEA+LMG SLFL LMIDRLHHY+RELR+RR
Sbjct  61   YSMVTIQKRWIDD--GAINPTDQVLMVKHLLEATLMGGSLFLALMIDRLHHYMRELRLRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEA+KKQ+RA+++GK   SEEIK+LEE+ ++L  ++KQLES ++ K+K+ ++SEAN +
Sbjct  119  KGMEAIKKQSRAVEDGKVSKSEEIKALEEERTTLETKLKQLESVLDSKTKDITTSEANVV  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            AL+KQSEG LLEYDRLLEENQ+LR QLQS++R+LS S SKK S
Sbjct  179  ALRKQSEGLLLEYDRLLEENQNLRGQLQSVERRLSRSGSKKNS  221



>ref|XP_008440020.1| PREDICTED: B-cell receptor-associated protein 29 [Cucumis melo]
Length=221

 Score =   258 bits (658),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 145/223 (65%), Positives = 192/223 (86%), Gaps = 2/223 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +I +EM LI +F F+TPLRKLVIL +DR+KRGRG I+VKTVAGTV +V+LS++
Sbjct  1    MIQLLFTVIISEMVLILLFSFKTPLRKLVILAVDRMKRGRGPIMVKTVAGTVLIVLLSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++++++ RWI+D  G I PTDQ+L+ +HLLEA+LMG SLFL LMIDRLHHY+RELR+RR
Sbjct  61   YSMVTIQKRWIDD--GAINPTDQVLMVKHLLEATLMGGSLFLALMIDRLHHYMRELRLRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEA+KKQ+RA+++GK   SEEIK+LEE+ ++L  ++KQLESE++ K+K+ ++SEAN +
Sbjct  119  KGMEAIKKQSRALEDGKVSKSEEIKALEEERTTLETKLKQLESELDSKTKDVTASEANVV  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            AL+KQSEG LLEYDRLLEENQ+LR QLQS++R+LS S SKK S
Sbjct  179  ALRKQSEGLLLEYDRLLEENQNLRGQLQSVERRLSRSGSKKNS  221



>gb|AFK47348.1| unknown [Lotus japonicus]
Length=222

 Score =   255 bits (652),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 186/221 (84%), Gaps = 1/221 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LLF +IF+E A+I + +F+TPLRKL+I+GLDR+KRGRG ++V+TV  TV VV+LS++
Sbjct  1    MIHLLFTVIFSEAAMIALLLFKTPLRKLMIMGLDRLKRGRGPLMVRTVGATVLVVLLSSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++ +++ R IED GG + PTDQ+L+A+HLLEA+LMG  LFL LMIDRLHHYIRELR+RR
Sbjct  61   YSMFNIQKRGIED-GGVVNPTDQVLMAKHLLEATLMGAVLFLALMIDRLHHYIRELRVRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEAVKKQ+R  D+GKA  SEEI+++EE+ + LR  I +LESE++ K+KE   +EAN  
Sbjct  120  KTMEAVKKQSRGSDDGKAAHSEEIRAMEEETTKLRAEINRLESELKSKTKEVDGAEANVS  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFLLEYDRLLEENQ+LR++LQS DR+LSHS SKK
Sbjct  180  ALRKQSEGFLLEYDRLLEENQNLRNELQSWDRRLSHSGSKK  220



>ref|XP_003534595.1| PREDICTED: B-cell receptor-associated protein 31 [Glycine max]
 gb|KHN40872.1| B-cell receptor-associated protein 31 [Glycine soja]
Length=222

 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 186/221 (84%), Gaps = 1/221 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +IF+E A+I + +F+TPLRKLVI+GLDR+KRGRG ++VKTVAGTV VV  S++
Sbjct  1    MIQLLFTVIFSETAMIALLLFKTPLRKLVIMGLDRLKRGRGPLMVKTVAGTVLVVFFSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++++++ R IE EG  + PTDQ+L+A+HLLEA+LMG  LFL LMIDRLHHYIRELR+RR
Sbjct  61   YSMVNIQKRGIE-EGAIVNPTDQVLMAKHLLEATLMGAILFLALMIDRLHHYIRELRIRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEAVKKQ R  ++GK   SEEIK++EE+ + LR  + +LESE++ K+K+  ++EAN  
Sbjct  120  KGMEAVKKQTRGTEDGKVANSEEIKAVEEERARLRAELSRLESELQSKTKDVDAAEANVA  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFLLEYDRLLEENQ+LR+QLQSLDRKLSHS SKK
Sbjct  180  ALRKQSEGFLLEYDRLLEENQNLRNQLQSLDRKLSHSGSKK  220



>ref|XP_011046959.1| PREDICTED: B-cell receptor-associated protein 31-like [Populus 
euphratica]
Length=219

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 191/221 (86%), Gaps = 4/221 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +IF+EMA+I +FVF++P+RK +I+ LDR+KRGRG ++VKTVAGTVFVV++S++
Sbjct  1    MIQLLFTVIFSEMAMILLFVFKSPIRKFLIMSLDRLKRGRGPVMVKTVAGTVFVVLMSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ R I D GG + PTDQ+L+A+HLLEA+LMG  LFL LMIDRLHHYIRELRMRR
Sbjct  61   YSMVKIQKRGI-DVGGVVNPTDQVLMAKHLLEATLMGSILFLSLMIDRLHHYIRELRMRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEAVKKQNR+ ++GK    EE K+LE + S+L+E++KQL+SE+E K+KE ++SEANAI
Sbjct  120  KSMEAVKKQNRSFEDGKV---EETKALETEVSTLQEKLKQLQSELEVKTKEVNTSEANAI  176

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL KQSEGFLLEYDRLLEENQ+LRSQLQS+D  LS S SKK
Sbjct  177  ALSKQSEGFLLEYDRLLEENQNLRSQLQSMDLGLSRSTSKK  217



>ref|XP_007212007.1| hypothetical protein PRUPE_ppa011145mg [Prunus persica]
 gb|EMJ13206.1| hypothetical protein PRUPE_ppa011145mg [Prunus persica]
Length=222

 Score =   254 bits (648),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 143/223 (64%), Positives = 189/223 (85%), Gaps = 1/223 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQL+F +I +EMALI  F+FRTP RKLVILGLD++KRGRG IVVKTVAGTV V +++++
Sbjct  1    MIQLMFIVILSEMALILAFLFRTPFRKLVILGLDQIKRGRGPIVVKTVAGTVLVALMTSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++I ++N  I D+   ++PTDQ+L+ +HLLEA+LMG SLFL LMIDRLHHYIRELR+RR
Sbjct  61   YSIIKIKNSRI-DKAAIVSPTDQVLMVKHLLEATLMGCSLFLALMIDRLHHYIRELRIRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEA+KKQNR  ++GKA   +EIK+LE + ++ R R+KQLESE+E K+K+  ++E+N +
Sbjct  120  KSMEAIKKQNRGSEDGKASSLDEIKALENEIATSRTRLKQLESEIETKTKDVHTAESNVL  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            AL+KQSEGFLLEYDRLLEENQ+L++QL+SLDRK+S S SKK S
Sbjct  180  ALRKQSEGFLLEYDRLLEENQNLKNQLKSLDRKMSRSGSKKDS  222



>ref|XP_008224696.1| PREDICTED: B-cell receptor-associated protein 31 [Prunus mume]
Length=222

 Score =   253 bits (647),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 143/223 (64%), Positives = 189/223 (85%), Gaps = 1/223 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQL+F +I +EMALI  F+FRTP RKLVILGLD++KRGRG IVVKTVAGTV V +++++
Sbjct  1    MIQLMFIVILSEMALILAFLFRTPFRKLVILGLDQIKRGRGPIVVKTVAGTVLVALMTSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++I ++N  I D+   ++PTDQ+L+ +HLLEA+LMG  LFL LMIDRLHHYIRELR+RR
Sbjct  61   YSIIKIKNSRI-DKAAIVSPTDQVLMVKHLLEATLMGCFLFLALMIDRLHHYIRELRIRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEA+KKQNR  ++GKA   +EIK+LE + ++LR R+KQLESE+E K+K+  ++E+N +
Sbjct  120  KSMEAIKKQNRGSEDGKASSLDEIKALENEIATLRTRLKQLESEIETKTKDVHTAESNVL  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            AL+KQSEGFLLEYDRLLEENQ+L++QL+SLDRK+S S SKK S
Sbjct  180  ALRKQSEGFLLEYDRLLEENQNLKNQLKSLDRKMSRSGSKKDS  222



>ref|XP_006383887.1| hypothetical protein POPTR_0004s00930g [Populus trichocarpa]
 gb|ERP61684.1| hypothetical protein POPTR_0004s00930g [Populus trichocarpa]
Length=219

 Score =   253 bits (646),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 190/221 (86%), Gaps = 4/221 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +IF+EMA+I +FVF++PLRK +I+ LDR+KRGRG ++VKTVAGTVF+V++S++
Sbjct  1    MIQLLFAVIFSEMAMILLFVFKSPLRKFLIMSLDRLKRGRGPVMVKTVAGTVFLVLISSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ R I D GG + PTDQ+L+A+HLLEA+LMG  LFL LMIDRLHHYIRELRMRR
Sbjct  61   YSMVKIQKRGI-DVGGVVNPTDQVLMAKHLLEATLMGSILFLSLMIDRLHHYIRELRMRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEAVKKQNR+ ++GK    EE K+LE + S+L+E++KQL+SE+E KSKE ++SEANA 
Sbjct  120  KSMEAVKKQNRSFEDGKV---EETKALETEVSTLQEKLKQLQSELEVKSKEVNTSEANAA  176

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL KQSEGFLLEYDRLLEENQ+LRSQLQS+D  LS S SKK
Sbjct  177  ALSKQSEGFLLEYDRLLEENQNLRSQLQSMDLGLSRSTSKK  217



>gb|KJB68573.1| hypothetical protein B456_010G251300 [Gossypium raimondii]
Length=222

 Score =   252 bits (644),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 189/221 (86%), Gaps = 1/221 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +IF+EMA+I +  F+TP RKLVI+GLDR+KRGRG +VVKTVAGTVFVVM+S++
Sbjct  1    MIQLLFMVIFSEMAVIMVLSFKTPFRKLVIMGLDRLKRGRGPVVVKTVAGTVFVVMVSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ RW++D+G  ++ TDQ+L+ +HLLEA+LMG ++FL LMIDRLHHYIRELR+RR
Sbjct  61   YSMMEIQKRWVDDDGP-VSSTDQVLMVRHLLEATLMGATIFLALMIDRLHHYIRELRIRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTM+AVKKQ +  D+ K    +++KSLEE+  +LRE++KQLES++E K+K+ +++E N +
Sbjct  120  KTMDAVKKQGQGSDDKKPDGFDKVKSLEEEVMTLREKLKQLESDIEAKTKQINAAEVNTV  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEG LLEYDRLLEEN+ LR QLQSLDRKLS SDSKK
Sbjct  180  ALRKQSEGLLLEYDRLLEENESLRGQLQSLDRKLSRSDSKK  220



>gb|ACU14586.1| unknown [Glycine max]
Length=225

 Score =   251 bits (642),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 142/223 (64%), Positives = 186/223 (83%), Gaps = 1/223 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +IF+E A+I + +F+TPLRKLVI+GLDR+KRGRG ++VKTVAGTV VV  S++
Sbjct  1    MIQLLFTVIFSETAMIALLLFKTPLRKLVIMGLDRLKRGRGPLMVKTVAGTVLVVFFSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++++++ R IE EG  + PTDQ+L+A+HLLEA+LMG  LFL LMIDRLHHYIRELR+RR
Sbjct  61   YSMVNIQKRGIE-EGAVVNPTDQVLMAKHLLEATLMGAILFLALMIDRLHHYIRELRIRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEAVKKQ R  ++GK   SEEIK++EE+ + LR  + +LESE++ K+K+  ++EAN  
Sbjct  120  KGMEAVKKQTRGTEDGKVANSEEIKAVEEERARLRAELSRLESELQSKTKDVDAAEANVA  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            AL+KQSEGFLLEYDRLLEENQ+LR+QLQSLDRKLSHS  +++ 
Sbjct  180  ALRKQSEGFLLEYDRLLEENQNLRNQLQSLDRKLSHSVPRRIC  222



>ref|XP_011086195.1| PREDICTED: B-cell receptor-associated protein 31-like [Sesamum 
indicum]
Length=221

 Score =   250 bits (639),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 189/221 (86%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQ+LF LIFAEMALI +F+F+ PLRK VI+GLDR+KRG G IVV+TV GTVFVVML+T+
Sbjct  1    MIQVLFALIFAEMALIVLFIFKNPLRKTVIMGLDRIKRGSGPIVVQTVGGTVFVVMLATL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN ++++ R + D   D   TDQIL A+HLL ASLMGFSLFL L IDRLHHYIRELR+ R
Sbjct  61   YNAVAIKRRQMRDATTD--STDQILCARHLLGASLMGFSLFLVLTIDRLHHYIRELRIWR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K++EA+KKQN+A+++ K  +S++IK +EE+ ++L+ERIK+LE+++EEKSKEAS + A+A+
Sbjct  119  KSIEALKKQNQALEDEKPAVSKQIKVMEEEKATLQERIKELETQLEEKSKEASRAGASAV  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            ALKKQS+GFL+EY+RLLEENQ LRSQLQSLDRK S+SD KK
Sbjct  179  ALKKQSDGFLIEYERLLEENQKLRSQLQSLDRKFSYSDIKK  219



>ref|NP_001236308.1| uncharacterized protein LOC100526943 [Glycine max]
 gb|ACU15966.1| unknown [Glycine max]
 gb|KHN33010.1| B-cell receptor-associated protein 31 [Glycine soja]
Length=222

 Score =   250 bits (638),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 185/221 (84%), Gaps = 1/221 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +IF+E ++I + +F+TPLRKLVI+GLDR+KRGRG ++VKTVAGTV VV+LS++
Sbjct  1    MIQLLFTVIFSEASMIALLLFKTPLRKLVIMGLDRLKRGRGPLMVKTVAGTVLVVLLSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ R I+ EG  + PTDQ+L+A+HLLEA+LM   LFL LMIDRLHHYIRELR+RR
Sbjct  61   YSMLKIQKRGIQ-EGAVVNPTDQVLMAKHLLEATLMVAVLFLALMIDRLHHYIRELRIRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEAVKKQ R  ++GK   SEEIKS+EE+ + LR  + +LESE++ K+K+   +EAN  
Sbjct  120  KGMEAVKKQTRGTEDGKVANSEEIKSVEEERARLRAELSRLESELQSKTKDVDGAEANIA  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFLLEYDRLLEENQ+LR+QLQSLDRKLSHS SKK
Sbjct  180  ALRKQSEGFLLEYDRLLEENQNLRNQLQSLDRKLSHSGSKK  220



>gb|KHG15358.1| B-cell receptor-associated 31 [Gossypium arboreum]
Length=222

 Score =   249 bits (635),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 188/221 (85%), Gaps = 1/221 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +IF+EMA+I +  F+TP RKLVI+GLDR+KRGRG +VVKTVAGTVFVVM+S++
Sbjct  1    MIQLLFMVIFSEMAVIMVLSFKTPFRKLVIMGLDRLKRGRGPVVVKTVAGTVFVVMVSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ RW+ D+G  ++ TDQ+L+ +HLLEA+LMG ++FL LMIDRLHHYIRELR+RR
Sbjct  61   YSMMEIQKRWVGDDG-PVSSTDQVLMVRHLLEATLMGATIFLALMIDRLHHYIRELRIRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTM+AVKKQ +  ++ K    ++IKSLEE+  +LRE++KQLES++E K+K+ +++E N +
Sbjct  120  KTMDAVKKQGQGSNDKKPDGFDKIKSLEEEVMTLREKLKQLESDIEAKTKQINAAEVNTV  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEG LLEYDRLLEEN+ LR QLQSLDRKLS SDSKK
Sbjct  180  ALRKQSEGLLLEYDRLLEENESLRVQLQSLDRKLSRSDSKK  220



>ref|XP_002518447.1| bcr-associated protein, bap, putative [Ricinus communis]
 gb|EEF43834.1| bcr-associated protein, bap, putative [Ricinus communis]
Length=218

 Score =   248 bits (634),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 188/221 (85%), Gaps = 5/221 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF  IF+EMALI I VF+TP RKLV++GLDRVKRG G I+VKTVAGT+ VV++S++
Sbjct  1    MIQLLFTGIFSEMALILILVFKTPFRKLVLMGLDRVKRGSGPIIVKTVAGTILVVLISSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ R I++  G + PTDQ+L+A+HLLEA+LMG  LFL LMIDRLHHYIRELRMRR
Sbjct  61   YSMMKIQKRGIDE--GFVNPTDQVLMAKHLLEATLMGAMLFLALMIDRLHHYIRELRMRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEAVKKQ+R  ++GKA   EE K+L E+ ++LR R+KQLESE+E K+KEA +SE NA+
Sbjct  119  KSMEAVKKQSRVAEDGKA---EENKALGEEMTTLRARLKQLESELEVKTKEAHASETNAV  175

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFLLEYDRLLEENQ+LR+QLQSLD +LS S SKK
Sbjct  176  ALRKQSEGFLLEYDRLLEENQNLRNQLQSLDLRLSRSGSKK  216



>ref|XP_012091317.1| PREDICTED: uncharacterized protein LOC105649311 [Jatropha curcas]
Length=218

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 188/221 (85%), Gaps = 5/221 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LL+ +IF+EM LI + +F+TPLRKLV++ LDRVKRGRG IVVKTVAGTV VV++S++
Sbjct  1    MINLLYTVIFSEMTLIMVLIFKTPLRKLVLMVLDRVKRGRGPIVVKTVAGTVLVVLISSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ RWI DEG  + PTDQ+L++ HLL+A+LMGF LFL LMIDRLHHYIRELRMRR
Sbjct  61   YSMMKIQKRWI-DEGA-VNPTDQVLMSGHLLQATLMGFCLFLALMIDRLHHYIRELRMRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEA+KKQ+RA ++GK    EE K++EE+ ++LR ++K LES++E K+KEA +SEANA+
Sbjct  119  KSMEAIKKQSRAFEDGKV---EESKAMEEEITTLRAKLKHLESDLEMKTKEAHASEANAV  175

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            ALKKQ+EGFLLEYDRL EENQ+LR+QLQSLD  LS S SKK
Sbjct  176  ALKKQAEGFLLEYDRLHEENQNLRNQLQSLDLTLSRSGSKK  216



>ref|XP_004486174.1| PREDICTED: B-cell receptor-associated protein 29-like [Cicer 
arietinum]
Length=222

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 181/221 (82%), Gaps = 1/221 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +IF E A+I + +F+TPLRKLVI+ LDR+KRGRG ++VKT+AGT+ VV+ S+I
Sbjct  1    MIQLLFTIIFCEAAMIALLLFKTPLRKLVIMALDRLKRGRGPLMVKTIAGTLLVVLSSSI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ R IED    + PTDQ+L+A+HLLEA+LMG  LFL LM+DRLHHYIRELR+RR
Sbjct  61   YSMLKIQKRGIEDAAA-VNPTDQVLMAKHLLEATLMGAVLFLALMVDRLHHYIRELRIRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEAVKKQ R  ++ KA  SE+ K++EE+A+ LR  + +LESE++ K+KE   SEAN  
Sbjct  120  KSMEAVKKQMRGSEDAKAATSEDTKAMEEEAAKLRAAVNRLESELQSKNKEVGVSEANVN  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFLLEYDRLLEENQ LR+QLQS+DR+ SHS SKK
Sbjct  180  ALRKQSEGFLLEYDRLLEENQSLRNQLQSVDRRFSHSASKK  220



>ref|XP_002270301.1| PREDICTED: B-cell receptor-associated protein 31-like [Vitis 
vinifera]
Length=214

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 181/214 (85%), Gaps = 2/214 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +IFAEMALI   +F+TPLRKLV++ LDRVKRGRG I+ +TVA TVFVV++S++
Sbjct  1    MIQLLFTVIFAEMALIMTLLFKTPLRKLVVMALDRVKRGRGPIMAQTVATTVFVVLMSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++NR +E   G I PTDQ+L+A+HLLEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSMMKIQNRSVEP--GLINPTDQVLMARHLLEASLMGFLLFLALMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEA KKQNR  ++GK G +EE K++ E+ SSLR +IK+LESE E K+KEA ++EAN +
Sbjct  119  KAMEAEKKQNRGFEDGKNGRAEEAKAMGEEMSSLRTQIKKLESECETKAKEAEAAEANTV  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKL  137
            ALKKQSEGFLLEYDRLLEENQ+L+SQL+S+D+ L
Sbjct  179  ALKKQSEGFLLEYDRLLEENQNLKSQLESIDQGL  212



>gb|KEH36901.1| B-cell receptor-associated-like protein [Medicago truncatula]
Length=222

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 183/221 (83%), Gaps = 1/221 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LLF LIF+E  +I + +F+TPLRKLVI+ LDR+KRGRG ++VKTVAGTV VV+ S++
Sbjct  1    MIHLLFTLIFSEATMIALLLFKTPLRKLVIMALDRLKRGRGPVMVKTVAGTVLVVLSSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ R IED G  + PTDQ+L+A+HLLEA+LMG  LFL LMIDRLHHYIRELR+RR
Sbjct  61   YSMMKIQQRGIED-GASVNPTDQVLMAKHLLEATLMGAILFLALMIDRLHHYIRELRIRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEAVKKQ R  ++ KAG S+E K++E++A+ LR  + +LESE++ K KE  ++EA+  
Sbjct  120  KSMEAVKKQMRGAEDAKAGTSDETKTMEQEAAKLRAEVGRLESELQSKDKEVGAAEASVS  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFLLEYDRLLEENQ+LR+QLQS+DR+ SHS SKK
Sbjct  180  ALRKQSEGFLLEYDRLLEENQNLRNQLQSVDRRFSHSVSKK  220



>ref|XP_010099186.1| B-cell receptor-associated protein 31 [Morus notabilis]
 gb|EXB77058.1| B-cell receptor-associated protein 31 [Morus notabilis]
Length=209

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 179/211 (85%), Gaps = 2/211 (1%)
 Frame = -1

Query  742  MALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTIYNVISLRNRWIE  563
            MA+I +  F+TPLRKLVI+ LDRVKRGRG +VVKTV+ T  V++ S++Y+++ ++ RWI+
Sbjct  1    MAVIILMSFKTPLRKLVIMALDRVKRGRGPVVVKTVSATAAVLLASSVYSMVKIQKRWID  60

Query  562  DEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRRKTMEAVKKQNRA  383
            D  G   PTDQ+++A+HLLEA+LMG SLFL LMIDRLHHYIRELR+RRKT+EAVKKQN+A
Sbjct  61   D--GASNPTDQVIMAKHLLEATLMGSSLFLVLMIDRLHHYIRELRIRRKTLEAVKKQNQA  118

Query  382  IDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAIALKKQSEGFLLE  203
             ++GK G S+EIK+ EE+ ++LR  +KQLESE+E K+K+  ++EANA+AL+KQSEGFLLE
Sbjct  119  FEDGKTGGSDEIKAKEEEMATLRTTLKQLESELETKTKDIHAAEANAVALQKQSEGFLLE  178

Query  202  YDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            YDRLLEENQ+LR+QLQ LDR LS S+SKK S
Sbjct  179  YDRLLEENQNLRNQLQILDRGLSRSNSKKNS  209



>ref|XP_004293309.1| PREDICTED: B-cell receptor-associated protein 31-like [Fragaria 
vesca subsp. vesca]
Length=222

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 186/221 (84%), Gaps = 1/221 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +I +EMALI   +FRTPLRKLVI+GLD++KRGRG +VVKT AGTVFVV+L+++
Sbjct  1    MIQLLFIVIISEMALILACLFRTPLRKLVIVGLDQIKRGRGPVVVKTAAGTVFVVLLTSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y ++ ++ R   D  G ++PTDQIL+ +HLLE +LMGF LFL LMIDR+HHYIRELR+RR
Sbjct  61   YGMVKIK-RSGADAVGILSPTDQILMFKHLLEVTLMGFFLFLVLMIDRIHHYIRELRVRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEA+KKQNR  ++GKAG  +E+K+LE + S+ R RIKQLES +E  +KEA ++EA+  
Sbjct  120  KTMEAIKKQNRGSEDGKAGGLDEVKALENEMSTSRLRIKQLESNIETTTKEAHAAEASVD  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFLLEYDRLLEENQ+L++QLQSLDRK+SHS SKK
Sbjct  180  ALRKQSEGFLLEYDRLLEENQNLKNQLQSLDRKVSHSGSKK  220



>gb|AFK46642.1| unknown [Medicago truncatula]
Length=222

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 182/221 (82%), Gaps = 1/221 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LLF LIF+E  +I + +F+TPLRKLVI+ LDR+KRGRG ++VKTVAGTV VV+ S++
Sbjct  1    MIHLLFTLIFSEATMIALPLFKTPLRKLVIMALDRLKRGRGPVMVKTVAGTVLVVLSSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ R IED G  + PTDQ+L+A+HLLEA+LMG  LFL LMIDRLHHYIRELR+RR
Sbjct  61   YSMMKIQQRGIED-GASVNPTDQVLMAKHLLEATLMGAILFLALMIDRLHHYIRELRIRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEAVKKQ R  ++ KAG S+E K++E++A+ LR  + +LESE++ K KE  ++EA   
Sbjct  120  KSMEAVKKQMRGAEDAKAGTSDETKTMEQEAAKLRAEVGRLESELQSKDKEVGAAEAGVS  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFLLEYDRLLEENQ+LR+QLQS+DR+ SHS SKK
Sbjct  180  ALRKQSEGFLLEYDRLLEENQNLRNQLQSVDRRFSHSVSKK  220



>ref|XP_008784370.1| PREDICTED: B-cell receptor-associated protein 31-like [Phoenix 
dactylifera]
Length=221

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 183/221 (83%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI+LLF L+ AE+ ++ + +F+TPLRKL ILGLDR+KRGRG ++VKTVA T+ +V+ S++
Sbjct  1    MIRLLFTLLSAEVGVVVVLLFKTPLRKLAILGLDRLKRGRGPVMVKTVAATLLIVLASSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  +R+   E   G +TPTDQ+L+++HLLEASLMG+SLFL L+IDRLHHYIRELR  R
Sbjct  61   YSIAKIRSHSTEI--GSLTPTDQVLMSRHLLEASLMGYSLFLALIIDRLHHYIRELRGLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEAV KQNRA++E K G S+E+KS ++  ++L E IK L+ E+E ++KEA ++EAN  
Sbjct  119  KNMEAVMKQNRALEETKGGGSDELKSQDKDITNLNEEIKHLKLELEARTKEAKAAEANTT  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFLLEYDRLLE+NQ+LR+QLQSLD++LSHSDSKK
Sbjct  179  ALRKQSEGFLLEYDRLLEDNQNLRNQLQSLDQRLSHSDSKK  219



>ref|XP_009390004.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009390005.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 178/221 (81%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF L+ AE+A++G+ +F TPLRKL +LGLDR+KRGRG +VV+T+A T  VV+ S++
Sbjct  1    MIQLLFALLLAEVAVVGVLLFNTPLRKLALLGLDRLKRGRGPLVVRTIAATGLVVLGSSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  + +R   D+ G +TPTDQ+L ++H LEASLMG+SLFL L+IDRLHHYIRE R  R
Sbjct  61   YSMSKIWSR--SDQIGALTPTDQVLHSRHFLEASLMGYSLFLALIIDRLHHYIREWRGLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEA  KQNR ++E K+G S+EIK  EE+ +SL E I+QL+   EE+ KE  ++EANAI
Sbjct  119  KSMEAATKQNRLLEEAKSGKSDEIKGREEKITSLNEEIQQLKLASEERMKEVKTAEANAI  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEG LLEYDRLLE+NQ+LRSQLQS+D  LSHSDSKK
Sbjct  179  ALRKQSEGLLLEYDRLLEDNQNLRSQLQSIDHHLSHSDSKK  219



>ref|XP_010057913.1| PREDICTED: B-cell receptor-associated protein 31-like [Eucalyptus 
grandis]
 gb|KCW75271.1| hypothetical protein EUGRSUZ_E04024 [Eucalyptus grandis]
Length=223

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 182/221 (82%), Gaps = 0/221 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF  I AE +LI + +F+TPLRKL I+GLDRVKRG G +VV TVA TV VV+ S +
Sbjct  1    MIQLLFAAILAEGSLILLLLFKTPLRKLAIVGLDRVKRGHGPVVVTTVAATVCVVLGSGV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ +R R  ED GG   PTDQ+L+A+HLLE +LMG +LFL LMIDRLHHYIRELR+RR
Sbjct  61   YSMVKIRRRGAEDGGGAANPTDQVLMAKHLLECTLMGATLFLALMIDRLHHYIRELRLRR  120

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEAVKKQ RA ++GK G  EE+K+LEE+   LRE++KQLES+++ ++K+  ++EAN++
Sbjct  121  KSMEAVKKQTRAFEDGKNGNLEELKNLEEETRVLREKVKQLESDLDTRTKDVHAAEANSV  180

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFLLEYDRLLEENQ+LR+QLQSLDRK S S SKK
Sbjct  181  ALRKQSEGFLLEYDRLLEENQNLRNQLQSLDRKFSRSGSKK  221



>ref|XP_007147709.1| hypothetical protein PHAVU_006G148100g [Phaseolus vulgaris]
 gb|ESW19703.1| hypothetical protein PHAVU_006G148100g [Phaseolus vulgaris]
Length=222

 Score =   238 bits (608),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 186/221 (84%), Gaps = 1/221 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LLF LIF+E  +I + +F+TPLRKLVI+GLDR+KRGRG ++VKTVAGT+ VV+LS++
Sbjct  1    MIHLLFTLIFSEAGMIALLLFKTPLRKLVIMGLDRLKRGRGPLIVKTVAGTILVVLLSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++I ++   IED GG + PTDQ+L+A+HLLEA+LMG  LFL LMIDRLHHYIRELR+RR
Sbjct  61   YSMIKIQKHEIED-GGSVNPTDQVLMAKHLLEATLMGGILFLALMIDRLHHYIRELRIRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEAVKKQ R  ++GK   SEE+K++EE+ + LR  +++LESE++ K+K+A  +EAN  
Sbjct  120  KGMEAVKKQTRGSEDGKFTFSEEMKAVEEERARLRAELRRLESELQSKTKDADIAEANVS  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFLLEYDRLLEENQ+LRSQLQSLDRKLSHS SKK
Sbjct  180  ALRKQSEGFLLEYDRLLEENQNLRSQLQSLDRKLSHSGSKK  220



>ref|XP_010689493.1| PREDICTED: B-cell receptor-associated protein 31 [Beta vulgaris 
subsp. vulgaris]
Length=221

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 176/221 (80%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LLF +IF EMA+I + +FRTPLRKLVILGLDR+KRGRG IV+ TV GT+ V++++TI
Sbjct  1    MIHLLFSVIFMEMAVILLLLFRTPLRKLVILGLDRMKRGRGPIVITTVGGTILVLLVTTI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
              +++++ R IE   G I PTDQIL  + LL+ASLMGF LFLGLM+DRLHHYIRELR+ R
Sbjct  61   STIVNIQQRDIEP--GTINPTDQILFTRSLLDASLMGFILFLGLMMDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEAVKKQNR+ D+ K G SEE+K++EE+ ++L+ RIK +ESE   K+ E  +SE+ + 
Sbjct  119  KTMEAVKKQNRSFDDAKNGSSEELKAMEEEVATLKSRIKTMESECVAKTDEIKASESKSE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            ALKKQSEG LLEYDRLLE+NQ LR QL+ + + L++SD KK
Sbjct  179  ALKKQSEGLLLEYDRLLEDNQSLRGQLEEIGQSLANSDGKK  219



>ref|XP_003605958.1| hypothetical protein MTR_4g049540 [Medicago truncatula]
 gb|AES88155.1| B-cell receptor-associated-like protein [Medicago truncatula]
 gb|AFK41440.1| unknown [Medicago truncatula]
Length=221

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 173/221 (78%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+  IF EM LI   VF+TPLRKLVI+ LDRVKRGRG IVV TV  T+ VV+ S++
Sbjct  1    MLQLLYTAIFGEMLLILTLVFKTPLRKLVIVSLDRVKRGRGPIVVTTVGATLIVVLSSSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  ++ R +E   G + PTDQ+L+++H+LEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSMAKIQQRTVE--AGVLNPTDQVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEAVKKQ R+ ++GK G +EE K+L E+ ++L+ ++K+LESE E K  +  + E    
Sbjct  119  KTMEAVKKQTRSFEDGKNGSTEEQKALTEEITTLKSKVKKLESECEAKGTKEKTLETEVE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            ALKKQSEGFL+EYDRLLE+NQ+LRSQL+++D+  SH D+KK
Sbjct  179  ALKKQSEGFLMEYDRLLEDNQNLRSQLEAIDQSSSHLDNKK  219



>gb|AFK33681.1| unknown [Medicago truncatula]
Length=221

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 172/221 (78%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+  IF EM LI   VF+TPLRKLVI+ LDRVKRGRG IVV TV  T+ VV+ S++
Sbjct  1    MLQLLYTAIFGEMLLILTLVFKTPLRKLVIVSLDRVKRGRGPIVVTTVGATLIVVLSSSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  ++ R +E   G + PTDQ+L+++H+LEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSMAKIQQRTVE--AGVLNPTDQVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEAVKKQ R+ ++GK G +EE K+L E+ ++L+ ++K+LESE E K  +  + E    
Sbjct  119  KTMEAVKKQTRSFEDGKNGSTEEQKALTEEITTLKSKVKKLESECEAKGTKEKTLETEVE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            ALKKQSEGF LEYDRLLE+NQ+LRSQL+++D+  SH D+KK
Sbjct  179  ALKKQSEGFFLEYDRLLEDNQNLRSQLEAIDQSSSHLDNKK  219



>ref|XP_008780367.1| PREDICTED: uncharacterized protein LOC103700158 [Phoenix dactylifera]
 ref|XP_008780411.1| PREDICTED: uncharacterized protein LOC103700158 [Phoenix dactylifera]
Length=221

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 188/221 (85%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF L+ AE+A++ + +F+TPLRKL  LGLD +KRGRG ++VKTVAGTV +V+ S++
Sbjct  1    MIQLLFALLSAEVAMVVLLLFKTPLRKLATLGLDHLKRGRGPVMVKTVAGTVLLVLASSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ +R R+ E   G +TPTDQ+L++Q+LLEASLMG+SLFL L+IDRLHHYIRELR  R
Sbjct  61   YSMVEIRGRFTEI--GSLTPTDQVLMSQNLLEASLMGYSLFLALIIDRLHHYIRELRRLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEAV KQNRA++E K G S+E+KS +++ ++L E+IKQL+ E+E ++KEA ++EA+A 
Sbjct  119  KSMEAVMKQNRALEETKNGGSDELKSRDKEVTNLNEQIKQLKLELEARTKEAKAAEASAT  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            ALKKQSEGFLLEYD LLE+N++LR+QLQS+D +LSH+DSKK
Sbjct  179  ALKKQSEGFLLEYDHLLEDNKNLRNQLQSIDLRLSHADSKK  219



>gb|KHG10853.1| B-cell receptor-associated 31 [Gossypium arboreum]
Length=219

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 185/221 (84%), Gaps = 4/221 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M QLLF +IF+EMA+I +  F+TPLRKL ++ LDRVKRGRG ++VKTVA T+ VVM+S++
Sbjct  1    MFQLLFLVIFSEMAVIMVLSFKTPLRKLTLMVLDRVKRGRGPLMVKTVAATIAVVMISSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ RWI+D  G   PT+QIL+ +HLLEA+LMG  LFL LMIDRLHHYIRELR+RR
Sbjct  61   YSMMMIQKRWIDD--GSANPTEQILMVKHLLEATLMGGVLFLALMIDRLHHYIRELRIRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEA+KKQ    ++GK+G S+++K+LE + ++L+ ++KQLES++E K+KE  +++ANA+
Sbjct  119  KSMEAIKKQGP--EDGKSGGSDKVKALEGEVTTLQAKLKQLESDLETKTKEMDAADANAV  176

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFLLEYDRLLEENQ+LR+QL+SL++  S S +KK
Sbjct  177  ALRKQSEGFLLEYDRLLEENQNLRNQLESLEQSPSRSGNKK  217



>gb|ACJ84514.1| unknown [Medicago truncatula]
Length=221

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 172/221 (78%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+  IF EM LI   VF+TPLRKLVI+ LDRVKRGRG IVV TV  T+ VV+ S++
Sbjct  1    MLQLLYTAIFGEMLLILTLVFKTPLRKLVIVSLDRVKRGRGPIVVTTVGATLIVVLSSSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  ++ R +E   G + PTDQ+L+++H+LEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSMAKIQQRTVE--AGVLNPTDQVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KT EAVKKQ R+ ++GK G +EE K+L E+ ++L+ ++K+LESE E K  +  + E    
Sbjct  119  KTTEAVKKQTRSFEDGKNGSTEEQKALTEEITTLKSKVKKLESECEAKGTKEKTLETEVE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            ALKKQSEGFL+EYDRLLE+NQ+LRSQL+++D+  SH D+KK
Sbjct  179  ALKKQSEGFLMEYDRLLEDNQNLRSQLEAIDQSSSHLDNKK  219



>gb|KJB69262.1| hypothetical protein B456_011G013000 [Gossypium raimondii]
 gb|KJB69263.1| hypothetical protein B456_011G013000 [Gossypium raimondii]
Length=219

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 185/221 (84%), Gaps = 4/221 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M QLLF +IF+EMA+I +  F+TPLRKL ++ LDRVKRGRG ++VKTVA T+ VVM+S++
Sbjct  1    MFQLLFMVIFSEMAVIMVLSFKTPLRKLTLMVLDRVKRGRGPLMVKTVAATIAVVMISSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++++++ RWI+D  G   PT+QIL+ +HLLEA+LMG  LFL LMIDRLHHYIRELR+RR
Sbjct  61   YSMMTIQKRWIDD--GSANPTEQILMVKHLLEATLMGGVLFLALMIDRLHHYIRELRIRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEA+KKQ    ++GK+  S+++K+LE + ++L+ ++KQLES++E K+KE  ++EANA+
Sbjct  119  KSMEAIKKQ--GPEDGKSSGSDKVKALEGEVTTLQAKLKQLESDLETKTKEMDAAEANAV  176

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFLLEYDRLLEENQ+LR+QL+SL++  S S +KK
Sbjct  177  ALRKQSEGFLLEYDRLLEENQNLRNQLESLEQSPSRSGNKK  217



>ref|XP_009610364.1| PREDICTED: uncharacterized protein LOC104104077 [Nicotiana tomentosiformis]
Length=219

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 177/220 (80%), Gaps = 7/220 (3%)
 Frame = -1

Query  775  IQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTIY  596
            +QLLF ++F EM+LI +F+F+TPLRKL+I+ LDRVKRGRG ++VK+VA TV V+M+ T+Y
Sbjct  5    VQLLFMVVFLEMSLILLFLFKTPLRKLIIMTLDRVKRGRGPLIVKSVAATVLVIMIYTVY  64

Query  595  NVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRRK  416
            ++  L++R  +     + PTDQILLA  +L+A+LMGF LFLGLM+DRLHHYIRELR+ RK
Sbjct  65   SIRELQSRPTDT----VNPTDQILLAHQILQAALMGFCLFLGLMVDRLHHYIRELRLLRK  120

Query  415  TMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAIA  236
            TMEA KKQ+RA+D GK G   E  +L+++ SSLR +++QLESE E K KE  S +AN+ +
Sbjct  121  TMEAAKKQDRALDNGKNG---EASNLKDEISSLRNKVRQLESENEAKEKEVKSQKANSDS  177

Query  235  LKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            LK QSE  LLEYDRLLEENQ+LRSQLQS+D+ +SHSDSKK
Sbjct  178  LKGQSEKLLLEYDRLLEENQNLRSQLQSVDQNVSHSDSKK  217



>gb|KDP20721.1| hypothetical protein JCGZ_21192 [Jatropha curcas]
Length=206

 Score =   232 bits (592),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 178/209 (85%), Gaps = 5/209 (2%)
 Frame = -1

Query  742  MALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTIYNVISLRNRWIE  563
            M LI + +F+TPLRKLV++ LDRVKRGRG IVVKTVAGTV VV++S++Y+++ ++ RWI 
Sbjct  1    MTLIMVLIFKTPLRKLVLMVLDRVKRGRGPIVVKTVAGTVLVVLISSVYSMMKIQKRWI-  59

Query  562  DEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRRKTMEAVKKQNRA  383
            DEG  + PTDQ+L++ HLL+A+LMGF LFL LMIDRLHHYIRELRMRRK+MEA+KKQ+RA
Sbjct  60   DEGA-VNPTDQVLMSGHLLQATLMGFCLFLALMIDRLHHYIRELRMRRKSMEAIKKQSRA  118

Query  382  IDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAIALKKQSEGFLLE  203
             ++GK    EE K++EE+ ++LR ++K LES++E K+KEA +SEANA+ALKKQ+EGFLLE
Sbjct  119  FEDGKV---EESKAMEEEITTLRAKLKHLESDLEMKTKEAHASEANAVALKKQAEGFLLE  175

Query  202  YDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            YDRL EENQ+LR+QLQSLD  LS S SKK
Sbjct  176  YDRLHEENQNLRNQLQSLDLTLSRSGSKK  204



>ref|XP_009795967.1| PREDICTED: uncharacterized protein LOC104242589 [Nicotiana sylvestris]
Length=219

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 178/220 (81%), Gaps = 7/220 (3%)
 Frame = -1

Query  775  IQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTIY  596
            +QLLF ++F EM+LI +F+F+TPLRKL+I+ LDRVKRGRG ++VK+VA TV V+M+ T+Y
Sbjct  5    VQLLFMVVFLEMSLILLFLFKTPLRKLIIMTLDRVKRGRGPLIVKSVAATVLVIMIYTVY  64

Query  595  NVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRRK  416
            ++  L++R  +     + PTDQILLA  +L+A+LMGF LFLGLM+DRLHHYIRELR+ RK
Sbjct  65   SIRELQSRPTDT----VNPTDQILLAHQILQAALMGFCLFLGLMVDRLHHYIRELRLLRK  120

Query  415  TMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAIA  236
            TMEAVKKQ+RA+D GK G   E  +L+++ SSLR +++QLES+ E K KE  S +AN+ +
Sbjct  121  TMEAVKKQDRALDNGKNG---EASNLKDEISSLRNKVRQLESDNEAKEKEVKSQKANSDS  177

Query  235  LKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            LK QSE  LLEYDRLLEENQ+LRSQLQS+++ +SHSDSKK
Sbjct  178  LKGQSEKLLLEYDRLLEENQNLRSQLQSVEQNVSHSDSKK  217



>ref|XP_004506274.1| PREDICTED: B-cell receptor-associated protein 31-like [Cicer 
arietinum]
Length=221

 Score =   232 bits (592),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 170/221 (77%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+  IF EM LI   VF+TPLRKLVI+ LDRVKRGRG IVV TV  T+ VV+ S++
Sbjct  1    MLQLLYTAIFIEMLLILTLVFKTPLRKLVIVSLDRVKRGRGPIVVTTVGATLVVVLSSSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  ++ R IE   G I PTDQ+L+++H+LEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSMAKIQQRTIE--AGIINPTDQVLMSKHMLEASLMGFMLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEAVKKQ R+ ++GK G +EE K+L E+ ++L+ ++K LESE E K  +  +      
Sbjct  119  KTMEAVKKQTRSFEDGKNGNTEEQKALAEEITTLKSKVKMLESECESKGNKEKTLHTEVE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            ALKKQSEGFL+EYDRLLE+NQ+LRSQL+++D+   H D+KK
Sbjct  179  ALKKQSEGFLMEYDRLLEDNQNLRSQLETMDQSSLHLDNKK  219



>ref|XP_009357471.1| PREDICTED: uncharacterized protein LOC103948199 [Pyrus x bretschneideri]
Length=222

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/223 (60%), Positives = 182/223 (82%), Gaps = 1/223 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +I +EM LI  F+FRTP RKLVILGLD++KRGRG +VVKTVA TV VV+++ +
Sbjct  1    MIQLLFVVILSEMVLILAFLFRTPFRKLVILGLDQIKRGRGPVVVKTVAATVLVVLMTNV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ +R   I D+   ++PTDQ+L+ +HLL+A+LMG SLFL LMIDRLHHYIRELR+RR
Sbjct  61   YSIVKIRGSRI-DKAAVLSPTDQVLMIKHLLDATLMGCSLFLALMIDRLHHYIRELRIRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEA+KKQNR  ++GK+   +++K LE + ++L  R+KQLESE+E K+K+  ++E++ +
Sbjct  120  KGMEALKKQNRGSEDGKSSSLDKMKVLENEMATLHTRLKQLESEIETKTKDVHTAESSVL  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            AL+KQSEGFLLEYDRLLEENQ+ +++LQS DRK+S S SKK S
Sbjct  180  ALRKQSEGFLLEYDRLLEENQNFKNRLQSFDRKMSRSGSKKDS  222



>ref|XP_010916117.1| PREDICTED: uncharacterized protein LOC105041025 [Elaeis guineensis]
Length=221

 Score =   230 bits (587),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 183/221 (83%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF L+ AE+ ++ + +F+TPLRKL ILGLDR+KRGRG ++VKTVAGTV +V+ S++
Sbjct  1    MIQLLFTLLLAEVGVVVVLLFKTPLRKLAILGLDRLKRGRGPVMVKTVAGTVLIVLASSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  +R+     E G +TPTDQ+L+++HLLEASLMG+SLFL L+IDRLHHYIRELR  R
Sbjct  61   YSMAKIRSH--STEIGSLTPTDQVLMSRHLLEASLMGYSLFLALIIDRLHHYIRELRGLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEAV KQNRA++E K+G S+E+K  +++ + L E+IKQL  ++E  +KEA ++EANA 
Sbjct  119  KNMEAVMKQNRALEETKSGGSDELKLRDKEITYLNEQIKQLNLKLESSTKEAKAAEANAT  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFLLEYDRLLE+NQ+LR+QLQS+D +LS SDSKK
Sbjct  179  ALRKQSEGFLLEYDRLLEDNQNLRNQLQSIDLRLSQSDSKK  219



>ref|XP_004251523.1| PREDICTED: uncharacterized protein LOC101250189 [Solanum lycopersicum]
Length=219

 Score =   230 bits (586),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 171/220 (78%), Gaps = 7/220 (3%)
 Frame = -1

Query  775  IQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTIY  596
            +QLLF ++F EM LI +F+FRTPLRKL+I+ LDRVKRG G ++VK+VA TV V+M+ T+Y
Sbjct  5    VQLLFMVVFLEMGLILMFLFRTPLRKLIIMSLDRVKRGSGPLIVKSVAATVLVIMIYTVY  64

Query  595  NVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRRK  416
            ++  L++R        + PTDQILLA  +LEA+LMGFSLFLGLMIDRLHHYIRELR+ RK
Sbjct  65   SIKELQSR----PADSVNPTDQILLAHQILEAALMGFSLFLGLMIDRLHHYIRELRLLRK  120

Query  415  TMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAIA  236
            TMEAVKKQ+R +D  K G   E  +L ++ SSLR R+KQLESE E K KE  S  AN+ +
Sbjct  121  TMEAVKKQDRTLDNIKNG---EASTLRDEISSLRNRMKQLESESEAKEKEVQSQRANSDS  177

Query  235  LKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            LK QSE  LLEYDR+LEENQ+LRSQLQS+D  LSHSD+KK
Sbjct  178  LKGQSEKLLLEYDRILEENQNLRSQLQSVDDTLSHSDNKK  217



>ref|XP_010926189.1| PREDICTED: uncharacterized protein LOC105048548 [Elaeis guineensis]
Length=221

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 138/221 (62%), Positives = 185/221 (84%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF L+ AE+ ++ + +F+TPLRKL ILGLDR+KRGRG ++VKTVAGTV VV+ S++
Sbjct  1    MIQLLFALLSAEVGMVVVLLFKTPLRKLAILGLDRLKRGRGPVMVKTVAGTVLVVLASSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ +R+R  E   G +TPTDQ+L++Q+LLEASLMG+SLFL L+IDRLHHYIRELR  R
Sbjct  61   YSMLKIRDRSAET--GFLTPTDQVLMSQNLLEASLMGYSLFLALIIDRLHHYIRELRGLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEAV KQNRA++E K G S+++KS +++ + L E+IKQL+ E++  SKEA ++EANA 
Sbjct  119  KSMEAVMKQNRALEETKNGGSDDLKSRDKETTDLNEQIKQLKLELDAISKEAKAAEANAT  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL KQSEG L EYDRLLE+N++LR+QLQS+D +LSHSDSKK
Sbjct  179  ALGKQSEGLLQEYDRLLEDNKNLRNQLQSIDLRLSHSDSKK  219



>ref|XP_009358864.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
Length=222

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 134/223 (60%), Positives = 184/223 (83%), Gaps = 1/223 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +I +EM +I  F+F+TP RKLVILGLD++KRGRG +VVKTVA TVFVV+++ +
Sbjct  1    MIQLLFIVILSEMVMILAFLFKTPFRKLVILGLDQIKRGRGPVVVKTVAATVFVVVMTNV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ +R   I D+   ++PTDQ+L+ +HLL+A+LMG SLFL LMIDRLHHYIRELR+RR
Sbjct  61   YSIVKIRASRI-DKAAVLSPTDQVLMIKHLLDATLMGCSLFLALMIDRLHHYIRELRIRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEA+KKQNR  ++GK+ I +++K  E + ++LR R+KQLESE+E K+K+  ++E+N +
Sbjct  120  KSMEALKKQNRGSEDGKSSILDQMKVSENEMATLRTRLKQLESEIETKTKDVHTAESNVL  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            AL+KQSEGFLLEYDRLLEENQ L++QL+SLD ++S   SKK S
Sbjct  180  ALRKQSEGFLLEYDRLLEENQKLKNQLKSLDWRVSRLGSKKDS  222



>ref|XP_010046363.1| PREDICTED: B-cell receptor-associated protein 31 [Eucalyptus 
grandis]
 gb|KCW88772.1| hypothetical protein EUGRSUZ_A01117 [Eucalyptus grandis]
Length=221

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 178/221 (81%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLL+ +I AEMALI   +F+TPLRKLVI+ LDRVKRGRG ++VKTV  T+ VV+ S++
Sbjct  1    MIQLLYTVIAAEMALILTLLFKTPLRKLVIMALDRVKRGRGPVMVKTVGVTLLVVLASSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ R +E   G + PTDQ+L+++H+LEASLMGF LFL LM+DRLHHYIRELR+ R
Sbjct  61   YSMVKIQRRTVE--AGLLNPTDQVLMSKHMLEASLMGFVLFLSLMLDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEA KKQ+R IDEGK G +EE+K L+E+ ++LR ++ +LE+E   K KEA ++EA A 
Sbjct  119  KTMEAAKKQSRGIDEGKNGSAEEVKGLKEEIATLRTKLNKLENEYGTKDKEAKTAEAEAE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            ALKKQSEG LLEYDRLL +NQ LRSQL+S+D  LS+SD KK
Sbjct  179  ALKKQSEGLLLEYDRLLADNQSLRSQLESIDLSLSNSDGKK  219



>ref|XP_008371075.1| PREDICTED: B-cell receptor-associated protein 31-like [Malus 
domestica]
Length=222

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 179/223 (80%), Gaps = 1/223 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +I  EM +I  F+F+TP RKLVILGLD++KRGRG +VV TVA TVFVV+++ +
Sbjct  1    MIQLLFVVILXEMVMILAFLFKTPFRKLVILGLDQIKRGRGPVVVATVAATVFVVLMTNV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y  + +R   I D+   ++PTDQ+LL +HLL+A+LMG SLFL LMIDRLHHYIRELR RR
Sbjct  61   YGXVKIRASRI-DKAAVLSPTDQVLLIKHLLDATLMGCSLFLALMIDRLHHYIRELRJRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEA+KKQNR  ++GK+ I +++K  E + ++LR R+KQLES++E K+K+  ++E+N +
Sbjct  120  KSMEALKKQNRGSEDGKSSILDQMKVSENEMATLRARLKQLESDIETKTKDVHTAESNVL  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            AL+KQSEGFLLEYDRLLEENQ L++QL+SLD ++S   SKK S
Sbjct  180  ALRKQSEGFLLEYDRLLEENQKLKNQLKSLDWRVSRXGSKKDS  222



>ref|XP_003539858.1| PREDICTED: B-cell receptor-associated protein 31-like [Glycine 
max]
Length=221

 Score =   227 bits (579),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 172/221 (78%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+  IF+EM LI   VF+TPLRKLVI+ LD VKRGRG +VV TV  T+ VV+ S++
Sbjct  1    MLQLLYTAIFSEMLLILTLVFKTPLRKLVIVSLDSVKRGRGPVVVSTVGATLMVVLASSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  ++ R +E   G + PTDQ+L+++H+LEASLMGF LFL LMIDRLHHYIRELR  R
Sbjct  61   YSMAKIQQRTLE--AGIVNPTDQVLMSKHMLEASLMGFLLFLSLMIDRLHHYIRELRSLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEA+KKQ+R+ ++GK G SEE K+L E+ ++L+ +IK+LESE E K  +A + E    
Sbjct  119  KTMEAIKKQSRSFEDGKNGNSEEHKALNEEITTLKSKIKKLESECEAKGSQAKTLETEVE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            ALKKQSEGFL+EYDRLLE+NQ LRSQLQ++D+   + D+KK
Sbjct  179  ALKKQSEGFLMEYDRLLEDNQSLRSQLQAIDQSPLNFDNKK  219



>gb|KHN21219.1| hypothetical protein glysoja_006698 [Glycine soja]
Length=221

 Score =   227 bits (579),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 172/221 (78%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+  IF+EM LI   VF+TPLRKLVI+ LD VKRGRG +VV TV  T+ VV+ S++
Sbjct  1    MLQLLYTAIFSEMLLILTLVFKTPLRKLVIVSLDSVKRGRGPVVVSTVGATLMVVLASSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  ++ R +E   G + PTDQ+L+++H+LEASLMGF LFL LMIDRLHHYIRELR  R
Sbjct  61   YSMAKIQQRTLE--AGIVNPTDQVLMSKHMLEASLMGFLLFLSLMIDRLHHYIRELRSLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEA+KKQ+R+ ++GK G SEE K+L E+ ++L+ +IK+LESE E K  +A + E    
Sbjct  119  KTMEAIKKQSRSFEDGKNGNSEEHKALNEEITALKSKIKKLESECEAKGSQAKTLETEVE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            ALKKQSEGFL+EYDRLLE+NQ LRSQLQ++D+   + D+KK
Sbjct  179  ALKKQSEGFLMEYDRLLEDNQSLRSQLQAIDQSPLNFDNKK  219



>ref|XP_006351969.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
tuberosum]
Length=219

 Score =   227 bits (578),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 172/220 (78%), Gaps = 7/220 (3%)
 Frame = -1

Query  775  IQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTIY  596
            +QLLF ++F EM LI +F+FRTPLRKL+I+ LDRVKRG G ++VK+VA TV V+M+ T+Y
Sbjct  5    VQLLFMVVFLEMGLILMFLFRTPLRKLIIMTLDRVKRGSGPLIVKSVAATVLVIMIYTVY  64

Query  595  NVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRRK  416
            ++  L++R        + PTDQILLA  +LEA+LMGFSLFLGLMIDRLHHYIRELR+ R+
Sbjct  65   SIKELQSR----PADSVNPTDQILLAHQILEAALMGFSLFLGLMIDRLHHYIRELRLLRR  120

Query  415  TMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAIA  236
            TMEAVKKQ+R +D  K G   E  +L ++ SSLR ++KQLESE E K +E  S  AN+ +
Sbjct  121  TMEAVKKQDRTLDNIKNG---EASTLRDEISSLRNKMKQLESESEAKEEEVQSQRANSDS  177

Query  235  LKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            LK QSE  LLEYDR+LEENQ+LRSQLQS+D+ +SHSD+KK
Sbjct  178  LKGQSEKLLLEYDRILEENQNLRSQLQSVDQTVSHSDNKK  217



>ref|XP_010549208.1| PREDICTED: B-cell receptor-associated protein 31 [Tarenaya hassleriana]
 ref|XP_010549209.1| PREDICTED: B-cell receptor-associated protein 31 [Tarenaya hassleriana]
Length=218

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 176/212 (83%), Gaps = 2/212 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLL+ +IFAE+ALI   +F+TPLRKLVI+ LDR+KRGRG +VVKT+A TVFVV+LS++
Sbjct  1    MIQLLYTVIFAEVALIMTLLFKTPLRKLVIMTLDRIKRGRGPVVVKTIATTVFVVLLSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++   +E   G ++PTDQIL+A+H+LEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSILKIQRGSVES--GVLSPTDQILMAKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTME  KKQNR  ++GK   +EE+K+L E+ ++L+ +IK+LESE E K KE  S++A   
Sbjct  119  KTMETAKKQNRGFEDGKNASAEEVKALGEEVAALKAKIKRLESECETKGKELKSAQAETE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDR  143
            AL+KQ++GFLLEYDRLLE+NQ+LR+QL+S+D+
Sbjct  179  ALRKQADGFLLEYDRLLEDNQNLRNQLESIDQ  210



>emb|CDP10783.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 166/221 (75%), Gaps = 4/221 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQL F +IF EMA+I + +F+TPLRKL I+ LDRVKRG G +VVK+V  TV V+M  ++
Sbjct  1    MIQLFFTVIFCEMAVILLLLFKTPLRKLEIMALDRVKRGSGPLVVKSVGATVLVMMTYSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y +  L +R +E       PTDQ+LLA  +L+ SLMGFSLFL LMIDRLHHYIRELR+ R
Sbjct  61   YTIRELNSRPVES----FNPTDQVLLAYEVLDTSLMGFSLFLALMIDRLHHYIRELRILR  116

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEA KKQ+R +DEGK     E+ +L+E+ ++++  I  LESE + K KE  ++E+N+ 
Sbjct  117  KTMEAAKKQSREVDEGKKANGAEVNALKEEVTAMKTMINILESECKAKEKELKAAESNSE  176

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            +LKKQSEG LLEYDRLLE+NQ LRSQL SLD+ L++SD KK
Sbjct  177  SLKKQSEGLLLEYDRLLEDNQSLRSQLHSLDQSLANSDGKK  217



>gb|KHN41234.1| hypothetical protein glysoja_017278 [Glycine soja]
Length=213

 Score =   220 bits (560),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 166/212 (78%), Gaps = 2/212 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+  IF EM LI   VF+TPLRKLVI+ LDRVKRGRG +VV TV  T+ VV+ S++
Sbjct  1    MLQLLYTAIFFEMILILTLVFKTPLRKLVIVSLDRVKRGRGPVVVSTVGATLMVVLASSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  ++ R +E   G + PTDQ+L+++H+LEASLMGF LFL LMIDRLHHYIRELR  R
Sbjct  61   YSMAKIQQRTLE--AGIVNPTDQVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRSLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEA+KKQ+R+ ++GK G  EE K+L E+ ++L+ +IK+LESE E K  +A + E    
Sbjct  119  KTMEAIKKQSRSFEDGKNGNLEEHKALNEEITTLKSKIKKLESECEAKGNQAKTLETEVE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDR  143
            ALKKQSEGFL+EYDRLLE+NQ LRSQLQ++++
Sbjct  179  ALKKQSEGFLMEYDRLLEDNQSLRSQLQAIEQ  210



>ref|NP_001239654.1| uncharacterized protein LOC100798727 [Glycine max]
 gb|ACU21248.1| unknown [Glycine max]
Length=213

 Score =   220 bits (560),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 166/212 (78%), Gaps = 2/212 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+  IF EM LI   VF+TPLRKLVI+ LDRVKRGRG +VV TV  T+ VV+ S++
Sbjct  1    MLQLLYTAIFFEMILILTLVFKTPLRKLVIVSLDRVKRGRGPVVVSTVGATLVVVLASSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  ++ R +E   G + PTDQ+L+++H+LEASLMGF LFL LMIDRLHHYIRELR  R
Sbjct  61   YSMAKIQQRTLE--AGIVNPTDQVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRSLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEA+KKQ+R+ ++GK G  EE K+L E+ ++L+ +IK+LESE E K  +A + E    
Sbjct  119  KTMEAIKKQSRSFEDGKNGNLEEHKALNEEITTLKSKIKKLESECEAKGNQAKTLETEVE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDR  143
            ALKKQSEGFL+EYDRLLE+NQ LRSQLQ++++
Sbjct  179  ALKKQSEGFLMEYDRLLEDNQSLRSQLQAIEQ  210



>ref|XP_010533802.1| PREDICTED: uncharacterized protein LOC104809492 [Tarenaya hassleriana]
Length=221

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 176/221 (80%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M QLLF ++  E+A+I    F+TP+RKL+I+ LDR KRGRG +VVKTV  TV VVM S++
Sbjct  1    MQQLLFAIVLLEVAVIMALSFKTPIRKLLIMSLDRAKRGRGPVVVKTVVATVCVVMASSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+V+ ++ RWI++  G + PTD++L+ ++LLE++LMG  LFLGLMIDRLHHY+RELR+RR
Sbjct  61   YSVMKIQKRWIDE--GTVNPTDEVLMTRNLLESTLMGGFLFLGLMIDRLHHYMRELRIRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEA+KKQ    ++GKA  S+E+KS+EEQ  SL+E   QLESE++ K+KEA S E+NA+
Sbjct  119  KSMEAIKKQGLGFEDGKAVASDELKSMEEQIRSLQEIKNQLESELDAKAKEARSEESNAV  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFLLE++RLLEENQ LR+QL  LD KLS +  KK
Sbjct  179  ALRKQSEGFLLEFNRLLEENQDLRNQLHLLDHKLSRTSIKK  219



>ref|XP_008384089.1| PREDICTED: B-cell receptor-associated protein 29-like [Malus 
domestica]
Length=222

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 174/211 (82%), Gaps = 1/211 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +I +EM LI  F+FRTP RKLVILGLD++KRGRG +VVKTVA TVFVV+++ +
Sbjct  1    MIQLLFVVILSEMVLILAFLFRTPFRKLVILGLDQIKRGRGPVVVKTVAATVFVVLMTNV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ +R   I D+   ++PTDQ+L+ +HLL+A+LMG SLFL LMIDRLHHYIRELR+RR
Sbjct  61   YSIVKIRGSRI-DKAAVLSPTDQVLMIKHLLDATLMGCSLFLALMIDRLHHYIRELRIRR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEA+KKQNR  ++GK+   +++K LE + ++L  R+KQLESE+E K+K+  ++E++ +
Sbjct  120  KGMEALKKQNRGSEDGKSSSLDKMKVLENEMATLHTRLKQLESEIETKTKDVHTAESSIL  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLD  146
            AL+KQSEGFLLEYDRLLEENQ+L+  LQS+D
Sbjct  180  ALRKQSEGFLLEYDRLLEENQNLKXXLQSVD  210



>ref|XP_010546686.1| PREDICTED: uncharacterized protein LOC104818690 [Tarenaya hassleriana]
 ref|XP_010546696.1| PREDICTED: uncharacterized protein LOC104818690 [Tarenaya hassleriana]
Length=221

 Score =   217 bits (552),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 176/221 (80%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M QLLF ++ +E+A+I    F+TP+RKL+I+ LDR KRGRG +VVKTVA TV VVM S++
Sbjct  1    MQQLLFAVVLSEVAVIMALSFKTPIRKLLIMSLDRAKRGRGPVVVKTVAATVCVVMASSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ RWI++  G + PTD++L+ ++LLE++LMG  LFLGLM DRLHHY+RELR+RR
Sbjct  61   YSMMKIQKRWIDE--GTVNPTDEVLMKKNLLESTLMGGFLFLGLMTDRLHHYMRELRVRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEA+KKQ    + GK G S+EIK +EEQ  +L+E  KQLESE+E K+KEA+  E+ A+
Sbjct  119  KSMEAIKKQGLGFNGGKPGNSDEIKGMEEQIRTLQEIQKQLESELEAKTKEANGEESGAV  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL++QSEGFLLE++RLLEENQ LR+QL SLD KLS +  KK
Sbjct  179  ALRQQSEGFLLEFNRLLEENQELRNQLNSLDHKLSRTSIKK  219



>ref|XP_010494193.1| PREDICTED: B-cell receptor-associated protein 31-like [Camelina 
sativa]
Length=218

 Score =   217 bits (552),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 168/210 (80%), Gaps = 2/210 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LL+ +IF+EMALI + +F+TPLRKL+IL  DR+KRGRG +VVKT+  TVFVV+LS++
Sbjct  1    MIHLLYSVIFSEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++I++R R   ++G  + PTDQ+L ++HLLEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSLINIRRR--SEDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTME  KKQNR  ++GK    EE+K+L E+ ++L+ +IK +ESE E K KE   ++    
Sbjct  119  KTMETAKKQNRGFEDGKTTSGEEVKALGEEIAALKAKIKTVESESEGKGKELKEAKGETE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSL  149
            AL+KQ++GFLLEYDRLLE+NQ+LR+QL+S+
Sbjct  179  ALRKQADGFLLEYDRLLEDNQNLRNQLESI  208



>ref|XP_009123682.1| PREDICTED: uncharacterized protein LOC103848551 [Brassica rapa]
 emb|CDY02396.1| BnaA02g23050D [Brassica napus]
Length=218

 Score =   217 bits (552),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 175/223 (78%), Gaps = 6/223 (3%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLL+ +IFAEMALI + +F+TPLRKL+IL  DR+KRGRG +VVKT+  TVFVV++S++
Sbjct  1    MIQLLYSVIFAEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGATVFVVLISSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++S++ R   ++G  + PTDQ+L ++HLLEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSLLSIQRR--SEDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTME  KKQNR+ ++GK    EE+K+L E+ + L+ +IK+LESE E K KE  S++A   
Sbjct  119  KTMETAKKQNRSFEDGKNTNGEEVKALGEEIAVLKAKIKKLESESESKGKELKSAQAETE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            AL+K ++GFL+EYDRLLE+NQ+LR+QL+S    + HS   K S
Sbjct  179  ALRKSADGFLMEYDRLLEDNQNLRNQLES----IGHSPEGKKS  217



>ref|NP_568607.1| B-cell receptor-associated 31-like protein [Arabidopsis thaliana]
 gb|AAK96684.1| Unknown protein [Arabidopsis thaliana]
 gb|ABD43004.1| At5g42570 [Arabidopsis thaliana]
 gb|AED94830.1| B-cell receptor-associated 31-like protein [Arabidopsis thaliana]
Length=218

 Score =   217 bits (552),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 168/210 (80%), Gaps = 2/210 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LL+ +IFAEMALI + +F+TPLRKL+IL  DR+KRGRG +VVKT+  TVFVV+LS+I
Sbjct  1    MIHLLYTVIFAEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++++++ R   ++G  + PTDQ+L ++HLLEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSLVNIQRR--SEDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTME  KKQNR  ++GK    EE+K+L E+ ++L+ +IK LESE E K KE   ++    
Sbjct  119  KTMETAKKQNRGFEDGKTTSGEEVKALGEEIAALKAKIKTLESESESKGKELKGAQGETE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSL  149
            AL+KQ++GFL+EYDRLLE+NQ+LR+QL+S+
Sbjct  179  ALRKQADGFLMEYDRLLEDNQNLRNQLESI  208



>emb|CDY34821.1| BnaA09g47470D [Brassica napus]
Length=221

 Score =   217 bits (552),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 177/221 (80%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M  LLF ++ AE+A+I    F+TP+RKL+I+ LDR KRGRG +VV+TV+ TV VV+++++
Sbjct  1    MQHLLFAVVLAEVAVILALSFKTPIRKLLIMSLDRAKRGRGPVVVQTVSATVCVVLVASV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ RW+E+  G + PTD++++++HLLE++LMG  LFLGLMIDRLHHY+RELRMRR
Sbjct  61   YSMMKIQKRWVEE--GAMNPTDEVIMSKHLLESTLMGGFLFLGLMIDRLHHYMRELRMRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEA+KK+   ++  KA  S+E+KSL+++ ++L+ER KQL +E+E KSKE  + E + I
Sbjct  119  KTMEAIKKEGSVLEGEKARASDEVKSLKQEITALQERQKQLAAEIEAKSKEIRTEETSGI  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFL+E++RL EENQ LR+QL ++D ++S S  KK
Sbjct  179  ALQKQSEGFLIEFNRLSEENQDLRNQLHTVDSRISRSSIKK  219



>ref|XP_002524828.1| bcr-associated protein, bap, putative [Ricinus communis]
 gb|EEF37548.1| bcr-associated protein, bap, putative [Ricinus communis]
Length=209

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 172/209 (82%), Gaps = 2/209 (1%)
 Frame = -1

Query  742  MALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTIYNVISLRNRWIE  563
            M LI   +F+TPLRKLVI+ LDRVKRGRG ++VKTV GTVFVV+LS++Y+++ ++NR IE
Sbjct  1    MGLIMTLLFKTPLRKLVIMSLDRVKRGRGPVMVKTVGGTVFVVLLSSVYSMVKIQNRTIE  60

Query  562  DEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRRKTMEAVKKQNRA  383
              GG + PTDQ+L+++H+LEASLMGF LFL LMIDRLHHYIRELR+ RKTMEA KKQ+R 
Sbjct  61   --GGAVNPTDQVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRILRKTMEAAKKQSRG  118

Query  382  IDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAIALKKQSEGFLLE  203
             ++GK G ++E K+L E+  +L+ +IK LES+ EEK+KEA ++EA   AL+KQSE FL+E
Sbjct  119  FEDGKNGSADEAKALGEEVKTLQNKIKYLESKFEEKAKEAKAAEAEVEALRKQSEVFLIE  178

Query  202  YDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            Y RLLE+NQ+LR+QL+S+D+ LS SD KK
Sbjct  179  YGRLLEDNQNLRNQLESMDQSLSQSDGKK  207



>ref|XP_009118164.1| PREDICTED: uncharacterized protein LOC103843216 [Brassica rapa]
Length=221

 Score =   216 bits (551),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 176/221 (80%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M  LLF ++ AE+A+I    F+TP+RKL+I+ LDR KRGRG +VV+TV+ TV VV+++++
Sbjct  1    MQHLLFAVVLAEVAVILALSFKTPIRKLLIMSLDRAKRGRGPVVVQTVSATVCVVLVASV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y ++ ++ RW+E+  G + PTD++++++HLLE++LMG  LFLGLMIDRLHHY+RELRMRR
Sbjct  61   YGMMKIQKRWVEE--GAMNPTDEVIMSKHLLESTLMGGFLFLGLMIDRLHHYMRELRMRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEA+KK+   ++  KA  S+E+KSL+++ ++L+ER KQL +E+E KSKE  + E + I
Sbjct  119  KTMEAIKKEGSVLEGEKARASDEVKSLKQEITALQERQKQLAAEIEAKSKEIRTEETSGI  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFL+E++RL EENQ LR+QL ++D ++S S  KK
Sbjct  179  ALQKQSEGFLIEFNRLSEENQDLRNQLHTVDSRISRSSIKK  219



>dbj|BAB09328.1| unnamed protein product [Arabidopsis thaliana]
Length=252

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 168/210 (80%), Gaps = 2/210 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LL+ +IFAEMALI + +F+TPLRKL+IL  DR+KRGRG +VVKT+  TVFVV+LS+I
Sbjct  1    MIHLLYTVIFAEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++++++ R   ++G  + PTDQ+L ++HLLEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSLVNIQRR--SEDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTME  KKQNR  ++GK    EE+K+L E+ ++L+ +IK LESE E K KE   ++    
Sbjct  119  KTMETAKKQNRGFEDGKTTSGEEVKALGEEIAALKAKIKTLESESESKGKELKGAQGETE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSL  149
            AL+KQ++GFL+EYDRLLE+NQ+LR+QL+S+
Sbjct  179  ALRKQADGFLMEYDRLLEDNQNLRNQLESI  208



>ref|XP_006403381.1| hypothetical protein EUTSA_v10003268mg [Eutrema salsugineum]
 gb|ESQ44834.1| hypothetical protein EUTSA_v10003268mg [Eutrema salsugineum]
Length=218

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 170/212 (80%), Gaps = 2/212 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LL+ ++FAEMALI + +F+TPLRKL+IL  DR+KRGRG +VVKT+  TVFVV++S++
Sbjct  1    MIHLLYSVLFAEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGATVFVVLMSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++S++ R   ++G  + PTDQ+L ++H+LEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSLLSIQRR--SEDGAALNPTDQVLASKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTME  KKQNR  ++GK    EE+K+L E+ ++L+ +I +LESE E K KE   + A   
Sbjct  119  KTMETAKKQNRGFEDGKNTSGEEVKALVEEIAALKSKIGKLESESESKGKELKGARAETE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDR  143
            AL+KQ++GFL+EYDRLLE+NQ+LR+QL+S+D+
Sbjct  179  ALRKQADGFLMEYDRLLEDNQNLRNQLESIDQ  210



>gb|AAM62748.1| unknown [Arabidopsis thaliana]
Length=218

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 168/210 (80%), Gaps = 2/210 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LL+ +IFAEMALI + +F+TPLRKL+IL  DR+KRGRG +VVKT+  TVFVV+LS+I
Sbjct  1    MIHLLYTVIFAEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++++++ R   ++G  + PTDQ+L ++HLLEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSLVNIQRR--SEDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTME  KKQNR  ++GK    EE+K+L E+ ++L+ +IK LESE E K KE   ++    
Sbjct  119  KTMETAKKQNRGFEDGKTTSGEEVKALGEEIAALKAKIKTLESESESKGKELKGAQGETE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSL  149
            AL+KQS+GFL+EYDRLLE+N++LR+QL+S+
Sbjct  179  ALRKQSDGFLMEYDRLLEDNRNLRNQLESI  208



>ref|XP_010481979.1| PREDICTED: B-cell receptor-associated protein 31-like [Camelina 
sativa]
Length=218

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 168/210 (80%), Gaps = 2/210 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LL+ +IF+EMALI + +F+TPLRKL+IL  DR+KRGRG +VVKT+  T+FVV+LS++
Sbjct  1    MIHLLYSVIFSEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTLFVVLLSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y ++++R R   ++G  + PTDQ+L ++HLLEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YGLVNIRRR--SEDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTME+ KKQNR  ++GK    EE+K+L E+ ++L+ +IK +ESE E K KE   ++    
Sbjct  119  KTMESAKKQNRGFEDGKTKSGEEVKALGEEIAALKAKIKTVESESEGKGKELKEAKGETE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSL  149
            AL+KQ++GFLLEYDRLLE+NQ+LR+QL+S+
Sbjct  179  ALRKQADGFLLEYDRLLEDNQNLRNQLESI  208



>ref|XP_007149980.1| hypothetical protein PHAVU_005G115800g [Phaseolus vulgaris]
 gb|ESW21974.1| hypothetical protein PHAVU_005G115800g [Phaseolus vulgaris]
Length=221

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 173/221 (78%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+ +IFA+M +I  F+F+TP RKLVIL LDR+KRGRG +VVKTVA T+ VV+ S++
Sbjct  1    MLQLLYAVIFAQMFVIVSFLFKTPARKLVILTLDRLKRGRGPVVVKTVAATLLVVLASSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  ++ R ++     + PTDQ+L+++H LEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSIAKIQRRSLD--ASVVNPTDQVLVSKHTLEASLMGFVLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTMEA KKQ+R+ ++GK+  + E K+L E+ S  +  +++LESE E K+ +A + EA   
Sbjct  119  KTMEAAKKQSRSFEDGKSVSAAEHKALVEEISGFKAEVEKLESECEVKASKAKTLEAEVE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFL+EYDRLLE+NQ+LRSQLQ++D   SH+ +KK
Sbjct  179  ALRKQSEGFLMEYDRLLEDNQNLRSQLQAIDLSPSHAVNKK  219



>ref|XP_003540294.1| PREDICTED: B-cell receptor-associated protein 31-like [Glycine 
max]
Length=221

 Score =   215 bits (548),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 171/221 (77%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+ +IF EM +I  F+F+TP RKLVI+ LDRVKRGRG +VVKTVA T+ VV+ S++
Sbjct  1    MLQLLYAVIFGEMFVIASFLFKTPARKLVIITLDRVKRGRGPVVVKTVAATLLVVLASSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  +R R ++     + PTDQ+L+++H+LEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSIAKIRRRNLD--APVVNPTDQVLVSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEA KKQ+R+ ++GK+  + E K+L E+ + L+ +I++LESE E ++ +A + E    
Sbjct  119  KAMEAAKKQSRSFEDGKSVSAAEHKALLEENAMLKPKIEKLESECEVEASKAKALETEVE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFL+EYDRLL +NQ+LRSQLQ++D    HS +KK
Sbjct  179  ALRKQSEGFLMEYDRLLADNQNLRSQLQAIDHSSPHSVNKK  219



>ref|XP_004287957.1| PREDICTED: B-cell receptor-associated protein 31-like [Fragaria 
vesca subsp. vesca]
Length=218

 Score =   215 bits (547),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 167/221 (76%), Gaps = 5/221 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+  IF++MALI   +F++PLRKLVILGLD++KRG+G +VVKTV GTV  V+ + I
Sbjct  1    MMQLLYTAIFSQMALILTLLFKSPLRKLVILGLDKLKRGKGPVVVKTVGGTVAAVLCANI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN+  L++R   +E G + PTD++L++  LLE SLMGF LFL LMIDRLHHYIRELR  R
Sbjct  61   YNLNELKSRT--NEAGMLNPTDEVLMSMKLLEISLMGFFLFLSLMIDRLHHYIRELRFLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEA KKQN+   E K   SE  K+L ++  +LR ++K LESE E K K+A ++ A   
Sbjct  119  KAMEAAKKQNQPTQEEK---SEGHKTLVQENETLRAKVKNLESEHETKEKKAKATGAEVQ  175

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            ALKKQSEG LLEYDRLLEENQHLR QL+S+DR +SHSD KK
Sbjct  176  ALKKQSEGLLLEYDRLLEENQHLRDQLKSIDRSMSHSDDKK  216



>ref|XP_009403539.1| PREDICTED: uncharacterized protein LOC103987073 [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   215 bits (547),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 181/223 (81%), Gaps = 2/223 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF ++ AE+A+    +F+TPLRKLV++GLDR+KRGRG ++VKTVAGTV VV+ S++
Sbjct  1    MIQLLFAVLSAEVAVAVTLLFKTPLRKLVVVGLDRLKRGRGPVMVKTVAGTVLVVLASSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  + +     E G +TPTDQ+L+++HLLEASLMG+SLFL L+IDRLHHY+RELR  R
Sbjct  61   YSIAKISSG--SAELGALTPTDQVLMSRHLLEASLMGYSLFLALIIDRLHHYVRELRGLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEAV KQNR ++E K G S E+K+L+   +SL E+IKQL+SE E++ +EA ++EA A 
Sbjct  119  KSMEAVLKQNRVLEEAKTGGSSEVKALDGMIASLNEQIKQLKSESEDRLQEAKAAEARAA  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            ALKKQSE  LLEYDRLLE+NQ+LR+QL S+D +LS SD+KK++
Sbjct  179  ALKKQSEDLLLEYDRLLEDNQNLRNQLNSIDNRLSFSDAKKIA  221



>ref|XP_006281077.1| hypothetical protein CARUB_v10027105mg [Capsella rubella]
 gb|EOA13975.1| hypothetical protein CARUB_v10027105mg [Capsella rubella]
Length=218

 Score =   214 bits (546),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 172/222 (77%), Gaps = 7/222 (3%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LL+ +IF+EMALI + +F+TPLRKL+IL  D++KRGRG +VVKT+  TVFVV+LS++
Sbjct  1    MIHLLYSVIFSEMALILLLLFKTPLRKLIILTFDKIKRGRGPVVVKTIGTTVFVVLLSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++++++ R   ++G  + PTDQ+L ++HLLEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSLVNIQRR--SEDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTME  KKQNR  ++GK    EE+K+L E+  +L+ +IK LESE E K KE   ++    
Sbjct  119  KTMETAKKQNRGFEDGKTTSGEEVKALGEEIVALKTKIKTLESESESKGKELKGAKGETE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHS-DSKK  116
            AL+KQ++GFLLEYDRLLE+NQ+LR+QL+S    + HS D KK
Sbjct  179  ALRKQADGFLLEYDRLLEDNQNLRNQLES----IGHSPDGKK  216



>ref|XP_006447584.1| hypothetical protein CICLE_v10016648mg [Citrus clementina]
 ref|XP_006469667.1| PREDICTED: B-cell receptor-associated protein 31-like [Citrus 
sinensis]
 gb|ESR60824.1| hypothetical protein CICLE_v10016648mg [Citrus clementina]
 gb|KDO54706.1| hypothetical protein CISIN_1g027898mg [Citrus sinensis]
Length=217

 Score =   214 bits (545),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 179/221 (81%), Gaps = 6/221 (3%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLL+ +IF++MALI   +F+TPLRKLVI+ LDRVKRGRG +VVKTV GT+F+V++S++
Sbjct  1    MIQLLYTVIFSQMALIMTLLFKTPLRKLVIMSLDRVKRGRGPVVVKTVGGTLFIVLMSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ R +E   G + PTDQIL+++H+LEASLMGF LFL LM+DRLHHYIRELR+ R
Sbjct  61   YSILKIQQRTLE--TGALNPTDQILMSKHMLEASLMGFLLFLSLMMDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEA KKQ R+ ++GK    +E K L +  ++L+ +IK+LESE E K KEA++++A A 
Sbjct  119  KAMEAAKKQTRSFEDGKNDNVDERKGLGDDIATLKTKIKKLESECEMKDKEANAAKAEAE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            ALKKQSEGFLLEYDRLL +NQHLR+QL+S+D    HSDSKK
Sbjct  179  ALKKQSEGFLLEYDRLLADNQHLRNQLESID----HSDSKK  215



>emb|CDY68895.1| BnaCnng60970D [Brassica napus]
Length=218

 Score =   214 bits (545),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 174/223 (78%), Gaps = 6/223 (3%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLL+ +IFAEMALI + +F+TPLRKL+IL  DR+KRGRG +VVKT+  TVFVV++S++
Sbjct  1    MIQLLYSVIFAEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGATVFVVLMSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++S++ R   ++G  + PTDQ+L ++HLLEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSLLSIQRR--SEDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTME  KKQNR+ ++GK    EE+K+L  + + L+ +IK+LESE E K KE  S++A   
Sbjct  119  KTMETAKKQNRSFEDGKNTNGEEVKALGGEIAVLKAKIKKLESESESKGKELKSAQAETE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            AL+K ++GFL+EYDRLLE+NQ+LR+QL+S    + HS   K S
Sbjct  179  ALRKSADGFLMEYDRLLEDNQNLRNQLES----IGHSPEGKKS  217



>gb|KFK32917.1| hypothetical protein AALP_AA6G305900 [Arabis alpina]
Length=218

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 171/212 (81%), Gaps = 2/212 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LL+ +IFAEMALI + +F+TPLRKL+IL  DR+KRGRG +VVKT+  T+FVV++S++
Sbjct  1    MIHLLYTVIFAEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTLFVVLMSSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++++++ R   ++G  + PTDQ+L ++HLLEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSLLNIQRR--SEDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTME  KKQNR  ++GK    EE+K+L E+ ++L+ + K+LES+ E K KE  S++A   
Sbjct  119  KTMETAKKQNRGFEDGKNTSGEEVKALGEEIAALKAKNKKLESDSESKGKELKSAQAETE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDR  143
            AL+KQ++GFLLEYDRLLE+NQ+L++QL S+D+
Sbjct  179  ALRKQADGFLLEYDRLLEDNQNLKNQLDSIDQ  210



>ref|XP_007215939.1| hypothetical protein PRUPE_ppa011161mg [Prunus persica]
 gb|EMJ17138.1| hypothetical protein PRUPE_ppa011161mg [Prunus persica]
Length=221

 Score =   213 bits (541),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 174/221 (79%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+ +IF EM LI   +F++PLRKLVIL LD++KRG+G ++VKTVAGTVFVV+L+ +
Sbjct  1    MLQLLYGVIFGEMFLILTLLFKSPLRKLVILALDKMKRGKGPVMVKTVAGTVFVVLLAGV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN++ ++NR IE   G + PTD++L++  +LE SLMGF LFL LM+DRLHHYIRELR  R
Sbjct  61   YNLVDIKNRTIE--SGVLNPTDEVLMSVKMLEISLMGFFLFLSLMLDRLHHYIRELRFLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K M+A KKQ+++I E K G SE++K+L ++  +LR +IK LESE E K+K+A ++ +   
Sbjct  119  KAMDAAKKQSQSIQEEKNGSSEQLKTLAQENDTLRTKIKNLESEYETKAKKAKAAGSEVE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEG L+EYDRLL +NQ+LRSQL S+++  SHSD KK
Sbjct  179  ALRKQSEGLLMEYDRLLADNQNLRSQLTSIEQSTSHSDDKK  219



>ref|XP_008348138.1| PREDICTED: B-cell receptor-associated protein 31-like [Malus 
domestica]
Length=221

 Score =   213 bits (541),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 173/221 (78%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+ +IF+EM LI  F+F+ PLRKLVIL LD++K+G+G ++VKTVAGTVF V+++ +
Sbjct  1    MLQLLYTVIFSEMLLILAFLFKNPLRKLVILALDKMKQGKGPVMVKTVAGTVFAVLMADV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN++ ++NR IE   G + PTD++L++  +LE SLMGF LFL LMIDRLHHYIRELR  R
Sbjct  61   YNLVDIKNRTIE--SGVLNPTDEVLMSVKMLEISLMGFFLFLSLMIDRLHHYIRELRFLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEAVK+QN++  E K G S+++K++ ++  +LR +IK LESE E K K+A ++ +   
Sbjct  119  KAMEAVKRQNQSSQEEKNGSSKQLKTIVQENETLRTKIKTLESEYETKEKKAEAAGSEVE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEG L+EYDRLL +NQ+LRSQL S+++  SH+D KK
Sbjct  179  ALRKQSEGLLMEYDRLLADNQNLRSQLTSIEQSASHTDGKK  219



>ref|XP_004151895.1| PREDICTED: B-cell receptor-associated protein 31 [Cucumis sativus]
 gb|KGN63240.1| hypothetical protein Csa_2G416790 [Cucumis sativus]
Length=210

 Score =   212 bits (539),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 174/215 (81%), Gaps = 5/215 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF +I  +MALI   +FRTPLRKLVI  LDR+KRG+G IVV+T+AGTVFVV+LS++
Sbjct  1    MIQLLFTVIATQMALILTLLFRTPLRKLVIFTLDRLKRGKGPIVVQTIAGTVFVVLLSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ + NR +E   G++ PTDQ+L++ HLLEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSMLKIHNRMVE--AGEVNPTDQVLMSNHLLEASLMGFLLFLALMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTME  KKQ RA ++  A   E++K+L E+A+++R +I +LESEVE K+KEA+ +EA   
Sbjct  119  KTMEVAKKQIRASEDASA---EKLKALGEEATTMRNKITKLESEVEVKTKEANDAEAETD  175

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLS  134
            AL+KQSE +LLEYDRLLE+NQ+LR+QL+S++   S
Sbjct  176  ALRKQSEEYLLEYDRLLEDNQNLRNQLESIEHASS  210



>ref|XP_008342021.1| PREDICTED: B-cell receptor-associated protein 31 [Malus domestica]
 ref|XP_008342022.1| PREDICTED: B-cell receptor-associated protein 31 [Malus domestica]
 ref|XP_008342023.1| PREDICTED: B-cell receptor-associated protein 31 [Malus domestica]
 ref|XP_008342024.1| PREDICTED: B-cell receptor-associated protein 31 [Malus domestica]
Length=221

 Score =   212 bits (540),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 175/221 (79%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+ +IF+EM LI I +F++PLRKLVIL LD++KRG+G ++VKTVAGTVF+V+L+ +
Sbjct  1    MLQLLYTVIFSEMLLILILLFKSPLRKLVILALDKMKRGKGPVMVKTVAGTVFIVLLANV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN++ ++NR   +E G + PTD++L++  +LE SLMGF LFL LM+DRLHHYIRELR  R
Sbjct  61   YNLVDIKNRT--NESGVLNPTDEVLMSMKMLENSLMGFFLFLSLMMDRLHHYIRELRFLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEA K+QN++  + K G SE++K+L ++  +LR +I+ LESE E K+K+A ++ +   
Sbjct  119  KAMEAAKRQNQSSQDDKNGSSEQLKTLVQENETLRTKIETLESEYETKAKKAKAAGSEVE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEG L+EYDRLL +NQ+LRSQL S+++  SHSD KK
Sbjct  179  ALRKQSEGLLMEYDRLLADNQNLRSQLTSIEQSASHSDGKK  219



>ref|XP_002863762.1| hypothetical protein ARALYDRAFT_494776 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40021.1| hypothetical protein ARALYDRAFT_494776 [Arabidopsis lyrata subsp. 
lyrata]
Length=218

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 167/210 (80%), Gaps = 2/210 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LL+ +IFAEMALI + +F+TPLRKL+IL  DR+KRGRG +VVKT+  TVF+V+LS+I
Sbjct  1    MIHLLYTVIFAEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGITVFIVLLSSI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ R   ++G  + PTDQ+L +++LLEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSLVKIQRR--SEDGAVLNPTDQVLASKYLLEASLMGFVLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTME  KKQNR  ++GK    EE+K++ E+ ++L+ +IK LESE E K KE   ++    
Sbjct  119  KTMETAKKQNRGFEDGKNTSGEEVKAIGEEIAALKAKIKTLESESESKGKELKGAQGETE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSL  149
            AL+KQ++GFL+EYDRLLE+NQ+LR+QL+S+
Sbjct  179  ALRKQADGFLMEYDRLLEDNQNLRNQLESV  208



>ref|XP_003543392.1| PREDICTED: B-cell receptor-associated protein 31-like [Glycine 
max]
Length=221

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 171/221 (77%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+ +IFAEM +I  F+F+TP RKLVI+ LDR+KRGRG +VVKTVA T+ VV+ S++
Sbjct  1    MLQLLYAVIFAEMFVIVSFLFKTPARKLVIVTLDRLKRGRGPVVVKTVAATLLVVLASSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  +R+R ++    +  PTDQ+L+ +H+LEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSIAKIRHRNLDAPVAN--PTDQVLVYKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEA KKQ+R+ + GK+  + E K+L E+ + L+ +I++LESE E ++ +A + E    
Sbjct  119  KAMEAAKKQSRSFEGGKSVSAAEHKALVEEIAMLKPKIEKLESECEMEASKAKALETEVE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFL+EYDRLL +NQ+LRSQ+Q++D    HS +KK
Sbjct  179  ALRKQSEGFLMEYDRLLADNQNLRSQVQAIDHSSPHSVNKK  219



>ref|XP_006417293.1| hypothetical protein EUTSA_v10008726mg [Eutrema salsugineum]
 gb|ESQ35646.1| hypothetical protein EUTSA_v10008726mg [Eutrema salsugineum]
Length=221

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 174/221 (79%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M  LLF ++ +E+A+I    F+TP+RKL+I+ LDR KRGRG +V++T++ TV VV+++++
Sbjct  1    MQHLLFAVVLSEVAVIMALSFKTPIRKLLIMSLDRAKRGRGPVVIQTISATVCVVLVASV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ R IED  G + PTD++++A+HLLE++LMG  LFLGLMIDRLHHY+RELR+RR
Sbjct  61   YSMMKIQKRGIED--GAMNPTDEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K ME +KK+   ++  KA  S+E+K+L+E+  SL+ER KQL SE+E +SKE  + + +A+
Sbjct  119  KMMEVIKKEGAVLEGVKARASDEVKNLKEEVVSLQERQKQLVSEIEARSKEIRTEKTSAV  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFL+E++RLLEENQ LR QL ++D ++S S  KK
Sbjct  179  ALEKQSEGFLIEFNRLLEENQDLRDQLHTVDSRISRSSIKK  219



>ref|XP_008229967.1| PREDICTED: B-cell receptor-associated protein 31-like [Prunus 
mume]
Length=221

 Score =   210 bits (534),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 173/221 (78%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+ +IF EM LI   +F++PLRKLVIL LD++KRG+G ++VKTVAGTVFVV+L+ +
Sbjct  1    MLQLLYGVIFGEMFLILTLLFKSPLRKLVILALDKMKRGKGPVMVKTVAGTVFVVLLAGV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y ++ ++NR IE   G + PTD++L++  +LE SLMGF LFL LM+DRLHHYIRELR  R
Sbjct  61   YTLVDIKNRTIE--SGMLNPTDEVLMSVKMLEISLMGFFLFLSLMLDRLHHYIRELRFLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K M+A KKQ+++I E K G SE++K+L ++  +LR +IK LESE E K+K+A ++ +   
Sbjct  119  KAMDAAKKQSQSIQEEKNGSSEQLKTLAQENDTLRTKIKNLESEYETKAKKAKAAGSEVE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEG L+EYDRLL +NQ+LRSQL S+++  SHSD KK
Sbjct  179  ALRKQSEGLLMEYDRLLADNQNLRSQLTSIEQSTSHSDDKK  219



>ref|XP_010442176.1| PREDICTED: B-cell receptor-associated protein 31-like [Camelina 
sativa]
Length=218

 Score =   209 bits (533),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 165/210 (79%), Gaps = 2/210 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LL+ +IF+EMALI + +F+TPLRKL+IL  DR+KRGRG +VVKT+  TVFVV+LS++
Sbjct  1    MIHLLYSVIFSEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++++R R   ++G  + PTDQ+L ++HLLEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSLVNIRRR--SEDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTME  KKQNR  ++GK    EE+K+L E+ + L+ +IK +ESE + K KE   ++    
Sbjct  119  KTMETAKKQNRGFEDGKTTSGEEVKALGEEIAVLKAKIKTVESESDGKGKELKEAKGETE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSL  149
            AL+KQ++ FL EYDRLLE+NQ+LR+QL+S+
Sbjct  179  ALRKQADEFLKEYDRLLEDNQNLRNQLESI  208



>ref|XP_009353295.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
 ref|XP_009353296.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
Length=221

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 169/221 (76%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+ +IF+EM LI   +F+ PLRKLVIL LD++KRG+G ++VKTVAGTVF V+++ +
Sbjct  1    MLQLLYTVIFSEMLLILTLLFKNPLRKLVILALDKMKRGKGPVMVKTVAGTVFAVLMADV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            +N++ ++NR IE   G + PTD+IL++  +LE SLMGF LFL LM DRLHHYIRELR  R
Sbjct  61   FNLVDIKNRTIE--SGVLKPTDEILMSMKMLEISLMGFFLFLSLMTDRLHHYIRELRFLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEA K+QN++  E K G SE++K++ ++  +LR +IK LE E E K K+A ++ +   
Sbjct  119  KAMEAAKRQNQSSQEEKNGSSEQLKTIVQENETLRTKIKTLEFEYETKEKKAKAAGSEVE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            ALKKQSEG L+EYDRLL +NQ+L+SQL S+++  SH+D KK
Sbjct  179  ALKKQSEGLLMEYDRLLADNQNLQSQLTSIEQSASHTDGKK  219



>ref|XP_007132530.1| hypothetical protein PHAVU_011G102200g [Phaseolus vulgaris]
 gb|ESW04524.1| hypothetical protein PHAVU_011G102200g [Phaseolus vulgaris]
Length=212

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 163/212 (77%), Gaps = 3/212 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+  IF+EM LI   VF+T LRKLVI+ LDRVKRGRG IVV TV  T+ VV+ S++
Sbjct  1    MLQLLYTAIFSEMLLILTLVFKTSLRKLVIISLDRVKRGRGPIVVSTVGATLVVVLSSSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  ++ R +E   G + PTDQ+L+++H+LEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSMTKIQQRTLE--AGILNPTDQVLMSKHMLEASLMGFLLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KT E +KKQ+R+ ++GK G +EE K+L E A +L+ +IK+LESE E K  EA + E    
Sbjct  119  KTNEVIKKQSRSFEDGKNGNAEEQKTLTEIA-TLKSKIKKLESECETKGNEAKTLETEVE  177

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDR  143
             LKKQSEGFL+EYDRLLE+NQ LRSQLQ +++
Sbjct  178  VLKKQSEGFLMEYDRLLEDNQSLRSQLQVIEQ  209



>ref|XP_010686812.1| PREDICTED: B-cell receptor-associated protein 31-like [Beta vulgaris 
subsp. vulgaris]
Length=220

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 168/225 (75%), Gaps = 7/225 (3%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LL+ +IF E A+I + +F++PLRKLVI  LD++KRGRG IVVKTV+ T+ +  +ST+
Sbjct  1    MIHLLYTVIFGEAAMIMLLLFKSPLRKLVIAVLDKIKRGRGPIVVKTVSATISIFFISTL  60

Query  598  YNVISLRNRWIEDEGGD--ITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRM  425
            Y+ + ++ R I ++G    + PTDQ+L ++HLLEASLMGF LFL LMIDRLHHYIRELR+
Sbjct  61   YSTLKIQRRGIGEDGAPDALNPTDQVLFSKHLLEASLMGFILFLSLMIDRLHHYIRELRL  120

Query  424  RRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseAN  245
            RRKTMEAVKK     ++ K    EEIK+ E+Q  + +  I+QLES++E K KEAS+SEA 
Sbjct  121  RRKTMEAVKK-----NDVKCAGPEEIKAREQQVETFKAMIRQLESDLESKVKEASTSEAT  175

Query  244  AIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
              AL+KQSEG LLEYDRLL ENQ  R+QL +LDR+ S S  KK S
Sbjct  176  VEALRKQSEGLLLEYDRLLAENQEFRNQLHTLDRRNSFSSGKKDS  220



>ref|XP_009419329.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
Length=210

 Score =   206 bits (525),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 167/211 (79%), Gaps = 2/211 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF ++ AE  +    +F+TPLRKLVILGLDR KRGRG ++VKTVAGTV +V+ S++
Sbjct  1    MIQLLFTMLSAEAGVAVALLFKTPLRKLVILGLDRFKRGRGPVMVKTVAGTVVIVLASSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  +R+R    E G  TPTDQ+L+++HLLEASLMG+SLFL L+IDRLHHYIRELR  R
Sbjct  61   YSMAKIRSR--SAEFGAFTPTDQVLMSRHLLEASLMGYSLFLVLIIDRLHHYIRELRGLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEAV KQNR ++E K G S+EIK+ + + + L E+IK L+ E EE+ KEA ++EAN +
Sbjct  119  KSMEAVMKQNRVLEETKCGGSDEIKTRDREIACLNEQIKHLKFESEERIKEARAAEANVM  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLD  146
            ALKKQS+  L+EYDRLLE+NQ++ +QL S+D
Sbjct  179  ALKKQSDDLLIEYDRLLEDNQNILNQLHSID  209



>ref|XP_003580219.1| PREDICTED: B-cell receptor-associated protein 31-like [Brachypodium 
distachyon]
Length=221

 Score =   206 bits (525),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 171/223 (77%), Gaps = 2/223 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF L+ AE  L+ + +FRTP R+L +L +DR KRGRG I+ +TVA T+F+V+ S+ 
Sbjct  1    MIQLLFTLLAAEAGLVLVLLFRTPARRLALLAVDRSKRGRGPIMARTVAATMFMVLGSSG  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  +R R  E +   +TPTDQ+L ++HLLEASLMG+SLFLGL+IDRLHHYIR++R  +
Sbjct  61   YSIAKIRRR--EGDFAQLTPTDQVLASRHLLEASLMGYSLFLGLVIDRLHHYIRQIRTMK  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K+MEAV KQ++ ++E K   +EEI+  +++ SSL E+++ ++ + E K++E  ++EAN +
Sbjct  119  KSMEAVTKQSKTLEEAKLQGAEEIQGYQKKISSLNEQVQAVKHQYETKTEELKTAEANTL  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKVS  110
            AL+KQSEG L EY+RL+ EN+ LR++LQS++ + SHSD KK S
Sbjct  179  ALRKQSEGLLTEYERLIAENEELRNKLQSMEVRFSHSDGKKNS  221



>gb|KFK35240.1| hypothetical protein AALP_AA5G258500 [Arabis alpina]
Length=221

 Score =   206 bits (525),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 168/211 (80%), Gaps = 2/211 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M  LLF ++ +E+ +I    F+TP+RKL+I+ LDR KRGRG +V++T++ TV VV+++++
Sbjct  1    MQHLLFAVVLSEVVVIMALSFKTPIRKLLIMSLDRAKRGRGPVVIQTISVTVLVVLVASV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++++++ RWIED  G + PTD++++A+HLLE++LMG  LFLGLMIDRLHHY+RELR+RR
Sbjct  61   YSMMNIQKRWIED--GAMNPTDEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTME +KK+   ++  KA   +E+K+L+E+  SL+ER KQL SE+E +SKE  + + +AI
Sbjct  119  KTMEVIKKEGAGLEGVKAKALDEVKNLKEEIMSLQERQKQLASEIETRSKEIRTEKTSAI  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLD  146
            AL+KQSEGFL+E++RLLEENQ LR QL + D
Sbjct  179  ALQKQSEGFLIEFNRLLEENQELRDQLHTAD  209



>emb|CDY34616.1| BnaC08g41750D [Brassica napus]
Length=224

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 172/224 (77%), Gaps = 5/224 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M  LLF ++ AE+A+I    F+TP+RKL+I+ LDR KRGRG +VV+TV+ TV VV+++++
Sbjct  1    MQHLLFAVVLAEVAVILALSFKTPIRKLLIMSLDRAKRGRGPVVVQTVSATVCVVLVASV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGL---MIDRLHHYIRELR  428
            Y+++ ++ RW+E+  G   PTD++++++HLLE++LMG S F  +   MIDRLHHY+RELR
Sbjct  61   YSMMKIQKRWVEE--GATNPTDEVIMSKHLLESTLMGKSSFASVAAEMIDRLHHYMRELR  118

Query  427  MRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseA  248
            MRRKTME +KK+   ++  KA  S+E+KSL+++ ++L+ER KQL +E+E  SKE  + E 
Sbjct  119  MRRKTMEVIKKEGSVLEGEKARASDEVKSLKQEITALQERQKQLAAEMEAMSKEIRTEET  178

Query  247  NAIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            + IAL+KQSEGFL+E++RL EENQ LR+QL ++D ++S S  KK
Sbjct  179  SGIALQKQSEGFLIEFNRLSEENQDLRNQLHTVDSRISRSSIKK  222



>gb|KFK40615.1| hypothetical protein AALP_AA2G019200 [Arabis alpina]
Length=221

 Score =   204 bits (520),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 161/203 (79%), Gaps = 2/203 (1%)
 Frame = -1

Query  724  FVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTIYNVISLRNRWIEDEGGDI  545
            F F+TP+RK +I+GLDR KRGRG +VVKTV+ T+FVV +S++Y+++ ++ RW  +  G +
Sbjct  19   FSFKTPIRKFLIMGLDRSKRGRGPMVVKTVSVTIFVVFVSSVYSMMKIQKRWFVE--GSV  76

Query  544  TPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRRKTMEAVKKQNRAIDEGKA  365
             PTD++++A+HLLE++LMG  LFLGLMIDRLHHY+RELR+RRK+MEA+KKQ    + GK 
Sbjct  77   NPTDEVIMAKHLLESTLMGGVLFLGLMIDRLHHYMRELRVRRKSMEAIKKQTVGFESGKV  136

Query  364  GISEEIKSLEEQASSLRERIKQLeseveekskeassseANAIALKKQSEGFLLEYDRLLE  185
            G S+EIK LE++  +L E+ K LESE+E  +KE  S E+N++AL+KQSEGFL+E++RLLE
Sbjct  137  GASDEIKKLEDEVKALLEKEKHLESELETMTKEVRSEESNSVALQKQSEGFLIEFNRLLE  196

Query  184  ENQHLRSQLQSLDRKLSHSDSKK  116
            ENQ LR QL S+  K+S S  KK
Sbjct  197  ENQKLRDQLHSMGMKISGSSIKK  219



>ref|XP_004952370.1| PREDICTED: B-cell receptor-associated protein 31-like [Setaria 
italica]
Length=219

 Score =   204 bits (518),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 164/219 (75%), Gaps = 2/219 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGR-GSIvvktvagtvfvVMLST  602
            MIQLLF ++ AE ++    +F+TPLRKL +LGLDR+KRGR   + VKTVAG    ++ ST
Sbjct  1    MIQLLFVVVLAEASVAAALLFKTPLRKLAVLGLDRLKRGRRAPVAVKTVAGVFLALLAST  60

Query  601  IYNVISLRNRWIE-DEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRM  425
            +Y++  +  R  + D GG +TPTDQ+L ++HLLEASLMG++LFL L+IDRLH YIR+LR 
Sbjct  61   LYSMAEISGRASDPDSGGGLTPTDQVLFSRHLLEASLMGYTLFLMLVIDRLHQYIRDLRG  120

Query  424  RRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseAN  245
             +K +EAV K N  ++E K GISEE K  +E+ ++L + + +L+ +V+EK++E   +E  
Sbjct  121  FKKNLEAVSKHNNMLEEAKVGISEETKKYQEEIANLNKEMNKLKLQVQEKTEEVHVAEDK  180

Query  244  AIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHS  128
            A+A++KQSEG L+EYDRLLE+NQHLR QLQS+D +LS S
Sbjct  181  ALAIQKQSEGLLIEYDRLLEDNQHLRIQLQSIDLRLSSS  219



>ref|XP_009347127.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
Length=221

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 167/221 (76%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+ +IF+EM LI   +F+ PLRKLVIL LD++KRG+G ++VKTVAGTVF V+++ +
Sbjct  1    MLQLLYTVIFSEMLLILTLLFKNPLRKLVILALDKMKRGKGPVMVKTVAGTVFAVLMADV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            +N++ ++NR IE   G + PTD+IL++  +LE SLMGF LFL LM DRLHHYIRELR  R
Sbjct  61   FNLVDIKNRTIE--SGVLKPTDEILMSMKMLEISLMGFFLFLSLMTDRLHHYIRELRFLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEA K+QN++  E K G  E++K++ ++  +L+ +IK LESE E  +K+A  + +   
Sbjct  119  KAMEAAKRQNQSSQEEKNGSPEQLKTIVQENETLKTKIKTLESEYETNAKKAKVAGSEVE  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEG L+EYDRL  +NQ+LRSQL S+++  SH+D KK
Sbjct  179  ALRKQSEGLLMEYDRLQADNQNLRSQLASIEQSASHTDGKK  219



>ref|XP_008649481.1| PREDICTED: uncharacterized protein LOC103630179 [Zea mays]
 gb|AFW77553.1| hypothetical protein ZEAMMB73_124915 [Zea mays]
Length=221

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 161/203 (79%), Gaps = 2/203 (1%)
 Frame = -1

Query  718  FRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTIYNVISLRNRWIEDEGGDITP  539
            F TP+R+L +L +DR KRGRG ++ KT+AGT+ +V++S  Y+V  +R R  E E G +TP
Sbjct  21   FPTPVRRLALLAIDRAKRGRGPVMAKTIAGTMLLVLVSAFYSVAKIRRR--EGELGQLTP  78

Query  538  TDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRRKTMEAVKKQNRAIDEGKAGI  359
            TDQ+L ++HLLEASLMG+SLFLGL+IDRLHHYIRELRM RK MEAV +Q R ++  K+G 
Sbjct  79   TDQVLASRHLLEASLMGYSLFLGLIIDRLHHYIRELRMLRKDMEAVTEQGRTLEAAKSGS  138

Query  358  SEEIKSLEEQASSLRERIKQLeseveekskeassseANAIALKKQSEGFLLEYDRLLEEN  179
            ++EI+  +++ +SL+E++++L+++ ++K++   ++EAN++AL+KQSEG L EYDRL+ EN
Sbjct  139  TDEIQGYQKEVASLKEQVQELQNQSQKKTERLKTAEANSVALQKQSEGLLAEYDRLIAEN  198

Query  178  QHLRSQLQSLDRKLSHSDSKKVS  110
            + LR QLQS+D +LSHS  KK S
Sbjct  199  RDLRDQLQSIDLRLSHSGGKKNS  221



>ref|XP_002889902.1| hypothetical protein ARALYDRAFT_334480 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66161.1| hypothetical protein ARALYDRAFT_334480 [Arabidopsis lyrata subsp. 
lyrata]
Length=221

 Score =   202 bits (513),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 168/211 (80%), Gaps = 2/211 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M QLLF ++  E+ +I    F+TP+RKL+I+ LDR KRGRG +V++TV+ TV V++++++
Sbjct  1    MQQLLFAVVLFEVVVIMALSFKTPMRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN+++++ RWIED  G + PTD++++A+HLLE++LMG  LFLGLMIDRLHHY+RELR+RR
Sbjct  61   YNMMAIQKRWIED--GVVNPTDEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K ME +KK+   ++  KA   +E+K+L E+ +SLR+R +QL+SE+E +SKE  +   +A+
Sbjct  119  KNMEVIKKEGALLEGVKARGLDEVKNLMEEITSLRKRQEQLDSELEARSKEIRTERTSAV  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLD  146
            AL+KQSEGFL+E++RLLEENQ LR QL ++D
Sbjct  179  ALQKQSEGFLIEFNRLLEENQVLRDQLHAVD  209



>ref|NP_849648.4| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
 gb|AAM98189.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28811.1| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
Length=221

 Score =   201 bits (512),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 168/211 (80%), Gaps = 2/211 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M QLLF ++  E+ +I    F+TP+RKL+I+ LDR KRGRG +V++TV+ TV V++++++
Sbjct  1    MQQLLFAVVLFEVVVIMALSFKTPIRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN++ ++ RWIED  G + PTD++++A+HLLE++LMG  LFLGLMIDRLHHY+RELR+RR
Sbjct  61   YNMMGIQKRWIED--GVVNPTDEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K ME +KK+   ++  KA   +E+K+L E+ +SLR+R +QL+SE+E +SKE  + + +A+
Sbjct  119  KNMEVIKKEGALLEGVKARGLDEVKNLMEEITSLRKRQEQLDSELEARSKEIRTEKTSAV  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLD  146
            AL+KQSEGFL+E++RLLEENQ LR QL ++D
Sbjct  179  ALQKQSEGFLIEFNRLLEENQVLRDQLHTVD  209



>gb|EMT11422.1| hypothetical protein F775_31561 [Aegilops tauschii]
Length=222

 Score =   199 bits (507),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 116/220 (53%), Positives = 165/220 (75%), Gaps = 4/220 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGR-GSIvvktvagtvfvVMLST  602
            MIQL   ++ AE A+  + +F+TPLRKL +LGLDR+KRGR   + VKTVAG V  ++ ST
Sbjct  1    MIQLRCVVLVAESAVATVLLFKTPLRKLAMLGLDRLKRGRRAPVAVKTVAGVVITLLAST  60

Query  601  IYNVISLRNRWIEDEGGD---ITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL  431
            +Y++  +  R  + E G    ++PTDQ+L ++HLLEASLMG++LFL L+IDRLH YIREL
Sbjct  61   LYSMAEISGRAGDPEAGGGAALSPTDQVLFSRHLLEASLMGYTLFLALVIDRLHQYIREL  120

Query  430  RMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassse  251
            R  +K +EAV KQN+ ++EGK G S+EI   +E+ ++L E +K+L+ +V+EK++E   +E
Sbjct  121  RGLKKNVEAVSKQNKTLEEGKHGRSQEIAKYQEEVATLNEEMKKLKLQVQEKTEEVHVAE  180

Query  250  ANAIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSH  131
              A+A++KQSE  LLEYDRLLE+NQHLR QLQS+D +LS+
Sbjct  181  DKALAIQKQSESLLLEYDRLLEDNQHLREQLQSIDLRLSN  220



>ref|NP_001170289.1| LOC100384252 [Zea mays]
 gb|ACG36076.1| B-cell receptor-associated protein 31-like containing protein 
[Zea mays]
 gb|AFW71005.1| b-cell receptor-associated protein 31-like containing protein 
[Zea mays]
Length=220

 Score =   199 bits (506),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 165/219 (75%), Gaps = 2/219 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGR-GSIvvktvagtvfvVMLST  602
            MIQLLF ++ AE +L    +F+TPLRKL +L +DR+KRGR   +VVKTVAG +  ++ ST
Sbjct  1    MIQLLFVVLVAEASLTAALLFKTPLRKLAVLVIDRLKRGRHAPVVVKTVAGVILALLAST  60

Query  601  IYNVISLRNRWIE-DEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRM  425
            +Y++  +     + D GG  TPTDQ+L ++HLLEA LMG+SLFL L+IDRLH YIR+LR 
Sbjct  61   LYSMTQIAGSTSDSDSGGGPTPTDQVLFSRHLLEACLMGYSLFLALVIDRLHQYIRDLRR  120

Query  424  RRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseAN  245
             +K +EAV+K N+ ++E K G SEE K  +E+ ++L + +K+L+ +V+EK++E   SE  
Sbjct  121  FKKDLEAVRKHNKMLEEAKHGNSEEAKKYQEEIATLNKEMKKLKLQVQEKTEEVHVSEDK  180

Query  244  AIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHS  128
            A+A++KQSEG L EYDRLLE+NQHLR+QL S+DR+LS+S
Sbjct  181  ALAIQKQSEGLLTEYDRLLEDNQHLRTQLLSIDRRLSNS  219



>ref|XP_010476134.1| PREDICTED: uncharacterized protein LOC104755448 [Camelina sativa]
Length=221

 Score =   197 bits (500),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 168/211 (80%), Gaps = 2/211 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M QLLF ++  E+ +I    F+TP+RKL+I+ LDR KRGRG +V++TV+ TV V+ ++++
Sbjct  1    MEQLLFAVVLFEVVVIVALSFKTPIRKLLIMSLDRAKRGRGPVVIQTVSVTVIVLFVASV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN+++++ RWIED  G + PTD++++A+HLLE++LMG  LFLGLMIDRLHHY+RELR+RR
Sbjct  61   YNMMAIQKRWIED--GAVNPTDEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTME +KK+   ++  KA   +EIK+L+E+  SLR+R +QL SE+E +SKE  + + +A+
Sbjct  119  KTMEVIKKEGALLEGVKARGLDEIKNLKEEIMSLRKRQEQLNSELEARSKEIRTQKTSAV  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLD  146
            AL+KQSEGFL+E++RLLEENQ LR QL ++D
Sbjct  179  ALQKQSEGFLIEFNRLLEENQGLRDQLHTVD  209



>ref|XP_010458605.1| PREDICTED: uncharacterized protein LOC104739838 [Camelina sativa]
Length=221

 Score =   196 bits (499),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 169/211 (80%), Gaps = 2/211 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M QLLF ++  E+ +I    F+TP+RKL+I+ LDR KRGRG +V++TV+ TV V+ ++++
Sbjct  1    MEQLLFAVVLFEVVVIVALSFKTPIRKLLIMSLDRAKRGRGPVVIQTVSATVIVLFVASV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN+++++ RWIED  G + PTD++++A+HLLE++LMG  LFLGLMIDRLHHY+RELR+RR
Sbjct  61   YNMMAIQKRWIED--GAVNPTDEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTME +KK+   ++  KA   +EIK+L+E+ +SL++R +QL SE+E +SKE  + + +A+
Sbjct  119  KTMEVIKKEGALLEGVKARGLDEIKNLKEEITSLQKRQEQLNSELEARSKEIRTQKTSAV  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLD  146
            AL+KQSEGFL+E++RLLEENQ LR QL ++D
Sbjct  179  ALQKQSEGFLIEFNRLLEENQGLRDQLHTVD  209



>ref|XP_006654198.1| PREDICTED: B-cell receptor-associated protein 31-like [Oryza 
brachyantha]
Length=221

 Score =   196 bits (499),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 156/201 (78%), Gaps = 2/201 (1%)
 Frame = -1

Query  718  FRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTIYNVISLRNRWIEDEGGDITP  539
            FRTP R+L +L LDR KRGRG ++V+TVA T+ VV+ S+ Y++  +R R    + G +TP
Sbjct  21   FRTPARRLALLALDRAKRGRGPVMVRTVAATMIVVLGSSGYSIAKIRRRV--GDLGQLTP  78

Query  538  TDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRRKTMEAVKKQNRAIDEGKAGI  359
            TDQ+L ++HLLEASLMG+SLFLG++IDRLHHYIRELR  +K MEAV KQ+R ++E K G 
Sbjct  79   TDQVLASRHLLEASLMGYSLFLGIIIDRLHHYIRELRTMKKNMEAVTKQSRVLEEAKHGS  138

Query  358  SEEIKSLEEQASSLRERIKQLeseveekskeassseANAIALKKQSEGFLLEYDRLLEEN  179
             E I+  +++ SSL E++++L+   E+K++E  ++EANA+AL+KQSEG L EY+RL+ EN
Sbjct  139  VEGIQQYQKEISSLNEQVQELKRLSEKKTEELKTAEANALALQKQSEGLLTEYERLIAEN  198

Query  178  QHLRSQLQSLDRKLSHSDSKK  116
            +  RSQLQS+D ++SHSD KK
Sbjct  199  EQFRSQLQSMDLRMSHSDGKK  219



>ref|NP_001055067.1| Os05g0272900 [Oryza sativa Japonica Group]
 gb|AAT85231.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16981.1| Os05g0272900 [Oryza sativa Japonica Group]
 gb|EAY97334.1| hypothetical protein OsI_19258 [Oryza sativa Indica Group]
 dbj|BAG97944.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63061.1| hypothetical protein OsJ_17869 [Oryza sativa Japonica Group]
Length=221

 Score =   194 bits (494),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 154/201 (77%), Gaps = 2/201 (1%)
 Frame = -1

Query  718  FRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTIYNVISLRNRWIEDEGGDITP  539
            FRTP R+L +L +DR KRGRG ++VKTVA T+ VV+ S+ Y++  +R R    + G +TP
Sbjct  21   FRTPFRRLALLAIDRAKRGRGPVMVKTVAATMLVVLGSSGYSIAKIRRRV--GDLGQLTP  78

Query  538  TDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRRKTMEAVKKQNRAIDEGKAGI  359
            TDQ+L ++HLLEASLMG+SLFLGL+IDRLHHYIRELR  +K MEAV KQ+R ++E K G 
Sbjct  79   TDQVLASRHLLEASLMGYSLFLGLIIDRLHHYIRELRTMKKNMEAVTKQSRTLEEAKHGS  138

Query  358  SEEIKSLEEQASSLRERIKQLeseveekskeassseANAIALKKQSEGFLLEYDRLLEEN  179
             EEI+  +++ S L E++++ +   E K++E  ++EAN +AL+KQSEG L EY+RL+ EN
Sbjct  139  VEEIQQYQKEISRLNEQVQEFKRLSETKTEELKTAEANTLALQKQSEGLLTEYERLIAEN  198

Query  178  QHLRSQLQSLDRKLSHSDSKK  116
            +  R+QLQS+D +LSHSD+KK
Sbjct  199  EEFRNQLQSMDLRLSHSDNKK  219



>dbj|BAK02060.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92500.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=222

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 168/220 (76%), Gaps = 4/220 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGR-GSIvvktvagtvfvVMLST  602
            MIQLLF ++ AE A+  + +F+TPLRKL +LGLDR+KRGR   + VKTVAG VF ++ ST
Sbjct  1    MIQLLFVVLVAEAAVATVLLFKTPLRKLAMLGLDRLKRGRRAPVAVKTVAGVVFTLLAST  60

Query  601  IYNVISLRNRWIEDEGGD---ITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL  431
            +Y++  +  R  + EGG    ++PTDQ+L ++HLLEASLMG+SLFL L+IDRLH YIREL
Sbjct  61   LYSMAEISGRAGDPEGGGGAALSPTDQVLFSRHLLEASLMGYSLFLALVIDRLHQYIREL  120

Query  430  RMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassse  251
            R  +K +EAV KQN+ ++EGK G S+EI   +E+ ++L E +K+L+ +V+EK+KE   ++
Sbjct  121  RGLKKNVEAVSKQNKMLEEGKHGRSQEIAKYQEEVATLNEEMKKLKLQVQEKTKEVHVAQ  180

Query  250  ANAIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSH  131
               +A++KQSE  LLEYDRLLE+NQHLR QLQS+D +LS+
Sbjct  181  DKTLAIQKQSESLLLEYDRLLEDNQHLREQLQSIDLRLSN  220



>ref|XP_007046390.1| B-cell receptor-associated 31-like [Theobroma cacao]
 gb|EOY02222.1| B-cell receptor-associated 31-like [Theobroma cacao]
Length=219

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 169/222 (76%), Gaps = 6/222 (3%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLL+ +I  ++  I   +F+TP RKL+I+ LDRVKRGRG +V+ TVA T+ VV+ ST+
Sbjct  1    MIQLLYSVIMLQVGFIITLLFKTPFRKLLIMALDRVKRGRGPVVLTTVAATLMVVLASTL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+++ ++ R I+     + PTDQ+L+++H+LEASLMGF LFL LMIDRLHHYIRELR  R
Sbjct  61   YSMLKIQRRTID--AAALNPTDQVLMSKHMLEASLMGFVLFLALMIDRLHHYIRELRFLR  118

Query  418  KTMEAVKKQNRAIDEGK-AGISEEIKSLEEQASSLRERIKQLeseveekskeassseANA  242
            K+ME  KKQ++  ++ K AG   E+K+L E+   L+ +IK+LESE E KSKE  +++A A
Sbjct  119  KSMETAKKQSQGYEDRKNAG---ELKALGEETVILKTKIKKLESECETKSKEVEAAQAEA  175

Query  241  IALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
             AL+KQSEG LLEYDRLLE+NQ+L++QL+S+++ LS   +KK
Sbjct  176  EALRKQSEGLLLEYDRLLEDNQNLQNQLESIEQSLSEPGAKK  217



>ref|XP_010493468.1| PREDICTED: uncharacterized protein LOC104770706 [Camelina sativa]
Length=221

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 157/191 (82%), Gaps = 2/191 (1%)
 Frame = -1

Query  718  FRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTIYNVISLRNRWIEDEGGDITP  539
            F+TP+RKL+I+ LDR KRGRG +V++TV+ TV V+ ++++YN+++++ RWIED  G + P
Sbjct  21   FKTPIRKLLIMSLDRAKRGRGPVVIQTVSATVIVLFVASVYNMMAIQKRWIED--GAVNP  78

Query  538  TDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRRKTMEAVKKQNRAIDEGKAGI  359
            TD++++A+HLLE++LMG  LFLGLMIDRLHHY+RELR+RRKTME +KK+   ++  KA  
Sbjct  79   TDEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKTMEVIKKEGALLEGVKARG  138

Query  358  SEEIKSLEEQASSLRERIKQLeseveekskeassseANAIALKKQSEGFLLEYDRLLEEN  179
             +EIK+L+E+  SL++R +QL SE+E +SKE  + + +A+AL+KQSEGFL+E++RLLEEN
Sbjct  139  LDEIKNLKEEIMSLQKRQEQLNSELEARSKEIRTQKTSAVALQKQSEGFLIEFNRLLEEN  198

Query  178  QHLRSQLQSLD  146
            Q LR QL ++D
Sbjct  199  QDLRDQLHTVD  209



>gb|KHN44866.1| hypothetical protein glysoja_040795 [Glycine soja]
Length=217

 Score =   191 bits (484),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 164/221 (74%), Gaps = 6/221 (3%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+ +IF EM +I  F+F+TP RKLVI+ LDRVKR        TVA T+ VV+ S++
Sbjct  1    MLQLLYAVIFGEMFVIASFLFKTPARKLVIITLDRVKRVVVK----TVAATLLVVLASSL  56

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  +R R ++     + PTDQ+L+++H+LEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  57   YSIAKIRRRNLD--APVVNPTDQVLVSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLR  114

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEA KKQ+R+ ++GK+  + E K+L E+ + L+ +I++LESE E ++ +A + E    
Sbjct  115  KAMEAAKKQSRSFEDGKSVSAAEHKALLEENAMLKPKIEKLESECEVEASKAKALETEVE  174

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFL+EYDRLL +NQ+LRSQLQ++D    HS +KK
Sbjct  175  ALRKQSEGFLMEYDRLLADNQNLRSQLQAIDHSSPHSVNKK  215



>ref|XP_010234160.1| PREDICTED: uncharacterized protein LOC100839925 [Brachypodium 
distachyon]
Length=222

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 166/221 (75%), Gaps = 4/221 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGR-GSIvvktvagtvfvVMLST  602
            MIQLLF ++ AE A+    +F+TPLRKL +LGLDR+KRGR   + VKTVAG V  ++ ST
Sbjct  1    MIQLLFVVLVAEAAVAVTLLFKTPLRKLAVLGLDRLKRGRRAPVAVKTVAGVVLTLLAST  60

Query  601  IYNVISLRNRWIEDE---GGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL  431
            +Y++  +  R  + E   GG ++PTDQ+L ++HLLEASLMG+SLFL L+IDRLH YIREL
Sbjct  61   LYSMAEISGRTGDPESGGGGALSPTDQVLFSRHLLEASLMGYSLFLALIIDRLHQYIREL  120

Query  430  RMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassse  251
            R  +K +EAV KQN+ ++E K G +EE    +E+ ++L E +K+L+ +V+EK++E   +E
Sbjct  121  RGLKKNVEAVSKQNKMLEETKHGRNEETIKYQEEIATLNEEMKKLKLQVQEKTEEVHVAE  180

Query  250  ANAIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHS  128
              A+A++KQSE  LLEYDRLLE+NQHLR QLQS+D +L++S
Sbjct  181  DKALAIRKQSENLLLEYDRLLEDNQHLREQLQSIDLRLNNS  221



>dbj|BAJ86435.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00959.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=221

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 167/221 (76%), Gaps = 2/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQL+F L+ AE AL+ + +FRTP R+L +L +D  KRGRG ++ +TVA T+ VV+ S+ 
Sbjct  1    MIQLMFTLLAAEAALVLVLLFRTPARRLALLAVDCSKRGRGPVMARTVAATMLVVLGSSG  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  +R R  E E   +TPTDQ+L ++HLLEASLMG+SLFLGL+IDRLHHYIR+LR  +
Sbjct  61   YSIAKIRRR--EGEFAQLTPTDQVLASRHLLEASLMGYSLFLGLIIDRLHHYIRQLRAMK  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEAV KQ+R ++E K G SEEI+  +++  SL E+++ L+ + E +++E  ++E N +
Sbjct  119  KNMEAVTKQSRVLEETKLGDSEEIQRYQKKIDSLNEQVQALKHQSESQTEELKTAEINNL  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEG L EY+RL+ EN+ LR++LQ+++ + S SDSKK
Sbjct  179  ALRKQSEGLLTEYERLIAENEELRNKLQTMEIRFSRSDSKK  219



>ref|XP_006847259.2| PREDICTED: B-cell receptor-associated protein 31 isoform X2 [Amborella 
trichopoda]
 ref|XP_011624428.1| PREDICTED: B-cell receptor-associated protein 31 isoform X3 [Amborella 
trichopoda]
Length=220

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 173/221 (78%), Gaps = 3/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF L+F E  LI + + RTPLRKLV+LGLDRVKRGRG  VVKT+A TVFVV++S++
Sbjct  1    MIQLLFALLFGEGLLILLLLVRTPLRKLVLLGLDRVKRGRGPAVVKTLATTVFVVLVSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
             +V+ ++ R      G ITPTDQ+L+++H+LEAS+MG++LFL LMIDR+HH++ ELR+ R
Sbjct  61   NSVMKIQRRA--SAVGSITPTDQVLMSKHMLEASMMGYALFLTLMIDRMHHHMTELRILR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K + +  +   A   G    S   ++LEE  ++L+E++K+L+ E E K +EA ++E NA+
Sbjct  119  KQIRSSGEGKSAGGSGDNSNSNR-RALEEDIAALQEKVKELQLESEAKDREAKTAETNAM  177

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFLLEYDRLLE+NQ+LRSQLQS+DR+LSHSDSKK
Sbjct  178  ALRKQSEGFLLEYDRLLEDNQNLRSQLQSVDRRLSHSDSKK  218



>gb|ERN08840.1| hypothetical protein AMTR_s00015p00062110, partial [Amborella 
trichopoda]
Length=219

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 173/221 (78%), Gaps = 3/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF L+F E  LI + + RTPLRKLV+LGLDRVKRGRG  VVKT+A TVFVV++S++
Sbjct  1    MIQLLFALLFGEGLLILLLLVRTPLRKLVLLGLDRVKRGRGPAVVKTLATTVFVVLVSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
             +V+ ++ R      G ITPTDQ+L+++H+LEAS+MG++LFL LMIDR+HH++ ELR+ R
Sbjct  61   NSVMKIQRRA--SAVGSITPTDQVLMSKHMLEASMMGYALFLTLMIDRMHHHMTELRILR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K + +  +   A   G    S   ++LEE  ++L+E++K+L+ E E K +EA ++E NA+
Sbjct  119  KQIRSSGEGKSAGGSGDNSNSNR-RALEEDIAALQEKVKELQLESEAKDREAKTAETNAM  177

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFLLEYDRLLE+NQ+LRSQLQS+DR+LSHSDSKK
Sbjct  178  ALRKQSEGFLLEYDRLLEDNQNLRSQLQSVDRRLSHSDSKK  218



>ref|XP_010089483.1| hypothetical protein L484_011937 [Morus notabilis]
 gb|EXB37876.1| hypothetical protein L484_011937 [Morus notabilis]
Length=253

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 123/252 (49%), Positives = 172/252 (68%), Gaps = 32/252 (13%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI+LL+ +I  EM LI   +F+TPLR+LV++ LD+VKRGRG ++VKT+A TVF++ + ++
Sbjct  1    MIELLYMVIAVEMVLILTLIFKTPLRQLVLMALDKVKRGRGPVMVKTIAITVFLLFVVSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSL-----FLGLMID--------  458
             + ++++N  I + GG I PTDQ+L+A+HLLEASLMGF L     F  L ++        
Sbjct  61   CSFVNIQNH-ITEAGGGINPTDQVLMAKHLLEASLMGFQLEIIMNFPNLYVEGSHLGFAS  119

Query  457  ------------------RLHHYIRELRMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEE  332
                              RLHHYIRELR+ RKTMEA KKQNR  + GK G + E+K+ E+
Sbjct  120  ITAIMKDYAIIASVYKNYRLHHYIRELRILRKTMEAAKKQNRGHENGKNGNAAELKASEQ  179

Query  331  QASSLRERIKQLeseveekskeassseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQS  152
              + L+  IK+LESE + K++EA ++E  A ALKKQSEGFL+EYD LL ENQ+LR+QL+S
Sbjct  180  DIAQLKATIKKLESECKTKTEEAEAAEGKAEALKKQSEGFLMEYDHLLAENQNLRNQLES  239

Query  151  LDRKLSHSDSKK  116
            +D+ L  SD+KK
Sbjct  240  IDQSLLASDNKK  251



>ref|XP_011624427.1| PREDICTED: B-cell receptor-associated protein 31 isoform X1 [Amborella 
trichopoda]
Length=222

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 173/221 (78%), Gaps = 3/221 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF L+F E  LI + + RTPLRKLV+LGLDRVKRGRG  VVKT+A TVFVV++S++
Sbjct  1    MIQLLFALLFGEGLLILLLLVRTPLRKLVLLGLDRVKRGRGPAVVKTLATTVFVVLVSSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
             +V+ ++ R      G ITPTDQ+L+++H+LEAS+MG++LFL LMIDR+HH++ ELR+ R
Sbjct  61   NSVMKIQRRA--SAVGSITPTDQVLMSKHMLEASMMGYALFLTLMIDRMHHHMTELRILR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K + +  +   A   G    S   ++LEE  ++L+E++K+L+ E E K +EA ++E NA+
Sbjct  119  KQIRSSGEGKSAGGSGDNSNSNR-RALEEDIAALQEKVKELQLESEAKDREAKTAETNAM  177

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEGFLLEYDRLLE+NQ+LRSQLQS+DR+LSHSDSKK
Sbjct  178  ALRKQSEGFLLEYDRLLEDNQNLRSQLQSVDRRLSHSDSKK  218



>ref|XP_009779153.1| PREDICTED: B-cell receptor-associated protein 31-like, partial 
[Nicotiana sylvestris]
Length=150

 Score =   184 bits (467),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  490  GFSLFLGLMIDRLHHYIRELRMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRE  311
            GFSLFL  MIDRLHHYIREL MRRKTMEAV+KQNRA ++GK+G SEEIK+LEE+AS+LR 
Sbjct  24   GFSLFLAFMIDRLHHYIRELSMRRKTMEAVRKQNRAFEDGKSGASEEIKTLEEEASALRG  83

Query  310  RIKQLeseveekskeassseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSH  131
            +IKQLESE++ K+KEAS +EANA+ALKKQSEGFLLEYDRLLEENQ+LRSQLQSLDR LS 
Sbjct  84   KIKQLESELQVKAKEASGAEANAVALKKQSEGFLLEYDRLLEENQNLRSQLQSLDRTLSR  143

Query  130  SDSKKVS  110
            SDSKKVS
Sbjct  144  SDSKKVS  150



>ref|XP_011047243.1| PREDICTED: B-cell receptor-associated protein 31-like [Populus 
euphratica]
Length=218

 Score =   186 bits (473),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 170/221 (77%), Gaps = 5/221 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQ L+  IF+EM +I   +FR PLRKLVI+GLDRVKRGRG +VVKTVAGT+ V++LS +
Sbjct  1    MIQPLYIAIFSEMGVILTLIFRNPLRKLVIMGLDRVKRGRGPVVVKTVAGTILVLLLSNV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y + +++NR +E   G + PTD++L+A  LL+ASL+GF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YTIGNIQNRKME--AGALNPTDEVLMAMLLLQASLLGFLLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEA KKQNR+ ++GK G   E K L E+  +LR ++K+LESE E K KEA ++EA A 
Sbjct  119  KAMEAAKKQNRSFEDGKNG---EGKGLGEEVEALRSKVKKLESEYEAKVKEAEAAEAKAE  175

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEG LL+YD LLE+NQ LR+QL S+D+  S SD KK
Sbjct  176  ALRKQSEGSLLQYDHLLEDNQSLRNQLDSIDQTSSPSDGKK  216



>ref|XP_006303826.1| hypothetical protein CARUB_v10012392mg [Capsella rubella]
 gb|EOA36724.1| hypothetical protein CARUB_v10012392mg [Capsella rubella]
Length=221

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 169/211 (80%), Gaps = 2/211 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M QLLF ++  E+ +I    F+TP+RKL+I+ LDR KRGRG +V++TV+ TV V++++++
Sbjct  1    MQQLLFAVVLFEVVVIMALSFKTPIRKLLIMSLDRAKRGRGPVVIQTVSATVIVLLVASV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN++ ++ RWIED  G + PTD++++A+HLLE++LMG  LFLGLMIDRLHHY+RELR+RR
Sbjct  61   YNMMGIQKRWIED--GAVNPTDEVIMAKHLLESTLMGGLLFLGLMIDRLHHYMRELRIRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            KTME +KK+   ++  KA   +EIK+L+E+  SLR+R +QL+SE+E KSKE  + + +A+
Sbjct  119  KTMEVIKKEGALLEGVKARGLDEIKTLKEEIMSLRKRQEQLDSELEAKSKEIRTEKTSAV  178

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLD  146
            AL+KQSEGFL+E++RLLEENQ LR QL ++D
Sbjct  179  ALQKQSEGFLIEFNRLLEENQDLREQLHTVD  209



>ref|XP_002320470.1| hypothetical protein POPTR_0014s15290g [Populus trichocarpa]
 gb|ABK92570.1| unknown [Populus trichocarpa]
 gb|EEE98785.1| hypothetical protein POPTR_0014s15290g [Populus trichocarpa]
Length=218

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 170/221 (77%), Gaps = 5/221 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQ ++  IF+EM +I   +FR PLRK VI+GLDRVKRGRG +VVKTVAGT+ V++LS +
Sbjct  1    MIQPVYVAIFSEMGVILTLIFRNPLRKFVIMGLDRVKRGRGPVVVKTVAGTILVLLLSNV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++ +++NR +E   G + PT+++L+A  LL+ASL+GF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSIGNMQNRKME--AGALNPTEEVLMAMQLLQASLLGFLLFLSLMIDRLHHYIRELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K MEA KKQNR+ ++GK G   E K L E+  +LR ++K+LESE E K KEA ++EA A 
Sbjct  119  KAMEAAKKQNRSFEDGKNG---EGKGLGEEVETLRSKVKKLESEYEAKVKEAEAAEAKAE  175

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            AL+KQSEG LL+YD LLE+NQ LR+QL S+D+  S SD KK
Sbjct  176  ALRKQSEGSLLQYDHLLEDNQSLRNQLDSIDQTSSPSDGKK  216



>gb|ADE75913.1| unknown [Picea sitchensis]
Length=228

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 169/230 (73%), Gaps = 13/230 (6%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT--PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLS  605
            MIQLLF L+FA+ AL  +F+     PLRKL+I  LD+ K G+GS +VKT+ GT+ V++ S
Sbjct  1    MIQLLFTLVFAQGAL-ALFLMANIPPLRKLIIKILDQTKTGKGSAIVKTLGGTMLVILAS  59

Query  604  TIYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRM  425
            +I +++ ++ R ++   G I PTDQIL+  HLLEASLMGF+LFL ++IDRLHHYIREL  
Sbjct  60   SITSILKIQTRSVK--MGTIAPTDQILMRTHLLEASLMGFALFLAIIIDRLHHYIRELSG  117

Query  424  RRKTMEAVKKQNRA-------IDEGKAGISEEIKSLEEQASSLRERIKQLeseveekske  266
             R  ME+++KQ ++       + E K G S E+  L+++ + L++++++L  E +EK +E
Sbjct  118  LRMNMESLRKQAKSSQEEYFRLKEEKEG-SNEMTLLKDEIADLKQKLQKLTLESKEKERE  176

Query  265  assseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            A  +E+NA+AL+KQSEGFLLEYDRLLE+NQ+LRSQL + DRK S SDSKK
Sbjct  177  AEVAESNALALRKQSEGFLLEYDRLLEDNQNLRSQLATFDRKFSRSDSKK  226



>gb|EAY85610.1| hypothetical protein OsI_06982 [Oryza sativa Indica Group]
Length=227

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 163/228 (71%), Gaps = 17/228 (7%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGR-GSIvvktvagtvfvVMLST  602
            MIQLLF ++ AE A+  + +F+TPLRKL ++G+DR+KRGR   + VKTVAG V  ++ ST
Sbjct  1    MIQLLFLVLVAEAAVAAVLLFKTPLRKLAVMGIDRLKRGRRAPVAVKTVAGVVLALLAST  60

Query  601  IYNVISLRNRWIEDEGGD------------ITPTDQILLAQHLLEASLMGFSLFLGLMID  458
            +Y++  +  R     GGD            ++PTDQ+L ++HLLEASLMG+SLFL L+ID
Sbjct  61   LYSMAEISGRA----GGDPESGGGGGGGASLSPTDQVLFSRHLLEASLMGYSLFLALVID  116

Query  457  RLHHYIRELRMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLesevee  278
            RLH YIRELR  +K +EAV K N+ ++E K G SEE K  +E+  +L E +K+L+ +V+E
Sbjct  117  RLHQYIRELRGLKKNVEAVIKHNKMLEEAKHGRSEETKKYQEEIGALNEDMKKLKLQVQE  176

Query  277  kskeassseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLS  134
            K++E   +E  A+A++KQSE  LLEYDRLLE+NQHLR QLQS+D +LS
Sbjct  177  KTEEVHVAEDKALAIRKQSESLLLEYDRLLEDNQHLREQLQSIDHRLS  224



>ref|XP_003563854.1| PREDICTED: B-cell receptor-associated protein 29 [Brachypodium 
distachyon]
Length=226

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 160/224 (71%), Gaps = 3/224 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF ++ AE  L    +F+TPLRKL +L LDR+KRG+G ++V+TVA TV VV+ S++
Sbjct  1    MIQLLFTVLGAEAGLAAALLFKTPLRKLAMLALDRLKRGKGPVMVRTVAATVLVVLASSL  60

Query  598  YNVISLRNRWIE---DEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELR  428
            +++  +         D  G +TPTDQ+LLA+HLLEASLMG+SLFL L+IDRLH YIRE+R
Sbjct  61   HSMAKIHGHASGGELDAPGALTPTDQVLLARHLLEASLMGYSLFLALIIDRLHRYIREMR  120

Query  427  MRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseA  248
              +K +EAV KQN+ ++E K   S+  K  ++  +SL E IK+L  +++EK+ E   +EA
Sbjct  121  GLKKNLEAVSKQNKTLEEVKLVTSDGSKPYQKDIASLNEEIKKLRLQLKEKADEVKDAEA  180

Query  247  NAIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
             A+A + QSEG +L+YDRLLE+ +HL  QLQS D  LSHSD KK
Sbjct  181  RAVAAQTQSEGLMLKYDRLLEDKKHLHDQLQSGDIALSHSDGKK  224



>ref|NP_001046689.1| Os02g0321800 [Oryza sativa Japonica Group]
 dbj|BAD28852.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08603.1| Os02g0321800 [Oryza sativa Japonica Group]
 gb|EAZ22804.1| hypothetical protein OsJ_06479 [Oryza sativa Japonica Group]
 dbj|BAG92174.1| unnamed protein product [Oryza sativa Japonica Group]
Length=226

 Score =   181 bits (460),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 161/223 (72%), Gaps = 8/223 (4%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGR-GSIvvktvagtvfvVMLST  602
            MIQLLF ++ AE A+  + +F+TPLRKL ++G+DR+KRGR   + VKTVAG V  ++ ST
Sbjct  1    MIQLLFLVLVAEAAVAAVLLFKTPLRKLAVMGIDRLKRGRRAPVAVKTVAGVVLALLAST  60

Query  601  IYNVISLRNRWIEDEG-------GDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHY  443
            +Y++  +  R   D           ++PTDQ+L ++HLLEASLMG+SLFL L+IDRLH Y
Sbjct  61   LYSMAEISGRAGGDPESGGGGGGASLSPTDQVLFSRHLLEASLMGYSLFLALVIDRLHQY  120

Query  442  IRELRMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            IRELR  +K +EAV K N+ ++E K G SEE K  +E+  +L E +K+L+ +V+EK++E 
Sbjct  121  IRELRGLKKNVEAVTKHNKMLEEAKHGRSEETKKYQEEIGALNEDMKKLKLQVQEKTEEV  180

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLS  134
              +E  A+A++KQSE  LLEYDRLLE+NQHLR QLQS+D +LS
Sbjct  181  HVAEDKALAIRKQSESLLLEYDRLLEDNQHLREQLQSIDHRLS  223



>ref|XP_002453641.1| hypothetical protein SORBIDRAFT_04g009770 [Sorghum bicolor]
 gb|EES06617.1| hypothetical protein SORBIDRAFT_04g009770 [Sorghum bicolor]
Length=222

 Score =   181 bits (458),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 156/221 (71%), Gaps = 4/221 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVML-ST  602
            MIQLLF ++ AE +L    +F+TPLRKL +L +DR+KRGR + VV      V + +L ST
Sbjct  1    MIQLLFAVLVAEASLTAALLFKTPLRKLAVLVVDRLKRGRHAPVVVKTVAGVVLALLAST  60

Query  601  IYNVISLRNRWIEDEGGDI---TPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL  431
            +Y++  +     + + G     TPTDQ+L ++HLLEA LMG+SLFL L+IDRLH YIR+L
Sbjct  61   LYSMSQISGGASDSDSGSGGGPTPTDQVLFSRHLLEACLMGYSLFLALVIDRLHQYIRDL  120

Query  430  RMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassse  251
            R+ +K +EAV+K N+ ++E K G SE+ K  +E+ + L + +K+L+ +V+EK +E   +E
Sbjct  121  RVFKKDLEAVRKHNKMLEETKHGNSEDAKKYQEEIAILNKEMKKLKLQVQEKIEEVHVAE  180

Query  250  ANAIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHS  128
              A+ ++KQSEG L+EYDRLLE+NQHLR QL S+D KLS S
Sbjct  181  DKALTIQKQSEGLLIEYDRLLEDNQHLRDQLMSIDLKLSSS  221



>dbj|BAJ87002.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 159/224 (71%), Gaps = 3/224 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF ++ AE  L  + +F+TPLRKL +L LDR+KRG+  ++V+TVA TV VV+ S++
Sbjct  1    MIQLLFTVLAAEAGLAAVLLFKTPLRKLAMLALDRLKRGQAPVMVRTVAATVLVVLASSL  60

Query  598  YNVISLRNRWIE---DEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELR  428
            +++  +         D  G ++PTDQ+LLA+HLLEASLMG+ LFL L+IDRLH YIRE+R
Sbjct  61   HSMAKIHGHAGAGELDAPGALSPTDQVLLARHLLEASLMGYILFLALVIDRLHSYIREMR  120

Query  427  MRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseA  248
              +K +EAV KQN+ ++E ++G S+E K      +SL E IK+L+ +++EK++EA  +EA
Sbjct  121  GLKKNLEAVSKQNKTLEEARSGKSDESKPHHNDMASLNEEIKKLKLQLKEKAQEAKDAEA  180

Query  247  NAIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
             A+A + QSEG   +YD LLE+N+HL  QLQS    LS SD KK
Sbjct  181  KAVAAQTQSEGLARKYDSLLEDNKHLHEQLQSGGIPLSRSDGKK  224



>gb|ACU19065.1| unknown [Glycine max]
Length=200

 Score =   177 bits (449),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+  IF+EM LI   VF+TPLRKLVI+ LD VKRGRG +VV TV  T+ VV+ S++
Sbjct  1    MLQLLYTAIFSEMLLILTLVFKTPLRKLVIVSLDSVKRGRGPVVVSTVGATLMVVLASSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  ++ R +E   G + PTDQ+L+++H+LEASLMGF LFL LMIDRLHHYIRELR  R
Sbjct  61   YSMAKIQQRTLE--AGIVNPTDQVLMSKHMLEASLMGFLLFLSLMIDRLHHYIRELRSLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQL  296
            KTMEA+KKQ+R+ ++GK G SEE K+L E+ ++L+ +IK+L
Sbjct  119  KTMEAIKKQSRSFEDGKNGNSEEHKALNEEITTLKSKIKKL  159



>ref|XP_003596956.1| hypothetical protein MTR_2g088060 [Medicago truncatula]
 gb|ABN08523.1| Prefoldin [Medicago truncatula]
 gb|AES67207.1| B-cell receptor-associated-like protein [Medicago truncatula]
Length=222

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 152/220 (69%), Gaps = 1/220 (0%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLL+ +IF EM +I  F+F+TPLR LVI+ L++VKRGRG ++VKTV GTV  ++ S +
Sbjct  1    MLQLLYAVIFVEMLMIMSFLFKTPLRNLVIITLNKVKRGRGPVIVKTVVGTVVTMLGSAL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN+  ++ R IE     +  TDQ+LL+ H+L+ASL+GF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YNIFKIQRRSIEG-FATVDSTDQVLLSNHVLQASLLGFVLFLSLMIDRLHHYIRELRLLR  119

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
              +E  KKQNR         + E  SL+E+  +LR +I++LESE E K     S E    
Sbjct  120  NAVETGKKQNRCFQNNTNIKAMEHTSLKEEIGALRFKIEKLESECEVKGSRVKSLEIEVE  179

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSK  119
            A KKQSEGFL+EYD LL +NQ+LR  L+ ++++ S+ D K
Sbjct  180  AFKKQSEGFLMEYDGLLIDNQNLRKLLECIEKRSSYVDDK  219



>ref|XP_006647215.1| PREDICTED: B-cell receptor-associated protein 29-like [Oryza 
brachyantha]
Length=225

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 160/225 (71%), Gaps = 8/225 (4%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGR-GSIvvktvagtvfvVMLST  602
            MIQLLF ++ AE A+    +F+TPLRKL +LG+D +KRGR   + VKTVAG V  ++ ST
Sbjct  1    MIQLLFLVLVAEAAVAAALLFKTPLRKLAVLGIDCLKRGRRAPVAVKTVAGVVTALLTST  60

Query  601  IYNVISLRNRWIEDEG-------GDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHY  443
            +Y++  +  R   D           ++PTDQ+L ++HLLEASLMG+SLFL L+IDRLH Y
Sbjct  61   LYSMAEISGRAGGDPESGGGGGGASLSPTDQVLFSRHLLEASLMGYSLFLALVIDRLHQY  120

Query  442  IRELRMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            IRELR  +K +EAV K N+ ++E K G  EE K  +E+ ++L E +K+L+ +V+EK++EA
Sbjct  121  IRELRGLKKNVEAVSKHNKMLEEAKHGSIEETKKYQEEIAALNEDMKKLKLQVQEKTEEA  180

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHS  128
              +E  A+A++KQSE  LLEYDRLLE+NQHLR QL S+D +LS S
Sbjct  181  HIAEDKALAIRKQSESLLLEYDRLLEDNQHLREQLHSIDLRLSSS  225



>ref|NP_001154328.1| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
 gb|AEE28812.1| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
Length=220

 Score =   173 bits (438),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 161/211 (76%), Gaps = 3/211 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M QLLF ++  E+ +I    F+TP+RKL+I+ LDR KRGRG +V++TV+ TV V++++++
Sbjct  1    MQQLLFAVVLFEVVVIMALSFKTPIRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN++ ++ RWIED  G + PTD++++A+HLLE++LM   +    ++  LHHY+RELR+RR
Sbjct  61   YNMMGIQKRWIED--GVVNPTDEVIMAKHLLESTLM-VRVLELCLLLWLHHYMRELRIRR  117

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAI  239
            K ME +KK+   ++  KA   +E+K+L E+ +SLR+R +QL+SE+E +SKE  + + +A+
Sbjct  118  KNMEVIKKEGALLEGVKARGLDEVKNLMEEITSLRKRQEQLDSELEARSKEIRTEKTSAV  177

Query  238  ALKKQSEGFLLEYDRLLEENQHLRSQLQSLD  146
            AL+KQSEGFL+E++RLLEENQ LR QL ++D
Sbjct  178  ALQKQSEGFLIEFNRLLEENQVLRDQLHTVD  208



>gb|KHG00718.1| separin [Gossypium arboreum]
 gb|KJB67240.1| hypothetical protein B456_010G182000 [Gossypium raimondii]
Length=160

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 129/161 (80%), Gaps = 4/161 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLLF +IFAEMA+I +  F+TPLRKLV++ LDR KRGRG ++VKTV GTV VVMLS I
Sbjct  1    MLQLLFTVIFAEMAVIIVLCFKTPLRKLVLMVLDRAKRGRGPVIVKTVGGTVSVVMLSYI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            ++++ L+ RWI D  G+ + TD+IL+A++LLE +LMG  LFL L+ID+LHHYI+ELR+RR
Sbjct  61   FSMMMLKKRWIVD--GNASLTDEILMAKNLLETTLMGGLLFLSLIIDKLHHYIKELRIRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQL  296
            KTME  KKQ +  ++  AG S+++ +LEE+ ++LR RIKQL
Sbjct  119  KTMETAKKQGQGFED--AGGSDKVTALEEEIATLRARIKQL  157



>ref|XP_012089876.1| PREDICTED: uncharacterized protein LOC105648175 [Jatropha curcas]
Length=139

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 115/142 (81%), Gaps = 3/142 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLL+ +IFAEMALI   +F+TPLRKLVIL LDRVK+GRG ++VKTV GTVF+V+LS++
Sbjct  1    MIQLLYTVIFAEMALILTLLFKTPLRKLVILTLDRVKQGRGPVMVKTVGGTVFIVLLSSL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  ++NR IE       PTDQ+L+A+H+LEASLMGF LFL LMIDRLHHYIRELR+ R
Sbjct  61   YSMFEIQNRSIEAAPN---PTDQVLMARHMLEASLMGFLLFLSLMIDRLHHYIRELRLLR  117

Query  418  KTMEAVKKQNRAIDEGKAGISE  353
            K MEA KKQ+R  ++ K G SE
Sbjct  118  KAMEAAKKQSRGFEDVKNGNSE  139



>ref|NP_001057612.2| Os06g0367500 [Oryza sativa Japonica Group]
 dbj|BAD69146.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG88794.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF19526.2| Os06g0367500 [Oryza sativa Japonica Group]
Length=199

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 149/197 (76%), Gaps = 5/197 (3%)
 Frame = -1

Query  691  ILGLDRVKRGRGSIvvktvagtvfvVMLSTIYNVISLRNRWI-EDEG---GDITPTDQIL  524
            +LGLDR+KRGRG ++V+TVA TV VV+ S+++++  +R R   E +G   G +TPTDQ+L
Sbjct  1    MLGLDRLKRGRGPVMVRTVAATVLVVLASSVHSMNKIRGRAAGELDGAGAGTLTPTDQVL  60

Query  523  LAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRRKTMEAVKKQNRAIDEGK-AGISEEI  347
            LA+HLLEASLMG+SLFL L+IDRLH+YIRE+R  ++ +EA  K N+ +DE K  G S+E 
Sbjct  61   LARHLLEASLMGYSLFLALVIDRLHNYIREVRGLKRNLEAASKLNKTLDEAKLIGSSDES  120

Query  346  KSLEEQASSLRERIKQLeseveekskeassseANAIALKKQSEGFLLEYDRLLEENQHLR  167
            K+ ++  +SL E IK+++ +++EK+ EA  +EA A+A +KQSEG ++EY+ L+E+N+HL 
Sbjct  121  KTYQKDIASLNEEIKKMKRQLKEKANEAKDAEAKALAAQKQSEGLMIEYNHLVEDNKHLH  180

Query  166  SQLQSLDRKLSHSDSKK  116
             QL+S D  +S SD KK
Sbjct  181  DQLESADLTVSRSDGKK  197



>gb|ACN36491.1| unknown [Zea mays]
Length=157

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = -1

Query  562  DEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRRKTMEAVKKQNRA  383
            D GG  TPTDQ+L ++HLLEA LMG+SLFL L+IDRLH YIR+LR  +K +EAV+K N+ 
Sbjct  12   DSGGGPTPTDQVLFSRHLLEACLMGYSLFLALVIDRLHQYIRDLRRFKKDLEAVRKHNKM  71

Query  382  IDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAIALKKQSEGFLLE  203
            ++E K G SEE K  +E+ ++L + +K+L+ +V+EK++E   SE  A+A++KQSEG L E
Sbjct  72   LEEAKHGNSEEAKKYQEEIATLNKEMKKLKLQVQEKTEEVHVSEDKALAIQKQSEGLLTE  131

Query  202  YDRLLEENQHLRSQLQSLDRKLSHS  128
            YDRLLE+NQHLR+QL S+DR+LS+S
Sbjct  132  YDRLLEDNQHLRTQLLSIDRRLSNS  156



>gb|AAC17626.1| Contains similarity to BAP31 protein gb|X81816 from Mus musculus 
[Arabidopsis thaliana]
 gb|ACB88825.1| At1g11905 [Arabidopsis thaliana]
Length=228

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 119/154 (77%), Gaps = 2/154 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M QLLF ++  E+ +I    F+TP+RKL+I+ LDR KRGRG +V++TV+ TV V++++++
Sbjct  1    MQQLLFAVVLFEVVVIMALSFKTPIRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN++ ++ RWIED  G + PTD++++A+HLLE++LMG  LFLGLMIDRLHHY+RELR+RR
Sbjct  61   YNMMGIQKRWIED--GVVNPTDEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSL  317
            K ME +KK+   ++  KA   +E+K+L E+ +S 
Sbjct  119  KNMEVIKKEGALLEGVKARGLDEVKNLMEEITSF  152



>ref|XP_006830526.1| PREDICTED: B-cell receptor-associated protein 31 [Amborella trichopoda]
 gb|ERM97942.1| hypothetical protein AMTR_s00117p00045900 [Amborella trichopoda]
Length=220

 Score =   150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 150/214 (70%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++F E  +  + + +  PLR+L + GLD++K GRG   VKT+A T+ V+M S+
Sbjct  1    MIQLLFLVLFMEGIVALLLMIKIGPLRELTMKGLDQLKMGRGPATVKTLACTMAVIMASS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            I +++ ++NR ++   G +TP DQ+L   HLLEASL+G+SLFL L+IDR+H+Y+ +L   
Sbjct  61   ITSILKIQNRGLKI--GTVTPMDQVLWRTHLLEASLIGYSLFLALVIDRMHNYLSKLSGS  118

Query  421  RKTMEAVKKQNRAIDEGKA-------GISEEIKSLEEQASSLRERIKQLeseveekskea  263
            +KT+   K+Q +   E  A         SEEI++L+E+ SSL ER+++L+ E +EK K A
Sbjct  119  KKTLGNSKQQAKKFQEEYALLKEKQEKASEEIRALKEEISSLTERLQKLKLESDEKEKRA  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EAN IAL+KQSE  LLEYDRLLE+NQ L+SQ
Sbjct  179  QAAEANVIALQKQSEDLLLEYDRLLEDNQILQSQ  212



>ref|XP_010247234.1| PREDICTED: B-cell receptor-associated protein 31-like [Nelumbo 
nucifera]
Length=218

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 152/214 (71%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE  +  + + +  PLR+LV+  LD++K G+G   VKT+AGT+ V++ S+
Sbjct  1    MIQLLFLVLFAEGIVAFLLMVKIGPLRELVMKALDQLKTGKGPATVKTIAGTMSVILASS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL---  431
            I +++ ++NR  +   G +TP DQ+L   HLLEASLMG+SLFLG +IDRLHHY+++L   
Sbjct  61   ITSLLKIQNRGTKL--GTVTPMDQVLWRTHLLEASLMGYSLFLGFVIDRLHHYLQKLGGL  118

Query  430  ----RMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
                R  ++ +E + K +  + E +   SEEIK L+E+ SSL+E IK+L+ E EEK K+ 
Sbjct  119  RTTARYSKQEVEKLHKDHLQLKEKEVKASEEIKLLQEEISSLKENIKKLKLECEEKDKQV  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             S+EA+  AL+KQ+E  LLEYDRLLE+NQ+L++Q
Sbjct  179  QSAEAHVTALQKQAEDLLLEYDRLLEDNQNLQAQ  212



>ref|XP_009778813.1| PREDICTED: uncharacterized protein LOC104228107 [Nicotiana sylvestris]
Length=108

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 92/100 (92%), Gaps = 1/100 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF LIFAEMALI IFVF+TPLRKLVI+GLDRVKRGRG I+VKTVAGTVFVVMLSTI
Sbjct  1    MIQLLFTLIFAEMALIVIFVFKTPLRKLVIMGLDRVKRGRGPIIVKTVAGTVFVVMLSTI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSL  479
            Y++ S+R RW+ DEGGDITPTDQILLAQHLLEASLMG  L
Sbjct  61   YSIASIRTRWM-DEGGDITPTDQILLAQHLLEASLMGIVL  99



>ref|XP_009802750.1| PREDICTED: uncharacterized protein LOC104248228 [Nicotiana sylvestris]
Length=145

 Score =   144 bits (364),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 108/137 (79%), Gaps = 4/137 (3%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQ LF L+F E+A++ I VFRTPLRK V++ LDR K+GRG ++VK+  GT+FVV++S +
Sbjct  1    MIQPLFALVFFEVAVVLILVFRTPLRKPVLMALDRSKQGRGPVIVKSAGGTLFVVLVSIL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            +NV  ++NR    E G + PTDQ+LLA HLLEASL+GFSLFL L+IDRLH+YI+ELR+ R
Sbjct  61   FNVTIIQNR--ATESGTVNPTDQVLLANHLLEASLLGFSLFLALVIDRLHYYIKELRLLR  118

Query  418  KTMEAVK--KQNRAIDE  374
            KT+EA K  KQ+R ++ 
Sbjct  119  KTLEAEKKTKQSREVEN  135



>gb|KHN36526.1| ATP-dependent helicase rhp16 [Glycine soja]
Length=1121

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 125/166 (75%), Gaps = 2/166 (1%)
 Frame = -1

Query  613   MLSTIYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRE  434
             + S++Y++  +R+R ++    +  PTDQ+L+ +H+LEASLMGF LFL LMIDRLHHYIRE
Sbjct  956   LASSLYSIAKIRHRNLDAPVAN--PTDQVLVYKHMLEASLMGFVLFLSLMIDRLHHYIRE  1013

Query  433   LRMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeasss  254
             LR+ RK MEA KKQ+R+ + GK+  + E K+L E+ + L+ +I++LESE E ++ +A + 
Sbjct  1014  LRLLRKAMEAAKKQSRSFEGGKSVSAAEHKALVEEIAMLKPKIEKLESECEMEASKAKAL  1073

Query  253   eANAIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
             E    AL+KQSEGFL+EYDRLL +NQ+LRSQ+Q++D    HS +KK
Sbjct  1074  ETEVEALRKQSEGFLMEYDRLLADNQNLRSQVQAIDHSSPHSVNKK  1119



>gb|EMS49195.1| hypothetical protein TRIUR3_29235 [Triticum urartu]
Length=183

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = -1

Query  562  DEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRRKTMEAVKKQNRA  383
            D  G ++PTDQ+LLA+HLLEASLMG+ LFL L+IDRLH YIRE+R  +K +EAV KQN+ 
Sbjct  33   DAPGALSPTDQVLLARHLLEASLMGYILFLALVIDRLHSYIREMRGLKKNLEAVSKQNKT  92

Query  382  IDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAIALKKQSEGFLLE  203
            ++E K+G S+E K      +SL E IK+L+ +++EK++EA  +EA A+A + QSEG   +
Sbjct  93   LEEAKSGRSDESKPHHNDIASLNEEIKKLKRQLKEKAEEAKDAEAKALAAQTQSEGLARK  152

Query  202  YDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            YDRLLE+N+HL  QLQS D  LS SD KK
Sbjct  153  YDRLLEDNKHLHDQLQSGDIPLSRSDGKK  181



>ref|XP_009381320.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381321.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381322.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381323.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
Length=218

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 150/214 (70%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE A+  I +++  PLR+L + GLD++K G+G   VKT+A T+ V++ S+
Sbjct  1    MIQLLFLVLFAEGAVALILMWKIGPLRELAMRGLDQLKTGKGPATVKTLACTMSVILASS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            + +++ ++NR  +   G +TP DQ+L   HL+EASL+G++LFL L+IDRLHHY+R+L   
Sbjct  61   VASILKIQNRGAK--LGTVTPMDQVLWRTHLVEASLIGYTLFLALVIDRLHHYLRKLINL  118

Query  421  RKT-------MEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R+T       +E +KK+ +   E +     EIK L E+ +SL+ER+++L+SE  E  K A
Sbjct  119  RRTANSSQEEVENLKKEQQRFKEKEETSLNEIKKLHEEVASLKERLQKLKSESAEHEKRA  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EA+  AL+KQSE  LLEYDRLLE+NQ L++Q
Sbjct  179  ETAEAHVTALQKQSEELLLEYDRLLEDNQILQTQ  212



>ref|XP_009599718.1| PREDICTED: uncharacterized protein LOC104095323 [Nicotiana tomentosiformis]
Length=145

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 108/137 (79%), Gaps = 4/137 (3%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQ LF L+F E+A++ I VFRTPLRK V++ LDR K+GRG ++VK+  GT+FVV++S +
Sbjct  1    MIQPLFALVFFEVAVVLILVFRTPLRKPVLMALDRSKQGRGPVIVKSAGGTLFVVLVSIL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            +NV  ++NR    + G + PTDQ+LLA HLLEASL+GFSLFL L+IDRLH+YI+ELR+ R
Sbjct  61   FNVTIIQNR--ATDSGTVNPTDQVLLANHLLEASLLGFSLFLALVIDRLHYYIKELRLLR  118

Query  418  KTMEAVK--KQNRAIDE  374
            KT+EA K  KQ+R ++ 
Sbjct  119  KTLEAEKKTKQSREVEN  135



>gb|ACG43219.1| B-cell receptor-associated protein 31-like containing protein 
[Zea mays]
 gb|ACG44967.1| B-cell receptor-associated protein 31-like containing protein 
[Zea mays]
 tpg|DAA52496.1| TPA: b-cell receptor-associated protein 31-like containing protein 
[Zea mays]
Length=217

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 153/217 (71%), Gaps = 10/217 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE A+  + + +  PLR+L + G+D+VK G+G   VKT+A T+ V+++S+
Sbjct  1    MIQLLFLVLFAEGAVALLLMVKVGPLRELAMRGVDQVKTGKGPATVKTLACTLSVILMSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            + +++ ++NR ++   G ++P DQ+L   HLLEASL+G++LFL  +IDRLHHY+R+L   
Sbjct  61   VASILKIQNRGLK--LGTVSPMDQVLWRTHLLEASLIGYTLFLAFVIDRLHHYLRKLMTL  118

Query  421  RKT-------MEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            RKT       +E ++ +NR++ E +   S E K L+ + + L E +K+L+SE EE  ++A
Sbjct  119  RKTSSTSREEVEKLQMENRSLREKEEKSSSETKRLQREIARLNEGMKKLKSETEEHERKA  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQS  152
            S +EA+  AL+KQSE  LLEYDRLLE+NQ L++QL S
Sbjct  179  SVAEAHVDALQKQSEELLLEYDRLLEDNQILQTQLLS  215



>gb|EMT32966.1| hypothetical protein F775_31670 [Aegilops tauschii]
Length=183

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -1

Query  562  DEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRRKTMEAVKKQNRA  383
            D    ++PTDQ+LLA+HLLEASLMG+ LFL L+IDRLH YIRE+R  +K +EAV KQN+ 
Sbjct  33   DAPAALSPTDQVLLARHLLEASLMGYILFLALVIDRLHSYIREMRGLKKNLEAVSKQNKT  92

Query  382  IDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAIALKKQSEGFLLE  203
            ++E K G S+E K      +SL E IK+L+ +++EK++EA  +EA A+A + QSEG   +
Sbjct  93   LEEAKPGRSDESKPHHNDIASLNEEIKKLKRQLKEKAEEAKDAEAKALAAQTQSEGLARK  152

Query  202  YDRLLEENQHLRSQLQSLDRKLSHSDSKK  116
            YDRLLE+N+HL  QLQS D  LS SD KK
Sbjct  153  YDRLLEDNKHLHEQLQSGDIPLSRSDGKK  181



>ref|XP_002266257.2| PREDICTED: B-cell receptor-associated protein 31 [Vitis vinifera]
Length=218

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 156/215 (73%), Gaps = 12/215 (6%)
 Frame = -1

Query  778  MIQLLFPLIFAE--MALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLS  605
            MIQLLF ++FAE  +AL+ + V   PLR+LV+ GLD+VK G+G   VKT+AGT+ V++LS
Sbjct  1    MIQLLFLVLFAEGIVALL-LMVKIGPLRELVMKGLDQVKMGKGPATVKTIAGTMSVILLS  59

Query  604  TIYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL-R  428
            ++ +++ ++N+  +   G +TP DQ+L   HLLE SLMGFSLFLG +IDR+HHY+++L R
Sbjct  60   SVTSILKIQNKGAKL--GTMTPMDQVLWRTHLLETSLMGFSLFLGFLIDRMHHYLQKLNR  117

Query  427  MR------RKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekske  266
            +R      ++  E ++K+   + E +   S+EIK L+EQ S+L + +K+L+ E EEK K+
Sbjct  118  LRGNAGASKEEFEKLQKERAQLKEKEEQASKEIKLLQEQISTLTQDLKKLKLEAEEKDKK  177

Query  265  assseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
              ++EA+ ++L+KQ+   LLEYDRLLE+NQ+L++Q
Sbjct  178  VETAEAHVVSLQKQAADLLLEYDRLLEDNQNLQTQ  212



>ref|XP_002463520.1| hypothetical protein SORBIDRAFT_01g001290 [Sorghum bicolor]
 gb|EER90518.1| hypothetical protein SORBIDRAFT_01g001290 [Sorghum bicolor]
Length=217

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 97/217 (45%), Positives = 151/217 (70%), Gaps = 10/217 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MI LLF ++FAE A+  + + +  PLR+L + G+D+VK G+G   VKT+A T+ V+++S 
Sbjct  1    MIHLLFLVLFAEGAVALLLMVKVGPLRELAMRGVDQVKTGKGPATVKTLACTLSVILMSN  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            + +++ ++NR ++   G ++P DQ+L   HLLEASL+G++LFL  +IDRLHHY+R+L   
Sbjct  61   VASILKIQNRGLK--LGTVSPMDQVLWRTHLLEASLIGYTLFLAFVIDRLHHYLRKLMTL  118

Query  421  RKT-------MEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            RKT       +E ++ +NR++ E +   S E K L+ + + L E +K+L+SE EE  ++A
Sbjct  119  RKTSSTSREEVEKLQMENRSLREKEEKSSSETKKLQREIAKLNESMKKLKSETEEHERKA  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQS  152
            S +EA+  AL+KQSE  LLEYDRLLE+NQ L++QL S
Sbjct  179  SVAEAHVNALQKQSEELLLEYDRLLEDNQILQTQLLS  215



>ref|XP_004248701.1| PREDICTED: uncharacterized protein LOC101261860 [Solanum lycopersicum]
Length=147

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 109/144 (76%), Gaps = 2/144 (1%)
 Frame = -1

Query  781  IMIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            +MIQ LF L+F E+ +I   +FRTPLRK V++ LD+ K+GRG ++VK+  GT+FVV++S 
Sbjct  1    MMIQPLFALVFLEVLVILTLIFRTPLRKPVLMALDKSKQGRGPVIVKSAGGTLFVVLVSI  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            ++NV  ++NR    + G + PTDQ+LLA HLLEASL+GF+LFL L+IDRLH+YI+ELR+ 
Sbjct  61   LFNVTLMQNR--ATDSGTVNPTDQVLLANHLLEASLLGFTLFLALVIDRLHYYIKELRLL  118

Query  421  RKTMEAVKKQNRAIDEGKAGISEE  350
            RKTME  KK N+  D+ ++  S+ 
Sbjct  119  RKTMEGEKKMNQNRDQVESAASKS  142



>ref|XP_006365288.1| PREDICTED: uncharacterized protein LOC102597522 [Solanum tuberosum]
Length=147

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 110/149 (74%), Gaps = 4/149 (3%)
 Frame = -1

Query  781  IMIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            +MIQ LF L+F E+ +I   +FRTPLRK V++ LD+ K+GRG ++VK+  GT+FVV++S 
Sbjct  1    MMIQPLFALVFLEVVVILTLIFRTPLRKPVLMALDKSKQGRGPVIVKSAGGTLFVVLVSI  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            ++NV  ++NR    + G + PTDQ+LLA HLLEASL+GF+LFL L+IDRLH+YI+ELR+ 
Sbjct  61   LFNVTLMQNR--ATDSGTVNPTDQVLLANHLLEASLLGFTLFLALVIDRLHYYIKELRLL  118

Query  421  RKTMEAVKKQNRAID--EGKAGISEEIKS  341
            RKT+E  KK N++ D  E  A  S  I +
Sbjct  119  RKTLEGEKKTNQSRDQVENAASKSPSIST  147



>ref|XP_010274041.1| PREDICTED: B-cell receptor-associated protein 31-like [Nelumbo 
nucifera]
Length=218

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 152/219 (69%), Gaps = 18/219 (8%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFR-----TPLRKLVILGLDRVKRGRGSIvvktvagtvfvV  614
            MIQLLF ++FAE    GI  F       PLR LV+ G+D++K G+GS  +KT+AGT+ V+
Sbjct  1    MIQLLFLVLFAE----GIVAFLLMVKIGPLRDLVMKGMDQLKTGKGSATLKTIAGTMSVI  56

Query  613  MLSTIYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRE  434
            + S+I ++++++N+  +   G +TP DQ+L   HLLEASLMG SLFLG +IDR+HHY+++
Sbjct  57   LASSIISLLNIQNKGTK--LGTVTPMDQVLWRSHLLEASLMGCSLFLGFVIDRIHHYLQK  114

Query  433  L-------RMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveek  275
            L       R  +K +E ++ ++  + E +   S EIK L+E+ SSL+E +K L+ + +EK
Sbjct  115  LIALRTAARSSKKEVEKLQIEHIQLKEKEEKASYEIKLLQEEISSLKENLKNLKLQSDEK  174

Query  274  skeassseANAIALKKQSEGFLLEYDRLLEENQHLRSQL  158
             K+  S+E++  AL+KQ+E  LLEYDRLL+++QHL++Q+
Sbjct  175  DKQIKSAESHVTALEKQTEDLLLEYDRLLDDSQHLQAQV  213



>ref|NP_001141677.1| uncharacterized protein LOC100273803 precursor [Zea mays]
 gb|ACF86841.1| unknown [Zea mays]
Length=217

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 152/217 (70%), Gaps = 10/217 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE A+  + + +  PLR+L + G+D+VK G+G   VKT+A T+ V+++S 
Sbjct  1    MIQLLFLVLFAEGAVALLLMVKVGPLRELAMRGVDQVKTGKGPATVKTLACTLSVILMSG  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            + +++ ++NR ++   G ++P DQ+L   HLLEASL+G++LFL  +IDRLHHY+R+L   
Sbjct  61   VASILKIQNRGLKL--GTVSPMDQVLWRTHLLEASLIGYTLFLAFVIDRLHHYLRKLMTL  118

Query  421  RKT-------MEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            RKT       +E ++ +NR++ E +   S E K L+ + + L E +K+L+SE EE  ++A
Sbjct  119  RKTSSTSREEVEKLQMENRSLREKEEKSSSETKRLQREIARLNEGMKKLKSETEEHERKA  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQS  152
            S +EA+  AL+KQSE  LLEYDRLLE+NQ L++QL S
Sbjct  179  SVAEAHVDALQKQSEELLLEYDRLLEDNQILQTQLLS  215



>ref|XP_012085075.1| PREDICTED: B-cell receptor-associated protein 31 [Jatropha curcas]
 ref|XP_012085076.1| PREDICTED: B-cell receptor-associated protein 31 [Jatropha curcas]
 gb|KDP26363.1| hypothetical protein JCGZ_17521 [Jatropha curcas]
Length=216

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 150/214 (70%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE  +  + + +  PLR+LV+  LD+VK G+G   VKT+AGT+ V++LS+
Sbjct  1    MIQLLFLVLFAEGVVAFLLLVKIGPLRELVLKSLDQVKMGKGPATVKTIAGTMSVILLSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            + +++ ++N+  +   G ++P DQ+L   HLLEASLMGF+LFLG +IDR+HHY+ +L   
Sbjct  61   LMSIVKIQNKGAKL--GTMSPMDQVLWRTHLLEASLMGFTLFLGFIIDRMHHYLTKLISL  118

Query  421  RKTMEAVKKQNRAID------EGKA-GISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R  + + K++   +       +GKA   S EIK L+EQ S+L E +K+L+ E EEK K+ 
Sbjct  119  RSNIGSSKEEVERLQKEKMQLKGKAEKASTEIKQLQEQISTLSESLKKLKLENEEKDKQI  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EA+ +AL+KQS   LLEYDRLLEENQ+L++Q
Sbjct  179  ETAEAHVVALQKQSADLLLEYDRLLEENQNLQAQ  212



>ref|XP_008809940.1| PREDICTED: B-cell receptor-associated protein 31-like [Phoenix 
dactylifera]
Length=218

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 155/217 (71%), Gaps = 10/217 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE A+  + + +  PLR+LV+ GLD++K G+G   VKT+A T+ V++ S+
Sbjct  1    MIQLLFLVLFAEGAVTLLLMVKIGPLRELVMRGLDQLKTGKGPATVKTLACTLSVLLASS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            I +++ ++NR ++   G +TP DQ+L   HLLEASL+G++LFLGL+IDRLHHY+R++   
Sbjct  61   ITSILKIQNRGVKL--GTVTPMDQVLWRTHLLEASLIGYTLFLGLVIDRLHHYLRKMVSL  118

Query  421  RKTM-------EAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            +KT+       E +KK++    + +  +S EI  L+ +  SL E++++L++E E++ K A
Sbjct  119  KKTVGTSKEEVEKLKKEHHYFKDKEDKVSSEIHKLQGEVGSLTEKLQKLKTECEQQEKRA  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQS  152
             S+EA+ ++L+KQSE  LLEYDRLLE+NQ L+ QL S
Sbjct  179  VSAEAHVVSLQKQSEELLLEYDRLLEDNQILQGQLLS  215



>ref|XP_006479253.1| PREDICTED: B-cell receptor-associated protein 31-like isoform 
X1 [Citrus sinensis]
 gb|KDO65964.1| hypothetical protein CISIN_1g027820mg [Citrus sinensis]
Length=218

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 156/216 (72%), Gaps = 10/216 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE AL  + + +  PLR+LVI  LD++K G+G   VKT+AGT+FV++LS+
Sbjct  1    MIQLLFLVLFAEGALAFLLLVKIGPLRELVIKSLDQLKMGKGPATVKTIAGTMFVILLSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL-RM  425
            + +++ ++N+  +   G ++P DQ+L   HLLEASL+GF+LFLG +IDR+HHY+ +L R+
Sbjct  61   LMSIVKIQNKGAK--LGTMSPMDQVLWRTHLLEASLIGFTLFLGFIIDRMHHYLTKLIRL  118

Query  424  R------RKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R      ++ +E ++K+   + + +   S+E+K L+E+ S+L   +K+L+SE E+K K+ 
Sbjct  119  RSNAGSSKEEVEQLQKEKMQLKDKEEKASKELKRLQEEISTLSVNLKKLKSECEQKDKQL  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQ  155
             +++A+ IAL+KQS   LLEYDRLLE+NQ+L+ Q Q
Sbjct  179  ETADAHVIALQKQSADLLLEYDRLLEDNQNLQKQAQ  214



>ref|XP_004981056.1| PREDICTED: B-cell receptor-associated protein 31-like [Setaria 
italica]
Length=217

 Score =   139 bits (349),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 152/217 (70%), Gaps = 10/217 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE A+  + + +  PLR+L +  +D+VK G+G   VKT+A T+ V+++S 
Sbjct  1    MIQLLFLVLFAEGAVALLLMVKVGPLRELAMRVVDQVKTGKGPATVKTLACTLTVILMSD  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            + +++ ++NR ++   G ++P DQ+L   HLLEASL+G++LFL  +IDRLHHY+R+L   
Sbjct  61   VASILKIQNRGLK--LGSVSPMDQVLWRTHLLEASLIGYTLFLAFVIDRLHHYLRKLMTL  118

Query  421  RKT-------MEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            RKT       +E ++ +N+++ E +   S E+K L+ + + L E +K+L+ E EE  ++A
Sbjct  119  RKTSSTSREEVEKLQMENQSLREKEGNSSGEMKKLQREIAKLNESMKKLKFENEEHERKA  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQS  152
            S++EA+  AL+KQSE  LLEYDRLLE+NQ L++QL S
Sbjct  179  SAAEAHVNALQKQSEELLLEYDRLLEDNQILQTQLLS  215



>ref|XP_004963921.1| PREDICTED: B-cell receptor-associated protein 31-like [Setaria 
italica]
Length=134

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  496  LMGFSLFLGLMIDRLHHYIRELRMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSL  317
            L G+SLFLGL+IDRLHHYIRELR   K MEAV KQ+R ++E K G +EEI+  +++ +SL
Sbjct  6    LAGYSLFLGLIIDRLHHYIRELRTMNKNMEAVTKQSRTLEEAKLGGTEEIQGYQKEIASL  65

Query  316  RERIKQLeseveekskeassseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKL  137
            +E+++ L+++ ++K++E  ++EAN++AL+KQSEG L+EYDRL+ EN  LR+QLQS+D ++
Sbjct  66   KEQVELLKNQSQKKTEELKTAEANSVALQKQSEGLLMEYDRLIAENGDLRNQLQSIDLRM  125

Query  136  SHSDSKKVS  110
            SHSD KK S
Sbjct  126  SHSDGKKNS  134



>ref|XP_009410623.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410624.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410625.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410626.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410627.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410629.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
Length=218

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 146/213 (69%), Gaps = 10/213 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE A+  I +++  PLR+L + GLD++K G+G   VKT+A T+ V++ S+
Sbjct  1    MIQLLFLVLFAEGAVALILIWKVGPLRELAMRGLDQLKTGKGPATVKTLACTMSVILASS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELR--  428
            + +++ ++NR    + G +TP DQ+L   HLLEASL+G++LFL L+IDRLHHY+R+L   
Sbjct  61   VASILKIQNR--AAKLGTVTPMDQVLWRTHLLEASLIGYTLFLALVIDRLHHYLRKLVSL  118

Query  427  -----MRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
                   R+ ++ +KK+ ++  E +     E K L E+ + L+ER+++L+ + EE  K A
Sbjct  119  KTTVGTSREEVDNLKKEQQSFKEKEKTSLSERKKLHEEVTRLKERLQKLKLDSEEHEKRA  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRS  164
             ++EA+  AL+KQSE  LLEYD LLE+NQ L++
Sbjct  179  QTAEAHVAALQKQSEELLLEYDHLLEDNQILQT  211



>ref|XP_010099686.1| hypothetical protein L484_025117 [Morus notabilis]
 gb|EXB80263.1| hypothetical protein L484_025117 [Morus notabilis]
Length=216

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 142/214 (66%), Gaps = 12/214 (6%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE  +  + + +  PLR+LVI  LD++K  RG+++            +S+
Sbjct  1    MIQLLFLVLFAEAVVAFLLLVKIGPLRELVIKSLDQLKMKRGTVLTIAGTMFAI--FMSS  58

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
             ++++ ++NR  +   G ++P DQ+L   HLLEASLMGF+LFLG +IDR+HHYIR+L   
Sbjct  59   FFSIVKIQNRGAK--LGSMSPMDQVLWRTHLLEASLMGFTLFLGFIIDRMHHYIRKLIGL  116

Query  421  RKT-------MEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R +       +E ++K+   + E +   S+EIK L+++ S+L E +K+L+ + EEK K+ 
Sbjct  117  RSSVGSSKEELEKLQKEKMQLKEKEQKYSKEIKLLKDEVSTLSESLKKLKIKSEEKDKKV  176

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EA+  AL+KQ+   LLEYDRLLE+NQ+L++Q
Sbjct  177  ETAEAHVQALQKQAADLLLEYDRLLEDNQNLQNQ  210



>gb|KHG09837.1| hypothetical protein F383_09194 [Gossypium arboreum]
Length=218

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 153/214 (71%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE A+  + + +  PLR+LVI  +D++K G+G   VKT+AGT+ V++LS+
Sbjct  1    MIQLLFLVLFAEGAMAFLLLVKIGPLRELVIKSIDQLKMGKGPATVKTIAGTMSVILLSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRE---L  431
            + +++ ++N+  +   G ++P DQ+L   HLLEASL+GF+LFLG +IDR+HHYI++   L
Sbjct  61   LMSIVKIQNKGAK--LGTMSPMDQVLWRTHLLEASLIGFTLFLGFIIDRMHHYIKKLIGL  118

Query  430  RMR----RKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R R    ++  E ++K+   + E     S+EIK L+E+ S+L E +K+L+SE EEK K+ 
Sbjct  119  RSRVGSSKEEAERIEKERIQLKEKDDKASKEIKLLKEEISTLSENLKKLKSESEEKDKKI  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EA+  +L+KQS   LLEYDRLLE+NQ+L++Q
Sbjct  179  KTAEAHVASLQKQSADLLLEYDRLLEDNQNLQNQ  212



>ref|XP_011011172.1| PREDICTED: uncharacterized protein LOC105115831 [Populus euphratica]
Length=218

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 149/214 (70%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE  +  + + +  PLR LVI  LD+VK G+G   VKT+AGT+ V++ S+
Sbjct  1    MIQLLFLVLFAEGFVASLLLVKIGPLRDLVIKSLDQVKMGKGPATVKTIAGTMSVILFSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            + +++ ++++  +   G ++P DQ+L   HLLEASLMGF+LFLG +IDR+HHY+ +L   
Sbjct  61   LMSIVKIQSKGAKL--GTMSPMDQVLWRTHLLEASLMGFTLFLGFLIDRMHHYLSKLIGL  118

Query  421  RKT-------MEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R +       +E ++K+   + E +  +S+E+K L+EQ S+L E +K+L+ E E+K K+ 
Sbjct  119  RSSVGSSKEEVERLQKEKMQLKEEEGKVSKEMKLLQEQFSTLSENLKKLKLESEQKDKQI  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EA+ +AL K+S   LLEYDRLLE+NQ+L++Q
Sbjct  179  ETAEAHVVALHKRSADLLLEYDRLLEDNQNLQAQ  212



>ref|XP_003562352.1| PREDICTED: B-cell receptor-associated protein 31 [Brachypodium 
distachyon]
Length=217

 Score =   136 bits (343),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 92/216 (43%), Positives = 149/216 (69%), Gaps = 10/216 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE A+  + + +  PLR+L +  +++VK G+G   VKT+A T+ V+ +S+
Sbjct  1    MIQLLFLVLFAEGAVALLLMVKVGPLRELAMRTVEQVKTGKGPATVKTLACTLSVIFMSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            + +++ ++NR ++   G ++P DQ+L   HLLEASL+G++LFL  +IDRLHHY+++L   
Sbjct  61   VASILKIQNRGLK--LGTVSPMDQVLWRTHLLEASLIGYTLFLAFVIDRLHHYLQKLITL  118

Query  421  RKT-------MEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            RKT       +E ++ +NR+  E +   S EIK L++  + L E +K+++SE ++  ++A
Sbjct  119  RKTANTSREEVEKLQMENRSFREKEEKSSSEIKKLQQDIAKLTEGMKKMKSESDDNERKA  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQ  155
              +EA+  AL+KQSE  LLEYDRLLE+NQ L+SQL 
Sbjct  179  LEAEAHVNALQKQSEELLLEYDRLLEDNQILQSQLH  214



>ref|XP_008380294.1| PREDICTED: uncharacterized protein LOC103443257 [Malus domestica]
Length=150

 Score =   134 bits (338),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 107/152 (70%), Gaps = 2/152 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI +LF L+ AEMALI   +FRTPLRKLVI+GLDR K+GRG +V K+V GT+ V   STI
Sbjct  1    MILILFTLVLAEMALILSLLFRTPLRKLVIVGLDRSKQGRGPLVXKSVGGTILVFFSSTI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+V S++ R    E G + PTD++L+A  LLEASL+GFSLFL ++IDRLH+YI+EL + R
Sbjct  61   YSVFSVQKRL--SEAGFVNPTDEVLMAHRLLEASLIGFSLFLAMIIDRLHYYIKELHLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQAS  323
            + +E VK   +  +  K+    E+K   ++ S
Sbjct  119  ERVEEVKNLKKDYEHKKSTDPAEVKKATQRIS  150



>ref|XP_009361097.1| PREDICTED: uncharacterized protein LOC103951454 [Pyrus x bretschneideri]
Length=153

 Score =   134 bits (338),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 107/152 (70%), Gaps = 2/152 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQ+LF L+ AEMALI   +FRTPLRKLVI+GLDR K+GRG +VVK+V GT+ V   STI
Sbjct  1    MIQILFTLVLAEMALILSLLFRTPLRKLVIVGLDRSKQGRGPLVVKSVGGTILVFFSSTI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+V S++ R    E G + PTD++L+A  LLEASL+GFSLFL ++IDRLH+ I+ELR+ R
Sbjct  61   YSVFSVQKRL--SEAGFVNPTDEVLMAHRLLEASLIGFSLFLAMIIDRLHYSIKELRLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKSLEEQAS  323
              +E VK   +  +  K+    E+K   +  S
Sbjct  119  GLVEEVKNLKKDDEHRKSTAPAEVKKATQMIS  150



>ref|NP_001143481.1| hypothetical protein [Zea mays]
 gb|ACF83647.1| unknown [Zea mays]
 gb|ACG32480.1| hypothetical protein [Zea mays]
 gb|AFW77082.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_955327 [Zea 
mays]
Length=161

 Score =   134 bits (338),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 108/147 (73%), Gaps = 4/147 (3%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF L+ AE A+  + +F+TPLR+L +L LD +KRGRG ++V+T+A TV VV+ S++
Sbjct  1    MIQLLFTLLAAEGAVAAVLLFKTPLRRLAVLALDHLKRGRGPVMVRTIAATVLVVLASSL  60

Query  598  YNVISLRNRWIEDEGGD----ITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL  431
            +++  +R     +  G     +TPTDQ+LLA+HLLEASLMG+SLFL L+IDRLH+Y++E 
Sbjct  61   HSMAKIRGHAEGELDGSGVVGLTPTDQVLLARHLLEASLMGYSLFLALVIDRLHNYVKEN  120

Query  430  RMRRKTMEAVKKQNRAIDEGKAGISEE  350
            R  RK +E V KQN+A++E   G  EE
Sbjct  121  RRLRKKLEEVLKQNKALEEATNGKLEE  147



>gb|KJB10919.1| hypothetical protein B456_001G232500 [Gossypium raimondii]
Length=218

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 151/214 (71%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE A+  + + +  PLR+LVI  +D++K G+G   VKT+AGT+ V++LS+
Sbjct  1    MIQLLFLVLFAEGAMAFLLLVKIGPLRELVIKSIDQLKMGKGPATVKTIAGTMSVILLSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRE---L  431
            + +++ ++N+  +   G ++P DQ+L   HLLEASL+GF+LFLG +IDR+HHYI++   L
Sbjct  61   LMSIVKIQNKGAK--LGTMSPMDQVLWRTHLLEASLIGFTLFLGFIIDRMHHYIKKLIGL  118

Query  430  RMR----RKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R R    +   E ++K+   + E     S+EIK L+E+ S+L E +K+L+SE EEK K+ 
Sbjct  119  RSRVGSSKDEAERIEKERIQLKEKDDKASKEIKLLKEEISTLSENLKKLKSESEEKDKKI  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
              +EA+  +L+KQS   LLEYDRLLE+NQ+L++Q
Sbjct  179  EIAEAHVASLQKQSADLLLEYDRLLEDNQNLQNQ  212



>ref|XP_009370674.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
 ref|XP_009334907.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
Length=218

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 91/222 (41%), Positives = 148/222 (67%), Gaps = 26/222 (12%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE  +  + + +  PLR+LVI  LD+VK G+G   VKT+AGT+ V+++S+
Sbjct  1    MIQLLFVVLFAEGVVAFLMLVKIGPLRELVIKSLDQVKMGKGPATVKTIAGTMSVILISS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL---  431
              +++ ++N+ ++   G ++P DQ+L   HLLEASLMGF+LFLG +IDR+HHY+ +L   
Sbjct  61   FISIVKIQNKGVK--LGTMSPMDQVLWRTHLLEASLMGFTLFLGFIIDRMHHYLSKLIGL  118

Query  430  ------------RMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLese  287
                        R++++TM+  K++ +A        S+E+K L+ + S+L E +K+L+ E
Sbjct  119  RSSVGASKEELDRLQKETMQLKKQEEKA--------SQEVKQLQAKISTLTEDLKKLKLE  170

Query  286  veekskeassseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
              EK K   ++E +  +L+KQ+   LLEYDRLLE+NQ+L++Q
Sbjct  171  CAEKDKSIETAECHVASLQKQAADLLLEYDRLLEDNQNLQNQ  212



>ref|XP_008794596.1| PREDICTED: B-cell receptor-associated protein 31 [Phoenix dactylifera]
Length=218

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 149/214 (70%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLL+ ++F E A+    + +  PLR++ + GLD++K G+G   VKT+A T+ V+++S+
Sbjct  1    MIQLLYLVLFIEGAVALFLMVKIGPLREMAMKGLDQLKSGKGPATVKTLACTLSVILVSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            +  ++ ++NR ++   G +TP DQ+L   HLLEASL+G+SLFL L+IDRLHHY+++L   
Sbjct  61   VATILKIQNRGVK--LGTVTPMDQVLWRTHLLEASLIGYSLFLALVIDRLHHYLQKLINL  118

Query  421  RKT-------MEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            RKT       +E +K ++    E +   S+EIK L+ + S+L E++++L+SE EE+ + A
Sbjct  119  RKTVGTSREEVEKLKMEHHRFKEKEEKSSDEIKKLQVEVSNLTEKLQKLKSEFEEQEQRA  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EA   +L+KQSE  LLEYDRLLE+NQ L++Q
Sbjct  179  ITAEAYVASLRKQSEELLLEYDRLLEDNQILQTQ  212



>ref|XP_003532279.1| PREDICTED: B-cell receptor-associated protein 31 [Glycine max]
 gb|KHN10978.1| hypothetical protein glysoja_026713 [Glycine soja]
Length=218

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 147/214 (69%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF +IF E  L  + + +  PLR LVI  LD++K G+G   VKT+AGT+ V++LS+
Sbjct  1    MIQLLFLVIFVEGVLAFLLLVKIGPLRDLVIKSLDQLKMGKGPATVKTIAGTMSVILLSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL---  431
            + ++I ++N+  +   G ++P DQ+L   HLLEASLMGF+LFLG +IDR HHY+++L   
Sbjct  61   LMSIIKIQNKGAK--LGTMSPMDQVLWRSHLLEASLMGFTLFLGFLIDRTHHYLQKLINL  118

Query  430  ----RMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
                   ++ +E +KK+   + E     S+EIK L+E+ S L + +++++SE EEK K+ 
Sbjct  119  RSNAGASKEELENLKKETVQLKEKDEKASKEIKQLKEELSCLSKSLEKIKSESEEKDKKV  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EA+  +L+KQ+   LLEYDRLLEENQ+L++Q
Sbjct  179  ETAEAHVASLQKQAADLLLEYDRLLEENQNLQAQ  212



>ref|XP_007140653.1| hypothetical protein PHAVU_008G130500g [Phaseolus vulgaris]
 gb|ESW12647.1| hypothetical protein PHAVU_008G130500g [Phaseolus vulgaris]
Length=218

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 146/214 (68%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF +IFAE  L  + + +  PLR LVI  LD++K G+G   VKT+AGT+ V++LS+
Sbjct  1    MIQLLFLVIFAEGVLAFLLLVKIGPLRDLVIKSLDQLKMGKGPATVKTIAGTMSVILLSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL---  431
            + +++ ++N+  +   G ++P DQ+L   HLLEASLMGF+LFLG +IDR+HHY+++L   
Sbjct  61   LMSIVKIQNKGAK--LGTMSPMDQVLWRTHLLEASLMGFALFLGFLIDRIHHYLQKLVNL  118

Query  430  ----RMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
                R   + +E ++K+   +       S+EIK L+E+ S + E +K ++ E EEK K+ 
Sbjct  119  RSSTRASNEDLENLRKETVQLKGKGEKASKEIKQLKEELSRVSESLKNIKLESEEKDKKV  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EA+  +L+KQ+   LLEYDRLLEENQ+L++Q
Sbjct  179  ETAEAHVASLQKQAADLLLEYDRLLEENQNLQAQ  212



>emb|CDP03896.1| unnamed protein product [Coffea canephora]
Length=216

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 141/214 (66%), Gaps = 12/214 (6%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLL+ ++FAE  +  + V +  PLR+LV+ GLD+VK  +G+++           +LS 
Sbjct  1    MIQLLYLVLFAEGLVAFLLVVKIGPLRELVMKGLDQVKMRKGTVLTIAGTFAAI--LLSN  58

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
             ++++ ++N+  +   G ++P DQ+L   +LLEASLMGF LFLG +IDR+HHY+R+L   
Sbjct  59   FFSIVKIQNKGAK--LGTMSPMDQVLWRTNLLEASLMGFCLFLGFLIDRMHHYLRKLIGL  116

Query  421  RKTMEAVKKQNRAIDEGKAGI-------SEEIKSLEEQASSLRERIKQLeseveekskea  263
            R T  A++K+N  +++ K  +        EEIK ++++ SSL E + +LE E  EK K+ 
Sbjct  117  RSTAGALRKENERLEKDKLQLKEKAEKADEEIKVMKKEISSLTENLNKLEMESAEKDKKV  176

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EA+  AL+KQ+   LLEYDRLLE+NQ+L++Q
Sbjct  177  ETAEAHVAALQKQAADLLLEYDRLLEDNQNLQNQ  210



>ref|XP_009371858.1| PREDICTED: B-cell receptor-associated protein 31 [Pyrus x bretschneideri]
Length=219

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 146/214 (68%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE  +  + + +  PLR+LVI  LD++K G+G   +KT+AGT+ V+++S 
Sbjct  1    MIQLLFVVLFAEGVVAFLLLVKIGPLRELVIKSLDQIKMGKGPATIKTIAGTMSVILISD  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
              +++ ++N+ ++   G ++P DQ+L   HLLEASLMGF+LFLG +IDR+HHY+ +L   
Sbjct  61   FISIVKIQNKGVK--LGTMSPMDQVLWRTHLLEASLMGFTLFLGFVIDRMHHYLSKLIGL  118

Query  421  RKTMEAVK-------KQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R ++ A K       K+   + E +   S+EIK L+++ S+L E +K+L+ E  EK K  
Sbjct  119  RSSVGASKEELDRLQKEKIQLKEKENKSSQEIKELQDKISTLTEDLKKLKLECAEKDKSI  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++E++  +L+KQ+   LLEYDRLLE+NQ+L++Q
Sbjct  179  ETAESHVASLQKQAADLLLEYDRLLEDNQNLQTQ  212



>ref|XP_008382607.1| PREDICTED: B-cell receptor-associated protein 31-like [Malus 
domestica]
Length=218

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 146/214 (68%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE  +  + + +  PLR+LVI  LD+VK G+G   VKT+AGT+ V+++S+
Sbjct  1    MIQLLFVVLFAEGVVAFLMLVKIGPLRELVIKSLDQVKMGKGPATVKTIAGTMSVILISS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL---  431
              +++ ++N+ ++   G ++P DQ+L   HLLEASLMGF+LFLG +IDR+HHY+ +L   
Sbjct  61   FISIVKIQNKGVK--LGTMSPMDQVLWRTHLLEASLMGFTLFLGFIIDRMHHYLSKLIGL  118

Query  430  ----RMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
                   ++ ++ ++K+   + E +   S+E+K L+ + S+L E +K+L+ E  EK K  
Sbjct  119  RXSVGXSKEELDRLQKETIQLKEKEEKASQEVKQLQAKISTLTEDLKKLKLECAEKDKSV  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++E +  +L+KQ+   LLEYDRLLE+NQ+L++Q
Sbjct  179  ETAECHVASLQKQAADLLLEYDRLLEDNQNLQNQ  212



>gb|EAZ03537.1| hypothetical protein OsI_25672 [Oryza sativa Indica Group]
 gb|EAZ39454.1| hypothetical protein OsJ_23885 [Oryza sativa Japonica Group]
Length=214

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 147/214 (69%), Gaps = 6/214 (3%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE A   + + +  PLR+L + G+++ K G+G   VKT+A T+ V+ +S+
Sbjct  1    MIQLLFLVLFAEGAAALLLMVKIGPLRELAMRGVEQAKDGKGPAAVKTLACTLLVIFMSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            + +++ ++NR I+   G ++P DQ+L   HLLEASL+G+ LFL  +IDRLHHY R+L + 
Sbjct  61   VASILRIQNRGIK--LGTVSPMDQVLWRTHLLEASLIGYILFLAFVIDRLHHYHRKLTIL  118

Query  421  RKTMEAVKKQNRAID---EGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassse  251
            +KT    +++   +    +GK   S+E+K L  + +SL E++K+L+SE EE  ++   +E
Sbjct  119  KKTANTSREEVEKLQIELQGKEDKSKEVKKLRAELASLSEKMKKLKSESEEHERQRLEAE  178

Query  250  ANAIALKKQSEGFLLEYDRLLEENQHLRSQLQSL  149
            A+  AL+KQSE  LLEYDRLLE+NQ L++Q+ SL
Sbjct  179  AHVNALQKQSEELLLEYDRLLEDNQILQTQVLSL  212



>ref|XP_002863915.1| hypothetical protein ARALYDRAFT_494932 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40174.1| hypothetical protein ARALYDRAFT_494932 [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 148/215 (69%), Gaps = 10/215 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++F E A+  + + +  PLR+LVI  LD++K G+G   VKT+AGT+ V++ S 
Sbjct  1    MIQLLFLVLFVEGAIAFLLLIKIGPLRELVIKSLDQMKMGKGPATVKTIAGTMSVILFSN  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            + +++ ++N+  +   G ++P DQ+L   HLLEASL+G  LFLG +IDR+HHY+R+L   
Sbjct  61   LMSIVKIQNKGAKL--GTMSPMDQVLWRTHLLEASLLGVVLFLGFIIDRMHHYLRKLINL  118

Query  421  RKTMEAVKKQNRAIDEGKAGI-------SEEIKSLEEQASSLRERIKQLeseveekskea  263
            R  + + K +   + + +AG+       S+EIK L+E+ SS+ ER+K+ E+E +EK K+ 
Sbjct  119  RSNVGSSKDELEQLQKERAGLKEKEDKASKEIKQLQEELSSILERLKKAETESKEKEKKL  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQL  158
             ++E +  AL+KQS   LLEYDRLLE+NQHL+SQ+
Sbjct  179  ETAETHVTALQKQSAELLLEYDRLLEDNQHLQSQI  213



>ref|NP_001136567.1| uncharacterized LOC100216689 precursor [Zea mays]
 ref|XP_008645522.1| PREDICTED: LOW QUALITY PROTEIN: B-cell receptor-associated protein 
31-like [Zea mays]
 gb|ACF82188.1| unknown [Zea mays]
 gb|AFW66986.1| b-cell receptor-associated protein 31-like containing protein 
[Zea mays]
Length=217

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 149/217 (69%), Gaps = 10/217 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MI LLF ++FAE A+  + + +  PLR+L +  +D+VK G+G   VKT+A T+ V+++S 
Sbjct  1    MIHLLFLVLFAEGAVALLLMVKVGPLRELAMRVVDQVKTGKGPATVKTLACTLSVILMSN  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            + +++ ++NR ++   G ++P DQ+L   HLLEASL+G++LFL  +IDRLHHY+++L   
Sbjct  61   VASILKIQNRGLK--LGTVSPMDQVLWRTHLLEASLIGYTLFLAFVIDRLHHYLQKLMTL  118

Query  421  RKT-------MEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            RKT       +E ++ +NR++ E +   S E K L+ +   L E +K+L+SE +E  ++A
Sbjct  119  RKTSSTSREEVEKLQMENRSLREKEEKSSGETKRLQREVVRLNESMKKLKSEAKEHERKA  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQS  152
            S +EA+  AL+KQSE  LLEYDRLLE+NQ L++QL S
Sbjct  179  SVAEAHVNALQKQSEELLLEYDRLLEDNQILQTQLLS  215



>ref|XP_007049723.1| B-cell receptor-associated protein 31-like [Theobroma cacao]
 gb|EOX93880.1| B-cell receptor-associated protein 31-like [Theobroma cacao]
Length=213

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 151/215 (70%), Gaps = 10/215 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE  +  + + +  PLR+LVI  LD++K G+G   +KT+AGT+ V++LS+
Sbjct  1    MIQLLFLVLFAEGVMAFLLLVKIGPLRELVIKSLDQLKMGKGPATMKTIAGTMSVILLSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL-RM  425
            + +++ ++N+  +   G ++P DQ+L   HLLEASLMGF+LFLG +IDR+HHY+R+L  +
Sbjct  61   LMSIVKIQNKGAK--LGTMSPMDQVLWRTHLLEASLMGFTLFLGFIIDRMHHYLRKLIGL  118

Query  424  RRKT------MEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R K       +E ++K+   + E     S+EIK L+E+ S+L E +K+L+ E EEK K+ 
Sbjct  119  RSKVGSSKEEVERLQKERIELKEKDDKASKEIKLLKEEISTLSENLKKLKLESEEKDKKI  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQL  158
             ++EA+  +L+KQ+   LLEYDRLLE+NQ+L+ +L
Sbjct  179  ETAEAHVASLQKQAADLLLEYDRLLEDNQNLQIKL  213



>ref|XP_008385961.1| PREDICTED: uncharacterized protein LOC103448478 [Malus domestica]
Length=155

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 105/145 (72%), Gaps = 2/145 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M Q+LF L+ AEMALI   +F+TP+RKLVI+GLDR K+GRG +V K+V GT+ V   STI
Sbjct  1    MNQVLFTLVLAEMALILSLLFQTPVRKLVIVGLDRSKQGRGPLVAKSVGGTILVFFSSTI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+V S++NR  E   G + PTD++L+A  LLEASL+GFSLFL ++IDRLH+YI+EL + R
Sbjct  61   YSVFSVQNRLTET--GFVNPTDEVLMAHRLLEASLIGFSLFLAMVIDRLHYYIKELXLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIK  344
            K +E VK   +  +  ++    E+K
Sbjct  119  KRVEEVKNLKKDQEHRESTAPAEVK  143



>ref|XP_006452411.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
 ref|XP_006475037.1| PREDICTED: uncharacterized protein LOC102621381 [Citrus sinensis]
 gb|ESR65651.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
Length=131

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 98/131 (75%), Gaps = 2/131 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LLF ++F EMALI   +FR PLRK VI+GLDR+KRGRG +V K+V  TV VV+ S +
Sbjct  1    MIYLLFKIVFTEMALILTLLFRNPLRKFVIMGLDRLKRGRGPLVAKSVGATVLVVLCSAV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+ + ++ R    EGG I PT+++L+A  LL+ASLMGFSLFL ++ DRLH+YI+EL + R
Sbjct  61   YSAMEIQRR--AREGGAINPTEEVLMANLLLQASLMGFSLFLAMITDRLHYYIKELHLVR  118

Query  418  KTMEAVKKQNR  386
            +T+E +K  N+
Sbjct  119  QTLEGLKNLNK  129



>ref|XP_010927692.1| PREDICTED: B-cell receptor-associated protein 31-like [Elaeis 
guineensis]
Length=218

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 147/214 (69%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MI LL+ ++  E A+  + + +  PLR++ + GLD++K G+G   VKT+A T+ V+++S+
Sbjct  1    MIPLLYLVLLIEGAVALLLMVKIGPLREMAMKGLDQLKSGKGPATVKTLACTLAVILVSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            + +++ ++NR ++   G +TP DQ+L   HLLEASL+G++LFL L+IDRLHHY R+L   
Sbjct  61   VTSILKIQNRGVK--LGTVTPMDQVLWRTHLLEASLIGYTLFLALVIDRLHHYHRKLITL  118

Query  421  RKT-------MEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            RK        +E +KK++    E +   S+EIK L+ + S+L E++++L+ E EE+ K A
Sbjct  119  RKIVGTSSEEVEKLKKEHHGFKEKEEKSSDEIKELQMEVSNLTEKLQKLKCEFEEQEKRA  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EA   AL+KQSE  LLEYDRLLE+NQ L++Q
Sbjct  179  ITAEAYVTALQKQSEELLLEYDRLLEDNQILQTQ  212



>emb|CDP15777.1| unnamed protein product [Coffea canephora]
Length=134

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQ    L+ AE+ LI   +FRTPLRK  ++ +D++K+GRG +V KTVAGT+F++ +ST+
Sbjct  1    MIQPFSALVIAEVVLILTLLFRTPLRKPTVMMVDKMKQGRGPVVAKTVAGTLFMIFISTL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
             N++ ++NR +E   G I PTDQILL  H+LEA L+GFSLFLG+MIDRLH+YI+EL   R
Sbjct  61   NNIMKIQNRAVE--AGTINPTDQILLVNHILEAILLGFSLFLGVMIDRLHYYIKELHRLR  118

Query  418  KTMEAVKKQNRAIDE  374
            K++EA KK N   D+
Sbjct  119  KSLEATKKSNYETDQ  133



>ref|XP_009151666.1| PREDICTED: uncharacterized protein LOC103874978 [Brassica rapa]
Length=217

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 96/215 (45%), Positives = 149/215 (69%), Gaps = 10/215 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++F E A+  + + +  PLR+LVI  LD++K G+G   VKT+AGT+ V++LS 
Sbjct  1    MIQLLFMVLFVEGAIAFLLLIKIGPLRELVIKSLDQMKMGKGPATVKTIAGTMSVILLSN  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL-RM  425
            + +++ ++N+  +   G ++P DQ+L   HLLEASLMG  LFLG +IDR+HHY+R+L  +
Sbjct  61   LMSIVKIQNKGAKL--GTMSPMDQVLWRTHLLEASLMGVVLFLGFIIDRMHHYLRKLINL  118

Query  424  R------RKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R      ++ +E ++K+     E +   S+EIK L+E+ SS+ ER+K+ E+E +EK K+ 
Sbjct  119  RGNVGSSKEELEQLQKERTEFKEKEDKASKEIKQLQEKLSSVSERLKKAETESKEKEKKL  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQL  158
             ++E +  AL+KQS   LLEYDRLLE+NQ L+SQ+
Sbjct  179  ETAETHVTALQKQSAELLLEYDRLLEDNQKLQSQI  213



>emb|CDX86287.1| BnaA06g30040D [Brassica napus]
Length=217

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 96/215 (45%), Positives = 149/215 (69%), Gaps = 10/215 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++F E A+  + + +  PLR+LVI  LD++K G+G   VKT+AGT+ V++LS 
Sbjct  1    MIQLLFLVLFVEGAIAFLLLIKIGPLRELVIKSLDQMKMGKGPATVKTIAGTMSVILLSN  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL-RM  425
            + +++ ++N+  +   G ++P DQ+L   HLLEASLMG  LFLG +IDR+HHY+R+L  +
Sbjct  61   LMSIVKIQNKGAKL--GTMSPMDQVLWRTHLLEASLMGVVLFLGFIIDRMHHYLRKLINL  118

Query  424  R------RKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R      ++ +E ++K+     E +   S+EIK L+E+ SS+ ER+K+ E+E +EK K+ 
Sbjct  119  RGNVGSSKEELEQLQKERNEFKEKEDKASKEIKQLQEKLSSVSERLKKAETESKEKEKKL  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQL  158
             ++E +  AL+KQS   LLEYDRLLE+NQ L+SQ+
Sbjct  179  ETAETHVTALQKQSAELLLEYDRLLEDNQKLQSQI  213



>ref|XP_008372494.1| PREDICTED: B-cell receptor-associated protein 31-like [Malus 
domestica]
Length=219

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 89/214 (42%), Positives = 146/214 (68%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE  +  + + +  PLR+LVI  LD++K G+G   +KT+AGT+ V+++S 
Sbjct  1    MIQLLFVVLFAEGVVAFLLLVKIGPLRELVIKSLDQIKMGKGPATIKTIAGTMSVILISD  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
              +++ ++N+ ++   G ++P DQ+L   HLLEASL+GF+LFLG +IDR+HHY+ +L   
Sbjct  61   FISIVKIQNKGVK--LGTMSPMDQVLWRTHLLEASLLGFTLFLGFIIDRMHHYLSKLIGL  118

Query  421  RKTMEAVK-------KQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R ++ A K       K+   + E +   S+EIK L+++ S+L E +K+L+ E  EK K  
Sbjct  119  RSSVGASKEELDRLQKEKIQLKEKEDKSSQEIKQLQDKISTLTEDLKKLKLECAEKDKSI  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++E++  +L+KQ+   LLEYDRLLE+NQ+L++Q
Sbjct  179  ETAESHVASLQKQAADLLLEYDRLLEDNQNLQTQ  212



>ref|XP_007215894.1| hypothetical protein PRUPE_ppa010667mg [Prunus persica]
 gb|EMJ17093.1| hypothetical protein PRUPE_ppa010667mg [Prunus persica]
Length=241

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 154/230 (67%), Gaps = 11/230 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVK--RGRGSIvvktvagtvfvVMLS  605
            ++ LL+ LIF+EM LI   +F  P+ K  IL LD +K  +G+G ++VK V GT+F+V+++
Sbjct  12   LVYLLYALIFSEMVLIMTLLFDAPMTKTAILELDSLKLNQGKGLLIVKIVTGTLFLVLMA  71

Query  604  TIYNV--ISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL  431
              Y+V  I+++NR   +EGG + PT+++L + ++L+ SL+G  LFL LMID LHHYIR L
Sbjct  72   NFYSVLRITMKNRT--NEGGGLNPTEEVLKSMNILQISLIGIVLFLVLMIDSLHHYIRGL  129

Query  430  RMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassse  251
                  MEA K QN++  + K    +++ ++ ++  +LR ++K LESE + ++ EA+ + 
Sbjct  130  PSLVMAMEAAKTQNQSFRKEKTESVQKLNTMVQEKDTLRTKLKYLESECKSEANEANKAR  189

Query  250  ANAIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRK-----LSHSDSKK  116
            A A AL+++SE FL EYDRLL +NQ+ R+Q + ++++     +SH + KK
Sbjct  190  AEAEALRQESEEFLKEYDRLLADNQNFRNQSKLVEQRFTKQSISHPNDKK  239



>ref|XP_010069636.1| PREDICTED: B-cell receptor-associated protein 31 [Eucalyptus 
grandis]
 gb|KCW58050.1| hypothetical protein EUGRSUZ_H00780 [Eucalyptus grandis]
Length=218

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 152/214 (71%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++F E AL+ + + +  PLR+LV+  L+++K G+G   VKT+AGT+ V++LS+
Sbjct  1    MIQLLFFVLFVEGALLFLMLVKIGPLRELVMKSLEQLKMGKGPATVKTIAGTMSVILLSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL---  431
              +++ ++N+  +   G ++P DQ+L   HLLEASLMGF+LFLG +IDR+HHY+++L   
Sbjct  61   FMSIVKIQNKGAKL--GTMSPMDQVLWRTHLLEASLMGFTLFLGFVIDRVHHYLQKLITL  118

Query  430  ----RMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
                 + ++ +E+++K+   + E +    +EIK L+++ S++ E +K+L+ E EEK K+ 
Sbjct  119  RSKEGVSKEEVESLRKEQLELKEKEGKSLKEIKQLQKEISNMLEGLKKLKLECEEKDKKV  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++E++  AL+KQS   LLEYDRLLE+NQ+L+SQ
Sbjct  179  ETAESHVAALQKQSADLLLEYDRLLEDNQNLQSQ  212



>ref|XP_008235454.1| PREDICTED: B-cell receptor-associated protein 31 [Prunus mume]
Length=218

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 146/214 (68%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE  +  + + +  PLR+LVI  LD++K G+G   VKT+A T+ V++LS+
Sbjct  1    MIQLLFLVLFAEGVVAFLLLVKIGPLRELVIKSLDQLKMGKGPATVKTIACTMSVILLSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
              +++ ++N+ ++   G ++P DQ+L   HLLEASLMGF+LFLG +IDR+HHY+ +L   
Sbjct  61   FISIVKIQNKGVK--LGTMSPMDQVLWRTHLLEASLMGFTLFLGFIIDRMHHYLSKLIGL  118

Query  421  RKTMEAVK-------KQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R  + A K       K+   + E +   S+EIK L+E+ S+L E +K+L+ E +EK K  
Sbjct  119  RSNVGASKEEVDRLQKETMQLKEKEDKSSQEIKQLQEKISTLSEDLKKLKLECKEKDKNI  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EA+  AL+KQ+   LLEYDRLLE+NQ+L++Q
Sbjct  179  ETAEAHVAALQKQAADLLLEYDRLLEDNQNLQTQ  212



>emb|CDX85356.1| BnaC07g26670D [Brassica napus]
Length=217

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 96/215 (45%), Positives = 148/215 (69%), Gaps = 10/215 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++F E A+  + + +  PLR+LVI  LD++K G+G   VKT+AGT+ V++LS 
Sbjct  1    MIQLLFLVLFVEGAIAFLLLIKIGPLRELVIKSLDQMKMGKGPATVKTIAGTMSVILLSN  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL-RM  425
            + +++ ++N+  +   G ++P DQ+L   HLLEASLMG  LFLG +IDR+HHY+R+L  +
Sbjct  61   LMSIVKIQNKGAKL--GTMSPMDQVLWRTHLLEASLMGVVLFLGFIIDRMHHYLRKLINL  118

Query  424  R------RKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R      ++ +E ++K+     E +   S+EIK L+E  SS+ ER+K+ E+E +EK K+ 
Sbjct  119  RGNVGSSKEELEQLQKERNEFKEKEDKASKEIKQLQETLSSVSERLKKAETESKEKEKKL  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQL  158
             ++E +  AL+KQS   LLEYDRLLE+NQ L+SQ+
Sbjct  179  ETAETHVTALQKQSAELLLEYDRLLEDNQKLQSQI  213



>ref|XP_003552124.1| PREDICTED: B-cell receptor-associated protein 31-like [Glycine 
max]
 gb|KHN41384.1| hypothetical protein glysoja_032570 [Glycine soja]
Length=218

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 146/214 (68%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF +IF E  L  + + +  PLR LVI  LD++K G+G   VKT+AGT+ V++LS+
Sbjct  1    MIQLLFMVIFVEGVLAFLLLVKIGPLRDLVIKSLDQLKMGKGPATVKTIAGTMSVILLSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL---  431
            + +++ ++N+  +   G ++P DQ+L   HLLEASLMGF+LFLG +IDR HHY+++L   
Sbjct  61   LMSIVKIQNKGAK--LGTMSPMDQVLWRTHLLEASLMGFTLFLGFLIDRTHHYLQKLINL  118

Query  430  ----RMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
                   ++ +E +KK+   + E     S+EIK L+E+ S L + +++++ E EEK K+ 
Sbjct  119  RSNAGASKEELENLKKETVQLKEKDEKASKEIKQLKEELSHLSKSLEKIKLESEEKDKKV  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EA+  +L+KQ+   LLEYDRLLE+NQ+L++Q
Sbjct  179  ETAEAHVASLQKQAADLLLEYDRLLEDNQNLQAQ  212



>ref|XP_008229970.1| PREDICTED: B-cell receptor-associated protein 31-like [Prunus 
mume]
Length=241

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 90/227 (40%), Positives = 150/227 (66%), Gaps = 7/227 (3%)
 Frame = -1

Query  775  IQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVK--RGRGSIvvktvagtvfvVMLST  602
            + LL+ LIF+EM LI   +F TP+ K  I  LD +K  +G+G ++VK V GT+F+V+++ 
Sbjct  13   VYLLYALIFSEMVLIMTLLFDTPVTKTAISELDSLKLNQGKGLLLVKIVTGTLFLVVMAN  72

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
             Y+++ +  +   +EG  + PT+++L + ++L+ SL+G  LFL LMID LHHYI+ L   
Sbjct  73   FYSLLRMNMKNRTNEGSGLNPTEEVLKSMNILQISLIGIVLFLVLMIDSLHHYIKGLPSL  132

Query  421  RKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANA  242
               MEA K QN++  + K G  +++ ++ ++  +LR ++K LESE E ++ EA+ + A A
Sbjct  133  VMAMEAAKTQNQSFRKEKTGSVQKLNTMVQEKDTLRTKLKYLESECESEANEANKARAEA  192

Query  241  IALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKL-----SHSDSKK  116
             AL+++SEGFL EYDRLL +NQ+ R+Q + ++++      SH + KK
Sbjct  193  EALRQESEGFLKEYDRLLADNQNFRNQSKLVEQRFTKQTTSHPNDKK  239



>ref|XP_002303054.2| hypothetical protein POPTR_0002s24670g [Populus trichocarpa]
 gb|ABK95486.1| unknown [Populus trichocarpa]
 gb|EEE82327.2| hypothetical protein POPTR_0002s24670g [Populus trichocarpa]
Length=218

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 145/214 (68%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++F E A+  + + +  PLR+LVI  LD+VK G+    VKT+AGT+ V++  +
Sbjct  1    MIQLLFLVLFVEGAVAFLLLVKIGPLRELVIKSLDQVKMGKRPATVKTIAGTMSVILFFS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            + N++ ++N+  +   G ++P DQ+L   HLLEASLMGF+LFLG +IDR+HHY+ +L   
Sbjct  61   LMNIVKIQNKGAK--LGTMSPMDQVLWRTHLLEASLMGFTLFLGFLIDRMHHYLSKLIGL  118

Query  421  RKT-------MEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R++       +E ++K+   + E +   S EIK L EQ S+L E +K+L+ E E K K+ 
Sbjct  119  RRSVGSSKEEVERLQKEKMQLKEKEDKASMEIKLLLEQISTLSENLKKLKLESENKDKQI  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EA+ ++L+KQ    LLEYDRLLE+NQ+L++Q
Sbjct  179  KTAEAHVVSLQKQCADLLLEYDRLLEDNQNLQAQ  212



>gb|KJB26032.1| hypothetical protein B456_004G226500 [Gossypium raimondii]
Length=216

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 150/214 (70%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE  +  + + +  PLR+LVI  LD++K G+G   VKT+AGT+  ++LS+
Sbjct  1    MIQLLFLVLFAEGVMAFLLLVKIGPLRELVIKSLDQLKMGKGPATVKTIAGTMSAILLSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL-RM  425
              +++ ++N+  +   G ++P DQ+L   HLLEASL+GF+LFLG +IDR+HHYI++L R+
Sbjct  61   FMSILKIQNKGAK--LGTMSPMDQVLWRTHLLEASLIGFTLFLGFIIDRIHHYIKKLIRL  118

Query  424  RR---KTMEAVKK---QNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R     + E V++   + + + E     S EIK L+E+ S+L + +K+L+SE EEK ++ 
Sbjct  119  RSSIGSSTEEVQRLHEERKQLKEKDDKASLEIKKLKEEISTLSQNLKKLKSESEEKDRKI  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EA+  +L+KQS   LLEYDRLLE+NQ+L++Q
Sbjct  179  ETAEAHVASLQKQSADLLLEYDRLLEDNQNLQNQ  212



>gb|ACG37455.1| B-cell receptor-associated protein 31-like containing protein 
[Zea mays]
Length=216

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 93/217 (43%), Positives = 148/217 (68%), Gaps = 11/217 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MI LLF ++FAE A+  + + +  PLR+L +  +D+VK G+G   VKT+A T+ V+++S 
Sbjct  1    MIHLLFLVLFAEGAVALLLMVKVGPLRELAMRVVDQVKTGKGPATVKTLACTLSVILMSN  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            + +++ ++NR ++     ++P DQ+L   HLLEASL+G++LFL  +IDRLHHY+++L   
Sbjct  61   VASILKIQNRGLK---LTVSPMDQVLWRTHLLEASLIGYTLFLAFVIDRLHHYLQKLMTL  117

Query  421  RKT-------MEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            RKT       +E ++ +NR++ E +   S E K L+ +   L E +K+L+SE +E  ++A
Sbjct  118  RKTSSTSREEVEKLQMENRSLREKEEKSSGETKRLQREVVRLNESMKKLKSEAKEHERKA  177

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQS  152
            S +EA+  AL+KQSE  LLEYDRLLE+NQ L++QL S
Sbjct  178  SVAEAHVNALQKQSEELLLEYDRLLEDNQILQTQLLS  214



>ref|XP_008226862.1| PREDICTED: uncharacterized protein LOC103326424 [Prunus mume]
Length=153

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 102/146 (70%), Gaps = 2/146 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQ+LF L+ AEMALI   +FRTPLR LVI+GLDR K+GRG +V K+V GTV V   ST+
Sbjct  1    MIQILFALVLAEMALILSLLFRTPLRTLVIVGLDRSKQGRGPLVAKSVGGTVLVFFSSTL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y V S++ R    E G + PTD++L+A  LLEASL+GFSLFL L+IDRLH+YI+EL + R
Sbjct  61   YGVFSVQKRL--TEAGFVNPTDEVLMAHRLLEASLIGFSLFLVLIIDRLHYYIKELNLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEEIKS  341
            K  E +K      ++ K   +E  K+
Sbjct  119  KFNEEIKNLKNDFEQRKNADAEMKKT  144



>ref|XP_002437063.1| hypothetical protein SORBIDRAFT_10g020520 [Sorghum bicolor]
 gb|EER88430.1| hypothetical protein SORBIDRAFT_10g020520 [Sorghum bicolor]
Length=160

 Score =   129 bits (325),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 107/147 (73%), Gaps = 4/147 (3%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF L+ AE A+    +F+TPLR+L ++ LDR+K+GRG ++V+T+A TV VV+ S++
Sbjct  1    MIQLLFSLLAAEGAVAATLLFKTPLRRLSVVALDRLKQGRGPVMVRTIAATVLVVLASSL  60

Query  598  YNVISLRNRWI-EDEGGDI---TPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL  431
            +++  +R+R   E +G  I   TPTDQ+LLA+H+LEASLMG+SLFL L+IDRLH+Y++E 
Sbjct  61   HSMTKIRSRADGELDGAGIVGLTPTDQVLLARHVLEASLMGYSLFLALVIDRLHNYVKEN  120

Query  430  RMRRKTMEAVKKQNRAIDEGKAGISEE  350
            R  RK +E V KQN  + E   G  E 
Sbjct  121  RRLRKKLEEVSKQNETMLEATHGPKES  147



>ref|XP_006657620.1| PREDICTED: B-cell receptor-associated protein 31-like [Oryza 
brachyantha]
Length=214

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 144/214 (67%), Gaps = 6/214 (3%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE A   + + +  PLR+L + G+++ K G+G   VKT+A T+ V+ +S+
Sbjct  1    MIQLLFLVLFAEGAAALLLMVKIGPLRELAMRGVEQAKDGKGPAAVKTLACTLLVIFMSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            + +++ ++NR  +   G ++P DQ+L   HLLEASL+G+ LFL  +IDRLHHY R+L + 
Sbjct  61   VTSILRIQNRGAK--LGTVSPMDQVLWRTHLLEASLIGYILFLAFVIDRLHHYHRKLTIL  118

Query  421  RKTMEAVKKQNRAID---EGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassse  251
            +KT    +++   +    +GK   S+EIK L  + ++L E++K+L+ E EE  +    +E
Sbjct  119  KKTANTSREEVEKLQNELQGKEDNSKEIKKLRGELATLSEKMKKLKFESEEHERRRLEAE  178

Query  250  ANAIALKKQSEGFLLEYDRLLEENQHLRSQLQSL  149
            A+  AL+KQSE  LLEYDRLLE+NQ L++Q+ SL
Sbjct  179  AHVNALQKQSEELLLEYDRLLEDNQILQTQVLSL  212



>ref|XP_008802267.1| PREDICTED: B-cell receptor-associated protein 29-like [Phoenix 
dactylifera]
Length=221

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 146/214 (68%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFR-TPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MI LL+ L+F E+A+  + + +  PLR+L + GLD++K G+G  +VK +A T+ V++ S+
Sbjct  1    MIHLLYVLLFVEVAVALLLMVKFGPLRELAMKGLDKLKTGKGPAMVKALACTLSVILASS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            I  ++ ++NR ++   G +TPTDQ+L   HLLEASL+G++LFL L+IDRLHH ++++   
Sbjct  61   ITGILRIQNRGLK--LGSVTPTDQVLWRTHLLEASLIGYTLFLALLIDRLHHCLQKVINL  118

Query  421  RKT-------MEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            RKT       +E +KK++    + +   S E   L E+  +L E++++L+SE+EE  K A
Sbjct  119  RKTVGTSRDEVEKLKKEHHHFKDEEEKSSNERTELREEVCNLTEKLQKLKSEIEELKKRA  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EA+  AL+KQ E  LLEYDRLLE+NQ L++Q
Sbjct  179  LTAEAHVAALQKQFEKLLLEYDRLLEDNQILQTQ  212



>ref|XP_009388739.1| PREDICTED: uncharacterized protein LOC103975489 [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 105/141 (74%), Gaps = 2/141 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF ++ AE A   + +F TPLRKL++LGLDR+KRGR +++VKT+A T  +V+ S+I
Sbjct  1    MIQLLFTVLAAEAAATAVLLFNTPLRKLLVLGLDRLKRGRSTVMVKTLAATAVLVLASSI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y++  +R R+ E   G  TPTDQIL+++HLLEASL+G+SLFL L+IDRLH YI EL   R
Sbjct  61   YSMAEIRLRFAEL--GAPTPTDQILMSRHLLEASLLGYSLFLALIIDRLHLYIGELHGLR  118

Query  418  KTMEAVKKQNRAIDEGKAGIS  356
             +M+AV KQNR I   K G S
Sbjct  119  NSMKAVMKQNRVIGTAKTGSS  139



>ref|XP_006650891.1| PREDICTED: B-cell receptor-associated protein 31-like [Oryza 
brachyantha]
Length=217

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 94/216 (44%), Positives = 148/216 (69%), Gaps = 10/216 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++ AE A+  + + +  PLR+  + G+++ K+G+G   VKT+A T+ V+++S+
Sbjct  1    MIQLLFLVVLAEAAVALLLMVKVGPLREAAMRGVEQAKQGKGPATVKTLACTLSVILMSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            + +++ ++NR ++   G ++P DQ+L   HLLEASL+GF+LFL  +IDRLHHY+R+L   
Sbjct  61   VASILKIQNRGLK--LGTVSPMDQVLWRTHLLEASLIGFTLFLAFVIDRLHHYLRKLVTL  118

Query  421  RKT-------MEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            RK        +E ++ +NR+  E +   S EIK L+++ + L E +K+L+SE E+  K A
Sbjct  119  RKAANTSREEVEKLQMENRSFHEKEEKSSGEIKKLQQEIAKLNESMKKLKSESEDHEKAA  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQ  155
              +EA+  AL+KQSE  LLEYDRLLE+NQ L+SQL 
Sbjct  179  LEAEAHVNALQKQSEELLLEYDRLLEDNQILQSQLH  214



>ref|XP_002521067.1| bcr-associated protein, bap, putative [Ricinus communis]
 gb|EEF41218.1| bcr-associated protein, bap, putative [Ricinus communis]
Length=292

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 150/215 (70%), Gaps = 12/215 (6%)
 Frame = -1

Query  778  MIQLLFPLIFAE--MALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLS  605
            MIQLLF ++FAE  +AL+ + V   PLR+LVI  LD++K G+G   VKT+A T+ V++LS
Sbjct  1    MIQLLFLVLFAEGIVALL-LLVKIGPLRELVIKSLDQLKMGKGPATVKTIASTMSVILLS  59

Query  604  TIYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL--  431
            ++ ++I ++N+    + G ++P DQ+L   HLLEASL+GF+LFLG +IDR+HHY+ +L  
Sbjct  60   SLMSIIKIQNK--GAKLGTMSPMDQVLWRTHLLEASLIGFTLFLGFIIDRMHHYLTKLIG  117

Query  430  -----RMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekske  266
                    ++ +E ++K+   + E +   S EI+ L +Q S+L E +++L+ E E+K K+
Sbjct  118  LRINIGSSKEEVERLQKEKMQLKEKEDKSSMEIEQLRKQVSTLSENLEKLKLENEQKDKQ  177

Query  265  assseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
              ++EA+ ++L+KQS   LLEYDRLLE+NQ+L++Q
Sbjct  178  IETAEAHVVSLQKQSADLLLEYDRLLEDNQNLQAQ  212



>ref|XP_006281079.1| hypothetical protein CARUB_v10027107mg [Capsella rubella]
 gb|EOA13977.1| hypothetical protein CARUB_v10027107mg [Capsella rubella]
Length=217

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 144/215 (67%), Gaps = 10/215 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE A+  + + +  PLR+LVI  LD++K G+G   VKT+AGT+ V++ S 
Sbjct  1    MIQLLFLVLFAEGAIAFLLLVKIGPLRELVIKSLDQMKMGKGPATVKTIAGTMSVILFSN  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            + N++ ++N+  +   G ++P DQ+L   HLLEASL+G  LFLG +IDR+HHY+ +L   
Sbjct  61   LMNIVKIQNKGAK--LGTMSPMDQVLWRTHLLEASLLGVVLFLGFIIDRMHHYLSKLINL  118

Query  421  RKTMEA-------VKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R    +       ++K+   + E     S+EIK L+E  SS+ E++K+ E+E +EK K+ 
Sbjct  119  RSNAGSSKEELEQLEKERTELKEKDEKASKEIKKLQENLSSILEKLKKAEAESKEKDKKL  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQL  158
             ++E +  AL+KQS   LLEYDRLLE+NQHL+SQ+
Sbjct  179  ETAETHVEALQKQSAELLLEYDRLLEDNQHLQSQI  213



>gb|KDO62065.1| hypothetical protein CISIN_1g045614mg, partial [Citrus sinensis]
Length=123

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 94/125 (75%), Gaps = 2/125 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LLF ++F EMALI   +FR PLRK VI+GLDR+KRGRG +V K+V  TV VV+ S +
Sbjct  1    MIYLLFKIVFTEMALILTLLFRNPLRKFVIMGLDRLKRGRGPLVAKSVGATVLVVLCSAV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+ + ++ R    EGG I PT+++L+A  LL+ASLMGFSLFL ++ DRLH+YI+EL + R
Sbjct  61   YSAMEIQRR--AREGGAINPTEEVLMANLLLQASLMGFSLFLAMITDRLHYYIKELHLVR  118

Query  418  KTMEA  404
            +T+E 
Sbjct  119  QTLEG  123



>ref|XP_004987306.1| PREDICTED: uncharacterized protein LOC101775823 [Setaria italica]
Length=163

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 111/148 (75%), Gaps = 5/148 (3%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF ++ AE A+    +F+TPLRKL +L LDR+KRGRG ++V+TVA TV VV+ S++
Sbjct  1    MIQLLFTVLAAEAAVAATLLFKTPLRKLAVLALDRLKRGRGPVMVRTVAATVLVVLASSL  60

Query  598  YNVISLRNRWIEDEGG----DITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL  431
            +++  +R R   +  G     +TPTDQ+LLA+HLLEASLMG+SLFL L+IDRLH+Y++E+
Sbjct  61   HSMAQIRGRAEGELDGAGVVGLTPTDQVLLARHLLEASLMGYSLFLALVIDRLHNYVKEI  120

Query  430  RMRRKTMEAVKKQNRA-IDEGKAGISEE  350
            R  +K +EAV KQN+  ++E   G SEE
Sbjct  121  RRLKKNLEAVSKQNKTMLEEATHGRSEE  148



>ref|XP_010685051.1| PREDICTED: B-cell receptor-associated protein 31-like [Beta vulgaris 
subsp. vulgaris]
Length=217

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 149/214 (70%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++F E  +  + + +  PLR+LV+  LD+VK G+G   VKT+AGT+ V++LS+
Sbjct  1    MIQLLFMVLFVEGLVAFLLLVKVGPLRELVMKSLDQVKMGKGPATVKTIAGTMSVILLSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL-RM  425
            + +++ ++N+  +   G ++P DQ+L   HLLEASLMGF+LFLG +IDR+HHY+R+L  +
Sbjct  61   LMSIVKIQNKGAK--LGTMSPMDQVLWRTHLLEASLMGFTLFLGFLIDRMHHYLRKLINI  118

Query  424  RRKTMEA------VKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R K   +      ++K+ + + + +   S+EI +L+++ S +   +K+L+ E +EK K  
Sbjct  119  RSKVGSSKEEVEKLEKEKQQLKDKEEKASKEITALQDELSKVSNEVKKLKIESQEKDKTI  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             +++A+ +AL+KQ+   LLEYDRLLE+NQ+L++Q
Sbjct  179  ETADAHVVALQKQAADLLLEYDRLLEDNQNLQTQ  212



>ref|NP_001051893.1| Os03g0848400 [Oryza sativa Japonica Group]
 gb|AAO37960.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99895.1| B-cell receptor-associated protein 31-like containing protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF13807.1| Os03g0848400 [Oryza sativa Japonica Group]
 gb|EAZ29303.1| hypothetical protein OsJ_13364 [Oryza sativa Japonica Group]
 dbj|BAG90494.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87435.1| unnamed protein product [Oryza sativa Japonica Group]
Length=217

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 146/216 (68%), Gaps = 10/216 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++ AE A+  + + +  PLR++ + G+++ K G+G   VKT+A T+ V+++S+
Sbjct  1    MIQLLFLVVLAEAAVALLLMVKVGPLREVAMRGVEQAKTGKGPATVKTLACTLSVILMSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL---  431
            + +++ ++NR ++   G ++P DQ+L   HLLEASL+GF+LFL  +IDRLHHY+R+L   
Sbjct  61   VASILKIQNRGLK--LGTVSPMDQVLWRTHLLEASLIGFTLFLAFVIDRLHHYLRKLITL  118

Query  430  ----RMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
                   R+ +E ++ +NR   E +   S EIK L ++ + L E +K+L+SE E+  ++ 
Sbjct  119  RKAANTSREEVEKLQMENRLFREKEEKSSSEIKKLHQEIAKLNESMKKLKSESEDHERKV  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQ  155
              +EA+  AL+KQSE  LLEYDRLLE+NQ L+SQL 
Sbjct  179  LEAEAHVNALQKQSEELLLEYDRLLEDNQILQSQLH  214



>ref|XP_011089080.1| PREDICTED: uncharacterized protein LOC105170143 [Sesamum indicum]
Length=216

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/215 (40%), Positives = 141/215 (66%), Gaps = 12/215 (6%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MI L F ++ AE  +  + + +  PLR+LVI GLD+VK  R +++       V   +LS 
Sbjct  1    MIPLFFLVVCAEGLVAFLLMVKIGPLRELVIKGLDQVKMRRATVLTIAGTIFVI--LLSN  58

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL-RM  425
            +++++ ++N+  +   G +TP DQ+L   +LLEA+LMGFSLFLG +IDR+HHY+R+L ++
Sbjct  59   LFSILKIQNKGAKH--GTMTPMDQVLWRTNLLEATLMGFSLFLGFLIDRMHHYMRKLIKL  116

Query  424  RRKT------MEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R  T      +E ++K+   + E +   + E+K L+++ SSL E + +L SE  EK K+ 
Sbjct  117  RSNTGVSKQEVEMLEKEKLQLKEKEEKAAGEVKRLQKEMSSLTENLNKLRSESAEKDKKV  176

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQL  158
             ++EA+  AL+KQ+   LLEYDRLLE+NQ+L++Q+
Sbjct  177  ETAEAHVAALQKQAADLLLEYDRLLEDNQNLQTQV  211



>gb|EAY92582.1| hypothetical protein OsI_14323 [Oryza sativa Indica Group]
Length=217

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 92/216 (43%), Positives = 146/216 (68%), Gaps = 10/216 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++ AE A+  + + +  PLR+  + G+++ K G+G   VKT+A T+ V+++S+
Sbjct  1    MIQLLFLVVLAEAAVALLLMVKVGPLREAAMRGVEQAKTGKGPATVKTLACTLSVILMSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL---  431
            + +++ ++NR ++   G ++P DQ+L   HLLEASL+GF+LFL  +IDRLHHY+R+L   
Sbjct  61   VASILKIQNRGLK--LGTVSPMDQVLWRTHLLEASLIGFTLFLAFVIDRLHHYLRKLITL  118

Query  430  ----RMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
                   R+ +E ++ +NR   E +   S EIK L ++ + L E +K+L+SE E+  ++A
Sbjct  119  RKAANTSREEVEKLQMENRLFREKEEKSSSEIKKLHQEIAKLNESMKKLKSESEDHERKA  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQ  155
              +EA+  AL+KQSE  LLEYDRLLE+NQ L+SQL 
Sbjct  179  LEAEAHVNALQKQSEELLLEYDRLLEDNQILQSQLH  214



>gb|EYU27354.1| hypothetical protein MIMGU_mgv1a015673mg [Erythranthe guttata]
Length=149

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 112/149 (75%), Gaps = 8/149 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQ L+ L+F E+A+I + +FRTPLRK +++ LDR+K+GRG +V  T  GT+FV+M+S +
Sbjct  1    MIQPLYALVFGEVAVILVLLFRTPLRKPLLILLDRLKQGRGPVVATTAGGTLFVIMVSLL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN+ +++NR +E   G + PTDQ+LLA  LLEASL+GF+LFL LMIDR+H+YIRE+RM R
Sbjct  61   YNITTIQNRSLE--AGGVNPTDQVLLANQLLEASLLGFALFLALMIDRIHYYIREVRMLR  118

Query  418  KTMEAVKKQN------RAIDEGKAGISEE  350
            K MEA+KK +      +  D+GK  + E+
Sbjct  119  KHMEAIKKSDQESEELKIKDKGKNKVVED  147



>ref|XP_007134124.1| hypothetical protein PHAVU_010G021100g [Phaseolus vulgaris]
 gb|ESW06118.1| hypothetical protein PHAVU_010G021100g [Phaseolus vulgaris]
Length=219

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 142/214 (66%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++F E A+  + + +  PLR LVI  LD++K G+G   VKT+AGT+ V++ S+
Sbjct  1    MIQLLFLVLFVEGAMAFLLLVKVGPLRDLVIKTLDQMKMGKGPATVKTIAGTMSVILFSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            + +++ ++N+  +   G ++P DQ+L   HLLEASLMGF+LFLG +IDR+HHY+++L   
Sbjct  61   LMSIVKIQNKGAKL--GTMSPMDQVLWRTHLLEASLMGFTLFLGFIIDRVHHYLQKLNKL  118

Query  421  RKTMEAVKKQNRAI-------DEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R    A K++  +I        E +   S+EI  L+EQ S L E +K+ + E EEK K  
Sbjct  119  RSNAGASKEEVESIEKEKVELKEKEEKASKEIMQLKEQISGLSESLKKTKVECEEKDKRV  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++E +  +L+KQ+   LLEYDRLLEENQ+L++Q
Sbjct  179  ETAEVHVTSLQKQAADLLLEYDRLLEENQNLQAQ  212



>ref|XP_002317336.1| hypothetical protein POPTR_0011s09140g [Populus trichocarpa]
 gb|EEE97948.1| hypothetical protein POPTR_0011s09140g [Populus trichocarpa]
Length=128

 Score =   123 bits (308),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 96/130 (74%), Gaps = 2/130 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LLF ++F EMALI I +FRTP+RKLVI+ +D++K+G+G +V KTVA T+ VV  S +
Sbjct  1    MINLLFTVVFTEMALILILLFRTPVRKLVIMAIDQLKQGKGPLVAKTVATTLIVVFTSVL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            +N + +R R ++   G +   D++L+ + +LEASL+GFSLFL +MIDRLH YI+EL   R
Sbjct  61   HNALQIRKRLLD--AGAVNSADEVLMVERILEASLLGFSLFLAMMIDRLHCYIKELLQVR  118

Query  418  KTMEAVKKQN  389
              +EAVK+ N
Sbjct  119  NELEAVKRLN  128



>ref|XP_004295837.1| PREDICTED: uncharacterized protein LOC101305253 [Fragaria vesca 
subsp. vesca]
Length=152

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 96/128 (75%), Gaps = 2/128 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQ+LF ++FAEM LI   +FR+PLR+LVI+GLD  K+GRG +V K+V GT+ V  +STI
Sbjct  1    MIQVLFTIVFAEMVLILSLLFRSPLRQLVIMGLDCSKQGRGPLVAKSVGGTILVFFISTI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL-RMR  422
            Y+V ++  +    E G I PT+++L+A  +LEASL GFSLFL LMIDRLH+YI+EL R+R
Sbjct  61   YSVFNVHKKR-STEAGFINPTNEVLMAHRILEASLTGFSLFLALMIDRLHYYIKELYRLR  119

Query  421  RKTMEAVK  398
            +   E +K
Sbjct  120  KYKQEELK  127



>ref|XP_010063029.1| PREDICTED: uncharacterized protein LOC104450251 isoform X1 [Eucalyptus 
grandis]
 gb|KCW70201.1| hypothetical protein EUGRSUZ_F03480 [Eucalyptus grandis]
Length=155

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 93/131 (71%), Gaps = 2/131 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M Q LF L+F EMAL  + +F +PLR L++LGLDR+KRG+G ++  TVA T+ VV  +T+
Sbjct  1    MTQFLFGLVFMEMALTVVLLFGSPLRTLLMLGLDRLKRGQGQLIAGTVATTMVVVFSATV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN++ ++ R    +   I+PTDQILLA  LLEASLMGFSLFLG++IDRLH+Y  EL   R
Sbjct  61   YNLLGVQRRL--TDATMISPTDQILLANSLLEASLMGFSLFLGILIDRLHYYASELYRLR  118

Query  418  KTMEAVKKQNR  386
              +E  K + R
Sbjct  119  NHLEETKSKQR  129



>ref|XP_006452412.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
 gb|ESR65652.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
Length=129

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 94/131 (72%), Gaps = 6/131 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LLF ++F EMALI   +FR PLRK VI+GLDR+KRGRG +V K+V  TV VV+ S +
Sbjct  1    MIYLLFKIVFTEMALILTLLFRNPLRKFVIMGLDRLKRGRGPLVAKSVGATVLVVLCSAV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+ + ++ R    EGG I PT+++L+A  LL+ASLMGFSLFL +M+DRLH YI+    R+
Sbjct  61   YSAMEIQRR--AREGGAINPTEEVLMANLLLQASLMGFSLFLAVMMDRLHSYIK----RK  114

Query  418  KTMEAVKKQNR  386
            + +E V   N+
Sbjct  115  QILEEVINPNK  125



>ref|XP_006340009.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
tuberosum]
Length=216

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 136/214 (64%), Gaps = 12/214 (6%)
 Frame = -1

Query  778  MIQLLFPLIFAE-MALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++  E M    + V   PLR+LV+  LD+VK  +G+++      +    ++S 
Sbjct  1    MIQLLFMVLCLESMVAFLLMVKIGPLRELVMKCLDQVKMRKGTVLTIAGTISAI--LVSN  58

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
              ++I ++N+  +   G +TP DQ+L   +LLEA+LMGFSLFLG +IDR+HHY+R+L + 
Sbjct  59   FISIIKIQNKGAKI--GTMTPMDQVLWRTNLLEATLMGFSLFLGFLIDRMHHYLRKLIVL  116

Query  421  R-------KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R       K  E ++K+   + E     +EEIK  ++Q SSL E +K+++ E EEK K  
Sbjct  117  RSSAGSSKKEFERLEKEKLQLKEKADKAAEEIKLSQKQLSSLTETLKKVKLESEEKDKRV  176

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EA+  AL+KQ+   LLEYDRLLE+NQ+L++Q
Sbjct  177  ETAEAHVAALQKQAADLLLEYDRLLEDNQNLQNQ  210



>gb|EMS47744.1| hypothetical protein TRIUR3_06470 [Triticum urartu]
Length=282

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = -1

Query  490  GFSLFLGLMIDRLHHYIRELRMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRE  311
            G+SLFLGL+IDRLHHYIR+LR  +K MEAV KQ+R ++E K G SEEI+  +++  SL E
Sbjct  156  GYSLFLGLIIDRLHHYIRQLRAMKKNMEAVTKQSRVLEETKLGDSEEIQGYQKKIDSLNE  215

Query  310  RIKQLeseveekskeassseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSH  131
            +++ L+ + E +++E  ++E N +AL+KQSEG L EY+RL+ EN+ LR++LQ++D + S 
Sbjct  216  QVQVLKHQSESQTQELKTAEMNNLALQKQSEGLLTEYERLIAENEELRNKLQTMDLRFSR  275

Query  130  SDSKK  116
            SDSKK
Sbjct  276  SDSKK  280



>gb|EMS58132.1| hypothetical protein TRIUR3_00710 [Triticum urartu]
Length=190

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 83/209 (40%), Positives = 134/209 (64%), Gaps = 23/209 (11%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MI LLF ++FAE A+  + + +  PLR+L + G+++VK G+G   VKT+A T+ V+++S+
Sbjct  1    MIPLLFLVLFAEGAVALLLMVKIGPLRELAMRGVEQVKTGKGPATVKTLACTLSVILMSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            +  ++ +++R    + G+++P DQ+L   HLLEASL+G++LFL  +IDRLHHY+R+L   
Sbjct  61   VAAIVRIQDRG--HKIGNVSPMDQVLWRTHLLEASLIGYTLFLAFVIDRLHHYLRKLITL  118

Query  421  RKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANA  242
            RK+       N + +E  A +SE++K L+ ++   + +                 +EA+ 
Sbjct  119  RKS------ANTSREEDMAKLSEDMKKLKSESEDHQRKASD--------------AEAHV  158

Query  241  IALKKQSEGFLLEYDRLLEENQHLRSQLQ  155
             AL+KQSE  LLEYDRLLE+NQ L+SQL 
Sbjct  159  NALQKQSEELLLEYDRLLEDNQILQSQLH  187



>ref|XP_004247073.1| PREDICTED: uncharacterized protein LOC101251810 [Solanum lycopersicum]
Length=216

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 135/214 (63%), Gaps = 12/214 (6%)
 Frame = -1

Query  778  MIQLLFPLIFAE-MALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++  E M    + V   PLR+LV+  LD+VK  +G+++      +    + S 
Sbjct  1    MIQLLFMVLCLEGMVAFLLMVKIGPLRELVMKCLDQVKMRKGTVLTIAGTISAI--LFSN  58

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
              ++I ++N+  +   G +TP DQ+L   +LLEA+LMGFSLFLG +IDR+HHY+R+L + 
Sbjct  59   FISIIKIQNKGAKI--GTMTPMDQVLWRTNLLEATLMGFSLFLGFLIDRMHHYLRKLIVL  116

Query  421  R-------KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R       K  E ++K+   + E     +EEIK  ++Q SSL E +K+++ E EEK K  
Sbjct  117  RSSAGSSKKEFERLEKEKLQLKEKADKAAEEIKLSQKQLSSLTETLKKVKLESEEKDKRV  176

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EA+  AL+KQ+   LLEYDRLLE+NQ+L++Q
Sbjct  177  ETAEAHVAALQKQAADLLLEYDRLLEDNQNLQNQ  210



>gb|KHN11907.1| hypothetical protein glysoja_019880 [Glycine soja]
Length=139

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 92/128 (72%), Gaps = 2/128 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF L+  ++A I I  F  PLRKLV+ GLD +K+GRG +V KTVA T+ VV+ ST+
Sbjct  1    MIQLLFILLMIQIAFILILSFANPLRKLVVKGLDLLKQGRGPLVTKTVAATMCVVLSSTV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y +  ++ R    + G + PTD++L+A  LLEA+ +GFSLFLGL+IDR H+YIRE+ + R
Sbjct  61   YTITKIQKR--SKDAGIVNPTDEVLMAHRLLEAAFLGFSLFLGLVIDRQHYYIREINLLR  118

Query  418  KTMEAVKK  395
            K ME  KK
Sbjct  119  KNMETAKK  126



>gb|KHN38264.1| hypothetical protein glysoja_003929 [Glycine soja]
Length=154

 Score =   121 bits (303),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 98/143 (69%), Gaps = 2/143 (1%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQLLF L+  ++A I I  F  P+RKLV++GLD +K+GRG +V KTVA T+ VV+ ST+
Sbjct  1    MIQLLFILLMIQIAFILILSFANPIRKLVVIGLDLLKQGRGPLVTKTVAATMCVVLSSTV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y +  ++ R    +   + PTD++L+A  LLEA+ +GFSLFLGL+IDR H+YIRE+ + R
Sbjct  61   YTITKIQKR--SKDASIVNPTDEVLMAHRLLEAAFLGFSLFLGLVIDRQHYYIREINLLR  118

Query  418  KTMEAVKKQNRAIDEGKAGISEE  350
            K +E  KK+N   D  K  +  E
Sbjct  119  KNLETWKKRNHNHDSLKRRVETE  141



>ref|XP_009775442.1| PREDICTED: uncharacterized protein LOC104225364 [Nicotiana sylvestris]
Length=216

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 136/214 (64%), Gaps = 12/214 (6%)
 Frame = -1

Query  778  MIQLLFPLIFAE-MALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++  E M    + V   PLR+LV+  LD+VK  +G+++           + S 
Sbjct  1    MIQLLFMVLCLEGMVAFLLMVKIGPLRELVMKCLDQVKMRKGTVLTIAGTIAAI--LFSN  58

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
              ++I ++N+  +   G +TP DQ+L   +LLEA+LMGFSLFLG +IDR+HHY+R+L + 
Sbjct  59   FISIIKIQNKGAK--LGTMTPMDQVLWRTNLLEATLMGFSLFLGFLIDRMHHYLRKLIVL  116

Query  421  R-------KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R       K  E+++K+     E     +EE+K  +++ SSL E +K+++ ++E+K+K  
Sbjct  117  RNNAGSSKKEFESLEKEKLQFKEKADKAAEEMKQSQKEISSLTESLKKVKLQLEQKNKLV  176

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EA+  AL+KQ+   LLEYDRLLE+NQ+L++Q
Sbjct  177  ETAEAHVAALQKQAADLLLEYDRLLEDNQNLQNQ  210



>ref|XP_008460368.1| PREDICTED: B-cell receptor-associated protein 31-like [Cucumis 
melo]
Length=219

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/214 (40%), Positives = 143/214 (67%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPL-RKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE  +  + + +  L R+ VI  LD++K G+G   VKT+A T+ V++LS+
Sbjct  1    MIQLLFLVLFAEGVVAFLLLVKIGLLREFVIKSLDQLKMGKGPATVKTIAATMSVILLSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL---  431
            + N++ ++N+  +   G ++P DQ+L    LLEASL+GF+LFLG +IDR+HHY ++L   
Sbjct  61   LMNIVKIQNKGAK--LGTMSPMDQVLWRTQLLEASLIGFTLFLGFIIDRMHHYFQKLIGL  118

Query  430  ----RMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
                   ++ +E ++K+   + + +   S++IK L E+ S L E +K+++ E EEK K  
Sbjct  119  RENIGSSKEEVERLQKEKTELAQKEEKCSKQIKELREEISILSENLKKVKQESEEKDKRI  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             +++A+  +L+KQ+   LLEYDRLLE+NQ+L++Q
Sbjct  179  ETADAHVTSLQKQAADLLLEYDRLLEDNQNLQNQ  212



>ref|XP_004290194.1| PREDICTED: B-cell receptor-associated protein 31 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458169.1| PREDICTED: B-cell receptor-associated protein 31 [Fragaria vesca 
subsp. vesca]
Length=214

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/210 (39%), Positives = 137/210 (65%), Gaps = 6/210 (3%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            M +LL P++ AE  +  + + +  PLR+LV+  LD++K GRG + +  +AGT+ V++LS 
Sbjct  1    MYELLIPVVIAEAVVASLMLLKIGPLRELVLKILDQLKVGRGPVTLIGIAGTMGVILLSR  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
              +++ ++N+   ++ G ++P DQ+L   H+LEASLM F++FLG +IDR H Y+ +L   
Sbjct  61   FISIVKMQNKG--EKLGTMSPMDQVLYRTHILEASLMSFAVFLGFIIDRTHDYLTKLDGL  118

Query  421  RKTMEAV---KKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskeassse  251
              T E V   +K+   + E +   S+EIK L+E+ ++L E +K+L+ E  EK K   ++E
Sbjct  119  TSTKEEVERLQKEKVQLTEKEEKSSKEIKQLQEKIATLSEDLKKLKLECAEKDKAVETAE  178

Query  250  ANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
            ++  +L+KQ+   LLEYD LLE+NQ L++Q
Sbjct  179  SHVTSLQKQAADLLLEYDHLLEDNQKLQTQ  208



>gb|EMT23366.1| hypothetical protein F775_19324 [Aegilops tauschii]
Length=305

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = -1

Query  490  GFSLFLGLMIDRLHHYIRELRMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRE  311
            G+SLFLGL+IDRLHHYIR+LR  +K MEAV KQ+R ++E K G SEEI+  +++  SL E
Sbjct  179  GYSLFLGLIIDRLHHYIRQLRAMKKNMEAVTKQSRVLEETKLGDSEEIQGYQKKIDSLNE  238

Query  310  RIKQLeseveekskeassseANAIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSH  131
            +++ L+ + E +++E  ++E N +AL+KQSEG L EY+RL+ EN+ LR++LQ+++ + S 
Sbjct  239  QVQVLKHQSESQTQELKTAEMNNLALQKQSEGLLTEYERLIAENEELRNKLQTMELRFSR  298

Query  130  SDSKK  116
            SDSKK
Sbjct  299  SDSKK  303


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 58/82 (71%), Gaps = 2/82 (2%)
 Frame = -1

Query  718  FRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTIYNVISLRNRWIEDEGGDITP  539
            FRTP R+L +L +D  KRGRG ++ +TVA T+FVV+ S+ Y++  +R R  E E   +TP
Sbjct  21   FRTPARRLALLAVDCSKRGRGPVMARTVAATMFVVLGSSGYSIAKIRRR--EGEFAQLTP  78

Query  538  TDQILLAQHLLEASLMGFSLFL  473
            TDQ+L ++HLLEASLMG    L
Sbjct  79   TDQVLASRHLLEASLMGMPFLL  100



>ref|XP_011024634.1| PREDICTED: uncharacterized protein LOC105125752 [Populus euphratica]
Length=218

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 147/214 (69%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++F E A+  + + +  PLR+LVI  LD+VK G+    VKT+AGT+ V++  +
Sbjct  1    MIQLLFLVLFVEGAVAFLLLVKIGPLRELVIKSLDQVKMGKRPATVKTIAGTMSVILFFS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYI-RELRM  425
            + N++ ++N+    + G ++P DQ+L   HLLEASLMGF+LFLG +IDR+HHY+ R + +
Sbjct  61   LMNIVKIQNKG--AKLGTMSPMDQVLWRTHLLEASLMGFTLFLGFLIDRMHHYLSRLIGL  118

Query  424  RR------KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            RR      + +E ++K+   + E +   S EIK L EQ S+L E +K+L+ E E+K K+ 
Sbjct  119  RRCVGSSKEEVERLQKEKMQLKEKEDKASMEIKLLLEQISTLSESLKKLKLESEKKDKQI  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EA+ ++L+KQ    LLEYDRLLE+NQ+L++Q
Sbjct  179  ETAEAHVVSLQKQCADLLLEYDRLLEDNQNLQAQ  212



>ref|XP_009610381.1| PREDICTED: uncharacterized protein LOC104104089 [Nicotiana tomentosiformis]
Length=216

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 85/214 (40%), Positives = 134/214 (63%), Gaps = 12/214 (6%)
 Frame = -1

Query  778  MIQLLFPLIFAE-MALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++  E M    + V   PLR+LV+  LD+VK  +G+++           + S 
Sbjct  1    MIQLLFMVLCLEGMVAFLLMVKIGPLRELVMKCLDQVKMRKGTVLTIAGTIAAI--LFSN  58

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
              ++I ++N+  +   G +TP DQ+L   +LLEA+LMGFSLFLG +IDR+HHY+R+L + 
Sbjct  59   FISIIKIQNKGAK--LGTMTPMDQVLWRTNLLEATLMGFSLFLGFLIDRMHHYLRKLIVL  116

Query  421  R-------KTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R       K  E ++K+     E     +EE+K  +++ SSL E +K+++ ++EEK K  
Sbjct  117  RNSAGSSKKEFERLEKEKLQFKEKADKAAEEMKQSQKEISSLTESLKKVKLQMEEKDKRV  176

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++EA+  AL+KQ+   LLEYDRLLE+NQ+L++Q
Sbjct  177  ETAEAHVAALQKQAADLLLEYDRLLEDNQNLQNQ  210



>gb|KJB26033.1| hypothetical protein B456_004G226500 [Gossypium raimondii]
Length=202

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 135/190 (71%), Gaps = 9/190 (5%)
 Frame = -1

Query  709  PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTIYNVISLRNRWIEDEGGDITPTDQ  530
            PLR+LVI  LD++K G+G   VKT+AGT+  ++LS+  +++ ++N+  +   G ++P DQ
Sbjct  11   PLRELVIKSLDQLKMGKGPATVKTIAGTMSAILLSSFMSILKIQNKGAK--LGTMSPMDQ  68

Query  529  ILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL-RMRR---KTMEAVKK---QNRAIDEG  371
            +L   HLLEASL+GF+LFLG +IDR+HHYI++L R+R     + E V++   + + + E 
Sbjct  69   VLWRTHLLEASLIGFTLFLGFIIDRIHHYIKKLIRLRSSIGSSTEEVQRLHEERKQLKEK  128

Query  370  KAGISEEIKSLEEQASSLRERIKQLeseveekskeassseANAIALKKQSEGFLLEYDRL  191
                S EIK L+E+ S+L + +K+L+SE EEK ++  ++EA+  +L+KQS   LLEYDRL
Sbjct  129  DDKASLEIKKLKEEISTLSQNLKKLKSESEEKDRKIETAEAHVASLQKQSADLLLEYDRL  188

Query  190  LEENQHLRSQ  161
            LE+NQ+L++Q
Sbjct  189  LEDNQNLQNQ  198



>ref|XP_011013138.1| PREDICTED: uncharacterized protein LOC105117241 [Populus euphratica]
Length=128

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 94/130 (72%), Gaps = 2/130 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI LLF ++F EMA+I I +FRTP+RKLVI+ +D++K+G+G +V KTVA T+ VV  S +
Sbjct  1    MINLLFTVVFTEMAVILILLFRTPVRKLVIMAIDQLKQGKGPLVAKTVATTLIVVFTSVL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            +N + +R R ++   G +   D++L+ + +LEASL+GFSLF  LMIDRLH YI+EL   R
Sbjct  61   HNALQIRKRLLD--AGAVNSADEVLMVERILEASLLGFSLFQALMIDRLHCYIKELLQIR  118

Query  418  KTMEAVKKQN  389
              +E VK+ N
Sbjct  119  TELEEVKRLN  128



>ref|XP_010552045.1| PREDICTED: B-cell receptor-associated protein 31 [Tarenaya hassleriana]
Length=219

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 151/215 (70%), Gaps = 10/215 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++F E A+  + + +  PLR+LV+  LD++K G+G   VKT+AGT+ V++LST
Sbjct  1    MIQLLFLVLFVEGAIAFLMLVKIGPLRELVMKSLDQLKMGKGPATVKTIAGTMSVILLST  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL---  431
            + +++ ++N+  +   G ++P DQ+L   HLLEASLMG  LFLG +IDR+HHY+ +L   
Sbjct  61   LMSIVKIQNKGAKL--GTMSPMDQVLWRTHLLEASLMGVVLFLGFVIDRMHHYLTKLLYL  118

Query  430  ----RMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
                 M ++ +E ++K+   + E +   S+E+K L+E+ SSL + +++LE+E ++K K+ 
Sbjct  119  RSNIGMSKEELEKLQKERTELKEKEEKASKEMKQLQEKLSSLSQNLEKLEAESKDKDKKL  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQL  158
             ++EA+  AL+KQS   LLEYDRLLE+NQ+L++Q+
Sbjct  179  ETAEAHVSALQKQSAELLLEYDRLLEDNQNLQTQI  213



>ref|XP_004491413.1| PREDICTED: uncharacterized protein LOC101509893 [Cicer arietinum]
Length=140

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 92/129 (71%), Gaps = 2/129 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M+QLLF L+  E+ +I I  F  P+RK+++  LD +KRG+G ++ KTVA TVFVV  STI
Sbjct  1    MLQLLFALLTMELTVILILSFANPIRKMMVRVLDVLKRGKGPLITKTVASTVFVVFGSTI  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y ++ +  R    + G I PT+++L+A HLLEASLMGFSLF GLMIDR H+Y++E+   R
Sbjct  61   YTILKIHKR--SKDAGMINPTEEVLMAHHLLEASLMGFSLFFGLMIDRQHYYVKEITSLR  118

Query  418  KTMEAVKKQ  392
            K ME  KKQ
Sbjct  119  KNMEIAKKQ  127



>ref|XP_004491710.1| PREDICTED: B-cell receptor-associated protein 31-like [Cicer 
arietinum]
Length=218

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 146/214 (68%), Gaps = 10/214 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++FAE A+  + + +  PLR LV+  LD++K G+G   VKT+AGT+ V++LS+
Sbjct  1    MIQLLFLVLFAEGAMAFLLLVKIGPLRDLVMKSLDQLKMGKGPATVKTIAGTMSVILLSS  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
              +++ ++N+  +   G ++P DQ+L   HLLEASL+GF+LFLG +IDR+HHY+++L   
Sbjct  61   FMSIVKIQNKGAKL--GTMSPMDQVLWRTHLLEASLIGFTLFLGFLIDRMHHYLQKLINL  118

Query  421  RKTMEAVKKQNRAI-------DEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R  M A K++   +        E +   S+EIK L+++ S+L E +K+ + E EEK K  
Sbjct  119  RSNMGASKEEVENLKKETMEFKEKEEKASKEIKQLKKELSTLSEGLKKAKMESEEKDKRV  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQ  161
             ++E++  +L+KQ+   LLEYDRLLE+NQ+L++Q
Sbjct  179  ETAESHVASLQKQAADLLLEYDRLLEDNQNLQAQ  212



>ref|XP_012070866.1| PREDICTED: uncharacterized protein LOC105632986 [Jatropha curcas]
Length=128

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 97/128 (76%), Gaps = 2/128 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MI  LF ++F E+++I   +FR+P+RK++++G+D +KRGRG +V KTVA T+F V  + +
Sbjct  1    MISALFCVVFGEISVIVTLLFRSPMRKVLMVGIDYMKRGRGQLVAKTVAATLFGVFSAIL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            Y+V+ ++ R +E   G + PTD++LLA+ LLEA+LMGFSLFL +M DRLH+YI+EL   R
Sbjct  61   YSVMQIQKRTLES--GVVNPTDEVLLAERLLEATLMGFSLFLAMMADRLHYYIKELYRVR  118

Query  418  KTMEAVKK  395
            K +E +K+
Sbjct  119  KEVEQLKR  126



>emb|CDY66080.1| BnaCnng49520D [Brassica napus]
Length=219

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 146/215 (68%), Gaps = 10/215 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++F E A+  + + +  PLR+LVI  LD++K G+G   VKT+AGT+ V++ S 
Sbjct  1    MIQLLFVILFVEGAITFLLLIKIGPLRELVIKSLDQMKMGKGPATVKTIAGTMAVILFSN  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIREL---  431
            + +++ ++N+  +   G ++P DQ+L   HLLEASLMG  LFLG +IDR+HHY+R+L   
Sbjct  61   LMSIVKIQNKGAKL--GTMSPMDQVLWRTHLLEASLMGVVLFLGFVIDRMHHYMRKLINF  118

Query  430  ----RMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
                   R+ +E ++K+   + E +   S+EIK L+E+ SS+ ER+K+ E+E +EK K+ 
Sbjct  119  RGNVGSSREELEQLQKERTELKEKEEKASKEIKQLQEKLSSMSERVKKAETECKEKEKKL  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQL  158
             ++E +  AL+KQS   LLEYD LLE+NQ L+SQ+
Sbjct  179  EAAETHVAALQKQSAELLLEYDSLLEDNQKLQSQI  213



>ref|XP_006452413.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
 ref|XP_006475036.1| PREDICTED: uncharacterized protein LOC102621108 [Citrus sinensis]
 gb|ESR65653.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
Length=129

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 91/131 (69%), Gaps = 6/131 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            M  L F  +F EMALI   +F +PLRKL+ILGLD++K+GRG +V K+V  TV VV+ S +
Sbjct  1    MFYLFFTTVFTEMALILALLFESPLRKLLILGLDKLKQGRGPLVAKSVGATVLVVLSSAV  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YNV+ +  R    E G + PT+++L+A  LLEASLMGFSLFL +M+DRLH YI+    R+
Sbjct  61   YNVVEIHKR--SRESGALNPTEEVLMADLLLEASLMGFSLFLAVMMDRLHSYIK----RK  114

Query  418  KTMEAVKKQNR  386
            + +E V   N+
Sbjct  115  QILEEVINPNK  125



>ref|XP_008458888.1| PREDICTED: uncharacterized protein LOC103498158 [Cucumis melo]
Length=123

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 89/124 (72%), Gaps = 2/124 (2%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRTPLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLSTI  599
            MIQ++  L+ AEMALI   +F+ PLR L++ GLDR+K+GRG +V K+VA T+ VV  S +
Sbjct  1    MIQVVLKLVLAEMALILALLFKNPLRNLIVKGLDRLKQGRGPLVAKSVAATMLVVFASAL  60

Query  598  YNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRR  419
            YN  ++R R    EGG +  TD+IL+A  LLE   +GFSLFLGL+IDR+H+YIREL   R
Sbjct  61   YNAAAIRGRM--AEGGILNQTDEILMAYRLLETYTIGFSLFLGLIIDRIHNYIRELHRLR  118

Query  418  KTME  407
             T+E
Sbjct  119  TTLE  122



>ref|NP_199677.1| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
 dbj|BAB10699.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAX55202.1| hypothetical protein At5g48660 [Arabidopsis thaliana]
 gb|AAZ52779.1| expressed protein [Arabidopsis thaliana]
 gb|AED95708.1| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
Length=219

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 146/215 (68%), Gaps = 10/215 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++F E A+  + + +  PLR+LVI  LD++K G+G   VKT+AGT+ V++ S 
Sbjct  1    MIQLLFLVLFVEGAIAFLLLIKIGPLRELVIKSLDQMKMGKGPATVKTIAGTMSVILFSN  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
            + +++ ++N+    + G ++P DQ+L   HLLEASL+G  LFLG +IDR+HHY+R+L   
Sbjct  61   LMSIVKIQNKG--AKLGTMSPMDQVLWRTHLLEASLLGVVLFLGFIIDRMHHYLRKLINL  118

Query  421  RKT-------MEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R         +E ++K+   + E +   S+EIK L+ + SS+ ER+K+ E+E +EK K+ 
Sbjct  119  RSNVGSSKEELEQLQKERTELKEKEEKASKEIKQLQVKLSSITERLKKAETESKEKEKKL  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQL  158
             ++E +  AL+KQS   LLEYDRLLE+NQHL+SQ+
Sbjct  179  ETAETHVTALQKQSAELLLEYDRLLEDNQHLQSQI  213



>ref|XP_006395148.1| hypothetical protein EUTSA_v10004894mg [Eutrema salsugineum]
 gb|ESQ32434.1| hypothetical protein EUTSA_v10004894mg [Eutrema salsugineum]
Length=219

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 146/215 (68%), Gaps = 10/215 (5%)
 Frame = -1

Query  778  MIQLLFPLIFAEMALIGIFVFRT-PLRKLVILGLDRVKRGRGSIvvktvagtvfvVMLST  602
            MIQLLF ++F E A+  + + +  PLR+LVI  LD++K G+G   VKT+AGT+ V++ S 
Sbjct  1    MIQLLFMVLFVEGAIAFLLLIKIGPLRELVIKSLDQLKMGKGPATVKTIAGTMSVILFSN  60

Query  601  IYNVISLRNRWIEDEGGDITPTDQILLAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMR  422
              +++ ++N+    + G ++P DQ+L   HLLEASLMG  LFLG +IDR+HHY+R+L   
Sbjct  61   FMSIVKIQNKG--AKLGTMSPMDQVLWRTHLLEASLMGVVLFLGFIIDRMHHYLRKLINL  118

Query  421  RKT-------MEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLeseveekskea  263
            R         +E ++K+   + E +   S+EIK L+E+ SS+ ER+K+ E+E +EK K+ 
Sbjct  119  RSNVGSSKEELEQLQKERTELKEKEEKASKEIKQLQEKLSSISERLKKAENESKEKEKKL  178

Query  262  ssseANAIALKKQSEGFLLEYDRLLEENQHLRSQL  158
             ++E +  AL+KQS   LLEYDRLLE+NQ+L++Q+
Sbjct  179  ETAETHVTALQKQSAELLLEYDRLLEDNQNLQTQI  213



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1936147003653