BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9914

Length=647
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007024263.1|  TCP-1/cpn60 chaperonin family protein              194   2e-54   
gb|KJB56809.1|  hypothetical protein B456_009G136600                    194   2e-54   Gossypium raimondii
ref|XP_002284134.1|  PREDICTED: ruBisCO large subunit-binding pro...    191   3e-53   Vitis vinifera
ref|XP_010942728.1|  PREDICTED: ruBisCO large subunit-binding pro...    189   1e-52   Elaeis guineensis
ref|XP_004235655.1|  PREDICTED: ruBisCO large subunit-binding pro...    189   2e-52   Solanum lycopersicum
ref|XP_010249575.1|  PREDICTED: ruBisCO large subunit-binding pro...    189   2e-52   Nelumbo nucifera [Indian lotus]
dbj|BAH20275.1|  AT1G55490                                              180   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006343054.1|  PREDICTED: ruBisCO large subunit-binding pro...    188   3e-52   Solanum tuberosum [potatoes]
ref|XP_010254011.1|  PREDICTED: ruBisCO large subunit-binding pro...    188   3e-52   Nelumbo nucifera [Indian lotus]
ref|XP_008803228.1|  PREDICTED: ruBisCO large subunit-binding pro...    188   4e-52   Phoenix dactylifera
ref|XP_002285746.1|  PREDICTED: ruBisCO large subunit-binding pro...    186   2e-51   Vitis vinifera
ref|XP_009597827.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    186   3e-51   Nicotiana tomentosiformis
ref|XP_009790232.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    186   3e-51   Nicotiana sylvestris
gb|AFW75264.1|  putative TCP-1/cpn60 chaperonin family protein          179   6e-51   
ref|XP_011089709.1|  PREDICTED: ruBisCO large subunit-binding pro...    185   6e-51   Sesamum indicum [beniseed]
ref|XP_009793336.1|  PREDICTED: ruBisCO large subunit-binding pro...    184   1e-50   Nicotiana sylvestris
gb|KHN23693.1|  RuBisCO large subunit-binding protein subunit bet...    182   2e-50   Glycine soja [wild soybean]
dbj|BAD94382.1|  RuBisCO subunit binding-protein beta subunit pre...    172   3e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AFW75263.1|  putative TCP-1/cpn60 chaperonin family protein          177   3e-50   
ref|XP_003546771.1|  PREDICTED: ruBisCO large subunit-binding pro...    182   3e-50   Glycine max [soybeans]
ref|XP_006838174.1|  PREDICTED: ruBisCO large subunit-binding pro...    183   3e-50   Amborella trichopoda
ref|XP_009628147.1|  PREDICTED: ruBisCO large subunit-binding pro...    182   4e-50   Nicotiana tomentosiformis
gb|AAT90346.1|  RuBisCo subunit binding-protein beta subunit            179   4e-50   Zea mays [maize]
ref|XP_010920048.1|  PREDICTED: ruBisCO large subunit-binding pro...    182   5e-50   
ref|XP_007014617.1|  TCP-1/cpn60 chaperonin family protein              182   6e-50   
ref|XP_009376036.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    182   6e-50   
pir||JT0902  chaperonin 60 beta - wheat (fragment)                      171   6e-50
ref|XP_008351333.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    182   6e-50   
ref|XP_009392770.1|  PREDICTED: ruBisCO large subunit-binding pro...    182   6e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010920050.1|  PREDICTED: ruBisCO large subunit-binding pro...    182   7e-50   Elaeis guineensis
ref|XP_006655715.1|  PREDICTED: chaperonin 60 subunit beta 1, chl...    182   7e-50   
ref|XP_009376045.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    182   7e-50   Pyrus x bretschneideri [bai li]
ref|XP_008809220.1|  PREDICTED: ruBisCO large subunit-binding pro...    182   7e-50   Phoenix dactylifera
sp|P08927.2|RUBB_PEA  RecName: Full=RuBisCO large subunit-binding...    181   9e-50   Pisum sativum [garden pea]
gb|KHN26774.1|  RuBisCO large subunit-binding protein subunit bet...    181   9e-50   Glycine soja [wild soybean]
gb|ABK24483.1|  unknown                                                 181   1e-49   Picea sitchensis
ref|XP_004498949.1|  PREDICTED: ruBisCO large subunit-binding pro...    181   1e-49   Cicer arietinum [garbanzo]
ref|XP_003531529.1|  PREDICTED: ruBisCO large subunit-binding pro...    181   1e-49   Glycine max [soybeans]
ref|XP_009339195.1|  PREDICTED: LOW QUALITY PROTEIN: ruBisCO larg...    181   2e-49   
ref|XP_012080824.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    181   2e-49   Jatropha curcas
ref|XP_002894506.1|  CPN60B                                             181   2e-49   
ref|XP_008659370.1|  PREDICTED: ruBisCO large subunit-binding pro...    180   2e-49   Zea mays [maize]
ref|XP_010501159.1|  PREDICTED: chaperonin 60 subunit beta 1, chl...    180   2e-49   Camelina sativa [gold-of-pleasure]
ref|NP_001056601.1|  Os06g0114000                                       180   3e-49   
ref|XP_009106876.1|  PREDICTED: ruBisCO large subunit-binding pro...    180   3e-49   Brassica rapa
gb|KJB73253.1|  hypothetical protein B456_011G224500                    180   3e-49   Gossypium raimondii
ref|XP_008659369.1|  PREDICTED: ruBisCO large subunit-binding pro...    180   3e-49   
ref|NP_175945.1|  chaperonin 60 subunit beta 1                          180   3e-49   Arabidopsis thaliana [mouse-ear cress]
gb|KJB73260.1|  hypothetical protein B456_011G224500                    180   3e-49   Gossypium raimondii
ref|XP_010480083.1|  PREDICTED: chaperonin 60 subunit beta 1, chl...    180   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_009418590.1|  PREDICTED: ruBisCO large subunit-binding pro...    180   3e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006307049.1|  hypothetical protein CARUB_v10008637mg             180   3e-49   Capsella rubella
ref|XP_010462399.1|  PREDICTED: chaperonin 60 subunit beta 1, chl...    180   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_008384375.1|  PREDICTED: ruBisCO large subunit-binding pro...    180   3e-49   
ref|XP_010552318.1|  PREDICTED: chaperonin 60 subunit beta 1, chl...    180   3e-49   Tarenaya hassleriana [spider flower]
gb|KJB73258.1|  hypothetical protein B456_011G224500                    180   3e-49   Gossypium raimondii
gb|EEE64974.1|  hypothetical protein OsJ_19883                          179   4e-49   Oryza sativa Japonica Group [Japonica rice]
gb|KDO54474.1|  hypothetical protein CISIN_1g007313mg                   176   4e-49   Citrus sinensis [apfelsine]
ref|XP_001754999.1|  predicted protein                                  180   4e-49   
ref|XP_001780334.1|  predicted protein                                  179   4e-49   
ref|XP_008221851.1|  PREDICTED: ruBisCO large subunit-binding pro...    179   5e-49   Prunus mume [ume]
ref|XP_010909417.1|  PREDICTED: ruBisCO large subunit-binding pro...    179   6e-49   Elaeis guineensis
ref|XP_010044926.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    179   6e-49   Eucalyptus grandis [rose gum]
gb|EYU32832.1|  hypothetical protein MIMGU_mgv1a003115mg                179   7e-49   Erythranthe guttata [common monkey flower]
ref|XP_008648746.1|  PREDICTED: ruBisCO large subunit-binding pro...    179   7e-49   
ref|XP_004144069.1|  PREDICTED: ruBisCO large subunit-binding pro...    179   1e-48   Cucumis sativus [cucumbers]
emb|CDY02438.1|  BnaA08g00450D                                          179   1e-48   
ref|XP_008451008.1|  PREDICTED: ruBisCO large subunit-binding pro...    178   1e-48   Cucumis melo [Oriental melon]
ref|XP_010536825.1|  PREDICTED: chaperonin 60 subunit beta 3, chl...    178   1e-48   Tarenaya hassleriana [spider flower]
ref|XP_006392634.1|  hypothetical protein EUTSA_v10011330mg             178   2e-48   Eutrema salsugineum [saltwater cress]
ref|XP_008813152.1|  PREDICTED: ruBisCO large subunit-binding pro...    177   2e-48   Phoenix dactylifera
ref|XP_002523404.1|  rubisco subunit binding-protein beta subunit...    178   2e-48   Ricinus communis
ref|XP_004228946.1|  PREDICTED: ruBisCO large subunit-binding pro...    177   2e-48   Solanum lycopersicum
ref|NP_001275097.1|  chaperonin-60 beta subunit                         177   2e-48   Solanum tuberosum [potatoes]
ref|XP_008813151.1|  PREDICTED: ruBisCO large subunit-binding pro...    177   2e-48   Phoenix dactylifera
ref|XP_007208310.1|  hypothetical protein PRUPE_ppa003093mg             177   2e-48   Prunus persica
ref|XP_006407212.1|  hypothetical protein EUTSA_v10020346mg             177   2e-48   Eutrema salsugineum [saltwater cress]
ref|XP_004964341.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    177   3e-48   Setaria italica
ref|XP_002437709.1|  hypothetical protein SORBIDRAFT_10g001120          177   3e-48   Sorghum bicolor [broomcorn]
ref|XP_003557154.1|  PREDICTED: ruBisCO large subunit-binding pro...    177   4e-48   Brachypodium distachyon [annual false brome]
ref|XP_004964340.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    177   4e-48   Setaria italica
sp|Q43831.1|RUBB_SECCE  RecName: Full=RuBisCO large subunit-bindi...    176   4e-48   Secale cereale
emb|CDY26100.1|  BnaC06g10960D                                          177   5e-48   Brassica napus [oilseed rape]
gb|KDO54471.1|  hypothetical protein CISIN_1g007313mg                   176   5e-48   Citrus sinensis [apfelsine]
ref|XP_009103725.1|  PREDICTED: ruBisCO large subunit-binding pro...    176   6e-48   Brassica rapa
emb|CDY08245.1|  BnaA05g13740D                                          176   6e-48   Brassica napus [oilseed rape]
ref|XP_006445574.1|  hypothetical protein CICLE_v10014640mg             176   6e-48   Citrus clementina [clementine]
ref|XP_009135307.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    176   7e-48   Brassica rapa
ref|XP_004294947.1|  PREDICTED: ruBisCO large subunit-binding pro...    176   8e-48   Fragaria vesca subsp. vesca
emb|CDY10557.1|  BnaC03g70570D                                          177   9e-48   Brassica napus [oilseed rape]
ref|XP_002303983.1|  chaperonin precursor family protein                176   9e-48   Populus trichocarpa [western balsam poplar]
emb|CDP18583.1|  unnamed protein product                                176   1e-47   Coffea canephora [robusta coffee]
ref|XP_011025126.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    176   1e-47   Populus euphratica
gb|KHG01053.1|  RuBisCO large subunit-binding protein subunit bet...    176   1e-47   Gossypium arboreum [tree cotton]
ref|XP_007149220.1|  hypothetical protein PHAVU_005G051700g             175   1e-47   Phaseolus vulgaris [French bean]
ref|XP_009382612.1|  PREDICTED: ruBisCO large subunit-binding pro...    175   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX82537.1|  BnaA03g32840D                                          175   2e-47   
ref|XP_006297271.1|  hypothetical protein CARUB_v10013285mg             175   2e-47   Capsella rubella
emb|CDX75713.1|  BnaC03g37960D                                          174   3e-47   
ref|XP_002297617.1|  hypothetical protein POPTR_0001s03980g             175   3e-47   Populus trichocarpa [western balsam poplar]
gb|KEH39992.1|  TCP-1/cpn60 chaperonin family protein                   174   3e-47   Medicago truncatula
ref|XP_011048163.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    174   3e-47   Populus euphratica
gb|KEH39991.1|  TCP-1/cpn60 chaperonin family protein                   174   3e-47   Medicago truncatula
ref|NP_001032083.1|  chaperonin 60 subunit beta 3                       174   5e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864459.1|  ATP binding protein                                174   5e-47   
ref|NP_187956.1|  TCP-1/cpn60 chaperonin family protein                 174   6e-47   Arabidopsis thaliana [mouse-ear cress]
gb|KJB73259.1|  hypothetical protein B456_011G224500                    174   7e-47   Gossypium raimondii
ref|XP_006280215.1|  hypothetical protein CARUB_v10026123mg             173   7e-47   Capsella rubella
ref|XP_003574065.1|  PREDICTED: ruBisCO large subunit-binding pro...    173   7e-47   Brachypodium distachyon [annual false brome]
emb|CDX86994.1|  BnaC03g52640D                                          174   8e-47   
gb|EMS68298.1|  RuBisCO large subunit-binding protein subunit bet...    174   8e-47   Triticum urartu
ref|XP_010451233.1|  PREDICTED: chaperonin 60 subunit beta 3, chl...    173   9e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010483125.1|  PREDICTED: chaperonin 60 subunit beta 3, chl...    173   9e-47   Camelina sativa [gold-of-pleasure]
gb|EMS63178.1|  RuBisCO large subunit-binding protein subunit bet...    173   9e-47   Triticum urartu
ref|XP_010500599.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    173   9e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010465189.1|  PREDICTED: LOW QUALITY PROTEIN: chaperonin 6...    173   1e-46   Camelina sativa [gold-of-pleasure]
dbj|BAB11583.1|  RuBisCO subunit binding-protein beta subunit pre...    172   1e-46   Arabidopsis thaliana [mouse-ear cress]
gb|EMT05406.1|  RuBisCO large subunit-binding protein subunit bet...    175   1e-46   
ref|XP_010103092.1|  Chaperonin 60 subunit beta 2                       172   2e-46   
ref|XP_006401314.1|  hypothetical protein EUTSA_v10013030mg             172   2e-46   Eutrema salsugineum [saltwater cress]
ref|XP_010487110.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    172   3e-46   Camelina sativa [gold-of-pleasure]
dbj|BAK07904.1|  predicted protein                                      172   3e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT19476.1|  RuBisCO large subunit-binding protein subunit bet...    172   3e-46   
ref|NP_001045601.1|  Os02g0102900                                       172   3e-46   
ref|XP_010094358.1|  RuBisCO large subunit-binding protein subuni...    172   3e-46   
gb|EMS56406.1|  RuBisCO large subunit-binding protein subunit bet...    172   3e-46   Triticum urartu
emb|CAJ19275.1|  beta chaperonin 60                                     171   3e-46   Solanum commersonii
ref|XP_010443301.1|  PREDICTED: chaperonin 60 subunit beta 3, chl...    171   4e-46   Camelina sativa [gold-of-pleasure]
ref|XP_001754571.1|  predicted protein                                  171   4e-46   
dbj|BAF00280.1|  RuBisCO subunit binding-protein beta subunit pre...    171   6e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CDY11918.1|  BnaC03g13440D                                          170   9e-46   Brassica napus [oilseed rape]
ref|XP_009132296.1|  PREDICTED: chaperonin 60 subunit beta 3, chl...    170   1e-45   Brassica rapa
ref|XP_010671843.1|  PREDICTED: ruBisCO large subunit-binding pro...    169   2e-45   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY36809.1|  BnaA03g10770D                                          168   5e-45   Brassica napus [oilseed rape]
gb|EMT33855.1|  RuBisCO large subunit-binding protein subunit bet...    169   5e-45   
emb|CDX75715.1|  BnaC03g37980D                                          167   7e-45   
gb|KDO54472.1|  hypothetical protein CISIN_1g007313mg                   167   9e-45   Citrus sinensis [apfelsine]
ref|XP_010691436.1|  PREDICTED: ruBisCO large subunit-binding pro...    167   1e-44   Beta vulgaris subsp. vulgaris [field beet]
sp|P21241.1|RUBB_BRANA  RecName: Full=RuBisCO large subunit-bindi...    167   1e-44   Brassica napus [oilseed rape]
ref|XP_004951187.1|  PREDICTED: ruBisCO large subunit-binding pro...    166   3e-44   Setaria italica
ref|XP_002964742.1|  hypothetical protein SELMODRAFT_142800             163   4e-43   Selaginella moellendorffii
emb|CDY32855.1|  BnaC09g33020D                                          162   5e-43   Brassica napus [oilseed rape]
ref|XP_002961675.1|  hypothetical protein SELMODRAFT_165043             162   1e-42   
ref|XP_002514548.1|  rubisco subunit binding-protein beta subunit...    161   2e-42   
emb|CDX85007.1|  BnaC05g20480D                                          163   3e-42   
gb|AFW66837.1|  putative TCP-1/cpn60 chaperonin family protein is...    158   3e-41   
gb|KCW87049.1|  hypothetical protein EUGRSUZ_B03593                     158   3e-41   Eucalyptus grandis [rose gum]
ref|XP_006484293.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    156   8e-41   Citrus sinensis [apfelsine]
gb|ACG36615.1|  ruBisCO large subunit-binding protein subunit beta      156   9e-41   Zea mays [maize]
ref|XP_006437814.1|  hypothetical protein CICLE_v10031053mg             155   2e-40   
ref|NP_001146890.1|  ruBisCO large subunit-binding protein subuni...    155   3e-40   
ref|XP_012080492.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    154   5e-40   Jatropha curcas
ref|XP_012080491.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    154   8e-40   Jatropha curcas
ref|XP_002966190.1|  hypothetical protein SELMODRAFT_168153             151   5e-39   
ref|XP_009356483.1|  PREDICTED: ruBisCO large subunit-binding pro...    151   6e-39   Pyrus x bretschneideri [bai li]
ref|XP_002982262.1|  hypothetical protein SELMODRAFT_271545             151   7e-39   Selaginella moellendorffii
ref|XP_011077788.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    150   8e-39   Sesamum indicum [beniseed]
ref|XP_008389354.1|  PREDICTED: ruBisCO large subunit-binding pro...    150   2e-38   
ref|XP_007227057.1|  hypothetical protein PRUPE_ppa020938mg             149   5e-38   
ref|XP_008243762.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    148   9e-38   Prunus mume [ume]
ref|XP_002890669.1|  hypothetical protein ARALYDRAFT_890123             147   1e-37   
ref|XP_007045690.1|  TCP-1/cpn60 chaperonin family protein isoform 2    146   2e-37   
ref|XP_009103087.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    147   2e-37   Brassica rapa
ref|XP_009103088.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    147   2e-37   Brassica rapa
ref|XP_010261583.1|  PREDICTED: ruBisCO large subunit-binding pro...    146   3e-37   Nelumbo nucifera [Indian lotus]
emb|CDY20555.1|  BnaC07g12220D                                          146   3e-37   Brassica napus [oilseed rape]
ref|XP_001418926.1|  chaperonin 60 beta chain, chloroplast              146   4e-37   Ostreococcus lucimarinus CCE9901
ref|XP_010460336.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    145   4e-37   Camelina sativa [gold-of-pleasure]
ref|XP_011009115.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    146   4e-37   Populus euphratica
ref|XP_010460335.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    146   4e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006307550.1|  hypothetical protein CARUB_v10009172mg             144   5e-37   
gb|KGN52011.1|  hypothetical protein Csa_5G607990                       145   6e-37   Cucumis sativus [cucumbers]
ref|XP_011655733.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    145   6e-37   Cucumis sativus [cucumbers]
ref|XP_004135135.1|  PREDICTED: ruBisCO large subunit-binding pro...    145   6e-37   Cucumis sativus [cucumbers]
ref|XP_010477881.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    145   6e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010477879.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    145   7e-37   Camelina sativa [gold-of-pleasure]
ref|XP_007045689.1|  TCP-1/cpn60 chaperonin family protein isoform 1    145   8e-37   
gb|KJB11272.1|  hypothetical protein B456_001G250800                    144   1e-36   Gossypium raimondii
gb|KJB11273.1|  hypothetical protein B456_001G250800                    144   1e-36   Gossypium raimondii
ref|XP_010499067.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    144   1e-36   Camelina sativa [gold-of-pleasure]
gb|KJB11274.1|  hypothetical protein B456_001G250800                    144   1e-36   Gossypium raimondii
ref|XP_006415907.1|  hypothetical protein EUTSA_v10007125mg             145   1e-36   Eutrema salsugineum [saltwater cress]
emb|CBI27426.3|  unnamed protein product                                144   1e-36   Vitis vinifera
ref|XP_010499065.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    145   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010499066.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    144   1e-36   
ref|XP_002269341.2|  PREDICTED: chaperonin 60 subunit beta 4, chl...    144   2e-36   Vitis vinifera
ref|XP_008446494.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    144   2e-36   
ref|XP_008446493.1|  PREDICTED: ruBisCO large subunit-binding pro...    144   2e-36   Cucumis melo [Oriental melon]
gb|EYU28916.1|  hypothetical protein MIMGU_mgv1a003338mg                144   2e-36   Erythranthe guttata [common monkey flower]
gb|KJB11275.1|  hypothetical protein B456_001G250800                    143   3e-36   Gossypium raimondii
ref|XP_007514774.1|  chaperonin GroEL                                   143   3e-36   Bathycoccus prasinos
emb|CDY66193.1|  BnaA07g36980D                                          143   4e-36   Brassica napus [oilseed rape]
ref|NP_001185097.1|  chaperonin 60 subunit beta 4                       142   6e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KJB11271.1|  hypothetical protein B456_001G250800                    143   6e-36   Gossypium raimondii
ref|NP_173947.1|  chaperonin 60 subunit beta 4                          142   7e-36   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD95277.1|  chaperonin precursor                                   142   7e-36   Arabidopsis thaliana [mouse-ear cress]
emb|CDP00506.1|  unnamed protein product                                142   8e-36   Coffea canephora [robusta coffee]
ref|XP_004297181.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    142   1e-35   Fragaria vesca subsp. vesca
ref|XP_006348604.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    141   2e-35   Solanum tuberosum [potatoes]
ref|XP_011009108.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    141   2e-35   Populus euphratica
ref|XP_008804418.1|  PREDICTED: ruBisCO large subunit-binding pro...    141   2e-35   Phoenix dactylifera
ref|XP_010905780.1|  PREDICTED: ruBisCO large subunit-binding pro...    141   2e-35   Elaeis guineensis
sp|Q42695.1|RUBC_CHLRE  RecName: Full=RuBisCO large subunit-bindi...    136   3e-35   Chlamydomonas reinhardtii
ref|XP_009418029.1|  PREDICTED: ruBisCO large subunit-binding pro...    140   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004490321.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    139   8e-35   Cicer arietinum [garbanzo]
ref|XP_009611004.1|  PREDICTED: ruBisCO large subunit-binding pro...    139   1e-34   Nicotiana tomentosiformis
ref|XP_009774325.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    138   2e-34   Nicotiana sylvestris
ref|XP_011623265.1|  PREDICTED: ruBisCO large subunit-binding pro...    138   2e-34   
ref|XP_009774324.1|  PREDICTED: ruBisCO large subunit-binding pro...    138   2e-34   Nicotiana sylvestris
ref|XP_011397598.1|  RuBisCO large subunit-binding protein subuni...    138   2e-34   Auxenochlorella protothecoides
ref|XP_006574985.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    138   3e-34   Glycine max [soybeans]
ref|XP_006653448.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    137   5e-34   Oryza brachyantha
ref|XP_010696183.1|  PREDICTED: ruBisCO large subunit-binding pro...    137   5e-34   Beta vulgaris subsp. vulgaris [field beet]
emb|CEF98707.1|  Chaperonin Cpn60                                       137   7e-34   Ostreococcus tauri
ref|XP_010066785.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    137   7e-34   Eucalyptus grandis [rose gum]
ref|XP_003080325.1|  RUBISCO SUBUNIT BINDING-PROTEIN BETA-2 SUBUN...    137   9e-34   
ref|XP_001692504.1|  chaperonin 60B2                                    136   1e-33   Chlamydomonas reinhardtii
ref|XP_005843554.1|  hypothetical protein CHLNCDRAFT_59809              136   1e-33   Chlorella variabilis
gb|EEC67866.1|  hypothetical protein OsI_35492                          136   1e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_003057879.1|  predicted protein                                  136   2e-33   Micromonas pusilla CCMP1545
gb|EEE61069.1|  hypothetical protein OsJ_14927                          135   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010320800.1|  PREDICTED: ruBisCO large subunit-binding pro...    135   2e-33   
ref|XP_010320799.1|  PREDICTED: ruBisCO large subunit-binding pro...    135   2e-33   Solanum lycopersicum
ref|XP_010320798.1|  PREDICTED: ruBisCO large subunit-binding pro...    135   3e-33   Solanum lycopersicum
ref|XP_010320797.1|  PREDICTED: ruBisCO large subunit-binding pro...    135   3e-33   
ref|XP_010320795.1|  PREDICTED: ruBisCO large subunit-binding pro...    135   3e-33   
ref|XP_003516734.2|  PREDICTED: chaperonin 60 subunit beta 4, chl...    134   7e-33   Glycine max [soybeans]
ref|XP_010552083.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    134   7e-33   Tarenaya hassleriana [spider flower]
ref|XP_003579836.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    133   1e-32   Brachypodium distachyon [annual false brome]
ref|XP_007146371.1|  hypothetical protein PHAVU_006G034900g             133   1e-32   Phaseolus vulgaris [French bean]
ref|XP_005647445.1|  chaperonin 60B2                                    132   4e-32   Coccomyxa subellipsoidea C-169
ref|XP_002951713.1|  hypothetical protein VOLCADRAFT_81582              131   6e-32   Volvox carteri f. nagariensis
gb|KDO54475.1|  hypothetical protein CISIN_1g007313mg                   131   8e-32   Citrus sinensis [apfelsine]
ref|XP_006573191.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    131   8e-32   Glycine max [soybeans]
ref|XP_002500045.1|  chaperonin 60 beta                                 130   2e-31   Micromonas commoda
emb|CDO97994.1|  unnamed protein product                                129   3e-31   Coffea canephora [robusta coffee]
ref|XP_004975721.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    128   9e-31   Setaria italica
gb|AFW66836.1|  putative TCP-1/cpn60 chaperonin family protein          120   9e-31   
gb|KDD74080.1|  TCP-1/cpn60 chaperonin                                  127   2e-30   Helicosporidium sp. ATCC 50920
ref|XP_010090495.1|  RuBisCO large subunit-binding protein subuni...    124   1e-29   
sp|Q42693.1|RUBB_CHLRE  RecName: Full=RuBisCO large subunit-bindi...    121   8e-29   Chlamydomonas reinhardtii
ref|XP_002315987.2|  hypothetical protein POPTR_0010s14520g             122   9e-29   
gb|EMS68279.1|  RuBisCO large subunit-binding protein subunit bet...    122   2e-28   Triticum urartu
ref|XP_001701113.1|  chaperonin 60B1                                    121   2e-28   Chlamydomonas reinhardtii
ref|XP_008653444.1|  PREDICTED: ruBisCO large subunit-binding pro...    121   2e-28   
ref|WP_045871448.1|  molecular chaperone GroEL                          111   1e-24   Nostocales
ref|WP_006278498.1|  molecular chaperone GroEL                          109   4e-24   Cylindrospermopsis raciborskii
ref|WP_012407975.1|  molecular chaperone GroEL                          109   4e-24   Nostoc punctiforme
ref|WP_009343442.1|  molecular chaperone GroEL                          109   5e-24   Raphidiopsis brookii
gb|AAA27284.1|  chaperonin 60                                           108   1e-23   Synechocystis sp.
ref|WP_010873466.1|  molecular chaperone GroEL                          108   1e-23   Synechocystis
ref|WP_006456066.1|  molecular chaperone GroEL                          108   2e-23   Synechococcus sp. PCC 7335
ref|WP_011320465.1|  molecular chaperone GroEL                          107   2e-23   Trichormus variabilis
gb|ABA23371.1|  Chaperonin Cpn60/TCP-1                                  107   2e-23   Trichormus variabilis ATCC 29413
ref|XP_010091675.1|  Chaperonin 60 subunit beta 4                       108   3e-23   
ref|WP_015127399.1|  molecular chaperone GroEL                          107   3e-23   Calothrix sp. PCC 7507
ref|WP_041643235.1|  molecular chaperone GroEL                          107   3e-23   Trichormus azollae
gb|ADI64918.1|  chaperonin GroEL                                        107   3e-23   'Nostoc azollae' 0708
ref|WP_015216715.1|  molecular chaperone GroEL                          107   4e-23   Anabaena cylindrica
ref|WP_028949194.1|  molecular chaperone GroEL                          106   5e-23   Synechocystis sp. PCC 6714
ref|WP_013568730.1|  molecular chaperone GroEL                          106   6e-23   Terriglobus saanensis
ref|WP_017711036.1|  molecular chaperone GroEL                          106   7e-23   Prochlorothrix hollandica
dbj|BAQ59925.1|  heat shock protein 60 family chaperone GroEL           106   8e-23   Geminocystis sp. NIES-3708
ref|WP_010996060.1|  molecular chaperone GroEL                          105   9e-23   Nostocaceae
ref|WP_016873105.1|  molecular chaperone GroEL                          105   1e-22   Chlorogloeopsis fritschii
ref|WP_017652866.1|  molecular chaperone GroEL                          105   1e-22   Fortiea contorta
ref|WP_016949529.1|  molecular chaperone GroEL                          105   2e-22   Anabaena sp. PCC 7108
ref|WP_015079668.1|  chaperonin GroEL                                   105   2e-22   Anabaena sp. 90
ref|WP_015111848.1|  molecular chaperone GroEL                          105   2e-22   Nostoc sp. PCC 7107
ref|XP_010320801.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    104   2e-22   Solanum lycopersicum
ref|WP_011610149.1|  molecular chaperone GroEL                          105   2e-22   Trichodesmium erythraeum
ref|WP_036001242.1|  molecular chaperone GroEL                          104   2e-22   [Leptolyngbya] sp. JSC-1
ref|WP_026733795.1|  molecular chaperone GroEL                          104   3e-22   Fischerella sp. PCC 9605
ref|WP_015207554.1|  chaperonin GroL                                    104   3e-22   
ref|WP_022608771.1|  chaperonin GroL                                    104   4e-22   Rubidibacter lacunae
ref|WP_037217788.1|  molecular chaperone GroEL                          103   5e-22   
emb|CDN11427.1|  Heat shock protein 60 family chaperone GroEL           103   6e-22   Richelia intracellularis
ref|WP_030006718.1|  molecular chaperone GroEL                          103   6e-22   Synechococcus sp. NKBG042902
sp|Q7WVY0.1|CH602_ANASL  RecName: Full=60 kDa chaperonin 2; AltNa...    103   6e-22   Anabaena sp. L-31
gb|AFY45941.1|  chaperonin GroL                                         103   6e-22   
ref|WP_012305785.1|  molecular chaperone GroEL                          103   6e-22   
ref|WP_041555042.1|  molecular chaperone GroEL                          103   7e-22   
ref|WP_015149515.1|  chaperonin GroL                                    103   8e-22   
ref|WP_042202155.1|  molecular chaperone GroEL                          103   8e-22   
ref|WP_028085385.1|  molecular chaperone GroEL                          103   8e-22   
gb|EAW45429.1|  Chaperonin                                              103   8e-22   
ref|WP_015221313.1|  chaperonin GroEL                                   102   1e-21   
ref|WP_017872176.1|  molecular chaperone GroEL                          102   1e-21   
ref|WP_039201828.1|  molecular chaperone GroEL                          102   2e-21   
ref|WP_029634993.1|  molecular chaperone GroEL [                        102   2e-21   
ref|WP_017316382.1|  molecular chaperone GroEL                          102   2e-21   
ref|WP_014786183.1|  molecular chaperone GroEL                          102   2e-21   
ref|WP_027404027.1|  molecular chaperone GroEL                          102   2e-21   
ref|WP_015219170.1|  molecular chaperone GroEL                          101   3e-21   
ref|WP_013579710.1|  molecular chaperone GroEL                          101   3e-21   
ref|WP_035350463.1|  molecular chaperone GroEL                          101   3e-21   
gb|KIJ81963.1|  molecular chaperone GroEL                               101   3e-21   
ref|WP_015185157.1|  chaperonin GroL                                    101   3e-21   
ref|WP_026442706.1|  molecular chaperone GroEL                          101   5e-21   
ref|WP_007303269.1|  molecular chaperone GroEL                          101   5e-21   
ref|WP_017888904.1|  molecular chaperone GroEL                          100   5e-21   
ref|WP_039715090.1|  molecular chaperone GroEL                          100   5e-21   
ref|WP_015177119.1|  molecular chaperone GroEL                          100   5e-21   
ref|WP_017746421.1|  molecular chaperone GroEL                          100   5e-21   
ref|WP_024545682.1|  molecular chaperone GroEL                          100   5e-21   
ref|WP_006099811.1|  molecular chaperone GroEL                          100   5e-21   
ref|WP_014265080.1|  molecular chaperone GroEL                          100   6e-21   
ref|WP_009545495.1|  MULTISPECIES: molecular chaperone GroEL            100   6e-21   
ref|WP_017321918.1|  molecular chaperone GroEL                          100   6e-21   
ref|WP_008273166.1|  molecular chaperone GroEL                          100   6e-21   
ref|WP_017303097.1|  molecular chaperone GroEL                          100   6e-21   
ref|WP_006528647.1|  chaperonin GroL                                    100   7e-21   
ref|WP_006634424.1|  molecular chaperone GroEL                          100   8e-21   
ref|WP_017663465.1|  molecular chaperone GroEL                          100   8e-21   
ref|WP_039737322.1|  molecular chaperone GroEL                          100   8e-21   
ref|WP_012594532.1|  MULTISPECIES: molecular chaperone GroEL            100   8e-21   
ref|WP_041033040.1|  molecular chaperone GroEL                          100   1e-20   
ref|WP_008230076.1|  Heat shock protein 60 family chaperone GroEL       100   1e-20   
ref|WP_035149954.1|  molecular chaperone GroEL                          100   1e-20   
ref|WP_017296590.1|  molecular chaperone GroEL                          100   1e-20   
ref|WP_040931194.1|  molecular chaperone GroEL                        99.8    1e-20   
ref|WP_040944510.1|  molecular chaperone GroEL                        99.8    1e-20   
ref|WP_015186725.1|  molecular chaperone GroEL                        99.8    1e-20   
ref|WP_040938971.1|  molecular chaperone GroEL                        99.8    1e-20   
ref|WP_016859319.1|  molecular chaperone GroEL                        99.8    1e-20   
gb|ERN05824.1|  hypothetical protein AMTR_s00006p00260480             99.4    2e-20   
ref|WP_015161862.1|  chaperonin GroL                                  99.4    2e-20   
ref|XP_001769377.1|  predicted protein                                99.8    2e-20   
ref|WP_015134386.1|  molecular chaperone GroEL                        99.4    2e-20   
ref|WP_022845623.1|  molecular chaperone GroEL                        99.4    2e-20   
ref|WP_020710616.1|  molecular chaperone GroEL                        99.4    2e-20   
ref|WP_025898344.1|  molecular chaperone GroEL                        99.0    2e-20   
gb|KIE11289.1|  molecular chaperone GroEL                             99.0    3e-20   
ref|WP_015195459.1|  molecular chaperone GroEL                        99.0    3e-20   
ref|WP_027846784.1|  molecular chaperone GroEL                        98.6    3e-20   
ref|WP_014276880.1|  chaperonin GroEL                                 98.6    3e-20   
ref|WP_028089933.1|  molecular chaperone GroEL                        98.6    3e-20   
ref|WP_041977667.1|  molecular chaperone GroEL                        98.6    4e-20   
emb|CDY32775.1|  BnaA10g10740D                                        91.7    4e-20   
dbj|BAQ66593.1|  heat shock protein 60 family chaperone GroEL         98.6    4e-20   
ref|WP_029006917.1|  molecular chaperone GroEL                        98.2    4e-20   
ref|WP_037114827.1|  molecular chaperone GroEL                        95.1    5e-20   
ref|XP_001755211.1|  predicted protein                                98.2    5e-20   
ref|WP_017311935.1|  molecular chaperone GroEL                        98.2    5e-20   
ref|WP_008233163.1|  Heat shock protein 60 family chaperone GroEL     98.2    5e-20   
ref|WP_007353288.1|  MULTISPECIES: molecular chaperone GroEL          98.2    5e-20   
ref|WP_009632953.1|  chaperonin GroL                                  98.2    5e-20   
ref|WP_044452656.1|  molecular chaperone GroEL                        97.8    7e-20   
ref|XP_002946991.1|  hypothetical protein VOLCADRAFT_79395            97.8    7e-20   
ref|WP_009458011.1|  MULTISPECIES: molecular chaperone GroEL          97.8    7e-20   
ref|WP_027269099.1|  molecular chaperone GroEL                        97.8    8e-20   
ref|WP_011243156.1|  MULTISPECIES: molecular chaperone GroEL          97.4    8e-20   
ref|WP_002788225.1|  molecular chaperone GroEL                        97.4    9e-20   
ref|WP_002802700.1|  molecular chaperone GroEL                        97.4    9e-20   
ref|WP_015142786.1|  chaperonin GroL                                  97.4    9e-20   
ref|WP_015152570.1|  chaperonin GroEL                                 97.4    9e-20   
ref|WP_016516009.1|  hypothetical protein                             97.4    9e-20   
ref|WP_002759846.1|  molecular chaperone GroEL                        97.4    9e-20   
ref|XP_006388723.1|  hypothetical protein POPTR_0113s00270g           92.8    9e-20   
ref|WP_012056293.1|  molecular chaperone GroEL                        97.4    1e-19   
ref|WP_002784220.1|  molecular chaperone GroEL                        97.4    1e-19   
ref|WP_015954854.1|  molecular chaperone GroEL                        97.4    1e-19   
ref|WP_002776160.1|  molecular chaperone GroEL                        97.4    1e-19   
ref|WP_002750554.1|  molecular chaperone GroEL                        97.4    1e-19   
ref|WP_013324620.1|  molecular chaperone GroEL                        97.4    1e-19   
ref|WP_026722382.1|  molecular chaperone GroEL                        97.1    1e-19   
gb|ACA23472.1|  chaperonin 60 alpha subunit                           91.7    1e-19   
ref|WP_002737038.1|  hypothetical protein                             97.1    1e-19   
ref|WP_035984973.1|  molecular chaperone GroEL                        97.1    1e-19   
ref|WP_002797729.1|  MULTISPECIES: molecular chaperone GroEL          97.1    1e-19   
ref|WP_002742506.1|  chaperonin GroL                                  97.1    1e-19   
ref|WP_024970482.1|  molecular chaperone GroEL                        97.1    1e-19   
ref|WP_016865329.1|  molecular chaperone GroEL                        97.1    1e-19   
ref|WP_014100310.1|  molecular chaperone GroEL                        97.1    1e-19   
ref|WP_011711994.1|  molecular chaperone GroEL                        96.7    1e-19   
ref|XP_008465363.1|  PREDICTED: ruBisCO large subunit-binding pro...  97.1    2e-19   
ref|WP_020713920.1|  molecular chaperone GroEL                        96.7    2e-19   
ref|WP_036224104.1|  molecular chaperone GroEL                        96.3    2e-19   
ref|WP_011433315.1|  molecular chaperone GroEL                        96.3    2e-19   
ref|WP_036363663.1|  molecular chaperone GroEL                        91.7    2e-19   
ref|XP_006374686.1|  hypothetical protein POPTR_0015s151902g          93.6    2e-19   
ref|XP_004145754.1|  PREDICTED: ruBisCO large subunit-binding pro...  96.3    2e-19   
ref|WP_002770556.1|  molecular chaperone GroEL                        96.3    3e-19   
ref|WP_015170801.1|  chaperonin GroEL                                 95.9    3e-19   
ref|WP_024124271.1|  molecular chaperone GroEL                        95.5    4e-19   
ref|WP_039729087.1|  MULTISPECIES: molecular chaperone GroEL          95.5    4e-19   
gb|AFK45390.1|  unknown                                               95.9    4e-19   
ref|WP_045581145.1|  molecular chaperone GroEL                        95.5    4e-19   
ref|WP_019009772.1|  molecular chaperone GroEL                        95.5    4e-19   
ref|WP_011057252.1|  molecular chaperone GroEL                        95.5    4e-19   
ref|WP_041739258.1|  molecular chaperone GroEL                        95.5    4e-19   
gb|AFZ00717.1|  60 kDa chaperonin                                     95.5    5e-19   
ref|WP_015799237.1|  molecular chaperone GroEL                        95.1    5e-19   
dbj|BAD95013.1|  putative rubisco subunit binding-protein alpha s...  90.9    5e-19   
ref|WP_026788053.1|  MULTISPECIES: molecular chaperone GroEL          95.5    5e-19   
ref|WP_026795295.1|  MULTISPECIES: molecular chaperone GroEL          95.5    5e-19   
ref|WP_026386338.1|  molecular chaperone GroEL                        95.1    5e-19   
ref|WP_038063632.1|  molecular chaperone GroEL                        95.1    6e-19   
ref|WP_019488785.1|  molecular chaperone GroEL                        95.1    6e-19   
ref|WP_011429241.1|  molecular chaperone GroEL                        95.1    6e-19   
ref|WP_013564447.1|  molecular chaperone GroeL                        95.1    6e-19   
ref|XP_004506047.1|  PREDICTED: ruBisCO large subunit-binding pro...  95.1    6e-19   
ref|WP_006625833.1|  MULTISPECIES: molecular chaperone GroEL          95.1    6e-19   
ref|WP_023788308.1|  molecular chaperone GroEL                        95.1    6e-19   
gb|EMT15819.1|  putative RuBisCO large subunit-binding protein su...  94.7    6e-19   
gb|AAC68501.1|  chaperonin 60 alpha subunit                           95.1    6e-19   
ref|WP_004162218.1|  molecular chaperone GroEL                        95.1    6e-19   
sp|P08823.1|RUBA_WHEAT  RecName: Full=RuBisCO large subunit-bindi...  94.7    7e-19   
ref|WP_016328316.1|  chaperonin GroL                                  94.7    7e-19   
ref|XP_010109474.1|  RuBisCO large subunit-binding protein subuni...  95.1    7e-19   
ref|WP_013615453.1|  molecular chaperone GroEL                        94.7    7e-19   
ref|WP_040054177.1|  molecular chaperone GroEL                        95.1    7e-19   
ref|XP_011096811.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...  95.1    7e-19   
ref|WP_015119171.1|  chaperonin GroL                                  94.7    7e-19   
ref|WP_039460128.1|  molecular chaperone GroEL                        94.7    7e-19   
ref|WP_026444640.1|  molecular chaperone GroEL                        94.7    7e-19   
emb|CDP07072.1|  unnamed protein product                              94.7    8e-19   
gb|EMS63359.1|  RuBisCO large subunit-binding protein subunit alp...  94.4    8e-19   
ref|XP_003637523.1|  RuBisCO large subunit-binding protein subuni...  94.0    8e-19   
gb|EMT15798.1|  putative RuBisCO large subunit-binding protein su...  94.7    8e-19   
ref|WP_014197822.1|  molecular chaperone GroEL                        94.7    8e-19   
ref|WP_020735365.1|  molecular chaperone GroEL                        94.7    9e-19   
ref|WP_040133927.1|  molecular chaperone GroEL                        94.4    9e-19   
ref|WP_044416099.1|  molecular chaperone GroEL                        94.4    1e-18   
ref|WP_011174077.1|  molecular chaperone GroEL                        94.4    1e-18   
ref|WP_008532224.1|  molecular chaperone GroEL                        94.4    1e-18   
ref|XP_003558045.1|  PREDICTED: ruBisCO large subunit-binding pro...  94.7    1e-18   
ref|WP_038687742.1|  molecular chaperone GroEL                        94.4    1e-18   
emb|CAB65482.1|  chaperonin-60                                        94.4    1e-18   
ref|WP_039618697.1|  molecular chaperone GroEL                        94.4    1e-18   
gb|ABR25547.1|  rubisco large subunit-binding protein subunit alpha   90.9    1e-18   
emb|CDY68896.1|  BnaAnng28680D                                        92.0    1e-18   
ref|WP_013216501.1|  molecular chaperone GroEL                        94.4    1e-18   
ref|WP_012975560.1|  molecular chaperone GroEL                        94.0    1e-18   
dbj|BAJ93636.1|  predicted protein                                    94.4    1e-18   
gb|AFK40829.1|  unknown                                               94.4    1e-18   
ref|WP_014685934.1|  molecular chaperone GroEL                        94.0    1e-18   
ref|WP_011138260.1|  molecular chaperone GroEL                        94.0    1e-18   
gb|ACM22340.1|  60 kDa chaperonin                                     94.0    1e-18   
ref|WP_044564406.1|  molecular chaperone GroEL                        94.0    1e-18   
ref|XP_006827424.1|  PREDICTED: ruBisCO large subunit-binding pro...  94.4    1e-18   
gb|EPS67631.1|  hypothetical protein M569_07141                       94.4    1e-18   
ref|WP_012235413.1|  molecular chaperone GroEL                        94.0    1e-18   
ref|WP_045056055.1|  molecular chaperone GroEL                        94.0    1e-18   
ref|WP_012106636.1|  molecular chaperone GroEL                        94.0    1e-18   
ref|WP_018399554.1|  molecular chaperone GroEL                        94.0    1e-18   
ref|WP_037452017.1|  molecular chaperone GroEL                        94.0    1e-18   
ref|WP_027460258.1|  MULTISPECIES: molecular chaperone GroEL          94.0    1e-18   
ref|WP_010472301.1|  MULTISPECIES: molecular chaperone GroEL          94.0    1e-18   
ref|WP_004081434.1|  molecular chaperone GroEL                        94.0    1e-18   
ref|WP_026873609.1|  molecular chaperone GroEL                        94.0    1e-18   
ref|WP_038066349.1|  MULTISPECIES: molecular chaperone GroEL          94.0    2e-18   
sp|Q9EZV1.1|CH60_THENE  RecName: Full=60 kDa chaperonin; AltName:...  94.0    2e-18   
ref|WP_008192177.1|  MULTISPECIES: molecular chaperone GroEL          94.0    2e-18   
ref|XP_011397597.1|  RuBisCO large subunit-binding protein subuni...  88.2    2e-18   
ref|WP_023076977.1|  chaperonin                                       94.0    2e-18   
ref|WP_018009709.1|  hypothetical protein                             90.1    2e-18   
ref|WP_029519893.1|  MULTISPECIES: molecular chaperone GroEL          93.6    2e-18   
ref|WP_011531346.1|  molecular chaperone GroEL                        93.6    2e-18   
ref|WP_012288165.1|  molecular chaperone GroEL                        93.6    2e-18   
ref|XP_006374694.1|  hypothetical protein POPTR_0015s15270g           93.2    2e-18   
ref|WP_020920769.1|  chaperonin GroEL 2                               93.6    2e-18   
ref|WP_015230198.1|  chaperonin GroL                                  93.6    2e-18   
ref|WP_017715999.1|  molecular chaperone GroEL                        93.6    2e-18   
gb|KEC72719.1|  hypothetical protein RLPCCGM1_c4100                   89.0    2e-18   
ref|WP_011424578.1|  molecular chaperone GroEL                        93.6    2e-18   
ref|WP_037137618.1|  molecular chaperone GroEL                        93.6    2e-18   
ref|WP_029041741.1|  molecular chaperone GroEL                        93.6    2e-18   
ref|WP_016734382.1|  molecular chaperone GroEL                        93.6    2e-18   
ref|WP_042154611.1|  molecular chaperone GroEL                        93.6    2e-18   
ref|WP_026796686.1|  molecular chaperone GroEL                        93.6    2e-18   
ref|WP_017288542.1|  molecular chaperone GroEL                        93.6    2e-18   
ref|WP_006860199.1|  molecular chaperone GroEL                        93.2    2e-18   
ref|WP_024325676.1|  hypothetical protein                             90.5    2e-18   
ref|WP_018062364.1|  molecular chaperone GroEL                        93.2    2e-18   
ref|WP_038048704.1|  molecular chaperone GroEL                        93.2    2e-18   
ref|WP_014162755.1|  molecular chaperone GroEL                        93.2    2e-18   
ref|WP_012653281.1|  molecular chaperone GroEL                        93.2    3e-18   
ref|WP_038036676.1|  molecular chaperone GroEL                        93.2    3e-18   
dbj|BAE71304.1|  putative rubisco subunit binding-protein alpha s...  92.4    3e-18   
ref|WP_018111013.1|  molecular chaperone GroEL                        93.2    3e-18   
ref|WP_038054698.1|  molecular chaperone GroEL                        93.2    3e-18   
ref|WP_034852058.1|  molecular chaperone GroEL                        93.2    3e-18   
ref|WP_040136796.1|  molecular chaperone GroEL                        93.2    3e-18   
ref|XP_011089255.1|  PREDICTED: ruBisCO large subunit-binding pro...  93.2    3e-18   
ref|WP_021998001.1|  molecular chaperone GroEL                        90.5    3e-18   
gb|KEC70093.1|  heat shock protein 60 family chaperone GroEL          88.6    3e-18   
ref|WP_012483160.1|  molecular chaperone GroEL                        92.8    3e-18   
dbj|BAE71302.1|  putative rubisco subunit binding-protein alpha s...  93.2    3e-18   
ref|WP_014242412.1|  molecular chaperone GroEL                        92.8    3e-18   
ref|XP_006365041.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...  93.2    3e-18   
ref|XP_007132293.1|  hypothetical protein PHAVU_011G082600g           93.2    3e-18   
ref|WP_029349472.1|  molecular chaperone GroEL                        92.8    3e-18   
ref|WP_020919601.1|  chaperonin GroEL 4                               92.8    3e-18   
ref|WP_013458370.1|  molecular chaperone GroEL                        92.8    4e-18   
gb|KJB47909.1|  hypothetical protein B456_008G048200                  92.8    4e-18   
ref|WP_028493581.1|  molecular chaperone GroEL                        92.8    4e-18   
gb|KJB47908.1|  hypothetical protein B456_008G048200                  92.8    4e-18   
ref|XP_011000529.1|  PREDICTED: ruBisCO large subunit-binding pro...  92.8    4e-18   
ref|XP_002528171.1|  rubisco subunit binding-protein alpha subuni...  92.8    4e-18   



>ref|XP_007024263.1| TCP-1/cpn60 chaperonin family protein [Theobroma cacao]
 gb|EOY26885.1| TCP-1/cpn60 chaperonin family protein [Theobroma cacao]
Length=608

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA +E LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  464  ATKAAVEEGIVVGGGCTLLRLAAKVDAVRETLDNDEQKVGADIVKRALSYPMKLIAKNAG  523

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI KV S DNP YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  524  VNGSVVIEKVLSSDNPNYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVARTFLTSD  583

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
            A V  IK PE A  GNPM  SG G
Sbjct  584  AVVVDIKEPETAAAGNPMDNSGYG  607



>gb|KJB56809.1| hypothetical protein B456_009G136600 [Gossypium raimondii]
 gb|KJB56810.1| hypothetical protein B456_009G136600 [Gossypium raimondii]
Length=609

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA KE LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  465  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKETLDNDEQKVGADIVKRALSYPMKLIAKNAG  524

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI KV S DNP YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  525  VNGSVVIEKVLSNDNPSYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVARTFLTSD  584

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
            A V  IK PEP   GNPM  SG G
Sbjct  585  AVVVDIKKPEPLPAGNPMDNSGYG  608



>ref|XP_002284134.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Vitis vinifera]
 ref|XP_010654639.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Vitis vinifera]
 emb|CBI36094.3| unnamed protein product [Vitis vinifera]
Length=609

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K+ LD+DE +VGA +VKRALS P KLIA NAG
Sbjct  465  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLDSDEQKVGADIVKRALSYPMKLIAKNAG  524

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI KV S DNP YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  525  VNGSVVIEKVLSSDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVARTFLTSD  584

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
            A V  IK PEP   GNPM  SG G
Sbjct  585  AVVVDIKEPEPIPAGNPMDNSGYG  608



>ref|XP_010942728.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Elaeis guineensis]
Length=608

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA KE L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  464  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKETLENDEQKVGADIVKRALSYPLKLIAKNAG  523

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI KV + DNP YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  524  VNGSVVIEKVLASDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  583

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  +K PEP   GNPM  SG G
Sbjct  584  VVVVDVKEPEPVPAGNPMDNSGYG  607



>ref|XP_004235655.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Solanum lycopersicum]
Length=605

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAV+EGIVVGGGCTLLRLAAKV+  K  LDNDE ++GA +VKRAL  P KLIA NAG
Sbjct  461  ATKAAVDEGIVVGGGCTLLRLAAKVEGIKGTLDNDEQKIGADIVKRALRYPMKLIAKNAG  520

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI KV S DNP YGYNAATG YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  521  VNGSVVIEKVLSNDNPNYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHAASVARTFLTSD  580

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
            A V  IK PEPAV GNPM  SG G
Sbjct  581  AVVTEIKVPEPAVAGNPMDNSGYG  604



>ref|XP_010249575.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Nelumbo nucifera]
Length=609

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K+ L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  465  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKDSLENDEQKVGADIVKRALSYPLKLIAKNAG  524

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+ KV S DNP YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  525  VNGSVVVEKVLSSDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVARTFLTSD  584

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  585  VVVVDIKEPEPVPAGNPMDNSGYG  608



>dbj|BAH20275.1| AT1G55490 [Arabidopsis thaliana]
Length=234

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  90   ATKAAVEEGIVVGGGCTLLRLASKVDAIKATLDNDEEKVGADIVKRALSYPLKLIAKNAG  149

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  +GYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  150  VNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  209

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP  VGNPM  SG G
Sbjct  210  CVVVEIKEPEPVPVGNPMDNSGYG  233



>ref|XP_006343054.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Solanum tuberosum]
Length=605

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAV+EGIVVGGGCTLLRLAAKV+  K  LDNDE ++GA +VKRAL  P KLIA NAG
Sbjct  461  ATKAAVDEGIVVGGGCTLLRLAAKVEDIKGTLDNDEQKIGADIVKRALRYPMKLIAKNAG  520

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI KV S DNP YGYNAATG YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  521  VNGSVVIEKVLSNDNPNYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHAASVARTFLTSD  580

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
            A V  IK PEPAV GNPM  SG G
Sbjct  581  AVVTEIKVPEPAVAGNPMDNSGYG  604



>ref|XP_010254011.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Nelumbo nucifera]
Length=608

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVD+ K+ LD+DE +VGA +VKRALS P KLIA NAG
Sbjct  464  ATKAAVEEGIVVGGGCTLLRLAAKVDSIKDTLDDDEQKVGADIVKRALSYPLKLIAKNAG  523

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI KV S DNP YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  524  VNGSVVIEKVLSSDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVARTFLTSD  583

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  584  VVVVDIKEPEPMPAGNPMDNSGYG  607



>ref|XP_008803228.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Phoenix dactylifera]
Length=608

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAA+VDA KE L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  464  ATKAAVEEGIVVGGGCTLLRLAARVDAIKETLENDEQKVGADIVKRALSYPLKLIAKNAG  523

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI KV + DNP YGYNAATGKYED  A GIIDP K VRCCLE AASVA  FLTSD
Sbjct  524  VNGSVVIEKVLASDNPKYGYNAATGKYEDLMAVGIIDPTKVVRCCLEHAASVAKTFLTSD  583

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  584  VVVVDIKEPEPVPAGNPMDNSGYG  607



>ref|XP_002285746.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Vitis vinifera]
 ref|XP_010651396.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Vitis vinifera]
 emb|CBI16557.3| unnamed protein product [Vitis vinifera]
Length=608

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  464  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLDNDEEKVGADIVKRALSYPLKLIAKNAG  523

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YG+NAATGKYED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  524  VNGSVVSEKVLSSDNPKYGFNAATGKYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  583

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP V GNPM  SG G
Sbjct  584  CVVVEIKEPEPVVAGNPMDNSGYG  607



>ref|XP_009597827.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Nicotiana 
tomentosiformis]
Length=599

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  455  ATKAAVEEGIVVGGGCTLLRLASKVDAIKETLENDEEKVGADIVKRALSYPLKLIAKNAG  514

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP +GYNAATG YED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  515  VNGSVVSEKVLSSDNPKFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  574

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEPAV GNPM  SG G
Sbjct  575  CVVVEIKEPEPAVAGNPMDNSGYG  598



>ref|XP_009790232.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Nicotiana 
sylvestris]
Length=599

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  455  ATKAAVEEGIVVGGGCTLLRLASKVDAIKETLENDEEKVGADIVKRALSYPLKLIAKNAG  514

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP +GYNAATG YED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  515  VNGSVVSEKVLSSDNPKFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  574

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEPAV GNPM  SG G
Sbjct  575  CVVVEIKEPEPAVAGNPMDNSGYG  598



>gb|AFW75264.1| putative TCP-1/cpn60 chaperonin family protein, partial [Zea 
mays]
Length=332

 Score =   179 bits (454),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K+ L+NDE +VGA +V+RALS P KLIA NAG
Sbjct  188  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALSYPLKLIAKNAG  247

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  YGYNAATG+YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  248  VNGSVVTEKVLSNDNFKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  307

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE A + NPM  SG G
Sbjct  308  VVVVDIKEPESAPLANPMDNSGYG  331



>ref|XP_011089709.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Sesamum indicum]
Length=608

 Score =   185 bits (469),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  464  ATKAAVEEGIVVGGGCTLLRLASKVDAIKETLENDEEKVGADIVKRALSYPLKLIAKNAG  523

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YGYNAATG+YED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  524  VNGSVVSEKVLSSDNPKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  583

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP V G PM  SG G
Sbjct  584  CVVVEIKEPEPVVAGTPMDNSGYG  607



>ref|XP_009793336.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Nicotiana sylvestris]
Length=605

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKV+  K  LD+DE ++GA +VKRAL  P KLIA NAG
Sbjct  461  ATKAAVEEGIVVGGGCTLLRLAAKVEDIKGTLDDDEQKIGADIVKRALRYPMKLIAKNAG  520

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI KV S DNP YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  521  VNGSVVIEKVLSNDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVARTFLTSD  580

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
            A V   K PEP V GNPM  SG G
Sbjct  581  AVVTENKEPEPVVAGNPMDNSGYG  604



>gb|KHN23693.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Glycine soja]
Length=546

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVD  K+ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  402  ATKAAVEEGIVVGGGCTLLRLASKVDTIKDSLDNDEEKVGADIVKRALSYPLKLIAKNAG  461

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YGYNAATGKYED  +AGIIDP K VRCCLE AASVA  FL SD
Sbjct  462  VNGSVVSEKVLSSDNPRYGYNAATGKYEDLMSAGIIDPTKVVRCCLEHAASVAKTFLMSD  521

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  522  CVVVEIKEPEPVPAGNPMDNSGYG  545



>dbj|BAD94382.1| RuBisCO subunit binding-protein beta subunit precursor [Arabidopsis 
thaliana]
Length=173

 Score =   172 bits (437),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L NDE +VGA +VK+ALS P KLIA NAG
Sbjct  28   ATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALSYPLKLIAKNAG  87

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP +GYNAATGKYED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  88   VNGSVVSEKVLSSDNPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  147

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  IK PE A   GNPM  SG G
Sbjct  148  CVVVEIKEPESAAPAGNPMDNSGYG  172



>gb|AFW75263.1| putative TCP-1/cpn60 chaperonin family protein, partial [Zea 
mays]
Length=334

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K+ L+NDE +VGA +V+RALS P KLIA NAG
Sbjct  188  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALSYPLKLIAKNAG  247

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  YGYNAATG+YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  248  VNGSVVTEKVLSNDNFKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  307

Query  285  AXVXXIKXPEPAVVGNPMXXSG  220
              V  IK PE A + NPM  SG
Sbjct  308  VVVVDIKEPESAPLANPMDNSG  329



>ref|XP_003546771.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Glycine max]
Length=591

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVD  K+ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  447  ATKAAVEEGIVVGGGCTLLRLASKVDTIKDSLDNDEEKVGADIVKRALSYPLKLIAKNAG  506

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YGYNAATGKYED  +AGIIDP K VRCCLE AASVA  FL SD
Sbjct  507  VNGSVVSEKVLSSDNPRYGYNAATGKYEDLMSAGIIDPTKVVRCCLEHAASVAKTFLMSD  566

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  567  CVVVEIKEPEPVPAGNPMDNSGYG  590



>ref|XP_006838174.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Amborella trichopoda]
 gb|ERN00743.1| hypothetical protein AMTR_s00106p00119930 [Amborella trichopoda]
Length=613

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  L+NDE ++GA +VKRALS P KLIA NAG
Sbjct  469  ATKAAVEEGIVVGGGCTLLRLASKVDAIKGTLENDEQKIGADIVKRALSYPLKLIAKNAG  528

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YGYNAATG YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  529  VNGSVVTEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHAASVARTFLTSD  588

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  589  VVVVDIKEPEPVPAGNPMDNSGYG  612



>ref|XP_009628147.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Nicotiana tomentosiformis]
Length=605

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA KV+  K  LD+DE ++GA +VKRAL  P KLIA NAG
Sbjct  461  ATKAAVEEGIVVGGGCTLLRLATKVEDIKGTLDDDEQKIGADIVKRALRYPMKLIAKNAG  520

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI KV S DNP YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  521  VNGSVVIEKVLSDDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVARTFLTSD  580

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
            A V   K PEP V GNPM  SG G
Sbjct  581  AVVTENKEPEPVVAGNPMDNSGYG  604



>gb|AAT90346.1| RuBisCo subunit binding-protein beta subunit [Zea mays]
Length=409

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K+ L+NDE +VGA +V+RALS P KLIA NAG
Sbjct  265  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALSYPLKLIAKNAG  324

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  YGYNAATG+YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  325  VNGSVVTEKVLSNDNFKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  384

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE   V NPM  SG G
Sbjct  385  VVVVDIKEPEATPVANPMDNSGYG  408



>ref|XP_010920048.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Elaeis guineensis]
 ref|XP_010920049.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Elaeis guineensis]
Length=611

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K+ L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  467  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGADIVKRALSYPLKLIAKNAG  526

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI KV S DN  YGYNAATG YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  527  VNGSVVIEKVLSSDNFKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHAASVARTFLTSD  586

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEPA  GN M  SG G
Sbjct  587  VVVVDIKEPEPAPAGNLMDNSGYG  610



>ref|XP_007014617.1| TCP-1/cpn60 chaperonin family protein [Theobroma cacao]
 gb|EOY32236.1| TCP-1/cpn60 chaperonin family protein [Theobroma cacao]
Length=607

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA++VD+ K+ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  463  ATKAAVEEGIVVGGGCTLLRLASEVDSIKDSLDNDEEKVGADIVKRALSYPLKLIAKNAG  522

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YGYNAATGKYED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  523  VNGSVVSEKVLSSDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  582

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  583  CVVVEIKEPEPVPAGNPMDTSGYG  606



>ref|XP_009376036.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic isoform 
X1 [Pyrus x bretschneideri]
Length=605

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 113/145 (78%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  460  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLDNDEEKVGADIVKRALSYPLKLIAKNAG  519

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YGYNAATG YED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  520  VNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  579

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  IK PEPAV  GNPM  SG G
Sbjct  580  CVVVEIKEPEPAVPAGNPMDNSGYG  604



>pir||JT0902 chaperonin 60 beta - wheat (fragment)
Length=156

 Score =   171 bits (433),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K+ L+NDE +VGA +V+RAL  P KLIA NAG
Sbjct  12   ATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALCYPLKLIAKNAG  71

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  +GYNAATGKYED  AAGIIDP K V CCLE AASVA  FLTSD
Sbjct  72   VNGSVVTEKVLSNDNFKFGYNAATGKYEDLMAAGIIDPTKVVTCCLEHAASVAKTFLTSD  131

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE A + NPM  SG G
Sbjct  132  VVVVEIKEPEAAPLANPMDNSGFG  155



>ref|XP_008351333.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Malus 
domestica]
 ref|XP_008351340.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Malus 
domestica]
Length=604

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 113/145 (78%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  459  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLDNDEEKVGADIVKRALSYPLKLIAKNAG  518

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YGYNAATG YED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  519  VNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  578

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  IK PEPAV  GNPM  SG G
Sbjct  579  CVVVEIKEPEPAVPAGNPMDNSGYG  603



>ref|XP_009392770.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=612

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  468  ATKAAVEEGIVVGGGCTLLRLASKVDAIKETLDNDEQKVGADIVKRALSYPLKLIAKNAG  527

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV + D+  YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  528  VNGSVVTEKVLANDSFKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  587

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  588  VVVVDIKEPEPVPAGNPMDNSGYG  611



>ref|XP_010920050.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X2 [Elaeis guineensis]
Length=604

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K+ L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  460  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGADIVKRALSYPLKLIAKNAG  519

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI KV S DN  YGYNAATG YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  520  VNGSVVIEKVLSSDNFKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHAASVARTFLTSD  579

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEPA  GN M  SG G
Sbjct  580  VVVVDIKEPEPAPAGNLMDNSGYG  603



>ref|XP_006655715.1| PREDICTED: chaperonin 60 subunit beta 1, chloroplastic-like [Oryza 
brachyantha]
Length=601

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAA+VDA K+ L+NDE +VGA +V+RALS P KLIA NAG
Sbjct  457  ATKAAVEEGIVVGGGCTLLRLAARVDAIKDTLENDEQKVGAEIVRRALSYPLKLIAKNAG  516

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  YGYNAATG+YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  517  VNGSVVTEKVLSNDNFKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  576

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEPA V NPM  SG G
Sbjct  577  VVVVEIKEPEPAPVTNPMDNSGYG  600



>ref|XP_009376045.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic isoform 
X2 [Pyrus x bretschneideri]
Length=605

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 113/145 (78%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  460  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLDNDEEKVGADIVKRALSYPLKLIAKNAG  519

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YGYNAATG YED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  520  VNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  579

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  IK PEPAV  GNPM  SG G
Sbjct  580  CVVVEIKEPEPAVPAGNPMDNSGYG  604



>ref|XP_008809220.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Phoenix dactylifera]
Length=612

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K+ L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  468  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGADIVKRALSYPLKLIAKNAG  527

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI KV S DN  +GYNAATG YED  A+GIIDP K VRCCLE AASVA  FLTSD
Sbjct  528  VNGSVVIEKVLSSDNFKFGYNAATGNYEDLMASGIIDPTKVVRCCLEHAASVARTFLTSD  587

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  588  VVVVDIKEPEPVPAGNPMDNSGYG  611



>sp|P08927.2|RUBB_PEA RecName: Full=RuBisCO large subunit-binding protein subunit beta, 
chloroplastic; AltName: Full=60 kDa chaperonin subunit 
beta; AltName: Full=CPN-60 beta; Flags: Precursor [Pisum sativum]
 gb|AAA66365.1| chaperonin precursor [Pisum sativum]
Length=595

 Score =   181 bits (460),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ L NDE +VGA +VKRALS P KLIA NAG
Sbjct  450  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLANDEEKVGADIVKRALSYPLKLIAKNAG  509

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YGYNAATGKYED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  510  VNGSVVSEKVLSSDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  569

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE A VGNPM  SG G
Sbjct  570  CVVVEIKEPESAPVGNPMDNSGYG  593



>gb|KHN26774.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Glycine soja]
Length=546

 Score =   181 bits (458),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  402  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDSLDNDEEKVGADIVKRALSYPLKLIAKNAG  461

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YGYNAATGKYED  +AGIIDP K VRCCLE AASVA  FL SD
Sbjct  462  VNGSVVSEKVLSSDNPRYGYNAATGKYEDLMSAGIIDPTKVVRCCLEHAASVAKTFLMSD  521

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE    GNPM  SG G
Sbjct  522  CVVVEIKEPEAIPAGNPMDNSGYG  545



>gb|ABK24483.1| unknown [Picea sitchensis]
Length=617

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGC LLRLA+KVDA ++ L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  473  ATKAAVEEGIVVGGGCALLRLASKVDAIRDTLENDEQKVGAGIVKRALSYPLKLIAKNAG  532

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+ KV S D+P YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  533  VNGSVVVEKVLSSDDPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  592

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEPA   NPM  SG G
Sbjct  593  VVVVDIKEPEPAASPNPMDNSGYG  616



>ref|XP_004498949.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Cicer arietinum]
Length=592

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ L NDE +VGA +VKRALS P KLIA NAG
Sbjct  448  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLANDEEKVGADIVKRALSYPLKLIAKNAG  507

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  YGYNAATGKYED  +AGIIDP K VRCCLE AASVA  FL SD
Sbjct  508  VNGSVVSEKVLSNDNTRYGYNAATGKYEDLMSAGIIDPTKVVRCCLEHAASVAKTFLMSD  567

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP V GNPM  SG G
Sbjct  568  CVVVEIKEPEPVVAGNPMDNSGYG  591



>ref|XP_003531529.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Glycine max]
Length=592

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  448  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDSLDNDEEKVGADIVKRALSYPLKLIAKNAG  507

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YGYNAATGKYED  +AGIIDP K VRCCLE AASVA  FL SD
Sbjct  508  VNGSVVSEKVLSSDNPRYGYNAATGKYEDLMSAGIIDPTKVVRCCLEHAASVAKTFLMSD  567

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE    GNPM  SG G
Sbjct  568  CVVVEIKEPEAIPAGNPMDNSGYG  591



>ref|XP_009339195.1| PREDICTED: LOW QUALITY PROTEIN: ruBisCO large subunit-binding 
protein subunit beta, chloroplastic-like [Pyrus x bretschneideri]
Length=607

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 113/145 (78%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ LDNDE +VGA +V+RALS P KLIA NAG
Sbjct  462  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLDNDEEKVGADIVRRALSYPLKLIAKNAG  521

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YGYNAATG YED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  522  VNGSVVSEKVLSNDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  581

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  IK PEPAV  GNPM  SG G
Sbjct  582  CVVVEIKEPEPAVPAGNPMDNSGYG  606



>ref|XP_012080824.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Jatropha 
curcas]
 ref|XP_012080825.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Jatropha 
curcas]
 gb|KDP30625.1| hypothetical protein JCGZ_16190 [Jatropha curcas]
Length=605

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  461  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLDNDEEKVGADIVKRALSYPLKLIAKNAG  520

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP +GYNAATG YED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  521  VNGSVVSEKVLSSDNPKFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  580

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  581  CVVVEIKEPEPVPAGNPMDNSGYG  604



>ref|XP_002894506.1| CPN60B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70765.1| CPN60B [Arabidopsis lyrata subsp. lyrata]
Length=600

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  456  ATKAAVEEGIVVGGGCTLLRLASKVDAIKATLDNDEEKVGADIVKRALSYPLKLIAKNAG  515

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  +GYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  516  VNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  575

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP  VGNPM  SG G
Sbjct  576  CVVVEIKEPEPVPVGNPMDNSGYG  599



>ref|XP_008659370.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X2 [Zea mays]
 ref|XP_008659372.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X2 [Zea mays]
 ref|XP_008659373.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X2 [Zea mays]
 gb|ACN28096.1| unknown [Zea mays]
 gb|ACN28325.1| unknown [Zea mays]
 gb|AFW86139.1| putative TCP-1/cpn60 chaperonin family protein isoform 1 [Zea 
mays]
 gb|AFW86140.1| putative TCP-1/cpn60 chaperonin family protein isoform 2 [Zea 
mays]
 gb|AFW86141.1| putative TCP-1/cpn60 chaperonin family protein isoform 3 [Zea 
mays]
Length=579

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K+ L+NDE +VGA +V+RALS P KLIA NAG
Sbjct  435  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALSYPLKLIAKNAG  494

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  YGYNAATG+YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  495  VNGSVVTEKVLSNDNFKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  554

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE A V NPM  SG G
Sbjct  555  VVVVDIKEPEAAPVANPMDNSGYG  578



>ref|XP_010501159.1| PREDICTED: chaperonin 60 subunit beta 1, chloroplastic-like [Camelina 
sativa]
Length=600

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  456  ATKAAVEEGIVVGGGCTLLRLASKVDAIKATLDNDEEKVGADIVKRALSYPLKLIAKNAG  515

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  +GYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  516  VNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  575

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP  VGNPM  SG G
Sbjct  576  CVVVEIKEPEPVPVGNPMDNSGYG  599



>ref|NP_001056601.1| Os06g0114000 [Oryza sativa Japonica Group]
 dbj|BAA92724.1| putative chaperonin 60 beta precursor [Oryza sativa Japonica 
Group]
 dbj|BAF18515.1| Os06g0114000 [Oryza sativa Japonica Group]
 gb|ABY52934.1| RuBisCo subunit binding-protein beta subunit [Oryza sativa Japonica 
Group]
 dbj|BAG95015.1| unnamed protein product [Oryza sativa Japonica Group]
Length=601

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAA+VDA K+ L+NDE +VGA +V+RALS P KLIA NAG
Sbjct  457  ATKAAVEEGIVVGGGCTLLRLAARVDAIKDNLENDEQKVGAEIVRRALSYPLKLIAKNAG  516

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  +GYNAATG+YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  517  VNGSVVTEKVLSNDNFKFGYNAATGQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  576

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEPA V NPM  SG G
Sbjct  577  VVVVEIKEPEPAPVTNPMDNSGYG  600



>ref|XP_009106876.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Brassica rapa]
Length=600

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  456  ATKAAVEEGIVVGGGCTLLRLASKVDAIKAALDNDEEKVGADIVKRALSYPLKLIAKNAG  515

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  +GYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  516  VNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  575

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP  VGNPM  SG G
Sbjct  576  CVVVEIKEPEPVPVGNPMDNSGYG  599



>gb|KJB73253.1| hypothetical protein B456_011G224500 [Gossypium raimondii]
 gb|KJB73254.1| hypothetical protein B456_011G224500 [Gossypium raimondii]
 gb|KJB73255.1| hypothetical protein B456_011G224500 [Gossypium raimondii]
 gb|KJB73256.1| hypothetical protein B456_011G224500 [Gossypium raimondii]
 gb|KJB73261.1| hypothetical protein B456_011G224500 [Gossypium raimondii]
Length=607

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  463  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDSLDNDEEKVGADIVKRALSYPLKLIAKNAG  522

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YG+NAATG YED  +AGIIDP K VRCCLE AASVA  FL SD
Sbjct  523  VNGSVVSEKVLSNDNPRYGFNAATGNYEDLMSAGIIDPTKVVRCCLEHAASVAKTFLMSD  582

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  583  CVVVEIKEPEPVPAGNPMDNSGYG  606



>ref|XP_008659369.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Zea mays]
 gb|ACN34709.1| unknown [Zea mays]
 gb|AFW86138.1| putative TCP-1/cpn60 chaperonin family protein [Zea mays]
Length=600

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K+ L+NDE +VGA +V+RALS P KLIA NAG
Sbjct  456  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALSYPLKLIAKNAG  515

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  YGYNAATG+YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  516  VNGSVVTEKVLSNDNFKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  575

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE A V NPM  SG G
Sbjct  576  VVVVDIKEPEAAPVANPMDNSGYG  599



>ref|NP_175945.1| chaperonin 60 subunit beta 1 [Arabidopsis thaliana]
 ref|NP_849811.1| chaperonin 60 subunit beta 1 [Arabidopsis thaliana]
 sp|P21240.3|CPNB1_ARATH RecName: Full=Chaperonin 60 subunit beta 1, chloroplastic; Short=CPN-60 
beta 1; AltName: Full=60 kDa chaperonin subunit beta 
1; AltName: Full=RuBisCO large subunit-binding protein subunit 
beta, chloroplastic; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK62390.1|AF386945_1 Rubisco subunit binding-protein beta subunit [Arabidopsis thaliana]
 gb|AAD10647.1| Rubisco subunit binding-protein beta subunit [Arabidopsis thaliana]
 gb|AAM10063.1| Rubisco subunit binding-protein beta subunit [Arabidopsis thaliana]
 dbj|BAH19596.1| AT1G55490 [Arabidopsis thaliana]
 gb|AEE33251.1| chaperonin 60 subunit beta 1 [Arabidopsis thaliana]
 gb|AEE33252.1| chaperonin 60 subunit beta 1 [Arabidopsis thaliana]
Length=600

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  456  ATKAAVEEGIVVGGGCTLLRLASKVDAIKATLDNDEEKVGADIVKRALSYPLKLIAKNAG  515

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  +GYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  516  VNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  575

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP  VGNPM  SG G
Sbjct  576  CVVVEIKEPEPVPVGNPMDNSGYG  599



>gb|KJB73260.1| hypothetical protein B456_011G224500 [Gossypium raimondii]
Length=610

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  466  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDSLDNDEEKVGADIVKRALSYPLKLIAKNAG  525

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YG+NAATG YED  +AGIIDP K VRCCLE AASVA  FL SD
Sbjct  526  VNGSVVSEKVLSNDNPRYGFNAATGNYEDLMSAGIIDPTKVVRCCLEHAASVAKTFLMSD  585

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  586  CVVVEIKEPEPVPAGNPMDNSGYG  609



>ref|XP_010480083.1| PREDICTED: chaperonin 60 subunit beta 1, chloroplastic-like [Camelina 
sativa]
Length=600

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  456  ATKAAVEEGIVVGGGCTLLRLASKVDAIKATLDNDEEKVGADIVKRALSYPLKLIAKNAG  515

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  +GYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  516  VNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  575

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP  VGNPM  SG G
Sbjct  576  CVVVEIKEPEPVPVGNPMDNSGYG  599



>ref|XP_009418590.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=612

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  468  ATKAAVEEGIVVGGGCTLLRLASKVDAIKETLDNDEQKVGADIVKRALSYPLKLIAKNAG  527

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S +N  +GYNAATGKYED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  528  VNGSVVTEKVLSNENFKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  587

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE    GNPM  SG G
Sbjct  588  VVVVDIKEPETLPAGNPMDNSGYG  611



>ref|XP_006307049.1| hypothetical protein CARUB_v10008637mg [Capsella rubella]
 gb|EOA39947.1| hypothetical protein CARUB_v10008637mg [Capsella rubella]
Length=600

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  456  ATKAAVEEGIVVGGGCTLLRLASKVDAIKATLDNDEEKVGADIVKRALSYPLKLIAKNAG  515

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  +GYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  516  VNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  575

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP  VGNPM  SG G
Sbjct  576  CVVVEIKEPEPVPVGNPMDNSGYG  599



>ref|XP_010462399.1| PREDICTED: chaperonin 60 subunit beta 1, chloroplastic [Camelina 
sativa]
Length=600

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  456  ATKAAVEEGIVVGGGCTLLRLASKVDAIKATLDNDEEKVGADIVKRALSYPLKLIAKNAG  515

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  +GYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  516  VNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  575

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP  VGNPM  SG G
Sbjct  576  CVVVEIKEPEPVPVGNPMDNSGYG  599



>ref|XP_008384375.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Malus domestica]
 ref|XP_008384376.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Malus domestica]
Length=605

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 112/145 (77%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVD  K+ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  460  ATKAAVEEGIVVGGGCTLLRLASKVDTIKDTLDNDEEKVGADIVKRALSYPLKLIAKNAG  519

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YGYNAATG YED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  520  VNGSVVSEKVLSNDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  579

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  IK PEPAV  GNPM  SG G
Sbjct  580  CVVVEIKEPEPAVPAGNPMDNSGYG  604



>ref|XP_010552318.1| PREDICTED: chaperonin 60 subunit beta 1, chloroplastic [Tarenaya 
hassleriana]
Length=595

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRL++KVDA K+ L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  451  ATKAAVEEGIVVGGGCTLLRLSSKVDAIKDTLENDEEKVGADIVKRALSYPLKLIAKNAG  510

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP +GYNAATGKYED  +AGIIDP K VRCCLE AASVA  FL SD
Sbjct  511  VNGSVVSEKVLSNDNPRFGYNAATGKYEDLMSAGIIDPTKVVRCCLEHAASVAKTFLMSD  570

Query  285  AXVXXIKXPEPAVVGNPMXXSG  220
              V  IK PEP  VGNPM  SG
Sbjct  571  CVVVEIKEPEPVPVGNPMDNSG  592



>gb|KJB73258.1| hypothetical protein B456_011G224500 [Gossypium raimondii]
Length=599

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  455  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDSLDNDEEKVGADIVKRALSYPLKLIAKNAG  514

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YG+NAATG YED  +AGIIDP K VRCCLE AASVA  FL SD
Sbjct  515  VNGSVVSEKVLSNDNPRYGFNAATGNYEDLMSAGIIDPTKVVRCCLEHAASVAKTFLMSD  574

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  575  CVVVEIKEPEPVPAGNPMDNSGYG  598



>gb|EEE64974.1| hypothetical protein OsJ_19883 [Oryza sativa Japonica Group]
Length=588

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAA+VDA K+ L+NDE +VGA +V+RALS P KLIA NAG
Sbjct  444  ATKAAVEEGIVVGGGCTLLRLAARVDAIKDNLENDEQKVGAEIVRRALSYPLKLIAKNAG  503

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  +GYNAATG+YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  504  VNGSVVTEKVLSNDNFKFGYNAATGQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  563

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEPA V NPM  SG G
Sbjct  564  VVVVEIKEPEPAPVTNPMDNSGYG  587



>gb|KDO54474.1| hypothetical protein CISIN_1g007313mg [Citrus sinensis]
Length=413

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRL++KVDA KE LDNDE +VGA +VKRAL  P KLIA NAG
Sbjct  268  ATKAAVEEGIVVGGGCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALCYPLKLIAKNAG  327

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  YGYNAATG YED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  328  VNGSVVSEKVLSSDNHKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  387

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  IK PEPA+  GNPM  SG G
Sbjct  388  CVVVEIKEPEPAMPAGNPMDNSGYG  412



>ref|XP_001754999.1| predicted protein [Physcomitrella patens]
 gb|EDQ80453.1| predicted protein [Physcomitrella patens]
Length=604

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE LDNDE +VGA +VKRAL  P KLIA NAG
Sbjct  460  ATKAAVEEGIVVGGGCTLLRLASKVDAIKESLDNDEQKVGADIVKRALCYPLKLIAKNAG  519

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+ KV + +N  +GYNAATG YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  520  VNGSVVVEKVLANENSSFGYNAATGVYEDLMAAGIIDPAKVVRCCLEHAASVAKIFLTSD  579

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  580  VVVTEIKEPEPVQAGNPMDASGYG  603



>ref|XP_001780334.1| predicted protein [Physcomitrella patens]
 gb|EDQ54893.1| predicted protein [Physcomitrella patens]
Length=604

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA++VDA K+ LDNDE +VG+ +V+RALS P KLIA NAG
Sbjct  460  ATKAAVEEGIVVGGGCTLLRLASQVDAIKDTLDNDEQKVGSEIVRRALSYPLKLIAKNAG  519

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+ KV + +NP +GYNAATG+Y+D  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  520  VNGSVVVEKVLANENPAFGYNAATGEYQDLMAAGIIDPAKVVRCCLEHAASVAKIFLTSD  579

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  580  VVVTEIKEPEPVPAGNPMDASGYG  603



>ref|XP_008221851.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Prunus mume]
Length=605

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 112/145 (77%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  460  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLDNDEEKVGADIVKRALSYPLKLIAKNAG  519

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YGYNAATG YED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  520  VNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  579

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  IK PE AV  GNPM  SG G
Sbjct  580  CVVVEIKEPEAAVPAGNPMDNSGYG  604



>ref|XP_010909417.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Elaeis guineensis]
Length=608

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L++DE +VGA +V+RALS P KLIA NAG
Sbjct  464  ATKAAVEEGIVVGGGCTLLRLASKVDAIKETLEDDEQKVGAEIVRRALSYPLKLIAKNAG  523

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV + DN  YGYNAATGKYED  A GIIDP K VRCCLE AASVA  FLTSD
Sbjct  524  VNGSVVTEKVLASDNLKYGYNAATGKYEDLMAVGIIDPTKVVRCCLEHAASVAKTFLTSD  583

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  584  VVVVDIKEPEPVPAGNPMDNSGYG  607



>ref|XP_010044926.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Eucalyptus 
grandis]
 gb|KCW87050.1| hypothetical protein EUGRSUZ_B03593 [Eucalyptus grandis]
Length=608

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  464  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLENDEEKVGADIVKRALSYPLKLIAKNAG  523

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  K+ S DNP YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  524  VNGSVVSEKILSNDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  583

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE    GNPM  SG G
Sbjct  584  CVVVEIKEPEAVPAGNPMDNSGYG  607



>gb|EYU32832.1| hypothetical protein MIMGU_mgv1a003115mg [Erythranthe guttata]
Length=607

 Score =   179 bits (454),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  L NDE +VGA +VKRALS P KLIA NAG
Sbjct  463  ATKAAVEEGIVVGGGCTLLRLASKVDAIKATLANDEEKVGADIVKRALSYPLKLIAKNAG  522

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YGYNAATG YED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  523  VNGSVVSEKVLSSDNPKYGYNAATGVYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  582

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEPAV G PM  SG G
Sbjct  583  CVVVEIKEPEPAVTGTPMDNSGYG  606



>ref|XP_008648746.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Zea mays]
Length=623

 Score =   179 bits (454),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K+ L+NDE +VGA +V+RALS P KLIA NAG
Sbjct  479  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALSYPLKLIAKNAG  538

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  YGYNAATG+YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  539  VNGSVVTEKVLSNDNFKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  598

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE A + NPM  SG G
Sbjct  599  VVVVDIKEPESAPLANPMDNSGYG  622



>ref|XP_004144069.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Cucumis sativus]
 gb|KGN66351.1| hypothetical protein Csa_1G599450 [Cucumis sativus]
Length=608

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE  +NDE +VGA +VKRALS P KLIA NAG
Sbjct  464  ATKAAVEEGIVVGGGCTLLRLASKVDAIKETFENDEEKVGADIVKRALSYPLKLIAKNAG  523

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  YGYNAATG YED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  524  VNGSVVSEKVLSSDNYRYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  583

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  584  CVVVEIKEPEPVPAGNPMDNSGYG  607



>emb|CDY02438.1| BnaA08g00450D [Brassica napus]
Length=697

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  545  ATKAAVEEGIVVGGGCTLLRLASKVDAIKAALDNDEEKVGADIVKRALSYPLKLIAKNAG  604

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  +GYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  605  VNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  664

Query  285  AXVXXIKXPEPAVVGNPMXXSG  220
              V  IK PEP  VGNPM  SG
Sbjct  665  CVVVEIKEPEPVPVGNPMDNSG  686



>ref|XP_008451008.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Cucumis melo]
Length=608

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE  +NDE +VGA +VKRALS P KLIA NAG
Sbjct  464  ATKAAVEEGIVVGGGCTLLRLASKVDAIKESFENDEEKVGADIVKRALSYPLKLIAKNAG  523

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  YGYNAATG YED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  524  VNGSVVSEKVLSSDNYRYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  583

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  584  CVVVEIKEPEPVPAGNPMDNSGYG  607



>ref|XP_010536825.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic [Tarenaya 
hassleriana]
 ref|XP_010536826.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic [Tarenaya 
hassleriana]
 ref|XP_010536827.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic [Tarenaya 
hassleriana]
Length=606

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L+NDE RVGA +VK+ALS P KLIA NAG
Sbjct  462  ATKAAVEEGIVVGGGCTLLRLASKVDAIKENLENDEERVGAEIVKKALSYPLKLIAKNAG  521

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV + DNP YGYNAA GKYED  A GIIDP K VRCCLE A+SVA  FL SD
Sbjct  522  VNGSVVSEKVLASDNPKYGYNAAIGKYEDLMAVGIIDPTKVVRCCLEHASSVAKTFLMSD  581

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  582  CVVVEIKEPEPLPAGNPMDNSGYG  605



>ref|XP_006392634.1| hypothetical protein EUTSA_v10011330mg [Eutrema salsugineum]
 gb|ESQ29920.1| hypothetical protein EUTSA_v10011330mg [Eutrema salsugineum]
Length=600

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  456  ATKAAVEEGIVVGGGCTLLRLASKVDAIKASLENDEEKVGADIVKRALSYPLKLIAKNAG  515

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  516  VNGSVVSEKVLSNDNVKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  575

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  576  CVVVEIKEPEPVPAGNPMDNSGYG  599



>ref|XP_008813152.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like isoform X2 [Phoenix dactylifera]
Length=601

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGC+LLRLA+KVDA KE L+NDE +VGA +V+RALS P KLIA NAG
Sbjct  457  ATKAAVEEGIVVGGGCSLLRLASKVDAIKETLENDEQKVGAEIVRRALSYPLKLIAKNAG  516

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI KV + DN   GYNAATG YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  517  VNGSVVIEKVLASDNLKIGYNAATGNYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  576

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  577  VVVVDIKEPEPVPAGNPMDNSGYG  600



>ref|XP_002523404.1| rubisco subunit binding-protein beta subunit, rubb, putative 
[Ricinus communis]
 gb|EEF38983.1| rubisco subunit binding-protein beta subunit, rubb, putative 
[Ricinus communis]
Length=605

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  461  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDSLDNDEEKVGADIVKRALSYPLKLIAKNAG  520

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP +GYNAATG YED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  521  VNGSVVSEKVLSSDNPRFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  580

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE    GNPM  SG G
Sbjct  581  CVVVEIKEPEAVPAGNPMDNSGYG  604



>ref|XP_004228946.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Solanum lycopersicum]
Length=599

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K  L NDE +VGA +VKRALS P KLIA NAG
Sbjct  455  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKGTLANDEEKVGADIVKRALSYPLKLIAKNAG  514

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S D+P +GYNAATG YED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  515  VNGSVVSEKVLSSDDPKFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  574

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE AV GNPM  SG G
Sbjct  575  CVVVEIKEPEAAVAGNPMDNSGYG  598



>ref|NP_001275097.1| chaperonin-60 beta subunit [Solanum tuberosum]
 gb|AAB39827.1| chaperonin-60 beta subunit [Solanum tuberosum]
Length=599

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K  L NDE +VGA +VKRALS P KLIA NAG
Sbjct  455  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKGTLANDEEKVGADIVKRALSYPLKLIAKNAG  514

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S D+P +GYNAATG YED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  515  VNGSVVSEKVLSSDDPKFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  574

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE AV GNPM  SG G
Sbjct  575  CVVVEIKEPEAAVAGNPMDNSGYG  598



>ref|XP_008813151.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like isoform X1 [Phoenix dactylifera]
Length=608

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGC+LLRLA+KVDA KE L+NDE +VGA +V+RALS P KLIA NAG
Sbjct  464  ATKAAVEEGIVVGGGCSLLRLASKVDAIKETLENDEQKVGAEIVRRALSYPLKLIAKNAG  523

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI KV + DN   GYNAATG YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  524  VNGSVVIEKVLASDNLKIGYNAATGNYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  583

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  584  VVVVDIKEPEPVPAGNPMDNSGYG  607



>ref|XP_007208310.1| hypothetical protein PRUPE_ppa003093mg [Prunus persica]
 gb|EMJ09509.1| hypothetical protein PRUPE_ppa003093mg [Prunus persica]
Length=605

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  460  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLDNDEEKVGADIVKRALSYPLKLIAKNAG  519

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YGYNAATG YED  A GIIDP K VRCCLE A+SVA  FL SD
Sbjct  520  VNGSVVSEKVLSSDNPKYGYNAATGNYEDLMAVGIIDPTKVVRCCLEHASSVAKTFLMSD  579

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  IK PE AV  GNPM  SG G
Sbjct  580  CVVVEIKEPEAAVPAGNPMDNSGYG  604



>ref|XP_006407212.1| hypothetical protein EUTSA_v10020346mg [Eutrema salsugineum]
 gb|ESQ48665.1| hypothetical protein EUTSA_v10020346mg [Eutrema salsugineum]
Length=596

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAV EGIVVGGGCTLLRLAAKVDA K+ L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  452  ATKAAVAEGIVVGGGCTLLRLAAKVDAIKDTLENDEEKVGAEIVKRALSYPLKLIAKNAG  511

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV + DN  +GYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  512  VNGSVVSEKVLANDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  571

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  572  CVVVEIKEPEPVPAGNPMDNSGYG  595



>ref|XP_004964341.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic-like isoform 
X2 [Setaria italica]
Length=579

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K+ L+NDE +VGA +V+RALS P KLIA NAG
Sbjct  435  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALSYPLKLIAKNAG  494

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S +N  YGYNAATG+YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  495  VNGSVVTEKVLSNENFKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  554

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE A + NPM  SG G
Sbjct  555  VVVVEIKEPEAAPLTNPMDNSGYG  578



>ref|XP_002437709.1| hypothetical protein SORBIDRAFT_10g001120 [Sorghum bicolor]
 gb|EER89076.1| hypothetical protein SORBIDRAFT_10g001120 [Sorghum bicolor]
Length=579

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K+ L+NDE +VGA +V+RALS P KLIA NAG
Sbjct  435  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALSYPLKLIAKNAG  494

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  YGYNAATG++ED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  495  VNGSVVTEKVLSNDNFKYGYNAATGQHEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  554

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE A + NPM  SG G
Sbjct  555  VVVVDIKEPEAAPLANPMDNSGYG  578



>ref|XP_003557154.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Brachypodium distachyon]
Length=599

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K+ L+N+E +VGA +V+RAL  P KLIA NAG
Sbjct  455  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENEEQKVGAEIVRRALCYPLKLIAKNAG  514

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  +GYNAATG+YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  515  VNGSVVTEKVLSNDNVKFGYNAATGQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  574

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEPA + NPM  SG G
Sbjct  575  VVVVEIKEPEPAPLANPMDNSGFG  598



>ref|XP_004964340.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic-like isoform 
X1 [Setaria italica]
Length=598

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K+ L+NDE +VGA +V+RALS P KLIA NAG
Sbjct  454  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALSYPLKLIAKNAG  513

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S +N  YGYNAATG+YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  514  VNGSVVTEKVLSNENFKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  573

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE A + NPM  SG G
Sbjct  574  VVVVEIKEPEAAPLTNPMDNSGYG  597



>sp|Q43831.1|RUBB_SECCE RecName: Full=RuBisCO large subunit-binding protein subunit beta, 
chloroplastic; AltName: Full=60 kDa chaperonin subunit 
beta; AltName: Full=CPN-60 beta, partial [Secale cereale]
 emb|CAA93139.1| chaperonin [Secale cereale]
Length=499

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K+ L+NDE +VGA +V+RAL  P KLIA NAG
Sbjct  355  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLENDEQKVGAEIVRRALCYPLKLIAKNAG  414

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  +GYNAATG+YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  415  VNGSVVTEKVLSNDNFKFGYNAATGQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  474

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE A + NPM  SG G
Sbjct  475  VVVVEIKEPEAAPLANPMDNSGFG  498



>emb|CDY26100.1| BnaC06g10960D [Brassica napus]
Length=628

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  456  ATKAAVEEGIVVGGGCTLLRLASKVDAIKAALENDEEKVGADIVKRALSYPLKLIAKNAG  515

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S +N  YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  516  VNGSVVSEKVLSNENVKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  575

Query  285  AXVXXIKXPEPAVVGNPMXXSG  220
              V  IK PEP  VGNPM  SG
Sbjct  576  CVVVEIKEPEPVPVGNPMDNSG  597



>gb|KDO54471.1| hypothetical protein CISIN_1g007313mg [Citrus sinensis]
Length=595

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRL++KVDA KE LDNDE +VGA +VKRAL  P KLIA NAG
Sbjct  450  ATKAAVEEGIVVGGGCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALCYPLKLIAKNAG  509

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  YGYNAATG YED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  510  VNGSVVSEKVLSSDNHKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  569

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  IK PEPA+  GNPM  SG G
Sbjct  570  CVVVEIKEPEPAMPAGNPMDNSGYG  594



>ref|XP_009103725.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Brassica rapa]
Length=600

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  456  ATKAAVEEGIVVGGGCTLLRLASKVDAIKATLENDEEKVGADIVKRALSYPLKLIAKNAG  515

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S +N  YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  516  VNGSVVSEKVLSNENVKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  575

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  576  CVVVEIKEPEPVPAGNPMDNSGYG  599



>emb|CDY08245.1| BnaA05g13740D [Brassica napus]
Length=600

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  456  ATKAAVEEGIVVGGGCTLLRLASKVDAIKATLENDEEKVGADIVKRALSYPLKLIAKNAG  515

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S +N  YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  516  VNGSVVSEKVLSNENVKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  575

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  576  CVVVEIKEPEPVPAGNPMDNSGYG  599



>ref|XP_006445574.1| hypothetical protein CICLE_v10014640mg [Citrus clementina]
 ref|XP_006488950.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic-like [Citrus 
sinensis]
 gb|ESR58814.1| hypothetical protein CICLE_v10014640mg [Citrus clementina]
 gb|KDO54473.1| hypothetical protein CISIN_1g007313mg [Citrus sinensis]
Length=608

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRL++KVDA KE LDNDE +VGA +VKRAL  P KLIA NAG
Sbjct  463  ATKAAVEEGIVVGGGCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALCYPLKLIAKNAG  522

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  YGYNAATG YED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  523  VNGSVVSEKVLSSDNHKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  582

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  IK PEPA+  GNPM  SG G
Sbjct  583  CVVVEIKEPEPAMPAGNPMDNSGYG  607



>ref|XP_009135307.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Brassica 
rapa]
Length=590

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAV EGIVVGGGCTLLRLAAKVDA K+ L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  446  ATKAAVAEGIVVGGGCTLLRLAAKVDAIKDTLENDEEKVGAEIVKRALSYPLKLIAKNAG  505

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV + DN  +GYNAATGKYED   AGIIDP K VRCCLE AASVA  FL SD
Sbjct  506  VNGSVVSEKVLANDNVKFGYNAATGKYEDLMVAGIIDPTKVVRCCLEHAASVAKTFLMSD  565

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  566  CVVVEIKEPEPVPAGNPMDNSGYG  589



>ref|XP_004294947.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=601

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  LDNDE +VGA +VKRAL  P KLIA NAG
Sbjct  457  ATKAAVEEGIVVGGGCTLLRLASKVDAIKNSLDNDEEKVGADIVKRALCYPLKLIAKNAG  516

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  YGYNAATG YED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  517  VNGSVVSEKVLSSDNFKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  576

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  577  CVVVEIKEPEPVPAGNPMDNSGYG  600



>emb|CDY10557.1| BnaC03g70570D [Brassica napus]
Length=829

 Score =   177 bits (450),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  684  ATKAAVEEGIVVGGGCTLLRLASKVDAIKAALDNDEEKVGADIVKRALSYPLKLIAKNAG  743

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  +GYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  744  VNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  803

Query  285  AXVXXIKXPEPAVVGNPMXXSG  220
              V  IK PEP  VGNPM  SG
Sbjct  804  CVVVEIKEPEPVPVGNPMDNSG  825



>ref|XP_002303983.1| chaperonin precursor family protein [Populus trichocarpa]
 gb|EEE78962.1| chaperonin precursor family protein [Populus trichocarpa]
Length=607

 Score =   176 bits (446),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  463  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDSLENDEEKVGADIVKRALSYPLKLIAKNAG  522

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP +GYNAATG YED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  523  VNGSVVSEKVLSTDNPKFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  582

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE    GNPM  SG G
Sbjct  583  CVVVEIKEPESVPAGNPMDNSGYG  606



>emb|CDP18583.1| unnamed protein product [Coffea canephora]
Length=609

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGC LLRLA KVD  KE LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  465  ATKAAVEEGIVVGGGCALLRLACKVDDIKETLDNDEEKVGADIVKRALSYPLKLIAKNAG  524

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  YGYNAATG YED  AAGIIDP K VRCC+E AASVA  FL SD
Sbjct  525  VNGSVVSEKVLSSDNLKYGYNAATGNYEDLMAAGIIDPTKVVRCCIEHAASVAKTFLMSD  584

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  585  CVVVEIKVPEPVAAGNPMDNSGYG  608



>ref|XP_011025126.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Populus 
euphratica]
Length=607

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  463  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDSLENDEEKVGADIVKRALSYPLKLIAKNAG  522

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP +GYNAATG YED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  523  VNGSVVSEKVLSNDNPKFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  582

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE    GNPM  SG G
Sbjct  583  CVVVEIKEPESVPAGNPMDNSGYG  606



>gb|KHG01053.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Gossypium arboreum]
 gb|KHG01054.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Gossypium arboreum]
Length=607

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  463  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDSLDNDEEKVGADIVKRALSYPLKLIAKNAG  522

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP +G+NAATG YED  +AGIIDP K VRCCLE AASVA  FL SD
Sbjct  523  VNGSVVSEKVLSNDNPRHGFNAATGNYEDLMSAGIIDPTKVVRCCLEHAASVAKTFLMSD  582

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE    GNPM  SG G
Sbjct  583  CVVVEIKEPETVPAGNPMDNSGYG  606



>ref|XP_007149220.1| hypothetical protein PHAVU_005G051700g [Phaseolus vulgaris]
 gb|ESW21214.1| hypothetical protein PHAVU_005G051700g [Phaseolus vulgaris]
Length=593

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA ++ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  449  ATKAAVEEGIVVGGGCTLLRLASKVDAIRDSLDNDEEKVGADIVKRALSYPLKLIAKNAG  508

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  YGYNAATG YED  +AGIIDP K VRCCLE AASVA  FL SD
Sbjct  509  VNGSVVSEKVLSSDNARYGYNAATGNYEDLMSAGIIDPTKVVRCCLEHAASVAKTFLMSD  568

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE    GNPM  SG G
Sbjct  569  CVVVEIKEPEAVPAGNPMDASGYG  592



>ref|XP_009382612.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=609

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L+NDE +VGA +V+RALS P KLIA NAG
Sbjct  465  ATKAAVEEGIVVGGGCTLLRLASKVDAIKETLENDEQKVGADIVRRALSYPLKLIAKNAG  524

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+ KV S D+  +GYNAATG YED  AAGIIDP K VRCCLE AASV+  FLTSD
Sbjct  525  VNGSVVVEKVLSNDDFKFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHAASVSKTFLTSD  584

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              +  IK PE    GNPM  SG G
Sbjct  585  VVMVDIKEPESVPAGNPMNNSGYG  608



>emb|CDX82537.1| BnaA03g32840D [Brassica napus]
Length=587

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAV EGIVVGGGCTLLRLAAKVDA K+ L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  446  ATKAAVAEGIVVGGGCTLLRLAAKVDAIKDTLENDEEKVGAEIVKRALSYPLKLIAKNAG  505

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV + DN  +GYNAATGKYED   AGIIDP K VRCCLE AASVA  FL SD
Sbjct  506  VNGSVVSEKVLANDNVKFGYNAATGKYEDLMVAGIIDPTKVVRCCLEHAASVAKTFLMSD  565

Query  285  AXVXXIKXPEPAVVGNPMXXSG  220
              V  IK PEP   GNPM  SG
Sbjct  566  CVVVEIKEPEPVPAGNPMDNSG  587



>ref|XP_006297271.1| hypothetical protein CARUB_v10013285mg [Capsella rubella]
 gb|EOA30169.1| hypothetical protein CARUB_v10013285mg [Capsella rubella]
Length=596

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  452  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLENDEEKVGAEIVKRALSYPLKLIAKNAG  511

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV + DN  YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  512  VNGSVVSEKVLANDNVKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  571

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  I  PEP   GNPM  SG G
Sbjct  572  CVVVEIPEPEPVPAGNPMDNSGYG  595



>emb|CDX75713.1| BnaC03g37960D [Brassica napus]
Length=593

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAV EGIVVGGGCTLLRLAAKVDA K+ L NDE +VGA +VKRAL  P KLIA NAG
Sbjct  452  ATKAAVAEGIVVGGGCTLLRLAAKVDAIKDTLGNDEEKVGAEIVKRALRYPLKLIAKNAG  511

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV + DN  +GYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  512  VNGSVVSEKVLANDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  571

Query  285  AXVXXIKXPEPAVVGNPMXXSG  220
              V  IK PEP  VGNPM  SG
Sbjct  572  CVVVEIKEPEPVPVGNPMDNSG  593



>ref|XP_002297617.1| hypothetical protein POPTR_0001s03980g [Populus trichocarpa]
 gb|ABK95011.1| unknown [Populus trichocarpa]
 gb|EEE82422.1| hypothetical protein POPTR_0001s03980g [Populus trichocarpa]
Length=607

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  463  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDSLENDEEKVGADIVKRALSYPLKLIAKNAG  522

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV + DNP +GYNAATG YED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  523  VNGSVVSEKVLASDNPKFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  582

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE    GNPM  SG G
Sbjct  583  CVVVEIKEPESVPAGNPMDNSGYG  606



>gb|KEH39992.1| TCP-1/cpn60 chaperonin family protein [Medicago truncatula]
Length=591

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  L NDE +VGA +VKRALS P KLIA NAG
Sbjct  447  ATKAAVEEGIVVGGGCTLLRLASKVDAIKATLANDEEKVGADIVKRALSYPLKLIAKNAG  506

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S D+  YGYNAATGKYED  +AGIIDP K VRCCLE AASVA  FL SD
Sbjct  507  VNGSVVSEKVLSNDDTRYGYNAATGKYEDLMSAGIIDPTKVVRCCLEHAASVAKTFLMSD  566

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE A VGNPM  SG G
Sbjct  567  CVVVEIKEPEVAPVGNPMDNSGFG  590



>ref|XP_011048163.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic-like [Populus 
euphratica]
Length=607

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  463  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDSLENDEEKVGADIVKRALSYPLKLIAKNAG  522

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV + DNP +GYNAATG YED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  523  VNGSVVSEKVLASDNPKFGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  582

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE    GNPM  SG G
Sbjct  583  CVVVEIKEPESVPAGNPMDNSGYG  606



>gb|KEH39991.1| TCP-1/cpn60 chaperonin family protein [Medicago truncatula]
Length=591

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  L NDE +VGA +VKRALS P KLIA NAG
Sbjct  447  ATKAAVEEGIVVGGGCTLLRLASKVDAIKATLANDEEKVGADIVKRALSYPLKLIAKNAG  506

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S D+  YGYNAATGKYED  +AGIIDP K VRCCLE AASVA  FL SD
Sbjct  507  VNGSVVSEKVLSNDDTRYGYNAATGKYEDLMSAGIIDPTKVVRCCLEHAASVAKTFLMSD  566

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE A VGNPM  SG G
Sbjct  567  CVVVEIKEPEVAPVGNPMDNSGFG  590



>ref|NP_001032083.1| chaperonin 60 subunit beta 3 [Arabidopsis thaliana]
 ref|NP_200461.4| chaperonin 60 subunit beta 3 [Arabidopsis thaliana]
 sp|C0Z361.1|CPNB3_ARATH RecName: Full=Chaperonin 60 subunit beta 3, chloroplastic; Short=CPN-60 
beta 3; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAH57140.1| AT5G56500 [Arabidopsis thaliana]
 gb|AED96773.1| TCP-1/cpn60 chaperonin family protein [Arabidopsis thaliana]
 gb|AED96774.1| TCP-1/cpn60 chaperonin family protein [Arabidopsis thaliana]
Length=597

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L NDE +VGA +VK+ALS P KLIA NAG
Sbjct  452  ATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALSYPLKLIAKNAG  511

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP +GYNAATGKYED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  512  VNGSVVSEKVLSSDNPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  571

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  IK PE A   GNPM  SG G
Sbjct  572  CVVVEIKEPESAAPAGNPMDNSGYG  596



>ref|XP_002864459.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40718.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
Length=597

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L NDE +VGA +VK+ALS P KLIA NAG
Sbjct  452  ATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALSYPLKLIAKNAG  511

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP +GYNAATGKYED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  512  VNGSVVSEKVLSSDNPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  571

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  IK PE A   GNPM  SG G
Sbjct  572  CVVVEIKEPESAAPAGNPMDNSGYG  596



>ref|NP_187956.1| TCP-1/cpn60 chaperonin family protein [Arabidopsis thaliana]
 sp|Q9LJE4.1|CPNB2_ARATH RecName: Full=Chaperonin 60 subunit beta 2, chloroplastic; Short=CPN-60 
beta 2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01754.1| GloEL protein; chaperonin, 60 kDa [Arabidopsis thaliana]
 gb|AEE75362.1| TCP-1/cpn60 chaperonin family protein [Arabidopsis thaliana]
Length=596

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  452  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLENDEEKVGAEIVKRALSYPLKLIAKNAG  511

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV + DN  +GYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  512  VNGSVVSEKVLANDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  571

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  I  PEP   GNPM  SG G
Sbjct  572  CVVVEIPEPEPVPAGNPMDNSGYG  595



>gb|KJB73259.1| hypothetical protein B456_011G224500 [Gossypium raimondii]
Length=603

 Score =   174 bits (440),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 110/144 (76%), Gaps = 4/144 (3%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  463  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDSLDNDEEKVGADIVKRALSYPLKLIAKNAG  522

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+    S DNP YG+NAATG YED  +AGIIDP K VRCCLE AASVA  FL SD
Sbjct  523  VNGSVVL----SNDNPRYGFNAATGNYEDLMSAGIIDPTKVVRCCLEHAASVAKTFLMSD  578

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PEP   GNPM  SG G
Sbjct  579  CVVVEIKEPEPVPAGNPMDNSGYG  602



>ref|XP_006280215.1| hypothetical protein CARUB_v10026123mg [Capsella rubella]
 gb|EOA13113.1| hypothetical protein CARUB_v10026123mg [Capsella rubella]
Length=598

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L NDE +VGA +VK+ALS P KLIA NAG
Sbjct  453  ATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALSYPLKLIAKNAG  512

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP +GYNAATGKYED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  513  VNGSVVSEKVLSSDNPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  572

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  IK PE A   GNPM  SG G
Sbjct  573  CVVVDIKEPESAAPAGNPMGNSGYG  597



>ref|XP_003574065.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Brachypodium distachyon]
 ref|XP_010233648.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Brachypodium distachyon]
Length=598

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA KE L+NDE ++GA +V+++LS P KLIA NAG
Sbjct  454  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKETLENDEQKIGAEIVRKSLSYPLKLIAKNAG  513

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV + DN  YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  F+TSD
Sbjct  514  VNGSVVTEKVLANDNFRYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFITSD  573

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
            A V  IK  E A   NPM  SG G
Sbjct  574  AVVVDIKEAEQAPAANPMAGSGYG  597



>emb|CDX86994.1| BnaC03g52640D [Brassica napus]
Length=702

 Score =   174 bits (441),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAV EGIVVGGGCTLLRLAAKVDA K+ L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  271  ATKAAVAEGIVVGGGCTLLRLAAKVDAIKDTLENDEEKVGAEIVKRALSYPLKLIAKNAG  330

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV + DN  +GYNAATGKYED   AGIIDP K VRCCLE AASVA  FL SD
Sbjct  331  VNGSVVSEKVLANDNVKFGYNAATGKYEDLMVAGIIDPTKVVRCCLEHAASVAKTFLMSD  390

Query  285  AXVXXIKXPEPAVVGNPMXXSG  220
              V  IK PEP   GNPM  SG
Sbjct  391  CVVVEIKEPEPVPAGNPMDNSG  412



>gb|EMS68298.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Triticum urartu]
Length=776

 Score =   174 bits (442),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K+ LDNDE +VGA +V+RAL  P KLIA NAG
Sbjct  632  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLDNDEQKVGAEIVRRALCYPLKLIAKNAG  691

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  +GYNAATG+YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  692  VNGSVVTEKVLSNDNFKFGYNAATGQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  751

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE A + NPM  SG G
Sbjct  752  VVVVEIKEPEAAPLANPMDNSGFG  775



>ref|XP_010451233.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic [Camelina 
sativa]
Length=598

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L NDE +VGA +VK+ALS P KLIA NAG
Sbjct  453  ATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALSYPLKLIAKNAG  512

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP +GYNAATGKYED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  513  VNGSVVSEKVLSNDNPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  572

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  IK PE A   GNPM  SG G
Sbjct  573  CVVVDIKEPESAAPAGNPMGNSGYG  597



>ref|XP_010483125.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic-like [Camelina 
sativa]
Length=597

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L NDE +VGA +VK+ALS P KLIA NAG
Sbjct  452  ATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALSYPLKLIAKNAG  511

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP +GYNAATGKYED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  512  VNGSVVSEKVLSNDNPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  571

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  IK PE A   GNPM  SG G
Sbjct  572  CVVVDIKEPESAAPAGNPMGNSGYG  596



>gb|EMS63178.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Triticum urartu]
Length=561

 Score =   173 bits (438),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L+NDE +VGA +V+++LS P KLIA NAG
Sbjct  417  ATKAAVEEGIVVGGGCTLLRLASKVDAIKETLENDEQKVGAEIVRKSLSYPLKLIAKNAG  476

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV   DN  YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  F+TSD
Sbjct  477  VNGSVVTEKVLVNDNFRYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFITSD  536

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
            A V  IK  E A   NPM  SG G
Sbjct  537  AVVVDIKESEQAPAANPMAGSGYG  560



>ref|XP_010500599.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Camelina 
sativa]
Length=596

 Score =   173 bits (438),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  452  ATKAAVEEGIVVGGGCTLLRLASKVDAIKNTLENDEEKVGAEIVKRALSYPLKLIAKNAG  511

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV + DN  +GYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  512  VNGSVVSEKVLANDNMKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  571

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  I  PEP   GNPM  SG G
Sbjct  572  CVVVEIPEPEPVPAGNPMDNSGYG  595



>ref|XP_010465189.1| PREDICTED: LOW QUALITY PROTEIN: chaperonin 60 subunit beta 2, 
chloroplastic [Camelina sativa]
Length=596

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  452  ATKAAVEEGIVVGGGCTLLRLASKVDAIKSTLENDEEKVGAEIVKRALSYPLKLIAKNAG  511

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV + DN  +GYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  512  VNGSVVSEKVLANDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  571

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  I  PEP   GNPM  SG G
Sbjct  572  CVVVEIPEPEPVPAGNPMDNSGYG  595



>dbj|BAB11583.1| RuBisCO subunit binding-protein beta subunit precursor; chaperonin, 
60 kDa [Arabidopsis thaliana]
Length=596

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 110/143 (77%), Gaps = 1/143 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L NDE +VGA +VK+ALS P KLIA NAG
Sbjct  452  ATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALSYPLKLIAKNAG  511

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP +GYNAATGKYED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  512  VNGSVVSEKVLSSDNPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  571

Query  285  AXVXXIKXPEPAV-VGNPMXXSG  220
              V  IK PE A   GNPM  SG
Sbjct  572  CVVVEIKEPESAAPAGNPMDNSG  594



>gb|EMT05406.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Aegilops tauschii]
Length=932

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K+ LDNDE +VGA +V+RAL  P KLIA NAG
Sbjct  788  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKDTLDNDEQKVGAEIVRRALCYPLKLIAKNAG  847

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  +GYNAATG+YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  848  VNGSVVTEKVLSNDNFKFGYNAATGQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  907

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE A + NPM  SG G
Sbjct  908  VVVVEIKEPEAAPLANPMDNSGFG  931



>ref|XP_010103092.1| Chaperonin 60 subunit beta 2 [Morus notabilis]
 gb|EXB94815.1| Chaperonin 60 subunit beta 2 [Morus notabilis]
Length=603

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVD  K+ L+N+E +VGA +VKRALS P KLIA NAG
Sbjct  459  ATKAAVEEGIVVGGGCTLLRLASKVDGIKDTLENEEEKVGADIVKRALSYPLKLIAKNAG  518

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YG+NAA+GKYED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  519  VNGSVVSEKVLSSDNPRYGFNAASGKYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  578

Query  285  AXVXXIKXPEPAVVGNPMXXSG  220
              V  IK  EP   GNPM  SG
Sbjct  579  CVVVEIKESEPVPAGNPMGNSG  600



>ref|XP_006401314.1| hypothetical protein EUTSA_v10013030mg [Eutrema salsugineum]
 gb|ESQ42767.1| hypothetical protein EUTSA_v10013030mg [Eutrema salsugineum]
Length=597

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L NDE +VGA +VK+ALS P KLIA NAG
Sbjct  452  ATKAAVEEGIVVGGGCTLLRLASKVDAIKESLANDEEKVGADIVKKALSYPLKLIAKNAG  511

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S D+P +GYNAATGKYED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  512  VNGSVVSEKVLSSDDPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  571

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  IK PE A   GNPM  SG G
Sbjct  572  CVVVEIKEPESAAPAGNPMDNSGYG  596



>ref|XP_010487110.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic-like [Camelina 
sativa]
Length=596

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTL+RLA+KVDA K  L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  452  ATKAAVEEGIVVGGGCTLIRLASKVDAIKNTLENDEEKVGAEIVKRALSYPLKLIAKNAG  511

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV + DN  +GYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  512  VNGSVVSEKVLANDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  571

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  I  PEP   GNPM  SG G
Sbjct  572  CVVVEIPEPEPVPAGNPMDNSGYG  595



>dbj|BAK07904.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=598

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEGIVVGGGCTL+RLA+KVDA K+ L+NDE RVGA +V+++LS P KLIA NAG
Sbjct  454  ATKAAIEEGIVVGGGCTLVRLASKVDAIKQTLENDEQRVGAEIVRKSLSYPLKLIAENAG  513

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI KV + DN  YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  F+TSD
Sbjct  514  VNGSVVIEKVLAIDNSRYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFITSD  573

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
            A V  I+ P+   V NPM  SG G
Sbjct  574  AVVVDIRVPKCTPVVNPMCGSGYG  597



>gb|EMT19476.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Aegilops tauschii]
Length=654

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L+NDE +VGA +V+++LS P KLIA NAG
Sbjct  510  ATKAAVEEGIVVGGGCTLLRLASKVDAIKETLENDEQKVGAEIVRKSLSYPLKLIAKNAG  569

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV   DN  YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  F+TSD
Sbjct  570  VNGSVVTEKVLVNDNFRYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFITSD  629

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
            A V  IK  E A   NPM  SG G
Sbjct  630  AVVVDIKESEQAPAANPMAGSGYG  653



>ref|NP_001045601.1| Os02g0102900 [Oryza sativa Japonica Group]
 dbj|BAD07821.1| putative RuBisCO subunit binding-protein beta subunit, chloroplast 
precursor [Oryza sativa Japonica Group]
 dbj|BAF07515.1| Os02g0102900 [Oryza sativa Japonica Group]
 gb|EEC72294.1| hypothetical protein OsI_05469 [Oryza sativa Indica Group]
 gb|EEE56131.1| hypothetical protein OsJ_05004 [Oryza sativa Japonica Group]
 gb|ADR66967.1| 60 kDa chaperonin beta subunit [Oryza sativa Japonica Group]
Length=598

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 112/145 (77%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA  E L+NDE +VGA +V+++LS P KLIA NAG
Sbjct  453  ATKAAVEEGIVVGGGCTLLRLASKVDAIIETLENDEQKVGAEIVRKSLSYPLKLIAKNAG  512

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV + DN  YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  F+TSD
Sbjct  513  VNGSVVTEKVLANDNFRYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFITSD  572

Query  285  AXVXXIKXPEP-AVVGNPMXXSGXG  214
            A V  IK PE  A  GNPM  SG G
Sbjct  573  AVVVDIKEPEKAAAAGNPMGGSGFG  597



>ref|XP_010094358.1| RuBisCO large subunit-binding protein subunit beta [Morus notabilis]
 gb|EXB55869.1| RuBisCO large subunit-binding protein subunit beta [Morus notabilis]
Length=769

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVD  ++ L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  459  ATKAAVEEGIVVGGGCTLLRLASKVDGIRDTLENDEEKVGADIVKRALSYPLKLIAKNAG  518

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP YGYNAATGKYED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  519  VNGSVVSEKVLSSDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  578

Query  285  AXVXXIKXPEPAVVGNPMXXS  223
              V  IK PE    GNPM  S
Sbjct  579  CVVVEIKEPESVPAGNPMDNS  599



>gb|EMS56406.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Triticum urartu]
Length=617

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTL+RLA+KVDA K+ L+NDE +VGA +V+++LS P KLIA NAG
Sbjct  473  ATKAAVEEGIVVGGGCTLIRLASKVDAIKQTLENDEQKVGAEIVRKSLSYPLKLIAKNAG  532

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            + GSVVI KV + DN  YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  F+TSD
Sbjct  533  INGSVVIEKVLAIDNSSYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFITSD  592

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
            A V  I+ P+ A V NPM  SG G
Sbjct  593  AVVVDIRAPKCAPVVNPMCGSGYG  616



>emb|CAJ19275.1| beta chaperonin 60 [Solanum commersonii]
Length=600

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 109/145 (75%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVE GIVVGGGCTLLRLAAKVDA K  L NDE +VGA +V+RALS P KLIA NAG
Sbjct  455  ATKAAVERGIVVGGGCTLLRLAAKVDAIKGTLANDEEKVGADIVQRALSYPLKLIAKNAG  514

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDX-XAAGIIDPPKXVRCCLEXAASVAXXFLTS  289
            V GSVV  KV S D+P +GYNAATG YED   AAGIIDP K VRCCLE AASVA  FL S
Sbjct  515  VNGSVVSEKVLSSDDPKFGYNAATGNYEDLIMAAGIIDPTKVVRCCLEHAASVAKTFLMS  574

Query  288  DAXVXXIKXPEPAVVGNPMXXSGXG  214
            D  V  IK PE AV GNPM  SG G
Sbjct  575  DCVVVEIKEPEAAVAGNPMDNSGYG  599



>ref|XP_010443301.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic-like [Camelina 
sativa]
Length=597

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L NDE +VGA +VK+ALS P KLIA NAG
Sbjct  452  ATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALSYPLKLIAKNAG  511

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S +NP +GYNAATGKYED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  512  VNGSVVSEKVLSNENPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  571

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  IK PE A   GNPM  SG G
Sbjct  572  CVVVDIKEPESAAPAGNPMGNSGYG  596



>ref|XP_001754571.1| predicted protein [Physcomitrella patens]
 gb|EDQ80541.1| predicted protein [Physcomitrella patens]
Length=548

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KV A    LDNDE RVGA +V+RAL  P KLIA NAG
Sbjct  406  ATKAAVEEGIVVGGGCTLLRLASKVSAIVSTLDNDEQRVGAEIVRRALCYPLKLIAKNAG  465

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+ KV +  NP +GYNAATG YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  466  VNGSVVVEKVLANSNPSFGYNAATGVYEDLMAAGIIDPTKVVRCCLEHAASVAKIFLTSD  525

Query  285  AXVXXIKXPEPAVVGNPMXXSG  220
              V  IK  E AV GNPM  SG
Sbjct  526  VVVTEIKEAEVAVAGNPMDASG  547



>dbj|BAF00280.1| RuBisCO subunit binding-protein beta subunit precursor [Arabidopsis 
thaliana]
Length=597

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 110/145 (76%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L NDE +VGA +VK+ALS P KLIA NAG
Sbjct  452  ATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALSYPLKLIAKNAG  511

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP +GYNAATGKYED  AA IIDP K VRCCLE A+SVA  FL SD
Sbjct  512  VNGSVVSEKVLSSDNPKHGYNAATGKYEDLMAARIIDPTKVVRCCLEHASSVAKTFLMSD  571

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  IK PE A   GNPM  SG G
Sbjct  572  CVVVEIKEPESAAPAGNPMDNSGYG  596



>emb|CDY11918.1| BnaC03g13440D [Brassica napus]
Length=595

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 110/145 (76%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L NDE +VGA +VK+ALS P KLIA NAG
Sbjct  450  ATKAAVEEGIVVGGGCTLLRLASKVDAVKESLANDEEKVGADIVKKALSYPLKLIAKNAG  509

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S D+P +GYNAATGKYED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  510  VNGSVVSEKVLSSDDPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  569

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  I  PE A   GNPM  SG G
Sbjct  570  CVVVEINEPESAAPAGNPMGNSGYG  594



>ref|XP_009132296.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic [Brassica 
rapa]
Length=591

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 110/145 (76%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L NDE +VGA +VK+ALS P KLIA NAG
Sbjct  446  ATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALSYPLKLIAKNAG  505

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S D+P +GYNAATGKYED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  506  VNGSVVSEKVLSSDDPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  565

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
              V  I  PE A   GNPM  SG G
Sbjct  566  CVVVEINEPESAAPAGNPMGNSGYG  590



>ref|XP_010671843.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=606

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRL++KVDA K+ L+N E +VGA +VKRALS P KLIA NAG
Sbjct  462  ATKAAVEEGIVVGGGCTLLRLSSKVDAIKDQLENVEEKVGADIVKRALSYPLKLIAKNAG  521

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  YGYNAATG+YED  +AGIIDP K VRCCLE A+SVA  FL SD
Sbjct  522  VNGSVVSEKVLSNDNTRYGYNAATGQYEDLMSAGIIDPTKVVRCCLEHASSVAKTFLMSD  581

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK  EP   GNPM  SG G
Sbjct  582  CVVVEIKEAEPMPAGNPMDNSGFG  605



>emb|CDY36809.1| BnaA03g10770D [Brassica napus]
Length=607

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 109/143 (76%), Gaps = 1/143 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA KE L NDE +VGA +VK+ALS P KLIA NAG
Sbjct  446  ATKAAVEEGIVVGGGCTLLRLASKVDAIKETLANDEEKVGADIVKKALSYPLKLIAKNAG  505

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S D+P +GYNAATGKYED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  506  VNGSVVSEKVLSSDDPKHGYNAATGKYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  565

Query  285  AXVXXIKXPEPAV-VGNPMXXSG  220
              V  I  PE A   GNPM  SG
Sbjct  566  CVVVEINEPESAAPAGNPMGNSG  588



>gb|EMT33855.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Aegilops tauschii]
Length=659

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTL+RLA+KVDA K+ L+NDE +VGA +V+++LS P KLIA NAG
Sbjct  515  ATKAAVEEGIVVGGGCTLVRLASKVDAIKQTLENDEQKVGAEIVRKSLSYPLKLIAENAG  574

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            + GSVVI KV + DN  YGYNAATG YED  AAGIIDP K VRCCLE AASVA  F+TSD
Sbjct  575  INGSVVIEKVLAIDNSSYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHAASVAKTFITSD  634

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
            A V  I+ P+ A V NPM  SG G
Sbjct  635  AVVVDIRAPKCAPVVNPMCGSGYG  658



>emb|CDX75715.1| BnaC03g37980D [Brassica napus]
Length=563

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 107/150 (71%), Gaps = 8/150 (5%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAV EGIVVG GCTLLRLAAKVDA K+ L+NDE +VGA +VK ALS P KLIA NAG
Sbjct  414  ATKAAVAEGIVVGVGCTLLRLAAKVDAIKDTLENDEEKVGAEIVKIALSYPLKLIAKNAG  473

Query  465  VXGSVVIXKVX--------SPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASV  310
            V GSVV  KV         S DN  +GYNAATGKYED  AAGIIDP K VRCCLE AASV
Sbjct  474  VNGSVVSEKVTDLTLNLHSSNDNVKFGYNAATGKYEDLTAAGIIDPTKVVRCCLEHAASV  533

Query  309  AXXFLTSDAXVXXIKXPEPAVVGNPMXXSG  220
            A  FL SD  V  IK PEP   GNPM  SG
Sbjct  534  AKTFLMSDCVVVEIKEPEPVPAGNPMDNSG  563



>gb|KDO54472.1| hypothetical protein CISIN_1g007313mg [Citrus sinensis]
Length=601

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRL++KVDA KE LDNDE +VGA +VKRAL  P KLIA NAG
Sbjct  463  ATKAAVEEGIVVGGGCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALCYPLKLIAKNAG  522

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  YGYNAATG YED  AAGIIDP K VRCCLE A+SVA  FL SD
Sbjct  523  VNGSVVSEKVLSSDNHKYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSD  582

Query  285  AXVXXIKXPEPAV  247
              V  IK PEPA+
Sbjct  583  CVVVEIKEPEPAM  595



>ref|XP_010691436.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Beta vulgaris subsp. vulgaris]
Length=610

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRL+ KVDA +E L+N+E ++GA +VKRALS P  LIA NAG
Sbjct  465  ATKAAVEEGIVVGGGCTLLRLSTKVDAIRERLENNEQKLGADIVKRALSYPLDLIAKNAG  524

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V G+VVI KV S D+  +GYNAATGKYED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  525  VNGAVVIEKVLSNDDQNFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  584

Query  285  AXVXXIKXPEPAVVGNPMXXSG  220
            A V  I  PE A   NPM  SG
Sbjct  585  AVVTEIPEPELAPAANPMDNSG  606



>sp|P21241.1|RUBB_BRANA RecName: Full=RuBisCO large subunit-binding protein subunit beta, 
chloroplastic; AltName: Full=60 kDa chaperonin subunit 
beta; AltName: Full=CPN-60 beta; Flags: Precursor [Brassica 
napus]
 gb|AAA32980.1| 60-kDa beta-polypeptide of plastid chaperonin-60 precursor [Brassica 
napus]
Length=588

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K  LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  456  ATKAAVEEGIVVGGGCTLLRLASKVDAIKAALDNDEEKVGADIVKRALSYPLKLIAKNAG  515

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DN  +GYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  516  VNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  575

Query  285  AXVXXIKXPEP  253
              V  IK PEP
Sbjct  576  CVVVEIKEPEP  586



>ref|XP_004951187.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Setaria italica]
Length=599

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA  E LDNDE +VGA +V+++LS P KLIA NAG
Sbjct  454  ATKAAVEEGIVVGGGCTLLRLASKVDAIIETLDNDEQKVGAEIVRKSLSYPLKLIAKNAG  513

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI KV +  N  YGYNAATG YED  AAGIIDP K VRCCLE AASVA  F+TSD
Sbjct  514  VNGSVVIEKVLANKNFRYGYNAATGNYEDLMAAGIIDPTKVVRCCLEHAASVAKTFITSD  573

Query  285  AXVXXIKXPEPAVVGNPM  232
            A V  I+ PE A   NPM
Sbjct  574  AVVVDIQVPEQAPAANPM  591



>ref|XP_002964742.1| hypothetical protein SELMODRAFT_142800 [Selaginella moellendorffii]
 gb|EFJ33580.1| hypothetical protein SELMODRAFT_142800 [Selaginella moellendorffii]
Length=603

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGG  LLRL++KVDA K+ L+NDE ++GA +V++ALS P KLIA NAG
Sbjct  458  ATKAAVEEGIVVGGGIALLRLSSKVDAIKDTLENDEQKIGAEIVRKALSYPVKLIAKNAG  517

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSV++ KV + DN  +GYNAATG +E+  AAGIIDP K VRCCLE A SVA  FLTSD
Sbjct  518  VNGSVIVEKVLADDNFNHGYNAATGAFENLMAAGIIDPTKVVRCCLEHAGSVARTFLTSD  577

Query  285  AXVXXIKXPEPAV-VGNPMXXSGXG  214
            A V  I  PEPAV  GNPM  SG G
Sbjct  578  AVVVSIPEPEPAVPAGNPMDNSGYG  602



>emb|CDY32855.1| BnaC09g33020D [Brassica napus]
Length=594

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K  L NDE +VGA +VK+ALS P KLIA NAG
Sbjct  452  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKATLANDEEKVGAEIVKKALSYPLKLIAKNAG  511

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV S DNP +GYNAATGKYED  +AGIIDP K VRCCLE A+SVA  FL SD
Sbjct  512  VNGSVVSEKVLSSDNPKHGYNAATGKYEDLMSAGIIDPTKVVRCCLEHASSVAKTFLMSD  571

Query  285  AXVXXIKXPEPA  250
              V  IK PE A
Sbjct  572  CVVVEIKEPESA  583



>ref|XP_002961675.1| hypothetical protein SELMODRAFT_165043 [Selaginella moellendorffii]
 gb|EFJ36935.1| hypothetical protein SELMODRAFT_165043 [Selaginella moellendorffii]
Length=607

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 110/143 (77%), Gaps = 1/143 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGG  LLRL++KVDA K+ L+NDE ++GA +V++ALS P KLIA NAG
Sbjct  458  ATKAAVEEGIVVGGGIALLRLSSKVDAIKDTLENDEQKIGAEIVRKALSYPVKLIAKNAG  517

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSV++ KV + DN  +GYNAATG +E+  AAGIIDP K VRCCLE A SVA  FLTSD
Sbjct  518  VNGSVIVEKVLADDNFNHGYNAATGAFENLMAAGIIDPTKVVRCCLEHAGSVARTFLTSD  577

Query  285  AXVXXIKXPEPAV-VGNPMXXSG  220
            A V  I  PEPAV  GNPM  SG
Sbjct  578  AVVVSIPEPEPAVPAGNPMDNSG  600



>ref|XP_002514548.1| rubisco subunit binding-protein beta subunit, rubb, putative 
[Ricinus communis]
 gb|EEF47654.1| rubisco subunit binding-protein beta subunit, rubb, putative 
[Ricinus communis]
Length=592

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+V+GGGC+LLRL+ KVDA KE LDN+E ++GA + KRALS P +LIA NAG
Sbjct  437  ATKAAIEEGVVIGGGCSLLRLSTKVDAIKELLDNEEQKIGAEIFKRALSYPTRLIAKNAG  496

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V G++VI ++ S D+P YGYNAA  +YED  +AGIIDP K VRCCLE AASVA  F+TSD
Sbjct  497  VNGNIVINQILSNDDPRYGYNAARDRYEDLISAGIIDPTKVVRCCLENAASVAKTFITSD  556

Query  285  AXVXXIKXPEPAVVGNPM  232
            A V  IK P+P  +  PM
Sbjct  557  AVVVKIKVPQPLPIRKPM  574



>emb|CDX85007.1| BnaC05g20480D [Brassica napus]
Length=1004

 Score =   163 bits (413),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 95/142 (67%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            A KAAVE+GIVVGGGCTLLRLA+KVD  K  LD+DE +VG  +VKRALS P   +A NAG
Sbjct  857  AKKAAVEDGIVVGGGCTLLRLASKVDTIKAALDDDEEKVGTDIVKRALSYPLNPVAKNAG  916

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GS+V  KV S +N  +GYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  917  VSGSIVSEKVLSNENVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSD  976

Query  285  AXVXXIKXPEPAVVGNPMXXSG  220
              V  IK PEP   GNPM  SG
Sbjct  977  CVVVEIKEPEPVPTGNPMDNSG  998



>gb|AFW66837.1| putative TCP-1/cpn60 chaperonin family protein isoform 1 [Zea 
mays]
 gb|AFW66838.1| putative TCP-1/cpn60 chaperonin family protein isoform 2 [Zea 
mays]
Length=605

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 108/144 (75%), Gaps = 2/144 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA  E L+NDE +VGA +V+++LS P KLIA NAG
Sbjct  456  ATKAAVEEGIVVGGGCTLLRLASKVDAIIETLENDEQKVGAEIVRKSLSYPLKLIAKNAG  515

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV + +N  YGYNAATG+YED  AAGIIDP K VRCCLE AASVA  F+TSD
Sbjct  516  VNGSVVTEKVLANENFRYGYNAATGEYEDLMAAGIIDPTKVVRCCLEHAASVAKTFITSD  575

Query  285  AXVXXIKXPE--PAVVGNPMXXSG  220
            A V   K  E  P+   NPM   G
Sbjct  576  AVVVDAKVAEQAPSSPANPMAMGG  599



>gb|KCW87049.1| hypothetical protein EUGRSUZ_B03593 [Eucalyptus grandis]
Length=620

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVDA K+ L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  464  ATKAAVEEGIVVGGGCTLLRLASKVDAIKDTLENDEEKVGADIVKRALSYPLKLIAKNAG  523

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTS  289
            V GSVV  K+ S DNP YGYNAATGKYED  AAGIIDP K VRCCLE AASVA  FL S
Sbjct  524  VNGSVVSEKILSNDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLIS  582



>ref|XP_006484293.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X1 [Citrus sinensis]
Length=612

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEGIVVGGGC+LLRL+AKV+  KE LDN+E ++GA + KRALS P KLIA NAG
Sbjct  431  ATKAAIEEGIVVGGGCSLLRLSAKVEGIKELLDNEEQKIGAEIFKRALSYPTKLIAKNAG  490

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V G+ V+ +V S D+P YGYNAA  +YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  491  VNGNFVVDQVLSNDDPRYGYNAARNRYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  550

Query  285  AXVXXIKXPEP  253
            A V  IK  EP
Sbjct  551  AVVVNIKESEP  561



>gb|ACG36615.1| ruBisCO large subunit-binding protein subunit beta [Zea mays]
Length=605

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 107/144 (74%), Gaps = 2/144 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+K DA  E L+NDE +VGA +V+++LS P KLIA NAG
Sbjct  456  ATKAAVEEGIVVGGGCTLLRLASKFDAIIETLENDEQKVGAEIVRKSLSYPLKLIAKNAG  515

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV + +N  YGYNAATG+YED  AAGIIDP K VRCCLE AASVA  F+TSD
Sbjct  516  VNGSVVTEKVLANENFRYGYNAATGEYEDLMAAGIIDPTKVVRCCLEHAASVAKTFITSD  575

Query  285  AXVXXIKXPE--PAVVGNPMXXSG  220
            A V   K  E  P+   NPM   G
Sbjct  576  AVVVDAKVAEQAPSSPANPMAMGG  599



>ref|XP_006437814.1| hypothetical protein CICLE_v10031053mg [Citrus clementina]
 gb|ESR51054.1| hypothetical protein CICLE_v10031053mg [Citrus clementina]
Length=583

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEGIVVGGGC+LLRL+ KV+  KE LDN+E ++GA + KRALS P KLIA NAG
Sbjct  402  ATKAAIEEGIVVGGGCSLLRLSTKVEGIKELLDNEEQKIGAEIFKRALSYPTKLIAKNAG  461

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V G+ V+ +V S D+P YGYNAA  +YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  462  VNGNFVVDQVLSNDDPRYGYNAARNRYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSD  521

Query  285  AXVXXIKXPEP  253
            A V  IK  EP
Sbjct  522  AVVVNIKESEP  532



>ref|NP_001146890.1| ruBisCO large subunit-binding protein subunit beta [Zea mays]
 gb|ACG24216.1| ruBisCO large subunit-binding protein subunit beta [Zea mays]
Length=604

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 93/129 (72%), Gaps = 2/129 (2%)
 Frame = -3

Query  600  CTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAGVXGSVVIXKVXSPDN  421
            CTLLRLA+KVDA  E L+NDE +VGA +V+++LS P KLIA NAGV GSVV  KV + +N
Sbjct  470  CTLLRLASKVDAIIETLENDEQKVGAEIVRKSLSYPLKLIAKNAGVNGSVVTEKVLANEN  529

Query  420  PXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSDAXVXXIKXPE--PAV  247
              YGYNAATG+YED  AAGIIDP K VRCCLE AASVA  F+TSDA V   K  E  P+ 
Sbjct  530  FRYGYNAATGEYEDLMAAGIIDPTKVVRCCLEHAASVAKTFITSDAVVVDAKVAEQAPSS  589

Query  246  VGNPMXXSG  220
              NPM   G
Sbjct  590  PANPMAMGG  598



>ref|XP_012080492.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X2 [Jatropha curcas]
Length=559

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+V+GGGC+LLRL+ KVD  KE LD++E ++GA + KRALS P +LIA NAG
Sbjct  402  ATKAAIEEGVVIGGGCSLLRLSTKVDGIKEFLDDEEQKIGAEIFKRALSYPTRLIAKNAG  461

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V G++VI ++ S DNP YGYNAA  +YED  +AGIIDP K VRCCLE AASVA  FL SD
Sbjct  462  VNGNIVINQILSNDNPRYGYNAARDRYEDLISAGIIDPTKVVRCCLENAASVAKTFLISD  521

Query  285  AXVXXIKXPEPAVVGNPMXXS  223
            A V  IK P    +  PM  +
Sbjct  522  AVVVDIKEPRMLPMRKPMSKT  542



>ref|XP_012080491.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X1 [Jatropha curcas]
 gb|KDP31429.1| hypothetical protein JCGZ_11805 [Jatropha curcas]
Length=592

 Score =   154 bits (388),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+V+GGGC+LLRL+ KVD  KE LD++E ++GA + KRALS P +LIA NAG
Sbjct  435  ATKAAIEEGVVIGGGCSLLRLSTKVDGIKEFLDDEEQKIGAEIFKRALSYPTRLIAKNAG  494

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V G++VI ++ S DNP YGYNAA  +YED  +AGIIDP K VRCCLE AASVA  FL SD
Sbjct  495  VNGNIVINQILSNDNPRYGYNAARDRYEDLISAGIIDPTKVVRCCLENAASVAKTFLISD  554

Query  285  AXVXXIKXPEPAVVGNPMXXS  223
            A V  IK P    +  PM  +
Sbjct  555  AVVVDIKEPRMLPMRKPMSKT  575



>ref|XP_002966190.1| hypothetical protein SELMODRAFT_168153 [Selaginella moellendorffii]
 gb|EFJ32217.1| hypothetical protein SELMODRAFT_168153 [Selaginella moellendorffii]
Length=550

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 102/145 (70%), Gaps = 3/145 (2%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGG  LLRL+ KVDA KE L+N E ++GA +VKRAL  P KLIA NAG
Sbjct  402  ATKAAVEEGIVVGGGTALLRLSKKVDAIKETLENQEQKIGADIVKRALGYPIKLIAKNAG  461

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+ KV + DN  +GYNAATG YED  AAGIIDP K VRCCLE A SVA  FLTSD
Sbjct  462  VNGSVVVEKVLANDNFNFGYNAATGTYEDLMAAGIIDPTKVVRCCLEHAGSVAKTFLTSD  521

Query  285  AXVXXIKX---PEPAVVGNPMXXSG  220
              V  IK    P  A  G  M  SG
Sbjct  522  VVVVDIKEEFIPTGAAQGMAMDNSG  546



>ref|XP_009356483.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Pyrus x bretschneideri]
Length=616

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC+LLRL+ KVD  KE LDN+E ++GA + KRALS P KLIA NAG
Sbjct  435  ATKAAIEEGVVVGGGCSLLRLSKKVDTIKELLDNEEQKIGAEIFKRALSYPVKLIAKNAG  494

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+ KV S D+  YGYNAA   YED   AGI+DP K VRCCLE AASVA  FLTSD
Sbjct  495  VNGSVVVEKVLSNDDMGYGYNAAKDCYEDLMKAGIMDPSKVVRCCLENAASVAKTFLTSD  554

Query  285  AXVXXIKXPEPAVVGNP  235
            A V  IK  +P   G P
Sbjct  555  AVVVEIKETQPIPKGMP  571



>ref|XP_002982262.1| hypothetical protein SELMODRAFT_271545 [Selaginella moellendorffii]
 gb|EFJ16507.1| hypothetical protein SELMODRAFT_271545 [Selaginella moellendorffii]
Length=598

 Score =   151 bits (381),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 102/145 (70%), Gaps = 3/145 (2%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGG  LLRL+ KVDA KE L+N E ++GA +VKRAL  P KLIA NAG
Sbjct  450  ATKAAVEEGIVVGGGTALLRLSKKVDAIKETLENQEQKIGADIVKRALGYPIKLIAKNAG  509

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+ KV + DN  +GYNAATG YED  AAGIIDP K VRCCLE A SVA  FLTSD
Sbjct  510  VNGSVVVEKVLANDNFNFGYNAATGTYEDLMAAGIIDPTKVVRCCLEHAGSVAKTFLTSD  569

Query  285  AXVXXIKX---PEPAVVGNPMXXSG  220
              V  IK    P  A  G  M  SG
Sbjct  570  VVVVDIKEEFIPTGAAQGMAMDNSG  594



>ref|XP_011077788.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X1 [Sesamum indicum]
Length=584

 Score =   150 bits (380),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC LLRL+ K+D+ +E LDN+E R+GA ++KRAL+ P + IA NAG
Sbjct  437  ATKAAIEEGVVVGGGCCLLRLSTKIDSVREGLDNEEQRIGADILKRALAYPTRQIAKNAG  496

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V G+ VI K+ S D+  +GYNAA  +YED  AAGI+DP K VRCCLE AASVA  FLT+D
Sbjct  497  VNGNTVINKILSSDDINFGYNAARDRYEDLMAAGILDPSKVVRCCLEHAASVAKTFLTAD  556

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
            A V  IK P   V+  P+  SG G
Sbjct  557  AVVIEIKEPVSKVLRKPIPTSGIG  580



>ref|XP_008389354.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Malus domestica]
Length=614

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 100/137 (73%), Gaps = 0/137 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC+LLRL+ KVDA KE LDN E ++GA + KRALS P KLIA NAG
Sbjct  435  ATKAAIEEGVVVGGGCSLLRLSKKVDAIKELLDNKEQKIGAEIFKRALSYPVKLIAKNAG  494

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+ KV S D+  YGYNAA   YED   AGI DP K VRCCLE AASVA  FLTSD
Sbjct  495  VNGSVVVEKVLSNDDMGYGYNAAKDCYEDLMKAGIXDPSKVVRCCLENAASVAKTFLTSD  554

Query  285  AXVXXIKXPEPAVVGNP  235
            A V  IK  +P   G P
Sbjct  555  AVVVEIKETQPIPRGMP  571



>ref|XP_007227057.1| hypothetical protein PRUPE_ppa020938mg [Prunus persica]
 gb|EMJ28256.1| hypothetical protein PRUPE_ppa020938mg [Prunus persica]
Length=611

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC+LLRL+ KVD  KE LDN+E ++GA + KRALS P KLIA NAG
Sbjct  435  ATKAAIEEGVVVGGGCSLLRLSKKVDGIKELLDNEEQKIGAEIFKRALSYPVKLIAKNAG  494

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V G+VV+ K+ S DN  YGYNAA   YED   AGI+DP K VRCCLE AASVA  FLTSD
Sbjct  495  VNGNVVVEKILSNDNIGYGYNAAKDCYEDLMKAGIMDPSKVVRCCLEHAASVAKTFLTSD  554

Query  285  AXVXXIKXPEP  253
            A V  IK  +P
Sbjct  555  AVVVDIKETQP  565



>ref|XP_008243762.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X1 [Prunus mume]
Length=625

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC+LLRL+ KVD  KE LDN+E ++GA + KRALS P KLI+ NAG
Sbjct  439  ATKAAIEEGVVVGGGCSLLRLSKKVDGIKELLDNEEQKIGAEIFKRALSYPVKLISKNAG  498

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V G+VV+ K+ S DN  YGYNAA   YED   AGI+DP K VRCCLE AASVA  FLTSD
Sbjct  499  VNGNVVVEKILSNDNMGYGYNAAKDCYEDLMKAGIMDPSKVVRCCLEHAASVAKTFLTSD  558

Query  285  AXVXXIKXPEP  253
            A V  IK  +P
Sbjct  559  AVVVDIKETQP  569



>ref|XP_002890669.1| hypothetical protein ARALYDRAFT_890123 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66928.1| hypothetical protein ARALYDRAFT_890123 [Arabidopsis lyrata subsp. 
lyrata]
Length=538

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+A+EEGIVVGGGC LLRLA KVD  K+ LDN E ++GA + K+ALS P +LIA NAG
Sbjct  367  ATKSAIEEGIVVGGGCALLRLATKVDRIKDTLDNTEQKIGAEIFKKALSYPIRLIAKNAG  426

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              G++VI KV S  NP YGYNAA  +YED   AGIIDP K VRCCLE AASVA  FLTSD
Sbjct  427  TNGNIVIEKVLSNKNPMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHAASVAQTFLTSD  486

Query  285  AXVXXIKXPEPAVVGNP  235
              +  IK  +P  + NP
Sbjct  487  CVIVEIKEIKPRPIINP  503



>ref|XP_007045690.1| TCP-1/cpn60 chaperonin family protein isoform 2 [Theobroma cacao]
 gb|EOY01522.1| TCP-1/cpn60 chaperonin family protein isoform 2 [Theobroma cacao]
Length=448

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC LLRL+AKVD  K  LDN E ++GA + KRALS P KLIA NAG
Sbjct  291  ATKAAIEEGVVVGGGCILLRLSAKVDGIKSLLDNQEQKIGAEIFKRALSYPTKLIAKNAG  350

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+ KV S D+  YGYNAA+  YED   AGI+DP K VRCCLE AASVA  FLTSD
Sbjct  351  VNGSVVVGKVLSNDDIRYGYNAASNSYEDLMKAGIMDPTKVVRCCLENAASVAKTFLTSD  410

Query  285  AXVXXI  268
            A V  I
Sbjct  411  AVVVDI  416



>ref|XP_009103087.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X1 [Brassica rapa]
Length=607

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+A+EEGIVVGGGC LLRLAAKVD+ K+ LDN E ++GA + K+ALS P +LIA NAG
Sbjct  437  ATKSAIEEGIVVGGGCALLRLAAKVDSIKDTLDNTEQKIGAEIFKKALSYPIRLIAKNAG  496

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              G++VI KV   +N  YGYNAA  +YED   AGIIDP K VRCCLE AASVA  FLTSD
Sbjct  497  TNGNIVIEKVLLNENMMYGYNAAKNQYEDLMMAGIIDPSKVVRCCLEHAASVANTFLTSD  556

Query  285  AXVXXIKXPEPAVVGNP  235
            A V  IK  +P  + NP
Sbjct  557  AVVVEIKENKPRPMINP  573



>ref|XP_009103088.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X2 [Brassica rapa]
Length=566

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+A+EEGIVVGGGC LLRLAAKVD+ K+ LDN E ++GA + K+ALS P +LIA NAG
Sbjct  396  ATKSAIEEGIVVGGGCALLRLAAKVDSIKDTLDNTEQKIGAEIFKKALSYPIRLIAKNAG  455

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              G++VI KV   +N  YGYNAA  +YED   AGIIDP K VRCCLE AASVA  FLTSD
Sbjct  456  TNGNIVIEKVLLNENMMYGYNAAKNQYEDLMMAGIIDPSKVVRCCLEHAASVANTFLTSD  515

Query  285  AXVXXIKXPEPAVVGNP  235
            A V  IK  +P  + NP
Sbjct  516  AVVVEIKENKPRPMINP  532



>ref|XP_010261583.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Nelumbo nucifera]
Length=589

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 104/144 (72%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEGIVVGGGC+LLRL+ KV+  K+ L+N+E ++GA + KRALS P +LIA NAG
Sbjct  437  ATKAAIEEGIVVGGGCSLLRLSLKVENIKDTLENEEQKIGADIFKRALSYPLRLIAKNAG  496

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              GSVV+ KV S D+  YGYNAA   YED  AAGIIDP K VRCCLE AASVA  FLTSD
Sbjct  497  GNGSVVVEKVLSIDDVRYGYNAAKDCYEDLIAAGIIDPTKVVRCCLEHAASVAKVFLTSD  556

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              +  IK  EP  +  P+  SG G
Sbjct  557  VVIVDIKELEPVPMRKPIPSSGVG  580



>emb|CDY20555.1| BnaC07g12220D [Brassica napus]
Length=607

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+A+EEGIVVGGGC LLRLAAKVD+ K+ LDN E ++GA + K+ALS P +LIA NAG
Sbjct  437  ATKSAIEEGIVVGGGCALLRLAAKVDSIKDTLDNTEQKIGAEIFKKALSYPIRLIAKNAG  496

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              G++VI KV   +N  YGYNAA  +YED   AGIIDP K VRCCLE AASVA  FLTSD
Sbjct  497  TNGNIVIEKVLLNENMMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHAASVANTFLTSD  556

Query  285  AXVXXIKXPEPAVVGNP  235
            A V  IK  +P  + NP
Sbjct  557  AVVVEIKENKPRPMINP  573



>ref|XP_001418926.1| chaperonin 60 beta chain, chloroplast [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO97219.1| chaperonin 60 beta chain, chloroplast [Ostreococcus lucimarinus 
CCE9901]
Length=594

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 103/145 (71%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+AVEEGIV+GGGCT L+LAA VD  K  L+NDE RVGA ++KRALS P +L+A NAG
Sbjct  449  ATKSAVEEGIVIGGGCTFLKLAAAVDEIKATLENDEQRVGADIIKRALSYPIRLVAHNAG  508

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSV   KV S  +P +GYNAATG+YED    G++DP K +RC LE A SVA  FLTSD
Sbjct  509  VNGSVACEKVMSSKDPNFGYNAATGEYEDLMKGGVLDPTKVIRCSLENACSVAKIFLTSD  568

Query  285  AXVXXI-KXPEPAVVGNPMXXSGXG  214
              V  I +  EPA  G+PM  SG G
Sbjct  569  VVVCEIPEDEEPAAGGSPMDNSGYG  593



>ref|XP_010460336.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=551

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 100/137 (73%), Gaps = 0/137 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+A+EEGIVVGGGC LLRLA+KVD  K+ LDN E ++GA + K+ALS P +LIA NAG
Sbjct  380  ATKSAIEEGIVVGGGCALLRLASKVDRIKDTLDNTEQKIGAEIFKKALSYPIRLIAKNAG  439

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              G++VI KV S  N  YGYNAA  +YED  +AGIIDP K VRCCLE AASVA  FLTSD
Sbjct  440  TNGNIVIEKVLSNKNTMYGYNAAKNQYEDLMSAGIIDPTKVVRCCLEHAASVAQTFLTSD  499

Query  285  AXVXXIKXPEPAVVGNP  235
              V  IK  +P  + NP
Sbjct  500  CVVVEIKEIKPRPIINP  516



>ref|XP_011009115.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X2 [Populus euphratica]
Length=592

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC+LLRL+ KVD  KE LDN+E ++GA + KRALS P +LIA N+G
Sbjct  434  ATKAAIEEGVVVGGGCSLLRLSTKVDGIKEFLDNEEQKIGAEIFKRALSYPARLIAKNSG  493

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V G+VVI +V S  +  YGYNAAT  YED   AGIIDP K VRCCLE A SVA  FLTSD
Sbjct  494  VNGNVVINQVLSNADIRYGYNAATDTYEDLITAGIIDPTKVVRCCLEHATSVAKTFLTSD  553

Query  285  AXVXXIKXPEP  253
            A V  I+  +P
Sbjct  554  AVVVDIRESDP  564



>ref|XP_010460335.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=636

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 100/137 (73%), Gaps = 0/137 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+A+EEGIVVGGGC LLRLA+KVD  K+ LDN E ++GA + K+ALS P +LIA NAG
Sbjct  465  ATKSAIEEGIVVGGGCALLRLASKVDRIKDTLDNTEQKIGAEIFKKALSYPIRLIAKNAG  524

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              G++VI KV S  N  YGYNAA  +YED  +AGIIDP K VRCCLE AASVA  FLTSD
Sbjct  525  TNGNIVIEKVLSNKNTMYGYNAAKNQYEDLMSAGIIDPTKVVRCCLEHAASVAQTFLTSD  584

Query  285  AXVXXIKXPEPAVVGNP  235
              V  IK  +P  + NP
Sbjct  585  CVVVEIKEIKPRPIINP  601



>ref|XP_006307550.1| hypothetical protein CARUB_v10009172mg [Capsella rubella]
 gb|EOA40448.1| hypothetical protein CARUB_v10009172mg [Capsella rubella]
Length=439

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 98/137 (72%), Gaps = 0/137 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+A+EEGIVVGGGC LLRLA KVD  K+ LDN E ++GA + K+ALS P +LIA NAG
Sbjct  268  ATKSAIEEGIVVGGGCALLRLATKVDRIKDTLDNTEQKIGADIFKKALSYPIRLIAKNAG  327

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              G++VI KV S  N  YGYNAA  +YED   AGIIDP K VRCCLE AASVA  FLTSD
Sbjct  328  TNGNIVIEKVLSNKNTMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHAASVAQTFLTSD  387

Query  285  AXVXXIKXPEPAVVGNP  235
              V  IK  +P  + NP
Sbjct  388  CVVVEIKEIKPRPIINP  404



>gb|KGN52011.1| hypothetical protein Csa_5G607990 [Cucumis sativus]
Length=619

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            A+KAA+EEG+VVGGGC LLRL+ KVDA K  L+NDE  VGA + KRALS P KLIA NAG
Sbjct  471  ASKAAIEEGVVVGGGCCLLRLSTKVDAIKNVLENDEQMVGAEIFKRALSYPTKLIARNAG  530

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI K+ S ++  YGYNAAT +YED   AGI+DP K VRCCLE AASV+  FLTSD
Sbjct  531  VNGSVVIDKILSNNDLDYGYNAATDRYEDLMKAGIMDPSKVVRCCLEHAASVSKTFLTSD  590

Query  285  AXVXXIKXPEPAVVGNPMXXSG  220
            A V  +K  +      PM  SG
Sbjct  591  AVVVDMKESQLIPRRTPMPISG  612



>ref|XP_011655733.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X2 [Cucumis sativus]
Length=551

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            A+KAA+EEG+VVGGGC LLRL+ KVDA K  L+NDE  VGA + KRALS P KLIA NAG
Sbjct  403  ASKAAIEEGVVVGGGCCLLRLSTKVDAIKNVLENDEQMVGAEIFKRALSYPTKLIARNAG  462

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI K+ S ++  YGYNAAT +YED   AGI+DP K VRCCLE AASV+  FLTSD
Sbjct  463  VNGSVVIDKILSNNDLDYGYNAATDRYEDLMKAGIMDPSKVVRCCLEHAASVSKTFLTSD  522

Query  285  AXVXXIKXPEPAVVGNPMXXSG  220
            A V  +K  +      PM  SG
Sbjct  523  AVVVDMKESQLIPRRTPMPISG  544



>ref|XP_004135135.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Cucumis sativus]
Length=597

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            A+KAA+EEG+VVGGGC LLRL+ KVDA K  L+NDE  VGA + KRALS P KLIA NAG
Sbjct  449  ASKAAIEEGVVVGGGCCLLRLSTKVDAIKNVLENDEQMVGAEIFKRALSYPTKLIARNAG  508

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI K+ S ++  YGYNAAT +YED   AGI+DP K VRCCLE AASV+  FLTSD
Sbjct  509  VNGSVVIDKILSNNDLDYGYNAATDRYEDLMKAGIMDPSKVVRCCLEHAASVSKTFLTSD  568

Query  285  AXVXXIKXPEPAVVGNPMXXSG  220
            A V  +K  +      PM  SG
Sbjct  569  AVVVDMKESQLIPRRTPMPISG  590



>ref|XP_010477881.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=551

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+A+EEGIVVGGGC LLRLA+KVD  K+ LDN E ++GA + K+ALS P +LIA NAG
Sbjct  380  ATKSAIEEGIVVGGGCALLRLASKVDKIKDTLDNSEQKIGAEIFKKALSYPIRLIAKNAG  439

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              G++VI KV S  N  YGYNAA  +YED   AGIIDP K VRCCLE AASVA  FLTSD
Sbjct  440  TNGNIVIEKVLSNKNTMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHAASVAQTFLTSD  499

Query  285  AXVXXIKXPEPAVVGNP  235
              V  IK  +P  + NP
Sbjct  500  CVVVEIKEIKPRPIINP  516



>ref|XP_010477879.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010477880.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=607

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+A+EEGIVVGGGC LLRLA+KVD  K+ LDN E ++GA + K+ALS P +LIA NAG
Sbjct  436  ATKSAIEEGIVVGGGCALLRLASKVDKIKDTLDNSEQKIGAEIFKKALSYPIRLIAKNAG  495

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              G++VI KV S  N  YGYNAA  +YED   AGIIDP K VRCCLE AASVA  FLTSD
Sbjct  496  TNGNIVIEKVLSNKNTMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHAASVAQTFLTSD  555

Query  285  AXVXXIKXPEPAVVGNP  235
              V  IK  +P  + NP
Sbjct  556  CVVVEIKEIKPRPIINP  572



>ref|XP_007045689.1| TCP-1/cpn60 chaperonin family protein isoform 1 [Theobroma cacao]
 gb|EOY01521.1| TCP-1/cpn60 chaperonin family protein isoform 1 [Theobroma cacao]
Length=617

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC LLRL+AKVD  K  LDN E ++GA + KRALS P KLIA NAG
Sbjct  460  ATKAAIEEGVVVGGGCILLRLSAKVDGIKSLLDNQEQKIGAEIFKRALSYPTKLIAKNAG  519

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+ KV S D+  YGYNAA+  YED   AGI+DP K VRCCLE AASVA  FLTSD
Sbjct  520  VNGSVVVGKVLSNDDIRYGYNAASNSYEDLMKAGIMDPTKVVRCCLENAASVAKTFLTSD  579

Query  285  AXVXXI  268
            A V  I
Sbjct  580  AVVVDI  585



>gb|KJB11272.1| hypothetical protein B456_001G250800 [Gossypium raimondii]
Length=430

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC LLRL+ KVD+ K  LDN E ++GA + KRALS P KLIA NAG
Sbjct  270  ATKAAIEEGVVVGGGCILLRLSEKVDSIKNLLDNQEQKIGAEIFKRALSYPTKLIAKNAG  329

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+ KV S ++  YGYNAA   YED   AGI+DP K VRCCLE AASVA  FLTSD
Sbjct  330  VNGSVVVEKVLSNNDTRYGYNAARNSYEDLIKAGIMDPTKVVRCCLEHAASVAKVFLTSD  389

Query  285  AXVXXI  268
            A V  I
Sbjct  390  AVVVDI  395



>gb|KJB11273.1| hypothetical protein B456_001G250800 [Gossypium raimondii]
Length=451

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC LLRL+ KVD+ K  LDN E ++GA + KRALS P KLIA NAG
Sbjct  291  ATKAAIEEGVVVGGGCILLRLSEKVDSIKNLLDNQEQKIGAEIFKRALSYPTKLIAKNAG  350

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+ KV S ++  YGYNAA   YED   AGI+DP K VRCCLE AASVA  FLTSD
Sbjct  351  VNGSVVVEKVLSNNDTRYGYNAARNSYEDLIKAGIMDPTKVVRCCLEHAASVAKVFLTSD  410

Query  285  AXVXXI  268
            A V  I
Sbjct  411  AVVVDI  416



>ref|XP_010499067.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X3 [Camelina sativa]
Length=551

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+A+EEGIVVGGGC LLRLA+KVD  K+ LDN E ++GA + K+ALS P +LIA NAG
Sbjct  380  ATKSAIEEGIVVGGGCALLRLASKVDRIKDTLDNTEQKIGAEIFKKALSYPIRLIAKNAG  439

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              G++VI K+ S  N  YGYNAA  +YED   AGIIDP K VRCCLE AASVA  FLTSD
Sbjct  440  TNGNIVIEKILSNKNTMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHAASVAQTFLTSD  499

Query  285  AXVXXIKXPEPAVVGNP  235
              V  IK  +P  + NP
Sbjct  500  CVVVEIKEIKPRPIINP  516



>gb|KJB11274.1| hypothetical protein B456_001G250800 [Gossypium raimondii]
Length=486

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC LLRL+ KVD+ K  LDN E ++GA + KRALS P KLIA NAG
Sbjct  326  ATKAAIEEGVVVGGGCILLRLSEKVDSIKNLLDNQEQKIGAEIFKRALSYPTKLIAKNAG  385

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+ KV S ++  YGYNAA   YED   AGI+DP K VRCCLE AASVA  FLTSD
Sbjct  386  VNGSVVVEKVLSNNDTRYGYNAARNSYEDLIKAGIMDPTKVVRCCLEHAASVAKVFLTSD  445

Query  285  AXVXXI  268
            A V  I
Sbjct  446  AVVVDI  451



>ref|XP_006415907.1| hypothetical protein EUTSA_v10007125mg [Eutrema salsugineum]
 gb|ESQ34260.1| hypothetical protein EUTSA_v10007125mg [Eutrema salsugineum]
Length=604

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+A+EEGIVVGGGC LLRLA+KVD+ K+ LDN E ++GA + ++ALS P +LIA NAG
Sbjct  434  ATKSAIEEGIVVGGGCALLRLASKVDSIKDTLDNTEQKMGAEIFRKALSYPIRLIAKNAG  493

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              G++VI KV   +N  YGYNAA  +YED   AGIIDP K VRCCLE AASVA  FLTSD
Sbjct  494  TNGNIVIEKVLLNENMMYGYNAAKNRYEDLMLAGIIDPTKVVRCCLEHAASVAKTFLTSD  553

Query  285  AXVXXIKXPEPAVVGNP  235
            A V  IK  +P  + NP
Sbjct  554  AVVVEIKEIKPRPIINP  570



>emb|CBI27426.3| unnamed protein product [Vitis vinifera]
Length=584

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC+LLRL+ KVD  KE LDN+E ++GA + KRAL+ P +LIA NAG
Sbjct  402  ATKAAIEEGVVVGGGCSLLRLSLKVDGIKELLDNEEQKIGAEIFKRALTYPARLIAKNAG  461

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V  SVVI KV S D+  YGYNAA   YED  AAGI+DP K VRCCLE AASVA  FLTSD
Sbjct  462  VNDSVVIEKVLSNDDFRYGYNAAIDCYEDLMAAGIMDPSKVVRCCLEHAASVAKTFLTSD  521

Query  285  AXVXXIK  265
            A V  IK
Sbjct  522  AVVVDIK  528



>ref|XP_010499065.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X1 [Camelina sativa]
Length=636

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+A+EEGIVVGGGC LLRLA+KVD  K+ LDN E ++GA + K+ALS P +LIA NAG
Sbjct  465  ATKSAIEEGIVVGGGCALLRLASKVDRIKDTLDNTEQKIGAEIFKKALSYPIRLIAKNAG  524

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              G++VI K+ S  N  YGYNAA  +YED   AGIIDP K VRCCLE AASVA  FLTSD
Sbjct  525  TNGNIVIEKILSNKNTMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHAASVAQTFLTSD  584

Query  285  AXVXXIKXPEPAVVGNP  235
              V  IK  +P  + NP
Sbjct  585  CVVVEIKEIKPRPIINP  601



>ref|XP_010499066.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X2 [Camelina sativa]
Length=608

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+A+EEGIVVGGGC LLRLA+KVD  K+ LDN E ++GA + K+ALS P +LIA NAG
Sbjct  437  ATKSAIEEGIVVGGGCALLRLASKVDRIKDTLDNTEQKIGAEIFKKALSYPIRLIAKNAG  496

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              G++VI K+ S  N  YGYNAA  +YED   AGIIDP K VRCCLE AASVA  FLTSD
Sbjct  497  TNGNIVIEKILSNKNTMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHAASVAQTFLTSD  556

Query  285  AXVXXIKXPEPAVVGNP  235
              V  IK  +P  + NP
Sbjct  557  CVVVEIKEIKPRPIINP  573



>ref|XP_002269341.2| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic [Vitis 
vinifera]
Length=610

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC+LLRL+ KVD  KE LDN+E ++GA + KRAL+ P +LIA NAG
Sbjct  428  ATKAAIEEGVVVGGGCSLLRLSLKVDGIKELLDNEEQKIGAEIFKRALTYPARLIAKNAG  487

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V  SVVI KV S D+  YGYNAA   YED  AAGI+DP K VRCCLE AASVA  FLTSD
Sbjct  488  VNDSVVIEKVLSNDDFRYGYNAAIDCYEDLMAAGIMDPSKVVRCCLEHAASVAKTFLTSD  547

Query  285  AXVXXIK  265
            A V  IK
Sbjct  548  AVVVDIK  554



>ref|XP_008446494.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X2 [Cucumis melo]
Length=553

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            A+KAA+EEG+VVGGGC LLRL+ KVDA K  L+NDE  +GA + KRALS P KLIA NAG
Sbjct  405  ASKAAIEEGVVVGGGCCLLRLSTKVDAIKNVLENDEQMIGAEIFKRALSYPTKLIARNAG  464

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI K+ S ++  YGYNAAT +YE+   AGI+DP K VRCCLE AASV+  FLTSD
Sbjct  465  VNGSVVIDKILSNNDLDYGYNAATDRYENLMKAGIMDPSKVVRCCLEHAASVSKTFLTSD  524

Query  285  AXVXXIKXPEPAVVGNPMXXSG  220
            A V  +K  +      PM  SG
Sbjct  525  AVVVDMKESQLIPRRTPMPISG  546



>ref|XP_008446493.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Cucumis melo]
Length=599

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            A+KAA+EEG+VVGGGC LLRL+ KVDA K  L+NDE  +GA + KRALS P KLIA NAG
Sbjct  451  ASKAAIEEGVVVGGGCCLLRLSTKVDAIKNVLENDEQMIGAEIFKRALSYPTKLIARNAG  510

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVVI K+ S ++  YGYNAAT +YE+   AGI+DP K VRCCLE AASV+  FLTSD
Sbjct  511  VNGSVVIDKILSNNDLDYGYNAATDRYENLMKAGIMDPSKVVRCCLEHAASVSKTFLTSD  570

Query  285  AXVXXIKXPEPAVVGNPMXXSG  220
            A V  +K  +      PM  SG
Sbjct  571  AVVVDMKESQLIPRRTPMPISG  592



>gb|EYU28916.1| hypothetical protein MIMGU_mgv1a003338mg [Erythranthe guttata]
Length=591

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 105/149 (70%), Gaps = 5/149 (3%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC LLRL+ K+ + +E LDN+E ++GA ++KRALS P + IA NAG
Sbjct  437  ATKAAIEEGVVVGGGCCLLRLSTKIASIRENLDNEEQKIGADILKRALSYPARQIAKNAG  496

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GS VI K+   D+  YGYNAA   YED  AAGIIDP K VRCCLE AASVA  FLT+D
Sbjct  497  VNGSTVIQKILLSDDVNYGYNAAKDIYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTAD  556

Query  285  AXVXXIKXP---EPAVVGN--PMXXSGXG  214
            A V  IK P    P ++G   PM  SG G
Sbjct  557  AVVVEIKEPVKARPNLMGERKPMPTSGIG  585



>gb|KJB11275.1| hypothetical protein B456_001G250800 [Gossypium raimondii]
Length=560

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC LLRL+ KVD+ K  LDN E ++GA + KRALS P KLIA NAG
Sbjct  400  ATKAAIEEGVVVGGGCILLRLSEKVDSIKNLLDNQEQKIGAEIFKRALSYPTKLIAKNAG  459

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+ KV S ++  YGYNAA   YED   AGI+DP K VRCCLE AASVA  FLTSD
Sbjct  460  VNGSVVVEKVLSNNDTRYGYNAARNSYEDLIKAGIMDPTKVVRCCLEHAASVAKVFLTSD  519

Query  285  AXVXXI  268
            A V  I
Sbjct  520  AVVVDI  525



>ref|XP_007514774.1| chaperonin GroEL [Bathycoccus prasinos]
 emb|CCO15014.1| chaperonin GroEL [Bathycoccus prasinos]
Length=589

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIV+GGG T L+L   VD  K+ LDNDE R+GA ++KRALS P +L+A N+G
Sbjct  443  ATKAAVEEGIVIGGGTTFLKLGQFVDGIKDELDNDEQRLGADIIKRALSYPMRLVAYNSG  502

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSV + KV S +NP YG+NAATGK+ED   +GIIDP K +RCCLE + SVA  FLTSD
Sbjct  503  VNGSVTVQKVLSENNPDYGFNAATGKFEDLMKSGIIDPTKVIRCCLENSVSVAKIFLTSD  562

Query  285  AXVXXIKXPEPA  250
              V  I   E A
Sbjct  563  VVVCEIPEGEEA  574



>emb|CDY66193.1| BnaA07g36980D [Brassica napus]
Length=607

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 100/137 (73%), Gaps = 0/137 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+A+EEGIVVGGG  LLRLAAKVD+ K+ LDN E ++GA + K+ALS P +LIA NAG
Sbjct  437  ATKSAIEEGIVVGGGSALLRLAAKVDSIKDSLDNTEQKIGAEIFKKALSYPIRLIAKNAG  496

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              G++VI KV   +N  YGYNAA  +YED   AGIIDP K VRCCLE AASVA  FLTSD
Sbjct  497  TNGNIVIEKVLLNENMMYGYNAAKNQYEDLMMAGIIDPTKVVRCCLEHAASVANTFLTSD  556

Query  285  AXVXXIKXPEPAVVGNP  235
            A V  IK  +P  + NP
Sbjct  557  AVVVEIKENKPRPMINP  573



>ref|NP_001185097.1| chaperonin 60 subunit beta 4 [Arabidopsis thaliana]
 gb|AEE30664.1| chaperonin 60 subunit beta 4 [Arabidopsis thaliana]
Length=559

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 97/137 (71%), Gaps = 0/137 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+A+EEGIVVGGGC LLRLA KVD  KE LDN E ++GA + K+ALS P +LIA NA 
Sbjct  388  ATKSAIEEGIVVGGGCALLRLATKVDRIKETLDNTEQKIGAEIFKKALSYPIRLIAKNAD  447

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              G++VI KV S  N  YGYNAA  +YED   AGIIDP K VRCCLE A+SVA  FLTSD
Sbjct  448  TNGNIVIEKVLSNKNTMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHASSVAQTFLTSD  507

Query  285  AXVXXIKXPEPAVVGNP  235
              V  IK  +P  + NP
Sbjct  508  CVVVEIKEIKPRPIINP  524



>gb|KJB11271.1| hypothetical protein B456_001G250800 [Gossypium raimondii]
 gb|KJB11276.1| hypothetical protein B456_001G250800 [Gossypium raimondii]
Length=599

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC LLRL+ KVD+ K  LDN E ++GA + KRALS P KLIA NAG
Sbjct  439  ATKAAIEEGVVVGGGCILLRLSEKVDSIKNLLDNQEQKIGAEIFKRALSYPTKLIAKNAG  498

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+ KV S ++  YGYNAA   YED   AGI+DP K VRCCLE AASVA  FLTSD
Sbjct  499  VNGSVVVEKVLSNNDTRYGYNAARNSYEDLIKAGIMDPTKVVRCCLEHAASVAKVFLTSD  558

Query  285  AXVXXI  268
            A V  I
Sbjct  559  AVVVDI  564



>ref|NP_173947.1| chaperonin 60 subunit beta 4 [Arabidopsis thaliana]
 sp|Q9C667.1|CPNB4_ARATH RecName: Full=Chaperonin 60 subunit beta 4, chloroplastic; Short=CPN-60 
beta 4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG50688.1|AC079829_21 chaperonin precursor, putative [Arabidopsis thaliana]
 gb|AEE30663.1| chaperonin 60 subunit beta 4 [Arabidopsis thaliana]
Length=611

 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 97/137 (71%), Gaps = 0/137 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+A+EEGIVVGGGC LLRLA KVD  KE LDN E ++GA + K+ALS P +LIA NA 
Sbjct  440  ATKSAIEEGIVVGGGCALLRLATKVDRIKETLDNTEQKIGAEIFKKALSYPIRLIAKNAD  499

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              G++VI KV S  N  YGYNAA  +YED   AGIIDP K VRCCLE A+SVA  FLTSD
Sbjct  500  TNGNIVIEKVLSNKNTMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHASSVAQTFLTSD  559

Query  285  AXVXXIKXPEPAVVGNP  235
              V  IK  +P  + NP
Sbjct  560  CVVVEIKEIKPRPIINP  576



>dbj|BAD95277.1| chaperonin precursor [Arabidopsis thaliana]
Length=611

 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 97/137 (71%), Gaps = 0/137 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+A+EEGIVVGGGC LLRLA KVD  KE LDN E ++GA + K+ALS P +LIA NA 
Sbjct  440  ATKSAIEEGIVVGGGCALLRLATKVDRIKETLDNTEQKIGAEIFKKALSYPIRLIAKNAD  499

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              G++VI KV S  N  YGYNAA  +YED   AGIIDP K VRCCLE A+SVA  FLTSD
Sbjct  500  TNGNIVIEKVLSNKNTMYGYNAAKNQYEDLMLAGIIDPTKVVRCCLEHASSVAQTFLTSD  559

Query  285  AXVXXIKXPEPAVVGNP  235
              V  IK  +P  + NP
Sbjct  560  CVVVEIKEIKPRPIINP  576



>emb|CDP00506.1| unnamed protein product [Coffea canephora]
Length=554

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 104/145 (72%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC LLRL+ KV+  K  LDN+E R+GA ++++AL+ P + IA N+G
Sbjct  402  ATKAAIEEGVVVGGGCCLLRLSLKVEDIKNHLDNEEQRIGADILRKALAYPARQIAKNSG  461

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            + G+ VI KV S DN  YGYNAA  KYED  AA I+DP K VRCCLE AASVA  FLTSD
Sbjct  462  LNGNAVIEKVLSVDNAAYGYNAARDKYEDLVAARILDPSKVVRCCLEHAASVANTFLTSD  521

Query  285  AXVXXIKXPEP-AVVGNPMXXSGXG  214
            A V  IK P P  ++  P+  SG G
Sbjct  522  AVVIDIKEPVPNNLMRKPLPTSGIG  546



>ref|XP_004297181.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X1 [Fragaria vesca subsp. vesca]
Length=616

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC LLRL+ KVD  KE +DN+E ++GA + K+ALS P KLIA NAG
Sbjct  435  ATKAAIEEGVVVGGGCCLLRLSKKVDVFKELMDNEEQKIGAEIFKKALSYPAKLIAKNAG  494

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+ KV S  N  YGYNAA   YED   AGI+DP K VRCCLE AASVA  FL SD
Sbjct  495  VNGSVVVEKVLSNANMGYGYNAARDCYEDLMKAGIMDPSKVVRCCLEHAASVAKTFLLSD  554

Query  285  AXVXXIKXPEP  253
            A V  IK   P
Sbjct  555  AVVVEIKESNP  565



>ref|XP_006348604.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like [Solanum 
tuberosum]
Length=594

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 98/131 (75%), Gaps = 2/131 (2%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            AT+AA EEG+VVGGGC LLRL++KVDA KE LDN++ ++GA + KRALS P K IA NAG
Sbjct  436  ATRAATEEGVVVGGGCCLLRLSSKVDAIKEMLDNEDQKIGADIFKRALSYPAKQIAKNAG  495

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GS+V+ K+ S D+  YGYNAA  +YED  AA I+DP K VRCCLE AA+VA  FL SD
Sbjct  496  VNGSIVVEKILSVDDMKYGYNAARDRYEDLMAAKILDPTKVVRCCLEHAAAVAKTFLISD  555

Query  285  AXVXXIKXPEP  253
            A V  I  PEP
Sbjct  556  AVV--IDIPEP  564



>ref|XP_011009108.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X1 [Populus euphratica]
Length=593

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXR-VGAXLVKRALSXPXKLIAXNA  469
            ATKAA+EEG+VVGGGC+LLRL+ KVD  KE LDN+E + +GA + KRALS P +LIA N+
Sbjct  434  ATKAAIEEGVVVGGGCSLLRLSTKVDGIKEFLDNEEQKMIGAEIFKRALSYPARLIAKNS  493

Query  468  GVXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTS  289
            GV G+VVI +V S  +  YGYNAAT  YED   AGIIDP K VRCCLE A SVA  FLTS
Sbjct  494  GVNGNVVINQVLSNADIRYGYNAATDTYEDLITAGIIDPTKVVRCCLEHATSVAKTFLTS  553

Query  288  DAXVXXIKXPEP  253
            DA V  I+  +P
Sbjct  554  DAVVVDIRESDP  565



>ref|XP_008804418.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Phoenix dactylifera]
Length=595

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 97/131 (74%), Gaps = 0/131 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+A+EEG+VVGGGC+LLRL+ KVD+ KE LDN+E  +GA + KRALS P KLIA NAG
Sbjct  427  ATKSAIEEGVVVGGGCSLLRLSMKVDSIKESLDNEEQMIGADIFKRALSYPSKLIAKNAG  486

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            + G VV+ KV S ++  YGYNAA   YED  AAGI+DP K VRCC+E AA+VA  FLTSD
Sbjct  487  INGDVVVEKVLSSNDVRYGYNAAKNCYEDLMAAGILDPTKVVRCCVEHAAAVAKTFLTSD  546

Query  285  AXVXXIKXPEP  253
              V   K  EP
Sbjct  547  VVVVDTKEAEP  557



>ref|XP_010905780.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Elaeis guineensis]
Length=595

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 97/131 (74%), Gaps = 0/131 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+A+EEG+VVGGGC+LLRL+ KVD+ KE LDN+E  +GA + KRALS P KLIA NAG
Sbjct  427  ATKSAIEEGVVVGGGCSLLRLSMKVDSIKESLDNEEQMIGADIFKRALSYPSKLIAKNAG  486

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            + G VV+ KV S ++  YGYNAA   YED  AAGI+DP K VRCC+E AA+VA  FLTSD
Sbjct  487  INGDVVVEKVLSSNDVRYGYNAAKNCYEDLMAAGILDPTKVVRCCVEHAAAVAKTFLTSD  546

Query  285  AXVXXIKXPEP  253
              V   K  EP
Sbjct  547  VVVVDTKEAEP  557



>sp|Q42695.1|RUBC_CHLRE RecName: Full=RuBisCO large subunit-binding protein subunit beta-2; 
AltName: Full=60 kDa chaperonin subunit beta-2; AltName: 
Full=CPN-60 beta-2, partial [Chlamydomonas reinhardtii]
 gb|AAA98643.1| chaperonin beta-like subunit [Chlamydomonas reinhardtii]
Length=259

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 98/140 (70%), Gaps = 5/140 (4%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIV+GGGCTLLRL+ KVD+ KE L N+E ++GA ++KRALS P KLIA NAG
Sbjct  117  ATKAAVEEGIVIGGGCTLLRLSQKVDSIKETLSNEEQKMGADIIKRALSYPIKLIANNAG  176

Query  465  VXGSVVIXKVX-SPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTS  289
              GSVV+ +V  + D P YGYNAAT  +ED   AGIIDP K VRC LE A SVA  FL +
Sbjct  177  TNGSVVMQRVMDNIDQPYYGYNAATDTFEDLMEAGIIDPTKVVRCSLENAVSVAKTFLLA  236

Query  288  DAXVXXI----KXPEPAVVG  241
            D  V  I    K P PA  G
Sbjct  237  DVVVTEIPEKEKAPAPAAGG  256



>ref|XP_009418029.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=591

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 95/130 (73%), Gaps = 0/130 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGCTLLRL+  VD  K+ LDN+E ++GA + KRALS P KLIA NAG
Sbjct  427  ATKAAIEEGVVVGGGCTLLRLSTMVDGIKDYLDNEEQKIGADIFKRALSYPAKLIAKNAG  486

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V G V++ KV S D+  YGYNAA   YED  AAGI+DP K VRCCLE AA+ A  FLTSD
Sbjct  487  VNGDVIVNKVLSNDDIRYGYNAAMNCYEDLVAAGILDPSKVVRCCLEHAAATAKTFLTSD  546

Query  285  AXVXXIKXPE  256
              V  +K  E
Sbjct  547  LVVVDVKGTE  556



>ref|XP_004490321.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X1 [Cicer arietinum]
Length=578

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 100/141 (71%), Gaps = 0/141 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            AT+AA+EEG+VVGGGC+LLRL+ KVD  K  LDN+E ++GA + KRALS P ++IA NAG
Sbjct  430  ATRAAIEEGVVVGGGCSLLRLSMKVDGIKSLLDNEEQKIGAEIFKRALSYPARMIAKNAG  489

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V G++VI KV S DN  +GYNAA   YED   A I+DP K VRCC+E AASVA  FLTS+
Sbjct  490  VNGNIVIDKVLSNDNMNFGYNAARDCYEDLMKARIMDPTKVVRCCIEHAASVAKTFLTSN  549

Query  285  AXVXXIKXPEPAVVGNPMXXS  223
            A V  +K  +P     PM  S
Sbjct  550  AVVIDLKELQPLPQRKPMAAS  570



>ref|XP_009611004.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Nicotiana tomentosiformis]
Length=612

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 97/131 (74%), Gaps = 2/131 (2%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            A +AA EEG+VVGGGC LLRL++KVDA KE LDN++ ++GA + KRALS P K IA NAG
Sbjct  436  AARAATEEGVVVGGGCCLLRLSSKVDAIKEMLDNEDQKIGADIFKRALSYPAKQIAKNAG  495

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V G++V+ K+ S DN  YGYNAA  +YED  AA I+DP K VRCCLE AA+VA  FL SD
Sbjct  496  VNGNIVVEKILSVDNMKYGYNAARDRYEDLMAAKILDPAKVVRCCLEHAAAVAKTFLISD  555

Query  285  AXVXXIKXPEP  253
            A V  I  PEP
Sbjct  556  AVV--IDIPEP  564



>ref|XP_009774325.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X2 [Nicotiana sylvestris]
Length=547

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 95/131 (73%), Gaps = 2/131 (2%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            A +AA EEG+VVGGGC LLRL+ KVDA KE LDND+ ++GA +VKRALS P K IA NAG
Sbjct  371  AARAATEEGVVVGGGCCLLRLSIKVDAIKEMLDNDDQKIGADIVKRALSYPAKQIAKNAG  430

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V G++ + K+ S DN  YGYN A  +YED  AA I+DP K VRCCLE AA+VA  FL SD
Sbjct  431  VNGNIAVEKILSVDNMKYGYNVARDRYEDLMAAKILDPAKVVRCCLEHAAAVAKTFLISD  490

Query  285  AXVXXIKXPEP  253
            A V  I  PEP
Sbjct  491  AVV--IDIPEP  499



>ref|XP_011623265.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Amborella trichopoda]
Length=584

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 101/144 (70%), Gaps = 2/144 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            +T+AA+EEGIVVGGGCT+LRL+ KVD  K+ L+N+E +VGA + ++AL  P K IA NAG
Sbjct  411  STRAAIEEGIVVGGGCTMLRLSLKVDTIKKSLENEEQKVGADIFRKALVYPMKRIAENAG  470

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            + G+VV+ KV   ++  YGYNA+ G YED  AAGIIDP K VRCCLE AASVA  FL SD
Sbjct  471  INGNVVVEKVMLTEDVRYGYNASKGIYEDLMAAGIIDPSKVVRCCLEHAASVAKTFLMSD  530

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  IK PE   V  P+   G G
Sbjct  531  VVVSEIKEPEA--VRMPLQSPGMG  552



>ref|XP_009774324.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Nicotiana sylvestris]
Length=612

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 95/131 (73%), Gaps = 2/131 (2%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            A +AA EEG+VVGGGC LLRL+ KVDA KE LDND+ ++GA +VKRALS P K IA NAG
Sbjct  436  AARAATEEGVVVGGGCCLLRLSIKVDAIKEMLDNDDQKIGADIVKRALSYPAKQIAKNAG  495

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V G++ + K+ S DN  YGYN A  +YED  AA I+DP K VRCCLE AA+VA  FL SD
Sbjct  496  VNGNIAVEKILSVDNMKYGYNVARDRYEDLMAAKILDPAKVVRCCLEHAAAVAKTFLISD  555

Query  285  AXVXXIKXPEP  253
            A V  I  PEP
Sbjct  556  AVV--IDIPEP  564



>ref|XP_011397598.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Auxenochlorella protothecoides]
 gb|KFM24710.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Auxenochlorella protothecoides]
Length=529

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 94/130 (72%), Gaps = 0/130 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIV GGGCTLL+LA ++DA +  LDNDE R+GA +++RAL  P KLIA NAG
Sbjct  386  ATKAAVEEGIVTGGGCTLLQLAQRIDAFRGSLDNDEQRMGADILRRALPYPLKLIASNAG  445

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              GSVV+ +V    +P +GYNAATG YED  AAGIIDP K +RC LE AASVA  FLTS 
Sbjct  446  DNGSVVMQRVLDGGSPAFGYNAATGAYEDLLAAGIIDPAKVIRCALENAASVAKTFLTSS  505

Query  285  AXVXXIKXPE  256
              V  I   E
Sbjct  506  VIVTEIPQEE  515



>ref|XP_006574985.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like [Glycine 
max]
 gb|KHN29911.1| Chaperonin 60 subunit beta 4, chloroplastic [Glycine soja]
Length=605

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC+LLRL+ KVD  K+ LDN+E ++GA + +RALS P ++IA NAG
Sbjct  432  ATKAAIEEGVVVGGGCSLLRLSQKVDGIKKLLDNEEQQIGAEIFRRALSYPTRMIAKNAG  491

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            + G+V+I KV S +N  +GYNAA   YED   AGI+DP K VRCC+E +ASVA  FLTS+
Sbjct  492  LNGNVIIDKVLSDNNMNFGYNAARDSYEDLMKAGIMDPTKVVRCCIEHSASVAKAFLTSN  551

Query  285  AXVXXIKXPEP  253
            A V   K  EP
Sbjct  552  AVVVERKELEP  562



>ref|XP_006653448.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like [Oryza 
brachyantha]
Length=583

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 98/138 (71%), Gaps = 0/138 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            AT+AA+EEG+V+GGGC+LLRL+ K+DA KE LDN E ++GA + K+ALS P  LIA NAG
Sbjct  428  ATRAAIEEGVVIGGGCSLLRLSMKIDAIKESLDNVEQKIGADIFKQALSYPTALIASNAG  487

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V G+ VI K+   D+  YGYNAA  +YED  AAGI+DP K VRCC+E AA VA  FLTSD
Sbjct  488  VNGNFVIEKLLLNDDSRYGYNAAKDRYEDLMAAGILDPSKVVRCCIEHAAVVAKSFLTSD  547

Query  285  AXVXXIKXPEPAVVGNPM  232
              V   K  +P  +  PM
Sbjct  548  VVVVEAKESKPVRIRPPM  565



>ref|XP_010696183.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Beta vulgaris subsp. vulgaris]
Length=584

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 100/145 (69%), Gaps = 1/145 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            A KAA+EEG+VVGGGCTLLRL+ KVD  KE LDN+E +VGA + +RALS P + IA NAG
Sbjct  436  AAKAAIEEGVVVGGGCTLLRLSLKVDEIKEQLDNEEQKVGAEIFRRALSYPIRKIAENAG  495

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+ KV S D+  YGYNAA+  Y++   AGI+DP K VRCCLE AASVA  FL SD
Sbjct  496  VSGSVVVQKVLSNDDLRYGYNAASDCYQNLMEAGIMDPTKVVRCCLEHAASVAKTFLISD  555

Query  285  AXVXXIKXPEPA-VVGNPMXXSGXG  214
            A    I+   P      PM  SG G
Sbjct  556  AVAVDIEERRPFPRTPMPMPMSGVG  580



>emb|CEF98707.1| Chaperonin Cpn60 [Ostreococcus tauri]
Length=593

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 101/146 (69%), Gaps = 4/146 (3%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIV+GGGCT L+LAA VD  KE LDNDE +VGA ++KRALS P +L+A NAG
Sbjct  445  ATKAAVEEGIVIGGGCTFLKLAAAVDGIKETLDNDEQKVGADIIKRALSYPIRLVAHNAG  504

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSV   +V S  +P +G+NAATG++ED   +G++DP K +RC LE A SVA  FLTSD
Sbjct  505  VNGSVTCERVMSSADPNFGFNAATGQFEDLMESGVLDPTKVIRCSLENACSVAKIFLTSD  564

Query  285  AXVXXIKXPEP----AVVGNPMXXSG  220
              V  I   E     A  G+ M  SG
Sbjct  565  VVVCEIPEDEDAAAAAAAGSAMDNSG  590



>ref|XP_010066785.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic [Eucalyptus 
grandis]
 gb|KCW64830.1| hypothetical protein EUGRSUZ_G02400 [Eucalyptus grandis]
Length=594

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 100/139 (72%), Gaps = 1/139 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+V+GGGC+LLRL+ KVD  KE LDN+E ++GA + K+ALS P + IA NAG
Sbjct  436  ATKAAIEEGVVIGGGCSLLRLSTKVDCIKEHLDNEEQKIGAEIFKKALSYPARQIAKNAG  495

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV+ KV S +   YGYNAA   YED  AAGI+DP K VRC LE AASVA  FLTSD
Sbjct  496  VNGSVVVEKVLSSNVMNYGYNAARDCYEDLLAAGIMDPTKVVRCSLEHAASVAKTFLTSD  555

Query  285  AXVXXIKXPE-PAVVGNPM  232
            A V  IK  E P  +  PM
Sbjct  556  AVVVDIKEVEQPIRMPMPM  574



>ref|XP_003080325.1| RUBISCO SUBUNIT BINDING-PROTEIN BETA-2 SUBUNIT (60 KD CHAPERONIN 
(IC) [Ostreococcus tauri]
Length=621

 Score =   137 bits (344),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 101/146 (69%), Gaps = 4/146 (3%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIV+GGGCT L+LAA VD  KE LDNDE +VGA ++KRALS P +L+A NAG
Sbjct  473  ATKAAVEEGIVIGGGCTFLKLAAAVDGIKETLDNDEQKVGADIIKRALSYPIRLVAHNAG  532

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSV   +V S  +P +G+NAATG++ED   +G++DP K +RC LE A SVA  FLTSD
Sbjct  533  VNGSVTCERVMSSADPNFGFNAATGQFEDLMESGVLDPTKVIRCSLENACSVAKIFLTSD  592

Query  285  AXVXXIKXPEP----AVVGNPMXXSG  220
              V  I   E     A  G+ M  SG
Sbjct  593  VVVCEIPEDEDAAAAAAAGSAMDNSG  618



>ref|XP_001692504.1| chaperonin 60B2 [Chlamydomonas reinhardtii]
 gb|EDP03982.1| chaperonin 60B2 [Chlamydomonas reinhardtii]
Length=577

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 98/140 (70%), Gaps = 5/140 (4%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIV+GGGCTLLRL+ KVD+ KE L N+E ++GA ++KRALS P KLIA NAG
Sbjct  433  ATKAAVEEGIVIGGGCTLLRLSQKVDSIKETLSNEEQKMGADIIKRALSYPIKLIANNAG  492

Query  465  VXGSVVIXKVX-SPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTS  289
              GSVV+ +V  + D P YGYNAAT  +ED   AGIIDP K VRC LE A SVA  FL +
Sbjct  493  TNGSVVMQRVMDNIDQPYYGYNAATDTFEDLMEAGIIDPTKVVRCSLENAVSVAKTFLLA  552

Query  288  DAXVXXI----KXPEPAVVG  241
            D  V  I    K P PA  G
Sbjct  553  DVVVTEIPEKEKAPAPAAGG  572



>ref|XP_005843554.1| hypothetical protein CHLNCDRAFT_59809 [Chlorella variabilis]
 gb|EFN51452.1| hypothetical protein CHLNCDRAFT_59809 [Chlorella variabilis]
Length=584

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 94/130 (72%), Gaps = 0/130 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIV GGGC LLRL++ VDA K  L ++E +VGA +VKRAL    KLIA NAG
Sbjct  441  ATKAAVEEGIVTGGGCALLRLSSMVDAFKAGLTDEEQKVGADIVKRALPYSLKLIANNAG  500

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              GSVV+ +V    NP +GYNAATGK+ED  AAGIIDP K VRC LE AASVA  FLTSD
Sbjct  501  DNGSVVMQRVLEDANPNFGYNAATGKFEDLMAAGIIDPVKVVRCALENAASVAKVFLTSD  560

Query  285  AXVXXIKXPE  256
              V  I  PE
Sbjct  561  VVVVAIPEPE  570



>gb|EEC67866.1| hypothetical protein OsI_35492 [Oryza sativa Indica Group]
Length=588

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 97/138 (70%), Gaps = 0/138 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+V+GGGC+LLRL+ K+D  KE LDN E ++GA + K+ALS P  LIA NAG
Sbjct  433  ATKAAIEEGVVIGGGCSLLRLSMKIDRIKESLDNMEQKIGADIFKQALSYPTALIANNAG  492

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GS VI KV   ++  YGYNAA  +YED  AAGI+DP K VRCC+E AA VA  FLTSD
Sbjct  493  VNGSFVIEKVLLNEDSRYGYNAAKNRYEDLMAAGILDPSKVVRCCIEHAAVVAKSFLTSD  552

Query  285  AXVXXIKXPEPAVVGNPM  232
              +   K  +P  +  PM
Sbjct  553  VVIVEAKEGKPVRIRPPM  570



>ref|XP_003057879.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57830.1| predicted protein [Micromonas pusilla CCMP1545]
Length=593

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 102/144 (71%), Gaps = 0/144 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIV+GGGCTLL+LAA V+  K  L N+E ++GA ++++AL+ P +LIA NAG
Sbjct  449  ATKAAVEEGIVIGGGCTLLKLAAAVEDIKAALPNEEQKLGADIIRKALAYPMRLIASNAG  508

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              GSVV+ +V +  +P +GYNAATGK+ED    G+IDP K +RC LE + SVA  FLTSD
Sbjct  509  DNGSVVVERVTNSKDPDFGYNAATGKFEDLMVGGVIDPTKVIRCALENSVSVAKIFLTSD  568

Query  285  AXVXXIKXPEPAVVGNPMXXSGXG  214
              V  I   + AV GN M  SG G
Sbjct  569  VVVCEIPEKKVAVAGNAMDNSGYG  592



>gb|EEE61069.1| hypothetical protein OsJ_14927 [Oryza sativa Japonica Group]
Length=623

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 97/138 (70%), Gaps = 0/138 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+V+GGGC+LLRL+ K+D  KE LDN E ++GA + K+ALS P  LIA NAG
Sbjct  468  ATKAAIEEGVVIGGGCSLLRLSMKIDRIKESLDNMEQKIGADIFKQALSYPTALIANNAG  527

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GS VI KV   ++  YGYNAA  +YED  AAGI+DP K VRCC+E AA VA  FLTSD
Sbjct  528  VNGSFVIEKVLLNEDSRYGYNAAKNRYEDLMAAGILDPSKVVRCCIEHAAVVAKSFLTSD  587

Query  285  AXVXXIKXPEPAVVGNPM  232
              +   K  +P  +  PM
Sbjct  588  VVIVEAKEGKPVRIRPPM  605



>ref|XP_010320800.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X5 [Solanum lycopersicum]
Length=578

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            A +AA EEG+VVGGGC LLRL++KVDA KE LDN++ ++GA + KRALS P K IA NAG
Sbjct  397  AARAASEEGVVVGGGCCLLRLSSKVDAIKETLDNEDQKIGADIFKRALSYPAKQIAKNAG  456

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GS+V+ K+ S D+  YGYNAA  +YED  AA I+DP K VRCC+E AA+VA  FL SD
Sbjct  457  VNGSIVVEKILSVDDMKYGYNAARDRYEDLMAAKILDPTKVVRCCVEHAAAVAKTFLISD  516

Query  285  AXVXXIKXP  259
            A V  I  P
Sbjct  517  AVVIDIPGP  525



>ref|XP_010320799.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X4 [Solanum lycopersicum]
Length=594

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            A +AA EEG+VVGGGC LLRL++KVDA KE LDN++ ++GA + KRALS P K IA NAG
Sbjct  438  AARAASEEGVVVGGGCCLLRLSSKVDAIKETLDNEDQKIGADIFKRALSYPAKQIAKNAG  497

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GS+V+ K+ S D+  YGYNAA  +YED  AA I+DP K VRCC+E AA+VA  FL SD
Sbjct  498  VNGSIVVEKILSVDDMKYGYNAARDRYEDLMAAKILDPTKVVRCCVEHAAAVAKTFLISD  557

Query  285  AXVXXIKXP  259
            A V  I  P
Sbjct  558  AVVIDIPGP  566



>ref|XP_010320798.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X3 [Solanum lycopersicum]
Length=608

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            A +AA EEG+VVGGGC LLRL++KVDA KE LDN++ ++GA + KRALS P K IA NAG
Sbjct  438  AARAASEEGVVVGGGCCLLRLSSKVDAIKETLDNEDQKIGADIFKRALSYPAKQIAKNAG  497

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GS+V+ K+ S D+  YGYNAA  +YED  AA I+DP K VRCC+E AA+VA  FL SD
Sbjct  498  VNGSIVVEKILSVDDMKYGYNAARDRYEDLMAAKILDPTKVVRCCVEHAAAVAKTFLISD  557

Query  285  AXVXXIKXP  259
            A V  I  P
Sbjct  558  AVVIDIPGP  566



>ref|XP_010320797.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X2 [Solanum lycopersicum]
Length=617

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            A +AA EEG+VVGGGC LLRL++KVDA KE LDN++ ++GA + KRALS P K IA NAG
Sbjct  436  AARAASEEGVVVGGGCCLLRLSSKVDAIKETLDNEDQKIGADIFKRALSYPAKQIAKNAG  495

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GS+V+ K+ S D+  YGYNAA  +YED  AA I+DP K VRCC+E AA+VA  FL SD
Sbjct  496  VNGSIVVEKILSVDDMKYGYNAARDRYEDLMAAKILDPTKVVRCCVEHAAAVAKTFLISD  555

Query  285  AXVXXIKXP  259
            A V  I  P
Sbjct  556  AVVIDIPGP  564



>ref|XP_010320795.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Solanum lycopersicum]
Length=619

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            A +AA EEG+VVGGGC LLRL++KVDA KE LDN++ ++GA + KRALS P K IA NAG
Sbjct  438  AARAASEEGVVVGGGCCLLRLSSKVDAIKETLDNEDQKIGADIFKRALSYPAKQIAKNAG  497

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GS+V+ K+ S D+  YGYNAA  +YED  AA I+DP K VRCC+E AA+VA  FL SD
Sbjct  498  VNGSIVVEKILSVDDMKYGYNAARDRYEDLMAAKILDPTKVVRCCVEHAAAVAKTFLISD  557

Query  285  AXVXXIKXP  259
            A V  I  P
Sbjct  558  AVVIDIPGP  566



>ref|XP_003516734.2| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X1 [Glycine max]
 gb|KHN31084.1| Chaperonin 60 subunit beta 4, chloroplastic [Glycine soja]
Length=605

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 100/144 (69%), Gaps = 2/144 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC LLRL+ KVD  K+ L+N+E ++GA + +RALS P ++IA NAG
Sbjct  432  ATKAAIEEGVVVGGGCCLLRLSQKVDGIKKLLENEEQQIGAEIFRRALSYPTRMIAKNAG  491

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V G+V+I KV S DN  +GYNAA   YED   AGI+DP K VRCC+E +ASVA  FLTS 
Sbjct  492  VNGNVIIDKVLSDDNLNFGYNAARDCYEDLMKAGIMDPTKVVRCCIEHSASVAKAFLTSS  551

Query  285  AXVXXIK--XPEPAVVGNPMXXSG  220
            A V   K   P P     PM  SG
Sbjct  552  AVVVERKELKPIPIPRRKPMPTSG  575



>ref|XP_010552083.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic [Tarenaya 
hassleriana]
Length=628

 Score =   134 bits (338),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 98/137 (72%), Gaps = 0/137 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATK+A+EEG+VVGGGC LLRL++KVD  K+ L+N E ++GA + K+ALS P +LIA NAG
Sbjct  446  ATKSAIEEGVVVGGGCALLRLSSKVDRIKDILENTEQKIGAEIFKKALSYPIRLIAKNAG  505

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              G++V+ KV + +N  YGYNAA   YED   A I+DP K VRCCLE AASVA  FLTS+
Sbjct  506  ANGNIVVEKVLASENVTYGYNAAKNVYEDLMLARIMDPTKVVRCCLEHAASVAKTFLTSE  565

Query  285  AXVXXIKXPEPAVVGNP  235
            A V  IK   P  + NP
Sbjct  566  AVVVEIKEIRPRPIINP  582



>ref|XP_003579836.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like [Brachypodium 
distachyon]
Length=586

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 94/138 (68%), Gaps = 0/138 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            AT AA++EG+VVGGGC+LLRL+ K+D  KE LDN E ++GA + K ALS P  LIA NAG
Sbjct  431  ATMAAIDEGVVVGGGCSLLRLSKKIDIIKESLDNIEQKIGADIFKHALSYPTILIANNAG  490

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            + G  VI KV S +N  YGYNAA   YED  AAGI+DP K VRCC+E AA VA  FLTSD
Sbjct  491  MSGKFVIQKVLSNENTNYGYNAANDCYEDLMAAGILDPSKVVRCCIEHAAVVARSFLTSD  550

Query  285  AXVXXIKXPEPAVVGNPM  232
              V   K  +P  +  PM
Sbjct  551  VVVVEAKESKPVRIRPPM  568



>ref|XP_007146371.1| hypothetical protein PHAVU_006G034900g [Phaseolus vulgaris]
 gb|ESW18365.1| hypothetical protein PHAVU_006G034900g [Phaseolus vulgaris]
Length=616

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA++EG+VVGGGC+LLRL+ KVDA K  LDN+E ++GA + +RALS P K+IA NAG
Sbjct  437  ATKAAIDEGVVVGGGCSLLRLSKKVDAIKVLLDNEEQKIGAEIFRRALSYPAKMIAKNAG  496

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V G+VVI KV   DN  +GYNAA   YED   A I+DP K VRCC+E +ASVA  FLTS 
Sbjct  497  VNGNVVINKVLLEDNMNFGYNAAKDCYEDLMKARIMDPTKVVRCCIEHSASVAKSFLTSH  556

Query  285  AXVXXIKXPEP  253
            A V   K  +P
Sbjct  557  AVVIEHKVLQP  567



>ref|XP_005647445.1| chaperonin 60B2 [Coccomyxa subellipsoidea C-169]
 gb|EIE22901.1| chaperonin 60B2 [Coccomyxa subellipsoidea C-169]
Length=546

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIV+GGGCT L+LA KVD  KE L+NDE +VGA +V+RALS P +LIA NAG
Sbjct  402  ATKAAVEEGIVIGGGCTFLKLARKVDEVKETLENDEQKVGAEIVRRALSYPLRLIANNAG  461

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  KV    +   GYNAAT  YED  AAGIIDP K +R  +  AASVA  FLTSD
Sbjct  462  VNGSVVQQKVLENLDANVGYNAATDVYEDLMAAGIIDPTKVLRVAMLNAASVAKVFLTSD  521

Query  285  AXVXXIKXPEPA  250
              +  I  PE A
Sbjct  522  VIITEIPQPEGA  533



>ref|XP_002951713.1| hypothetical protein VOLCADRAFT_81582 [Volvox carteri f. nagariensis]
 gb|EFJ47164.1| hypothetical protein VOLCADRAFT_81582 [Volvox carteri f. nagariensis]
Length=577

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEG+V+GGGCTLLRL+  VD  +  L+N+E ++GA ++KRALS P KLIA NAG
Sbjct  434  ATKAAVEEGVVIGGGCTLLRLSQNVDQIRAALENEEQKMGADIIKRALSYPIKLIANNAG  493

Query  465  VXGSVVIXKVX-SPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTS  289
            V GSVV+ +V  + + P YGYNAAT KYED   AGIIDP K VRC LE A SVA  FL +
Sbjct  494  VNGSVVMQRVMDNIEQPYYGYNAATDKYEDLMEAGIIDPTKVVRCSLENACSVAKTFLLA  553

Query  288  DAXVXXI  268
            D  V  I
Sbjct  554  DVVVTEI  560



>gb|KDO54475.1| hypothetical protein CISIN_1g007313mg [Citrus sinensis]
Length=571

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRL++KVDA KE LDNDE +VGA +VKRAL  P KLIA NAG
Sbjct  463  ATKAAVEEGIVVGGGCTLLRLSSKVDAIKETLDNDEEKVGADIVKRALCYPLKLIAKNAG  522

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCL  328
            V GSVV  KV S DN  YGYNAATG YED  AAGIIDP K V CC+
Sbjct  523  VNGSVVSEKVLSSDNHKYGYNAATGNYEDLMAAGIIDPTK-VSCCI  567



>ref|XP_006573191.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X2 [Glycine max]
Length=587

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = -3

Query  600  CTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAGVXGSVVIXKVXSPDN  421
            C LLRL+ KVD  K+ L+N+E ++GA + +RALS P ++IA NAGV G+V+I KV S DN
Sbjct  429  CCLLRLSQKVDGIKKLLENEEQQIGAEIFRRALSYPTRMIAKNAGVNGNVIIDKVLSDDN  488

Query  420  PXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSDAXVXXIK--XPEPAV  247
              +GYNAA   YED   AGI+DP K VRCC+E +ASVA  FLTS A V   K   P P  
Sbjct  489  LNFGYNAARDCYEDLMKAGIMDPTKVVRCCIEHSASVAKAFLTSSAVVVERKELKPIPIP  548

Query  246  VGNPMXXSG  220
               PM  SG
Sbjct  549  RRKPMPTSG  557



>ref|XP_002500045.1| chaperonin 60 beta [Micromonas sp. RCC299]
 gb|ACO61303.1| chaperonin 60 beta [Micromonas sp. RCC299]
Length=594

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 100/146 (68%), Gaps = 2/146 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIV+GGGCTLL+LAA VD  K+ L NDE ++GA +++RAL  P +LIA NAG
Sbjct  448  ATKAAVEEGIVIGGGCTLLKLAAAVDDIKKELPNDEQKLGADIIQRALKYPMRLIAANAG  507

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              GSVV+ +V +  +  +GYNAATG+++D    GIIDP K +RC LE + SVA  FLTSD
Sbjct  508  DNGSVVVERVTASKDANFGYNAATGEFQDLMVNGIIDPTKVIRCALENSCSVAKIFLTSD  567

Query  285  AXVXXIKXPEPAVVG--NPMXXSGXG  214
              V  I   EP + G    M  SG G
Sbjct  568  VVVCEIPENEPMIAGGAGAMDNSGYG  593



>emb|CDO97994.1| unnamed protein product [Coffea canephora]
Length=577

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLAAKVDA K+ LDNDE +VGA +VKRALS P KLIA NAG
Sbjct  458  ATKAAVEEGIVVGGGCTLLRLAAKVDAIKDSLDNDEQKVGADIVKRALSYPMKLIAKNAG  517

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPK  346
            V GSVVI KV S +N  +GYNAATG YED  AAGIIDP K
Sbjct  518  VNGSVVIEKVLSSENVKFGYNAATGNYEDLMAAGIIDPTK  557



>ref|XP_004975721.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like [Setaria 
italica]
Length=588

 Score =   128 bits (322),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEX-LDNDEXRVGAXLVKRALSXPXKLIAXNA  469
            AT+AA+EEG+VVGGGC+LLRL+ K+DA K+  LDN E ++GA + K+ALS P  LIA NA
Sbjct  432  ATRAAIEEGVVVGGGCSLLRLSKKIDAIKDSSLDNMEQKIGADIFKKALSYPTSLIANNA  491

Query  468  GVXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTS  289
            GV G  VI KV   D   YGYNAA  +YED  AAGI+DP K VRCC+E AA VA  FLTS
Sbjct  492  GVNGDFVIEKVLLNDTTNYGYNAAKNRYEDLMAAGILDPSKVVRCCIEHAAVVAKSFLTS  551

Query  288  DAXVXXIK  265
            D  V   K
Sbjct  552  DVVVVEAK  559



>gb|AFW66836.1| putative TCP-1/cpn60 chaperonin family protein [Zea mays]
Length=121

 Score =   120 bits (302),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 75/107 (70%), Gaps = 2/107 (2%)
 Frame = -3

Query  534  RVGAXLVKRALSXPXKLIAXNAGVXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIID  355
            +VGA +V+++LS P KLIA NAGV GSVV  KV + +N  YGYNAATG+YED  AAGIID
Sbjct  9    KVGAEIVRKSLSYPLKLIAKNAGVNGSVVTEKVLANENFRYGYNAATGEYEDLMAAGIID  68

Query  354  PPKXVRCCLEXAASVAXXFLTSDAXVXXIKXPE--PAVVGNPMXXSG  220
            P K VRCCLE AASVA  F+TSDA V   K  E  P+   NPM   G
Sbjct  69   PTKVVRCCLEHAASVAKTFITSDAVVVDAKVAEQAPSSPANPMAMGG  115



>gb|KDD74080.1| TCP-1/cpn60 chaperonin [Helicosporidium sp. ATCC 50920]
Length=622

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIV GGGCTLLRLA+ V   +  L NDE R+GA +V RALS P KLIA NAG
Sbjct  478  ATKAAVEEGIVTGGGCTLLRLASCVAELRSQLANDEQRMGADVVARALSAPLKLIAANAG  537

Query  465  VXGSVVIXKVXSPD-NPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTS  289
              G++V  KV     +  YGYNAATG+Y D  AAGI+DP K VRC LE A+SVA  FLTS
Sbjct  538  GNGAIVAEKVAEHAADARYGYNAATGQYGDLLAAGIVDPAKVVRCALENASSVARTFLTS  597

Query  288  DAXVXXIKXPEPAV  247
               V  I  PEPA+
Sbjct  598  SVVVTEIPQPEPAM  611



>ref|XP_010090495.1| RuBisCO large subunit-binding protein subunit beta [Morus notabilis]
 gb|EXB39594.1| RuBisCO large subunit-binding protein subunit beta [Morus notabilis]
Length=496

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 91/142 (64%), Gaps = 19/142 (13%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIVVGGGCTLLRLA+KVD  ++ L+NDE +VGA +VKRALS P KLIA NAG
Sbjct  371  ATKAAVEEGIVVGGGCTLLRLASKVDGIRDTLENDEEKVGADIVKRALSYPLKLIAKNAG  430

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSVV  +V S D+P YGYNAATGKYED  A G                     +   D
Sbjct  431  VNGSVVSEEVLSSDDPRYGYNAATGKYEDLMAGG-------------------NNYSNQD  471

Query  285  AXVXXIKXPEPAVVGNPMXXSG  220
              V  IK PEP   GNPM  SG
Sbjct  472  CVVVEIKEPEPVPAGNPMGNSG  493



>sp|Q42693.1|RUBB_CHLRE RecName: Full=RuBisCO large subunit-binding protein subunit beta-1; 
AltName: Full=60 kDa chaperonin subunit beta-1; AltName: 
Full=CPN-60 beta-1, partial [Chlamydomonas reinhardtii]
 gb|AAA98641.1| chaperonin beta-like subunit [Chlamydomonas reinhardtii]
Length=435

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 93/139 (67%), Gaps = 1/139 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            AT+AAVEEG+V GGGCTLLRL+ KVD  K  + + E ++GA ++KRAL  P KLIA NAG
Sbjct  286  ATRAAVEEGVVPGGGCTLLRLSEKVDVIKRRMTDPEQQMGADIIKRALCYPIKLIAQNAG  345

Query  465  VXGSVVIXKVX-SPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTS  289
            V GSVV+ +V  + D P YGYNAAT  +E+    GIIDP K VRC +E A SVA  FL +
Sbjct  346  VNGSVVMNEVMKNLDRPHYGYNAATDSFENLMETGIIDPSKVVRCSMENAVSVAKTFLLA  405

Query  288  DAXVXXIKXPEPAVVGNPM  232
            D  V  +K  E     NP+
Sbjct  406  DVVVTELKEIEAGAKPNPV  424



>ref|XP_002315987.2| hypothetical protein POPTR_0010s14520g [Populus trichocarpa]
 gb|EEF02158.2| hypothetical protein POPTR_0010s14520g [Populus trichocarpa]
Length=585

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 90/131 (69%), Gaps = 7/131 (5%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAA+EEG+VVGGGC+LLRL+ K       L     ++GA + KRALS P +LIA NAG
Sbjct  434  ATKAAIEEGVVVGGGCSLLRLSTK-------LFQLLTKIGAEIFKRALSYPARLIAKNAG  486

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V G+VVI +V S  +  YGYNAAT  YED   AGIIDP K VRCCLE A SVA  FLTSD
Sbjct  487  VNGNVVINQVLSNADIRYGYNAATDTYEDLITAGIIDPTKVVRCCLEHATSVAKTFLTSD  546

Query  285  AXVXXIKXPEP  253
            A V  IK  +P
Sbjct  547  AVVVDIKESDP  557



>gb|EMS68279.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Triticum urartu]
Length=622

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 95/159 (60%), Gaps = 21/159 (13%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXR---------------------V  529
            AT AA+EEG+VVGGGC+LLRL+ K+D  KE LDN E +                     +
Sbjct  448  ATMAAIEEGVVVGGGCSLLRLSQKIDMIKESLDNLEQKAQLEFTTIRAYWCNYAFVVVKI  507

Query  528  GAXLVKRALSXPXKLIAXNAGVXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPP  349
            GA + K ALS P  LIA NAG+ G  VI KV + DN  YGYNAA G YED  A+GI+DP 
Sbjct  508  GADIFKHALSYPSTLIANNAGMSGKFVIEKVLANDNASYGYNAANGCYEDLMASGILDPS  567

Query  348  KXVRCCLEXAASVAXXFLTSDAXVXXIKXPEPAVVGNPM  232
            K VRCC+E +A VA  FLTSD  +   +  +P  V  PM
Sbjct  568  KVVRCCIEHSAVVAKSFLTSDVVIVEAQESKPIRVRPPM  606



>ref|XP_001701113.1| chaperonin 60B1 [Chlamydomonas reinhardtii]
 gb|EDO97815.1| chaperonin 60B1 [Chlamydomonas reinhardtii]
Length=580

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 93/139 (67%), Gaps = 1/139 (1%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            AT+AAVEEG+V GGGCTLLRL+ KVD  K  + + E ++GA ++KRAL  P KLIA NAG
Sbjct  431  ATRAAVEEGVVPGGGCTLLRLSEKVDVIKRRMTDPEQQMGADIIKRALCYPIKLIAQNAG  490

Query  465  VXGSVVIXKVX-SPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTS  289
            V GSVV+ +V  + D P YGYNAAT  +E+    GIIDP K VRC +E A SVA  FL +
Sbjct  491  VNGSVVMNEVMKNLDRPHYGYNAATDSFENLMETGIIDPSKVVRCSMENAVSVAKTFLLA  550

Query  288  DAXVXXIKXPEPAVVGNPM  232
            D  V  +K  E     NP+
Sbjct  551  DVVVTELKEIEAGAKPNPV  569



>ref|XP_008653444.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Zea mays]
 tpg|DAA44367.1| TPA: putative TCP-1/cpn60 chaperonin family protein [Zea mays]
Length=588

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 88/127 (69%), Gaps = 1/127 (1%)
 Frame = -3

Query  642  TKAAveegivvggGCTLLRLAAKVDAXKEX-LDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            T+AA+EEG+VVGGGC+LLRL+ K+DA KE  LDN E  VGA + K+ALS P  LIA NAG
Sbjct  433  TRAAIEEGVVVGGGCSLLRLSEKIDAIKESSLDNIEQEVGADIFKQALSYPTSLIAKNAG  492

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V G  VI KV   D+  YGYNAA   YED  AAGI+D  K VRCC+E AA VA  FLTSD
Sbjct  493  VNGDFVIKKVLLNDDANYGYNAAKNCYEDLMAAGILDATKVVRCCIEHAAVVAKSFLTSD  552

Query  285  AXVXXIK  265
              +   K
Sbjct  553  VVIVEAK  559



>ref|WP_045871448.1| molecular chaperone GroEL [Tolypothrix sp. PCC 7601]
 gb|EKF00980.1| chaperonin GroL [Tolypothrix sp. PCC 7601]
Length=558

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 92/130 (71%), Gaps = 3/130 (2%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIV GGG TL+ LA KV+A K  L+++E ++GA ++ RAL  P + IA NAG
Sbjct  400  ATKAAVEEGIVPGGGTTLIHLATKVEAIKNSLEDNEEKIGADIIGRALEAPLRQIADNAG  459

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSV++ +V   D    GYNAATG++ED  AAGIIDP K VR  L+ AAS+A   LT++
Sbjct  460  VEGSVIVSRVKETD-INVGYNAATGEFEDLIAAGIIDPAKVVRSALQNAASIAGLVLTTE  518

Query  285  AXVXXIKXPE  256
            A V  ++ PE
Sbjct  519  ALV--VEKPE  526



>ref|WP_006278498.1| molecular chaperone GroEL [Cylindrospermopsis raciborskii]
 gb|EFA68659.1| Chaperonin Cpn60/TCP-1 [Cylindrospermopsis raciborskii CS-505]
Length=561

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 93/130 (72%), Gaps = 4/130 (3%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIV GGG TL+ L AKVDA K+ LD +E ++GA +V+R+L  P + IA NAG
Sbjct  407  ATKAAVEEGIVPGGGTTLIHLVAKVDAIKDTLDGEE-KIGAEIVQRSLEAPLRQIANNAG  465

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSV++ +V + D    GYNAATG++ED  AAGIIDP K VR  L+ AAS+A   LT++
Sbjct  466  VEGSVIVSQVRNSDF-NIGYNAATGEFEDLIAAGIIDPAKVVRSSLQNAASIAGMVLTTE  524

Query  285  AXVXXIKXPE  256
              V  ++ PE
Sbjct  525  VLV--VEKPE  532



>ref|WP_012407975.1| molecular chaperone GroEL [Nostoc punctiforme]
 gb|ACC79954.1| chaperonin GroEL [Nostoc punctiforme PCC 73102]
Length=560

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 90/130 (69%), Gaps = 3/130 (2%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIV GGG TL+ LA  V+A K+ L NDE R+GA +V+RAL  P + IA NAG
Sbjct  400  ATKAAVEEGIVPGGGTTLIHLAKAVEAIKKTLQNDEERIGADIVERALEAPLRQIADNAG  459

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
              GSV++ KV   +    GYNAATG++ED  AAGIIDP K VR  L+ A S+A   LT++
Sbjct  460  AEGSVIVSKVRDSEF-NIGYNAATGEFEDLIAAGIIDPAKVVRSALQNAGSIAGLVLTTE  518

Query  285  AXVXXIKXPE  256
            A V  ++ PE
Sbjct  519  AIV--VEKPE  526



>ref|WP_009343442.1| molecular chaperone GroEL [Raphidiopsis brookii]
 gb|EFA72908.1| Chaperonin Cpn60/TCP-1 [Raphidiopsis brookii D9]
Length=561

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 93/130 (72%), Gaps = 4/130 (3%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIV GGG TL+ L AKVDA K+ LD +E ++GA +V+R+L  P + IA NAG
Sbjct  407  ATKAAVEEGIVPGGGTTLIHLVAKVDAIKDTLDGEE-KIGAEIVQRSLEAPLRQIANNAG  465

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSV++ +V + D    GYNAATG++ED  AAGIIDP K VR  L+ AAS+A   LT++
Sbjct  466  VEGSVIVSQVRNSDF-NIGYNAATGEFEDLIAAGIIDPAKVVRSSLQNAASIAGMVLTTE  524

Query  285  AXVXXIKXPE  256
              V  ++ PE
Sbjct  525  VLV--VEKPE  532



>gb|AAA27284.1| chaperonin 60 [Synechocystis sp.]
Length=551

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 88/132 (67%), Gaps = 3/132 (2%)
 Frame = -3

Query  645  ATKAAveegivvggGCTLLRLAAKVDAXKEXLDNDEXRVGAXLVKRALSXPXKLIAXNAG  466
            ATKAAVEEGIV GGG TL+RLA K+++ K  L NDE RV A ++ +AL  P   +A NAG
Sbjct  401  ATKAAVEEGIVPGGGTTLIRLAGKIESFKAQLSNDEERVAADIIAKALEAPLHQLASNAG  460

Query  465  VXGSVVIXKVXSPDNPXYGYNAATGKYEDXXAAGIIDPPKXVRCCLEXAASVAXXFLTSD  286
            V GSV++ KV        GYN  TGK ED  AAGIIDP K VR  L+ AAS+A   LT++
Sbjct  461  VEGSVIVEKVKEATG-NQGYNVITGKIEDLIAAGIIDPAKVVRSALQNAASIAGMVLTTE  519

Query  285  AXVXXIKXPEPA  250
            A V  ++ PEPA
Sbjct  520  ALV--VEKPEPA  529



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1012179015936