BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9912

Length=899
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086869.1|  PREDICTED: uncharacterized protein LOC105168472    380   6e-125   Sesamum indicum [beniseed]
ref|XP_002297871.1|  hypothetical protein POPTR_0001s13160g             374   1e-122   
ref|XP_003536819.1|  PREDICTED: myosin heavy chain, skeletal musc...    373   2e-122   Glycine max [soybeans]
ref|XP_007142592.1|  hypothetical protein PHAVU_007G000500g             369   4e-122   Phaseolus vulgaris [French bean]
ref|XP_012088735.1|  PREDICTED: coiled-coil domain-containing pro...    373   6e-122   Jatropha curcas
ref|XP_003556588.1|  PREDICTED: protein anoxia up-regulated-like ...    370   2e-121   Glycine max [soybeans]
ref|XP_007142591.1|  hypothetical protein PHAVU_007G000500g             370   3e-121   Phaseolus vulgaris [French bean]
gb|KCW64334.1|  hypothetical protein EUGRSUZ_G01963                     369   1e-120   Eucalyptus grandis [rose gum]
ref|XP_010066444.1|  PREDICTED: uncharacterized protein LOC104453...    369   1e-120   Eucalyptus grandis [rose gum]
ref|XP_006343189.1|  PREDICTED: uncharacterized protein LOC102581164    367   5e-120   Solanum tuberosum [potatoes]
gb|KDO83180.1|  hypothetical protein CISIN_1g008906mg                   360   6e-120   Citrus sinensis [apfelsine]
ref|XP_011036158.1|  PREDICTED: uncharacterized protein LOC105133757    367   1e-119   Populus euphratica
ref|XP_004497432.1|  PREDICTED: uncharacterized protein LOC101507...    365   2e-119   Cicer arietinum [garbanzo]
ref|XP_004239298.1|  PREDICTED: uncharacterized protein LOC101253187    365   4e-119   Solanum lycopersicum
ref|XP_010066445.1|  PREDICTED: uncharacterized protein LOC104453...    365   6e-119   Eucalyptus grandis [rose gum]
ref|XP_008222369.1|  PREDICTED: uncharacterized protein LOC103322249    364   1e-118   Prunus mume [ume]
ref|XP_004310133.1|  PREDICTED: coiled-coil domain-containing pro...    363   2e-118   Fragaria vesca subsp. vesca
ref|XP_006438862.1|  hypothetical protein CICLE_v10031153mg             363   3e-118   Citrus clementina [clementine]
gb|KDO83179.1|  hypothetical protein CISIN_1g008906mg                   359   6e-118   Citrus sinensis [apfelsine]
ref|XP_006483009.1|  PREDICTED: myosin-9-like isoform X3                359   8e-118   
gb|KDO83174.1|  hypothetical protein CISIN_1g008906mg                   361   2e-117   Citrus sinensis [apfelsine]
ref|XP_004497431.1|  PREDICTED: uncharacterized protein LOC101507...    360   2e-117   Cicer arietinum [garbanzo]
ref|XP_006483007.1|  PREDICTED: myosin-9-like isoform X1                360   3e-117   Citrus sinensis [apfelsine]
ref|XP_011020859.1|  PREDICTED: uncharacterized protein LOC105123085    360   7e-117   Populus euphratica
ref|XP_007043822.1|  Uncharacterized protein isoform 1                  360   9e-117   
ref|XP_002267942.2|  PREDICTED: uncharacterized protein LOC100260846    358   2e-116   
ref|XP_008459909.1|  PREDICTED: uncharacterized protein LOC103498889    356   1e-115   Cucumis melo [Oriental melon]
ref|XP_011656790.1|  PREDICTED: coiled-coil domain-containing pro...    353   9e-115   Cucumis sativus [cucumbers]
ref|XP_009359892.1|  PREDICTED: uncharacterized protein LOC103950...    351   1e-114   
ref|XP_009359891.1|  PREDICTED: uncharacterized protein LOC103950...    352   6e-114   Pyrus x bretschneideri [bai li]
ref|XP_009597749.1|  PREDICTED: uncharacterized protein LOC104093...    352   6e-114   Nicotiana tomentosiformis
ref|XP_009781777.1|  PREDICTED: uncharacterized protein LOC104230...    350   3e-113   Nicotiana sylvestris
ref|XP_008390187.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    350   5e-113   
gb|KHN27159.1|  hypothetical protein glysoja_032927                     342   1e-112   Glycine soja [wild soybean]
ref|XP_009378816.1|  PREDICTED: uncharacterized protein LOC103967265    349   1e-112   
ref|XP_006483008.1|  PREDICTED: myosin-9-like isoform X2                347   3e-112   Citrus sinensis [apfelsine]
gb|EYU37358.1|  hypothetical protein MIMGU_mgv1a004629mg                343   5e-111   Erythranthe guttata [common monkey flower]
ref|XP_008369644.1|  PREDICTED: uncharacterized protein LOC103433181    345   5e-111   
ref|XP_002304646.2|  hypothetical protein POPTR_0003s16260g             344   8e-111   
gb|KDO51298.1|  hypothetical protein CISIN_1g008306mg                   339   1e-110   Citrus sinensis [apfelsine]
ref|XP_006485111.1|  PREDICTED: dynactin subunit 1-like isoform X2      339   1e-110   
gb|KJB15173.1|  hypothetical protein B456_002G163500                    337   4e-110   Gossypium raimondii
ref|XP_006485110.1|  PREDICTED: dynactin subunit 1-like isoform X1      340   2e-109   Citrus sinensis [apfelsine]
ref|XP_006436938.1|  hypothetical protein CICLE_v10031078mg             340   3e-109   Citrus clementina [clementine]
gb|KDO51296.1|  hypothetical protein CISIN_1g008306mg                   340   3e-109   Citrus sinensis [apfelsine]
ref|XP_009597748.1|  PREDICTED: uncharacterized protein LOC104093...    340   5e-109   Nicotiana tomentosiformis
ref|XP_010249187.1|  PREDICTED: uncharacterized protein LOC104591834    339   9e-109   Nelumbo nucifera [Indian lotus]
gb|KJB15171.1|  hypothetical protein B456_002G163500                    338   1e-108   Gossypium raimondii
gb|KDO51297.1|  hypothetical protein CISIN_1g008306mg                   336   2e-107   Citrus sinensis [apfelsine]
emb|CBI15742.3|  unnamed protein product                                332   2e-106   Vitis vinifera
ref|XP_002284492.1|  PREDICTED: uncharacterized protein LOC100256039    332   4e-106   Vitis vinifera
emb|CAN81274.1|  hypothetical protein VITISV_021176                     332   9e-106   Vitis vinifera
ref|XP_008239546.1|  PREDICTED: uncharacterized protein LOC103338...    330   2e-105   Prunus mume [ume]
ref|XP_010682658.1|  PREDICTED: uncharacterized protein LOC104897472    331   2e-105   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010453387.1|  PREDICTED: uncharacterized protein LOC104735325    327   8e-105   Camelina sativa [gold-of-pleasure]
ref|XP_010419899.1|  PREDICTED: uncharacterized protein LOC104705575    328   8e-105   Camelina sativa [gold-of-pleasure]
gb|AFK47824.1|  unknown                                                 317   9e-105   Lotus japonicus
ref|XP_007209092.1|  hypothetical protein PRUPE_ppa003575mg             328   1e-104   Prunus persica
ref|XP_006399817.1|  hypothetical protein EUTSA_v10013191mg             327   2e-104   Eutrema salsugineum [saltwater cress]
gb|KFK25562.1|  hypothetical protein AALP_AA8G131000                    327   3e-104   Arabis alpina [alpine rockcress]
ref|XP_007038109.1|  Uncharacterized protein isoform 3                  322   6e-104   
ref|XP_010556094.1|  PREDICTED: GRIP1-associated protein 1              326   1e-103   Tarenaya hassleriana [spider flower]
ref|XP_006286776.1|  hypothetical protein CARUB_v10003326mg             325   2e-103   Capsella rubella
gb|KEH35693.1|  ripening-regulated protein                              320   2e-103   Medicago truncatula
gb|KJB15172.1|  hypothetical protein B456_002G163500                    325   2e-103   Gossypium raimondii
ref|XP_007038108.1|  Uncharacterized protein isoform 2                  323   2e-103   
ref|XP_008351703.1|  PREDICTED: uncharacterized protein LOC103415127    325   3e-103   
ref|XP_006578723.1|  PREDICTED: uncharacterized abhydrolase domai...    324   6e-103   Glycine max [soybeans]
ref|XP_010492074.1|  PREDICTED: uncharacterized protein LOC104769543    323   7e-103   Camelina sativa [gold-of-pleasure]
gb|KHN09724.1|  hypothetical protein glysoja_011998                     318   8e-103   Glycine soja [wild soybean]
ref|XP_011073178.1|  PREDICTED: macoilin-1                              323   9e-103   Sesamum indicum [beniseed]
gb|KHN31266.1|  hypothetical protein glysoja_012916                     324   9e-103   Glycine soja [wild soybean]
ref|XP_007038107.1|  Uncharacterized protein isoform 1                  323   2e-102   
ref|XP_004501741.1|  PREDICTED: uncharacterized abhydrolase domai...    323   2e-102   Cicer arietinum [garbanzo]
ref|XP_011652277.1|  PREDICTED: coiled-coil domain-containing pro...    317   3e-102   Cucumis sativus [cucumbers]
ref|XP_009337519.1|  PREDICTED: uncharacterized protein LOC103929...    321   6e-102   Pyrus x bretschneideri [bai li]
ref|XP_006376918.1|  hypothetical protein POPTR_0012s10720g             321   1e-101   Populus trichocarpa [western balsam poplar]
gb|EYU21825.1|  hypothetical protein MIMGU_mgv1a021335mg                312   1e-101   Erythranthe guttata [common monkey flower]
ref|XP_009368792.1|  PREDICTED: uncharacterized protein LOC103958...    320   1e-101   Pyrus x bretschneideri [bai li]
gb|KEH35692.1|  ripening-regulated protein                              320   2e-101   Medicago truncatula
ref|XP_009334312.1|  PREDICTED: uncharacterized protein LOC103927...    320   2e-101   Pyrus x bretschneideri [bai li]
ref|XP_007137890.1|  hypothetical protein PHAVU_009G164500g             320   3e-101   Phaseolus vulgaris [French bean]
ref|XP_008440074.1|  PREDICTED: macoilin-1                              319   3e-101   
ref|XP_006844529.1|  PREDICTED: coiled-coil domain-containing pro...    319   4e-101   Amborella trichopoda
ref|XP_006581845.1|  PREDICTED: plectin-like                            319   5e-101   Glycine max [soybeans]
gb|KJB40055.1|  hypothetical protein B456_007G044600                    312   5e-101   Gossypium raimondii
ref|XP_004145144.1|  PREDICTED: coiled-coil domain-containing pro...    318   5e-101   Cucumis sativus [cucumbers]
ref|XP_006368855.1|  hypothetical protein POPTR_0001s13160g             318   7e-101   
ref|XP_009121778.1|  PREDICTED: uncharacterized protein LOC103846586    318   9e-101   Brassica rapa
ref|XP_009767496.1|  PREDICTED: uncharacterized protein LOC104218...    313   2e-100   Nicotiana sylvestris
emb|CDX69654.1|  BnaA10g20030D                                          316   3e-100   
gb|KJB40053.1|  hypothetical protein B456_007G044600                    311   5e-100   Gossypium raimondii
gb|KDO83175.1|  hypothetical protein CISIN_1g008906mg                   316   6e-100   Citrus sinensis [apfelsine]
gb|KJB51281.1|  hypothetical protein B456_008G210100                    316   6e-100   Gossypium raimondii
emb|CDO98314.1|  unnamed protein product                                316   6e-100   Coffea canephora [robusta coffee]
emb|CDY09779.1|  BnaC09g43820D                                          315   7e-100   Brassica napus [oilseed rape]
ref|XP_006341491.1|  PREDICTED: uncharacterized protein LOC102585...    312   9e-100   
ref|XP_011002098.1|  PREDICTED: uncharacterized protein LOC105109182    315   1e-99    Populus euphratica
ref|XP_008374187.1|  PREDICTED: uncharacterized protein LOC103437...    310   2e-99    
ref|XP_008356569.1|  PREDICTED: uncharacterized protein LOC103420...    310   2e-99    
ref|XP_009767495.1|  PREDICTED: uncharacterized protein LOC104218...    314   4e-99    Nicotiana sylvestris
ref|XP_008356568.1|  PREDICTED: uncharacterized protein LOC103420...    311   8e-99    
ref|XP_008374186.1|  PREDICTED: uncharacterized protein LOC103437...    311   1e-98    
ref|XP_006646640.1|  PREDICTED: ELKS/Rab6-interacting/CAST family...    311   1e-98    Oryza brachyantha
ref|XP_009781778.1|  PREDICTED: uncharacterized protein LOC104230...    312   1e-98    Nicotiana sylvestris
gb|KJB40052.1|  hypothetical protein B456_007G044600                    312   2e-98    Gossypium raimondii
tpg|DAA56002.1|  TPA: hypothetical protein ZEAMMB73_352561              305   2e-98    
gb|KJB40054.1|  hypothetical protein B456_007G044600                    311   2e-98    Gossypium raimondii
ref|XP_009337520.1|  PREDICTED: uncharacterized protein LOC103929...    311   3e-98    Pyrus x bretschneideri [bai li]
ref|XP_010026209.1|  PREDICTED: dynactin subunit 1-like                 311   4e-98    Eucalyptus grandis [rose gum]
ref|XP_008356566.1|  PREDICTED: uncharacterized protein LOC103420...    311   5e-98    
ref|XP_008374184.1|  PREDICTED: uncharacterized protein LOC103437...    311   5e-98    
ref|XP_006341490.1|  PREDICTED: uncharacterized protein LOC102585...    311   5e-98    Solanum tuberosum [potatoes]
ref|XP_004971152.1|  PREDICTED: uncharacterized protein LOC101760852    311   6e-98    Setaria italica
ref|XP_002459023.1|  hypothetical protein SORBIDRAFT_03g044670          311   6e-98    Sorghum bicolor [broomcorn]
ref|XP_009368793.1|  PREDICTED: uncharacterized protein LOC103958...    311   7e-98    Pyrus x bretschneideri [bai li]
gb|KJB15175.1|  hypothetical protein B456_002G163500                    312   8e-98    Gossypium raimondii
ref|XP_009334313.1|  PREDICTED: uncharacterized protein LOC103927...    310   1e-97    Pyrus x bretschneideri [bai li]
ref|XP_008356567.1|  PREDICTED: uncharacterized protein LOC103420...    310   1e-97    
ref|XP_008374185.1|  PREDICTED: uncharacterized protein LOC103437...    310   1e-97    
ref|XP_011042951.1|  PREDICTED: uncharacterized protein LOC105138...    310   2e-97    Populus euphratica
ref|XP_011042949.1|  PREDICTED: uncharacterized protein LOC105138...    310   2e-97    Populus euphratica
ref|XP_010909766.1|  PREDICTED: uncharacterized protein LOC105035770    309   2e-97    Elaeis guineensis
ref|XP_004501742.1|  PREDICTED: uncharacterized abhydrolase domai...    308   6e-97    Cicer arietinum [garbanzo]
ref|XP_004235837.1|  PREDICTED: uncharacterized protein LOC101264...    308   6e-97    Solanum lycopersicum
ref|NP_001045273.1|  Os01g0928100                                       308   7e-97    
ref|XP_009368795.1|  PREDICTED: uncharacterized protein LOC103958...    308   1e-96    Pyrus x bretschneideri [bai li]
ref|XP_008777461.1|  PREDICTED: uncharacterized protein LOC103697393    307   2e-96    Phoenix dactylifera
ref|XP_002511106.1|  conserved hypothetical protein                     307   2e-96    Ricinus communis
ref|XP_003564988.1|  PREDICTED: MAP7 domain-containing protein 1-...    307   2e-96    Brachypodium distachyon [annual false brome]
ref|XP_008674618.1|  PREDICTED: myosin heavy chain, striated muscle     306   4e-96    
ref|XP_002321743.2|  hypothetical protein POPTR_0015s11590g             305   6e-96    
ref|XP_012090607.1|  PREDICTED: coiled-coil domain-containing pro...    304   2e-95    Jatropha curcas
ref|XP_008791048.1|  PREDICTED: uncharacterized protein LOC103708063    303   6e-95    Phoenix dactylifera
gb|AFN54517.1|  ripening-regulated protein                              301   5e-94    Fragaria x ananassa
ref|XP_004297498.1|  PREDICTED: coiled-coil domain-containing pro...    301   7e-94    Fragaria vesca subsp. vesca
ref|XP_010550755.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    300   2e-93    Tarenaya hassleriana [spider flower]
ref|XP_002871557.1|  hypothetical protein ARALYDRAFT_488142             297   9e-93    Arabidopsis lyrata subsp. lyrata
ref|NP_196830.2|  uncharacterized protein                               295   4e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006405440.1|  hypothetical protein EUTSA_v10028083mg             287   6e-92    
gb|EPS59084.1|  hypothetical protein M569_15727                         294   1e-91    Genlisea aurea
emb|CDM85875.1|  unnamed protein product                                291   2e-90    Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ93558.1|  predicted protein                                      291   3e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010929655.1|  PREDICTED: protein Hook homolog 2-like isofo...    290   4e-90    Elaeis guineensis
ref|XP_010929654.1|  PREDICTED: protein Hook homolog 2-like isofo...    291   4e-90    Elaeis guineensis
ref|XP_010545937.1|  PREDICTED: uncharacterized protein LOC104818...    284   4e-89    Tarenaya hassleriana [spider flower]
ref|XP_010066446.1|  PREDICTED: dynactin subunit 1 isoform X3           285   2e-88    Eucalyptus grandis [rose gum]
ref|XP_010545934.1|  PREDICTED: uncharacterized protein LOC104818...    285   2e-88    Tarenaya hassleriana [spider flower]
ref|XP_010545933.1|  PREDICTED: uncharacterized protein LOC104818...    285   2e-88    Tarenaya hassleriana [spider flower]
emb|CDY64711.1|  BnaA06g38700D                                          275   3e-87    Brassica napus [oilseed rape]
ref|XP_008790703.1|  PREDICTED: uncharacterized protein LOC103707...    283   4e-87    Phoenix dactylifera
ref|XP_009415853.1|  PREDICTED: uncharacterized protein LOC103996...    281   6e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415852.1|  PREDICTED: uncharacterized protein LOC103996...    281   9e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415851.1|  PREDICTED: uncharacterized protein LOC103996...    281   1e-86    Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK34186.1|  hypothetical protein AALP_AA5G111700                    281   3e-86    Arabis alpina [alpine rockcress]
ref|XP_010678340.1|  PREDICTED: myosin heavy chain, non-muscle          280   4e-86    Beta vulgaris subsp. vulgaris [field beet]
emb|CDP18972.1|  unnamed protein product                                266   4e-85    Coffea canephora [robusta coffee]
ref|XP_009149792.1|  PREDICTED: uncharacterized protein LOC103873113    278   5e-85    Brassica rapa
emb|CAN81746.1|  hypothetical protein VITISV_038195                     275   1e-84    Vitis vinifera
ref|XP_010531859.1|  PREDICTED: uncharacterized protein LOC104808...    275   3e-84    Tarenaya hassleriana [spider flower]
emb|CDY05877.1|  BnaC08g20540D                                          275   4e-84    
ref|XP_007222390.1|  hypothetical protein PRUPE_ppa004878mg             273   4e-84    
ref|XP_006404211.1|  hypothetical protein EUTSA_v10010238mg             273   3e-83    Eutrema salsugineum [saltwater cress]
ref|XP_010426384.1|  PREDICTED: uncharacterized protein LOC104711382    272   5e-83    Camelina sativa [gold-of-pleasure]
ref|XP_006292226.1|  hypothetical protein CARUB_v10018432mg             272   6e-83    Capsella rubella
ref|XP_009623175.1|  PREDICTED: uncharacterized protein LOC104114...    267   6e-83    Nicotiana tomentosiformis
ref|XP_010503527.1|  PREDICTED: uncharacterized protein LOC104780...    272   1e-82    Camelina sativa [gold-of-pleasure]
ref|XP_011627464.1|  PREDICTED: coiled-coil domain-containing pro...    271   1e-82    
ref|XP_010503528.1|  PREDICTED: uncharacterized protein LOC104780...    271   1e-82    Camelina sativa [gold-of-pleasure]
ref|NP_190455.2|  uncharacterized protein                               270   3e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009395181.1|  PREDICTED: uncharacterized protein LOC103980467    269   4e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010247124.1|  PREDICTED: uncharacterized protein LOC104590245    263   8e-82    Nelumbo nucifera [Indian lotus]
ref|XP_009623174.1|  PREDICTED: uncharacterized protein LOC104114...    268   9e-82    Nicotiana tomentosiformis
gb|ERN16866.1|  hypothetical protein AMTR_s00057p00146260               268   1e-81    Amborella trichopoda
emb|CAB86633.1|  putative protein                                       265   4e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010515221.1|  PREDICTED: uncharacterized protein LOC104791110    265   6e-80    Camelina sativa [gold-of-pleasure]
ref|XP_002875929.1|  hypothetical protein ARALYDRAFT_485239             264   8e-80    
ref|XP_002964484.1|  hypothetical protein SELMODRAFT_438807             260   1e-78    Selaginella moellendorffii
ref|XP_002975311.1|  hypothetical protein SELMODRAFT_442801             259   3e-78    
gb|KCW48522.1|  hypothetical protein EUGRSUZ_K02199                     257   1e-77    Eucalyptus grandis [rose gum]
ref|XP_010438932.1|  PREDICTED: caldesmon-like                          260   1e-77    Camelina sativa [gold-of-pleasure]
ref|XP_010237694.1|  PREDICTED: uncharacterized protein LOC100834...    261   2e-77    Brachypodium distachyon [annual false brome]
ref|XP_006287432.1|  hypothetical protein CARUB_v10000636mg             257   2e-77    Capsella rubella
ref|XP_010237693.1|  PREDICTED: uncharacterized protein LOC100834...    261   2e-77    
ref|XP_010448485.1|  PREDICTED: uncharacterized protein LOC104730...    259   2e-77    Camelina sativa [gold-of-pleasure]
ref|XP_010448486.1|  PREDICTED: uncharacterized protein LOC104730...    259   2e-77    Camelina sativa [gold-of-pleasure]
ref|XP_010433693.1|  PREDICTED: uncharacterized protein LOC104717762    259   3e-77    Camelina sativa [gold-of-pleasure]
ref|XP_006663480.1|  PREDICTED: CAP-Gly domain-containing linker ...    259   5e-77    Oryza brachyantha
ref|XP_002869690.1|  expressed protein                                  259   1e-76    Arabidopsis lyrata subsp. lyrata
emb|CDX80382.1|  BnaC07g30620D                                          255   1e-76    
gb|KHG28186.1|  atg11                                                   257   1e-76    Gossypium arboreum [tree cotton]
ref|NP_001119051.1|  uncharacterized protein                            260   1e-76    Arabidopsis thaliana [mouse-ear cress]
ref|NP_194237.2|  uncharacterized protein                               260   1e-76    Arabidopsis thaliana [mouse-ear cress]
gb|KHG28185.1|  atg11                                                   257   2e-76    Gossypium arboreum [tree cotton]
ref|XP_010421179.1|  PREDICTED: uncharacterized protein LOC104706668    254   2e-76    Camelina sativa [gold-of-pleasure]
ref|XP_006283270.1|  hypothetical protein CARUB_v10004304mg             257   4e-76    
gb|ABA93965.1|  expressed protein                                       259   4e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010493493.1|  PREDICTED: uncharacterized protein LOC104770731    253   6e-76    
ref|XP_006413349.1|  hypothetical protein EUTSA_v10024690mg             255   6e-76    Eutrema salsugineum [saltwater cress]
ref|XP_010545938.1|  PREDICTED: plectin-like isoform X4                 249   6e-76    Tarenaya hassleriana [spider flower]
ref|XP_004980549.1|  PREDICTED: pre-mRNA-splicing factor CWC22 ho...    257   7e-76    
emb|CDX88044.1|  BnaA06g26350D                                          253   9e-76    
dbj|BAJ95178.1|  predicted protein                                      256   1e-75    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001067981.2|  Os11g0520500                                       258   1e-75    
ref|XP_008790705.1|  PREDICTED: uncharacterized protein LOC103707...    252   2e-75    Phoenix dactylifera
ref|XP_009150900.1|  PREDICTED: uncharacterized protein LOC103874239    251   3e-75    Brassica rapa
gb|KFK27654.1|  hypothetical protein AALP_AA8G411300                    251   5e-75    Arabis alpina [alpine rockcress]
ref|XP_008678157.1|  PREDICTED: protein SOGA3-like                      254   7e-75    Zea mays [maize]
ref|XP_008798921.1|  PREDICTED: uncharacterized protein LOC103713683    244   7e-75    
ref|XP_002449559.1|  hypothetical protein SORBIDRAFT_05g019070          256   1e-74    Sorghum bicolor [broomcorn]
ref|XP_010099602.1|  hypothetical protein L484_004034                   249   1e-74    
ref|XP_010454658.1|  PREDICTED: uncharacterized protein LOC104736385    249   2e-74    Camelina sativa [gold-of-pleasure]
ref|XP_009615103.1|  PREDICTED: uncharacterized protein LOC104107890    239   4e-74    Nicotiana tomentosiformis
ref|XP_012089161.1|  PREDICTED: coiled-coil domain-containing pro...    251   4e-74    Jatropha curcas
emb|CAB87914.1|  putative protein                                       249   9e-74    Arabidopsis thaliana [mouse-ear cress]
gb|EMT30590.1|  hypothetical protein F775_12884                         255   1e-73    
gb|EEE52188.1|  hypothetical protein OsJ_34062                          251   1e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010904828.1|  PREDICTED: uncharacterized protein LOC105032156    246   1e-73    Elaeis guineensis
ref|XP_008218218.1|  PREDICTED: uncharacterized protein LOC103318595    251   1e-73    
ref|XP_006394633.1|  hypothetical protein EUTSA_v10003911mg             248   1e-73    
emb|CAB36749.1|  putative protein                                       240   2e-73    Arabidopsis thaliana [mouse-ear cress]
gb|KFK29000.1|  hypothetical protein AALP_AA7G076100                    249   3e-73    Arabis alpina [alpine rockcress]
gb|KFK29001.1|  hypothetical protein AALP_AA7G076100                    249   3e-73    Arabis alpina [alpine rockcress]
ref|XP_010039005.1|  PREDICTED: uncharacterized protein LOC104427641    245   8e-73    
gb|EEC68259.1|  hypothetical protein OsI_36288                          250   9e-73    Oryza sativa Indica Group [Indian rice]
ref|XP_007207715.1|  hypothetical protein PRUPE_ppa025957mg             246   3e-72    
gb|KCW61705.1|  hypothetical protein EUGRSUZ_H04425                     233   7e-72    Eucalyptus grandis [rose gum]
emb|CDY03383.1|  BnaC01g16990D                                          244   2e-71    
emb|CDY34338.1|  BnaA01g14410D                                          243   3e-71    Brassica napus [oilseed rape]
ref|XP_010097351.1|  hypothetical protein L484_010229                   245   3e-71    
gb|EEC72087.1|  hypothetical protein OsI_05032                          238   4e-71    Oryza sativa Indica Group [Indian rice]
ref|XP_009138814.1|  PREDICTED: triadin isoform X2                      243   6e-71    Brassica rapa
ref|XP_009138807.1|  PREDICTED: triadin isoform X1                      243   6e-71    Brassica rapa
ref|XP_006413348.1|  hypothetical protein EUTSA_v10024690mg             241   8e-71    
ref|XP_009342037.1|  PREDICTED: fas-binding factor 1-like               243   8e-71    
ref|XP_009772645.1|  PREDICTED: uncharacterized protein LOC104222...    241   1e-70    Nicotiana sylvestris
ref|XP_007030136.1|  Uncharacterized protein TCM_025951                 244   2e-70    
gb|EEE55938.1|  hypothetical protein OsJ_04631                          238   3e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010485897.1|  PREDICTED: uncharacterized protein LOC104764...    243   5e-70    Camelina sativa [gold-of-pleasure]
ref|XP_010485896.1|  PREDICTED: uncharacterized protein LOC104764...    243   5e-70    
ref|XP_011032546.1|  PREDICTED: uncharacterized protein LOC105131319    240   1e-69    Populus euphratica
ref|XP_011465884.1|  PREDICTED: coiled-coil domain-containing pro...    238   3e-69    Fragaria vesca subsp. vesca
ref|XP_011465885.1|  PREDICTED: coiled-coil domain-containing pro...    238   3e-69    Fragaria vesca subsp. vesca
ref|XP_011465883.1|  PREDICTED: coiled-coil domain-containing pro...    238   4e-69    Fragaria vesca subsp. vesca
ref|XP_006471854.1|  PREDICTED: golgin candidate 5-like                 241   4e-69    
ref|XP_010464000.1|  PREDICTED: uncharacterized protein LOC104744625    240   6e-69    Camelina sativa [gold-of-pleasure]
ref|XP_002872068.1|  hypothetical protein ARALYDRAFT_489231             235   6e-69    
ref|XP_010659988.1|  PREDICTED: uncharacterized protein LOC100260652    237   6e-69    
ref|XP_006382705.1|  hypothetical protein POPTR_0005s04600g             237   6e-69    
ref|XP_010327287.1|  PREDICTED: uncharacterized protein LOC101260484    236   9e-69    Solanum lycopersicum
ref|XP_007147111.1|  hypothetical protein PHAVU_006G096900g             225   1e-68    Phaseolus vulgaris [French bean]
ref|XP_006338920.1|  PREDICTED: mucin-17-like                           234   1e-68    
ref|XP_001777692.1|  predicted protein                                  226   2e-68    
ref|XP_006408121.1|  hypothetical protein EUTSA_v10020103mg             237   6e-68    
ref|XP_011082849.1|  PREDICTED: uncharacterized protein LOC105165513    233   6e-68    Sesamum indicum [beniseed]
ref|XP_010421737.1|  PREDICTED: uncharacterized protein LOC104707...    236   8e-68    Camelina sativa [gold-of-pleasure]
ref|XP_010421675.1|  PREDICTED: uncharacterized protein LOC104707...    236   9e-68    Camelina sativa [gold-of-pleasure]
ref|XP_010025108.1|  PREDICTED: uncharacterized protein LOC104415...    234   1e-67    
ref|XP_010025105.1|  PREDICTED: uncharacterized protein LOC104415...    234   1e-67    Eucalyptus grandis [rose gum]
ref|XP_010025106.1|  PREDICTED: uncharacterized protein LOC104415...    234   1e-67    
ref|XP_009381579.1|  PREDICTED: uncharacterized protein LOC103969678    231   2e-67    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001774305.1|  predicted protein                                  231   2e-67    
ref|XP_002512652.1|  conserved hypothetical protein                     229   4e-67    
ref|NP_197759.3|  uncharacterized protein                               231   4e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008388995.1|  PREDICTED: uncharacterized protein LOC103451360    232   6e-67    
gb|KDO51299.1|  hypothetical protein CISIN_1g008306mg                   228   1e-66    Citrus sinensis [apfelsine]
ref|XP_009147293.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    232   5e-66    
gb|KDO42712.1|  hypothetical protein CISIN_1g0362271mg                  229   7e-66    Citrus sinensis [apfelsine]
gb|KHN43239.1|  hypothetical protein glysoja_001822                     228   1e-65    Glycine soja [wild soybean]
emb|CBI34283.3|  unnamed protein product                                216   1e-65    Vitis vinifera
ref|XP_003626360.1|  hypothetical protein MTR_7g114220                  228   2e-65    
gb|AES82578.2|  ripening-regulated protein                              227   3e-65    Medicago truncatula
ref|XP_010675034.1|  PREDICTED: uncharacterized protein LOC104891083    228   4e-65    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006605263.1|  PREDICTED: uncharacterized protein LOC100819816    228   4e-65    
emb|CDP18381.1|  unnamed protein product                                226   4e-65    Coffea canephora [robusta coffee]
gb|KCW64335.1|  hypothetical protein EUGRSUZ_G01963                     223   7e-65    Eucalyptus grandis [rose gum]
ref|XP_006438861.1|  hypothetical protein CICLE_v10031153mg             222   9e-65    
emb|CDY27806.1|  BnaA05g32150D                                          228   1e-64    Brassica napus [oilseed rape]
gb|KJB44659.1|  hypothetical protein B456_007G263800                    226   2e-64    Gossypium raimondii
emb|CDY41922.1|  BnaC05g46820D                                          226   5e-64    
gb|KDO83176.1|  hypothetical protein CISIN_1g008906mg                   220   5e-64    
gb|KJB44660.1|  hypothetical protein B456_007G263800                    226   6e-64    
ref|XP_010025107.1|  PREDICTED: uncharacterized protein LOC104415...    224   7e-64    
gb|KDP23593.1|  hypothetical protein JCGZ_23426                         226   8e-64    
gb|EYU38200.1|  hypothetical protein MIMGU_mgv1a002994mg                223   1e-63    
ref|XP_006606606.1|  PREDICTED: protein anoxia up-regulated-like ...    219   1e-63    
ref|XP_010546642.1|  PREDICTED: uncharacterized protein LOC104818...    225   2e-63    
ref|XP_010546640.1|  PREDICTED: uncharacterized protein LOC104818...    225   2e-63    
ref|XP_010524892.1|  PREDICTED: uncharacterized protein LOC104802...    224   3e-63    
ref|XP_010524893.1|  PREDICTED: uncharacterized protein LOC104802...    223   4e-63    
ref|XP_006300090.1|  hypothetical protein CARUB_v10016318mg             223   5e-63    
ref|XP_002884485.1|  hypothetical protein ARALYDRAFT_340666             223   5e-63    
ref|XP_007043823.1|  Uncharacterized protein isoform 2                  218   7e-63    
ref|XP_006577742.1|  PREDICTED: uncharacterized protein LOC102666442    213   2e-62    
ref|XP_011648785.1|  PREDICTED: coiled-coil domain-containing pro...    219   7e-62    
gb|EPS68720.1|  hypothetical protein M569_06050                         215   3e-61    
ref|XP_007043824.1|  Uncharacterized protein isoform 3                  211   2e-60    
gb|KHN04038.1|  hypothetical protein glysoja_022724                     213   4e-60    
ref|XP_008662960.1|  PREDICTED: uncharacterized protein LOC103641...    212   4e-60    
ref|XP_008662961.1|  PREDICTED: uncharacterized protein LOC103641...    212   4e-60    
ref|XP_008455538.1|  PREDICTED: uncharacterized protein LOC103495...    212   2e-59    
gb|KJB15174.1|  hypothetical protein B456_002G163500                    207   4e-59    
ref|XP_001774286.1|  predicted protein                                  205   1e-57    
ref|NP_192603.2|  uncharacterized protein                               205   3e-56    
ref|XP_006606607.1|  PREDICTED: protein anoxia up-regulated-like ...    193   6e-54    
ref|XP_010100044.1|  hypothetical protein L484_013156                   193   1e-53    
gb|KGN60847.1|  hypothetical protein Csa_2G013280                       193   1e-52    
ref|XP_010231707.1|  PREDICTED: uncharacterized protein LOC100835935    191   3e-52    
ref|XP_010546643.1|  PREDICTED: uncharacterized protein LOC104818...    192   6e-52    
gb|KDO51300.1|  hypothetical protein CISIN_1g008306mg                   186   3e-51    
ref|XP_010100043.1|  hypothetical protein L484_013155                   176   9e-51    
ref|XP_008392717.1|  PREDICTED: uncharacterized protein LOC103454897    182   1e-49    
ref|XP_010318662.1|  PREDICTED: uncharacterized protein LOC101264...    181   5e-49    
dbj|BAK04121.1|  predicted protein                                      175   4e-48    
gb|AAB81875.2|  hypothetical protein                                    181   7e-48    
gb|KJB51280.1|  hypothetical protein B456_008G210100                    172   5e-46    
ref|NP_851014.1|  uncharacterized protein                               167   9e-44    
ref|XP_007043827.1|  Uncharacterized protein isoform 6                  159   4e-41    
ref|XP_010531861.1|  PREDICTED: uncharacterized protein LOC104808...    157   2e-40    
ref|XP_009595702.1|  PREDICTED: uncharacterized protein LOC104091958    147   1e-39    
ref|XP_004963416.1|  PREDICTED: uncharacterized protein LOC101763367    157   2e-39    
ref|XP_008370656.1|  PREDICTED: uncharacterized protein LOC103434129    132   4e-34    
ref|XP_008355870.1|  PREDICTED: uncharacterized protein LOC103419545    131   1e-33    
gb|EPS73766.1|  hypothetical protein M569_00990                         135   8e-33    
ref|XP_006433123.1|  hypothetical protein CICLE_v100035142mg            130   1e-32    
ref|XP_007043825.1|  Uncharacterized protein isoform 4                  133   5e-32    
ref|XP_009772646.1|  PREDICTED: uncharacterized protein LOC104222...    132   2e-31    
gb|EPS67968.1|  hypothetical protein M569_06807                         120   3e-30    
ref|XP_002512287.1|  conserved hypothetical protein                     129   7e-30    
ref|XP_008455554.1|  PREDICTED: uncharacterized protein LOC103495...    126   6e-29    
ref|XP_011465896.1|  PREDICTED: coiled-coil domain-containing pro...    125   1e-28    
ref|NP_001054649.1|  Os05g0148500                                       119   2e-26    
gb|AFW57617.1|  hypothetical protein ZEAMMB73_211275                    114   3e-25    
dbj|BAA97231.1|  unnamed protein product                                113   8e-25    
ref|XP_011648787.1|  PREDICTED: coiled-coil domain-containing pro...    114   1e-24    
emb|CDP18971.1|  unnamed protein product                                105   3e-22    
ref|XP_011465893.1|  PREDICTED: coiled-coil domain-containing pro...    104   2e-21    
ref|XP_011465889.1|  PREDICTED: coiled-coil domain-containing pro...    104   2e-21    
gb|KHG14472.1|  Autophagy-related 11                                    100   7e-21    
gb|KHG09717.1|  Taz1-interacting factor 1                             98.6    4e-20    
gb|EEE62332.1|  hypothetical protein OsJ_17121                        97.4    8e-20    
ref|XP_006433124.1|  hypothetical protein CICLE_v100035141mg          90.9    2e-19    
gb|AFW57616.1|  hypothetical protein ZEAMMB73_774231                  87.4    4e-18    
ref|XP_011648788.1|  PREDICTED: coiled-coil domain-containing pro...  92.8    2e-17    
gb|EEC78518.1|  hypothetical protein OsI_18458                        88.6    2e-16    
ref|XP_008455555.1|  PREDICTED: uncharacterized protein LOC103495...  88.2    5e-16    
ref|XP_003063871.1|  predicted protein                                79.3    4e-13    
ref|XP_002505829.1|  predicted protein                                77.4    1e-12    
emb|CDX68503.1|  BnaC01g25810D                                        70.5    4e-12    
emb|CEG01980.1|  unnamed product                                      69.3    5e-10    
ref|XP_003082852.1|  unnamed protein product                          68.9    9e-10    
ref|XP_001422651.1|  predicted protein                                66.6    4e-09    
gb|KIY99844.1|  hypothetical protein MNEG_8115                        66.6    5e-09    
ref|XP_001703560.1|  predicted protein                                62.8    8e-08    



>ref|XP_011086869.1| PREDICTED: uncharacterized protein LOC105168472 [Sesamum indicum]
Length=557

 Score =   380 bits (976),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 178/218 (82%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLAA+ GIC+DIA++K+EYWSSLAPLP E+VLSAGQKAKEECW+KGD NP+R 
Sbjct  334  CWLARYWGLAAQLGICADIALSKHEYWSSLAPLPLEVVLSAGQKAKEECWEKGDNNPQRG  393

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V D +DLTGEGNIESML+VEMGLKEL SLKVE++IVLA AQQRRPN+ RTS++D KSP
Sbjct  394  KLVEDFNDLTGEGNIESMLTVEMGLKELASLKVEESIVLAFAQQRRPNSTRTSLTDFKSP  453

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPKYMEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEEEIANK+L+FWI RS +SPTS
Sbjct  454  IDPKYMEAFELSPEESEDVLFKEAWLTYFWRRAKAYGIEEEIANKRLKFWISRSGQSPTS  513

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIG  244
            HDAVDVEQGLMELRKL IEHRLWEASRKE DQD SL+ 
Sbjct  514  HDAVDVEQGLMELRKLEIEHRLWEASRKEIDQDDSLLN  551



>ref|XP_002297871.1| hypothetical protein POPTR_0001s13160g [Populus trichocarpa]
 gb|EEE82676.1| hypothetical protein POPTR_0001s13160g [Populus trichocarpa]
Length=539

 Score =   374 bits (959),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 194/215 (90%), Gaps = 1/215 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLAR WGLAA+YGIC+D+A++K+EYWSSLAPLPFE+V+SAGQKAKEECW+KGDE+ E R
Sbjct  325  CWLARYWGLAAKYGICADVAVSKHEYWSSLAPLPFEVVVSAGQKAKEECWEKGDEDSEKR  384

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
                 DLSDLTGEGNIESMLSVEMGLKEL SLKVEDAIVLALAQQRR N+ R SISD+KS
Sbjct  385  STLAQDLSDLTGEGNIESMLSVEMGLKELASLKVEDAIVLALAQQRRANSLRLSISDVKS  444

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPKY EA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE+ A ++ QFWI RSA SP+
Sbjct  445  PGDPKYTEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEDTAKERFQFWISRSAHSPS  504

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            SHDAVDVEQGLMELRKLGIEHRLWEASRKE DQDS
Sbjct  505  SHDAVDVEQGLMELRKLGIEHRLWEASRKEIDQDS  539



>ref|XP_003536819.1| PREDICTED: myosin heavy chain, skeletal muscle-like [Glycine 
max]
 gb|KHN37247.1| hypothetical protein glysoja_013462 [Glycine soja]
Length=529

 Score =   373 bits (957),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/220 (81%), Positives = 198/220 (90%), Gaps = 1/220 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLAR WGLAA+YGIC+D+A++KYE WSSLAPLPFE+V+SAGQKAKEECW+KGD+  E R
Sbjct  308  CWLARYWGLAAKYGICADVAVSKYELWSSLAPLPFEVVVSAGQKAKEECWEKGDDAIEKR  367

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DL+DLTGEGNIESMLSVEMGLKEL SLKVEDAIV ALAQQRRPN+AR  +SD+KS
Sbjct  368  SKLVPDLNDLTGEGNIESMLSVEMGLKELASLKVEDAIVQALAQQRRPNSARQLVSDIKS  427

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEEEIA ++L+FWI RS  SPT
Sbjct  428  PGDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEEIAEERLRFWISRSGHSPT  487

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK  241
            SHDAVDVEQGL ELRKLGIEHRLWEASRKE DQDS++  K
Sbjct  488  SHDAVDVEQGLSELRKLGIEHRLWEASRKEVDQDSTIARK  527



>ref|XP_007142592.1| hypothetical protein PHAVU_007G000500g [Phaseolus vulgaris]
 gb|ESW14586.1| hypothetical protein PHAVU_007G000500g [Phaseolus vulgaris]
Length=428

 Score =   369 bits (946),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 197/220 (90%), Gaps = 1/220 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLAR WGLAA+YGIC+D+A++KYE WSSLAPLPFE+V+SAGQKAKEECW+KGD+  E R
Sbjct  205  CWLARYWGLAAKYGICADVAVSKYELWSSLAPLPFEVVVSAGQKAKEECWEKGDDAIEKR  264

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DL+DLTGEGNIESMLSVEMGLKEL SLKVEDAIV ALAQQRRPN+AR  +SD+KS
Sbjct  265  SKIVPDLNDLTGEGNIESMLSVEMGLKELASLKVEDAIVQALAQQRRPNSARQLVSDIKS  324

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPK+MEA ELSPEESEDVLFKEAWLT+FWRRAK  GIEE+IA ++LQFWIGRS  SPT
Sbjct  325  PGDPKFMEAFELSPEESEDVLFKEAWLTFFWRRAKVHGIEEDIAKERLQFWIGRSGHSPT  384

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK  241
            SHDAVDVEQGL ELRKLGIEHRLWEASRKE DQD ++  K
Sbjct  385  SHDAVDVEQGLSELRKLGIEHRLWEASRKEVDQDLTIARK  424



>ref|XP_012088735.1| PREDICTED: coiled-coil domain-containing protein SCD2 [Jatropha 
curcas]
 gb|KDP23274.1| hypothetical protein JCGZ_23107 [Jatropha curcas]
Length=572

 Score =   373 bits (958),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDE-NPER  721
            CWLAR WGLAA+YGIC+D+A++K+EYWSSLAPLPFE+V+SAGQKAKEECW+KGD+ N +R
Sbjct  341  CWLARYWGLAAKYGICADVAVSKHEYWSSLAPLPFEVVVSAGQKAKEECWEKGDDDNEKR  400

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DLSDLTGEGNIESMLSVEMGLKEL SLKVEDAIVLALAQQRR N+AR SISD+KS
Sbjct  401  SKLVEDLSDLTGEGNIESMLSVEMGLKELASLKVEDAIVLALAQQRRANSARLSISDIKS  460

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPKYMEA+ELSPEESEDVLFKEAWLTYFW  AKA GIEE+IA ++LQFWI R   SP+
Sbjct  461  PGDPKYMEAVELSPEESEDVLFKEAWLTYFWSTAKANGIEEDIAKERLQFWINRRGHSPS  520

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            SHDAVDV+QGL+ELRKLGIEHRLWEASR++ DQDSS
Sbjct  521  SHDAVDVDQGLVELRKLGIEHRLWEASRRDIDQDSS  556



>ref|XP_003556588.1| PREDICTED: protein anoxia up-regulated-like isoform X1 [Glycine 
max]
Length=527

 Score =   370 bits (951),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 197/220 (90%), Gaps = 1/220 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLAR WGLAA+YGIC+D+A++KYE WSSLAPLPFE+V+SAGQKAKEECW+KGD+  E R
Sbjct  305  CWLARYWGLAAKYGICADVAVSKYELWSSLAPLPFEVVVSAGQKAKEECWEKGDDATEKR  364

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DL+DLTGEGNIESMLSVEMGLKEL SLKVEDAIV ALAQQRRPN+AR  +SD+KS
Sbjct  365  SKLVPDLNDLTGEGNIESMLSVEMGLKELASLKVEDAIVRALAQQRRPNSARQLVSDIKS  424

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE+IA ++L+FWIGRS  SPT
Sbjct  425  PGDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEDIAKERLRFWIGRSGHSPT  484

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK  241
            SHDAVD EQGL ELRKLGIEHRLWEASRKE DQD ++  K
Sbjct  485  SHDAVDAEQGLSELRKLGIEHRLWEASRKEVDQDFTIARK  524



>ref|XP_007142591.1| hypothetical protein PHAVU_007G000500g [Phaseolus vulgaris]
 gb|ESW14585.1| hypothetical protein PHAVU_007G000500g [Phaseolus vulgaris]
Length=540

 Score =   370 bits (951),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 197/220 (90%), Gaps = 1/220 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLAR WGLAA+YGIC+D+A++KYE WSSLAPLPFE+V+SAGQKAKEECW+KGD+  E R
Sbjct  317  CWLARYWGLAAKYGICADVAVSKYELWSSLAPLPFEVVVSAGQKAKEECWEKGDDAIEKR  376

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DL+DLTGEGNIESMLSVEMGLKEL SLKVEDAIV ALAQQRRPN+AR  +SD+KS
Sbjct  377  SKIVPDLNDLTGEGNIESMLSVEMGLKELASLKVEDAIVQALAQQRRPNSARQLVSDIKS  436

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPK+MEA ELSPEESEDVLFKEAWLT+FWRRAK  GIEE+IA ++LQFWIGRS  SPT
Sbjct  437  PGDPKFMEAFELSPEESEDVLFKEAWLTFFWRRAKVHGIEEDIAKERLQFWIGRSGHSPT  496

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK  241
            SHDAVDVEQGL ELRKLGIEHRLWEASRKE DQD ++  K
Sbjct  497  SHDAVDVEQGLSELRKLGIEHRLWEASRKEVDQDLTIARK  536



>gb|KCW64334.1| hypothetical protein EUGRSUZ_G01963 [Eucalyptus grandis]
Length=537

 Score =   369 bits (947),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YGIC+D+A++K+E+WSSLAPLPFE+VLSAGQKAKEE  +KGD+NPER 
Sbjct  326  CWLARYWGLAVKYGICADVAVSKHEHWSSLAPLPFEVVLSAGQKAKEEFSEKGDDNPERS  385

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DLSDLTGEGNIESMLSVEMGLKEL SLKVE+AIVLALAQQRRPN+ R S SDLKSP
Sbjct  386  KIAHDLSDLTGEGNIESMLSVEMGLKELASLKVEEAIVLALAQQRRPNSTRISASDLKSP  445

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIE E A ++LQFWI RSA SPTS
Sbjct  446  GDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEVETAKERLQFWINRSAHSPTS  505

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKET  268
            HDAVDVEQGLMELRKLGIEHRLWEASRKET
Sbjct  506  HDAVDVEQGLMELRKLGIEHRLWEASRKET  535



>ref|XP_010066444.1| PREDICTED: uncharacterized protein LOC104453551 isoform X1 [Eucalyptus 
grandis]
 gb|KCW64333.1| hypothetical protein EUGRSUZ_G01963 [Eucalyptus grandis]
Length=555

 Score =   369 bits (948),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YGIC+D+A++K+E+WSSLAPLPFE+VLSAGQKAKEE  +KGD+NPER 
Sbjct  344  CWLARYWGLAVKYGICADVAVSKHEHWSSLAPLPFEVVLSAGQKAKEEFSEKGDDNPERS  403

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DLSDLTGEGNIESMLSVEMGLKEL SLKVE+AIVLALAQQRRPN+ R S SDLKSP
Sbjct  404  KIAHDLSDLTGEGNIESMLSVEMGLKELASLKVEEAIVLALAQQRRPNSTRISASDLKSP  463

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIE E A ++LQFWI RSA SPTS
Sbjct  464  GDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEVETAKERLQFWINRSAHSPTS  523

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKET  268
            HDAVDVEQGLMELRKLGIEHRLWEASRKET
Sbjct  524  HDAVDVEQGLMELRKLGIEHRLWEASRKET  553



>ref|XP_006343189.1| PREDICTED: uncharacterized protein LOC102581164 [Solanum tuberosum]
Length=551

 Score =   367 bits (943),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA +K+EYWSS APLPFE+V+SAGQKAKEEC +KGD+NPER 
Sbjct  344  CWLARYWGLATQFGICADIAASKHEYWSSFAPLPFELVISAGQKAKEECLEKGDDNPERG  403

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DL+DLTGEGNIESMLSVEMGL EL SLKVEDAIVLALAQQRRPN+ARTSISD+KSP
Sbjct  404  KFVQDLNDLTGEGNIESMLSVEMGLNELVSLKVEDAIVLALAQQRRPNSARTSISDIKSP  463

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPKYMEA ELSPEESEDVLFKEAWLTYFWRRAKA GI+EE ANK+LQFW  RS  SPTS
Sbjct  464  SDPKYMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIQEEKANKRLQFWSSRSGHSPTS  523

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRK  274
            HDAVDVEQGLMELRKL IE +LWE+SR+
Sbjct  524  HDAVDVEQGLMELRKLAIEQKLWESSRR  551



>gb|KDO83180.1| hypothetical protein CISIN_1g008906mg [Citrus sinensis]
Length=351

 Score =   360 bits (925),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 191/209 (91%), Gaps = 1/209 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDE-NPER  721
            CWLAR WGLAA+YGIC D+A++KYEYWSSLAPLPFE+V+SAGQKAKEECW+KGD+ N +R
Sbjct  142  CWLARYWGLAAKYGICVDVAVSKYEYWSSLAPLPFEVVISAGQKAKEECWEKGDDDNEKR  201

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K ++D++DLTGEGNIESMLSVEMGLKEL + KVEDAIVLALAQQRR N+ R SISD+KS
Sbjct  202  SKLLVDINDLTGEGNIESMLSVEMGLKELAASKVEDAIVLALAQQRRANSLRVSISDIKS  261

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE IA ++L+FWI RS  SP+
Sbjct  262  PGDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEHIAKERLEFWISRSGHSPS  321

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRK  274
            SHDAVDVEQGLMELRKLGIEHRLWEASR+
Sbjct  322  SHDAVDVEQGLMELRKLGIEHRLWEASRR  350



>ref|XP_011036158.1| PREDICTED: uncharacterized protein LOC105133757 [Populus euphratica]
Length=558

 Score =   367 bits (941),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/215 (81%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLAR WGLAA+YGIC+D+A++K+EYWSSLAPLPFE+V+SAGQKAKEECW+KGDE+ E R
Sbjct  344  CWLARYWGLAAKYGICADVAVSKHEYWSSLAPLPFEVVVSAGQKAKEECWEKGDEDSEKR  403

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
                 DLSDLTGEGNIESMLSVEMGLKEL SLKVEDAIVLALAQQR+ N+ R SISD KS
Sbjct  404  STLAQDLSDLTGEGNIESMLSVEMGLKELASLKVEDAIVLALAQQRQANSLRLSISDAKS  463

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPKY EA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE+ A ++ QFWI RS  SP+
Sbjct  464  PGDPKYTEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEDTAKERFQFWISRSVHSPS  523

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            SHDAVDVEQGL ELRKLGIEHRLWEASRKE DQDS
Sbjct  524  SHDAVDVEQGLTELRKLGIEHRLWEASRKEIDQDS  558



>ref|XP_004497432.1| PREDICTED: uncharacterized protein LOC101507286 isoform X2 [Cicer 
arietinum]
Length=533

 Score =   365 bits (937),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 193/217 (89%), Gaps = 1/217 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLAR WGLAA+YGIC+D+A++KYE WSSLAPLPFE+V+SAGQKAKEECW+KGD+  E R
Sbjct  316  CWLARYWGLAAKYGICADVAVSKYELWSSLAPLPFEVVVSAGQKAKEECWEKGDDATEKR  375

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
               V D++DLTGEGNIESMLSVEMGLKEL SLKVEDAIV ALAQQRRPN+AR  +SD+KS
Sbjct  376  SNLVPDINDLTGEGNIESMLSVEMGLKELVSLKVEDAIVQALAQQRRPNSARQLVSDIKS  435

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE+IA ++ QFWIGRS  SPT
Sbjct  436  PGDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEDIAKERFQFWIGRSGHSPT  495

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  250
            SHDAVDVEQGL ELRKLG+E RLWE SRKE DQD ++
Sbjct  496  SHDAVDVEQGLSELRKLGVERRLWEESRKEVDQDFAI  532



>ref|XP_004239298.1| PREDICTED: uncharacterized protein LOC101253187 [Solanum lycopersicum]
Length=551

 Score =   365 bits (937),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA +K+EYWSS APLPFE+V+SAGQKAKEEC +KGD+NPE  
Sbjct  344  CWLARYWGLATQFGICADIAASKHEYWSSFAPLPFELVISAGQKAKEECLEKGDDNPEMG  403

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DL+DLTGEGNIESMLSVEMGL EL SLKVEDAIVLALAQQRRPN+ARTSISD+KSP
Sbjct  404  KFVQDLNDLTGEGNIESMLSVEMGLNELVSLKVEDAIVLALAQQRRPNSARTSISDIKSP  463

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPKYMEA ELSPEESEDVLFKEAWLTYFWRRAKA GI+EE ANK+LQFW  RS  SPTS
Sbjct  464  SDPKYMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIQEEKANKRLQFWSSRSGHSPTS  523

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRK  274
            HDAVDVEQGLMELRKL IE +LWE+SR+
Sbjct  524  HDAVDVEQGLMELRKLAIEQKLWESSRR  551



>ref|XP_010066445.1| PREDICTED: uncharacterized protein LOC104453551 isoform X2 [Eucalyptus 
grandis]
Length=554

 Score =   365 bits (936),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 191/210 (91%), Gaps = 1/210 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YGIC+D+A++K+E+WSSLAPLPFE+VLSAGQKAKEE  +KGD+NPER 
Sbjct  344  CWLARYWGLAVKYGICADVAVSKHEHWSSLAPLPFEVVLSAGQKAKEEFSEKGDDNPERS  403

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DLSDLTGEGNIESMLSVEMGLKEL SLKVE+AIVLALAQQRRPN+ R S SDLKSP
Sbjct  404  KIAHDLSDLTGEGNIESMLSVEMGLKELASLKVEEAIVLALAQQRRPNSTRIS-SDLKSP  462

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIE E A ++LQFWI RSA SPTS
Sbjct  463  GDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEVETAKERLQFWINRSAHSPTS  522

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKET  268
            HDAVDVEQGLMELRKLGIEHRLWEASRKET
Sbjct  523  HDAVDVEQGLMELRKLGIEHRLWEASRKET  552



>ref|XP_008222369.1| PREDICTED: uncharacterized protein LOC103322249 [Prunus mume]
Length=563

 Score =   364 bits (935),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 194/217 (89%), Gaps = 1/217 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKG-DENPER  721
            CWLAR WGLAA +GIC+DIA+TKYEYWSSLAPLPFE+V+SAGQKAKEE W+KG D+  +R
Sbjct  338  CWLARNWGLAAMHGICADIAVTKYEYWSSLAPLPFEVVISAGQKAKEESWEKGYDDLEKR  397

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DL+DLTGEGNIESML+VEMGLKEL SLKVE+AIVLALAQQRRPN++R S SD+KS
Sbjct  398  NKLVQDLNDLTGEGNIESMLAVEMGLKELASLKVEEAIVLALAQQRRPNSSRLSFSDIKS  457

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            P DPK+MEAIELSPEESEDVLFKEAWLTYFWRRAK  GIEEEIA +++QFWI RS  SPT
Sbjct  458  PADPKFMEAIELSPEESEDVLFKEAWLTYFWRRAKVHGIEEEIAKERVQFWINRSRHSPT  517

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  250
            SHDAVDVE+GLMELRKLGIEHRLWE SRK  DQD S+
Sbjct  518  SHDAVDVEEGLMELRKLGIEHRLWEESRKAIDQDPSM  554



>ref|XP_004310133.1| PREDICTED: coiled-coil domain-containing protein SCD2 [Fragaria 
vesca subsp. vesca]
Length=554

 Score =   363 bits (932),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 195/218 (89%), Gaps = 1/218 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLAR WGLA+RYGIC+DIA++KYE+WSSLAPLPFE+V+SAGQKAKEE W+KGD++P+ R
Sbjct  333  CWLARNWGLASRYGICADIAVSKYEHWSSLAPLPFEVVVSAGQKAKEESWEKGDDDPDKR  392

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DL+DLTGEGNIESML+VEMGLKEL  LKVE+ IVLALA+QRR N+AR S SD+KS
Sbjct  393  NKLVQDLNDLTGEGNIESMLAVEMGLKELAFLKVEENIVLALAEQRRSNSARLSFSDMKS  452

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            P DPK+MEAIELSPEESEDVLFKEAWLTYFWRRAK LGIEE IA +++QFWI RS  +P+
Sbjct  453  PSDPKFMEAIELSPEESEDVLFKEAWLTYFWRRAKVLGIEENIAKERVQFWINRSGHAPS  512

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  247
            SHDAVDVE+GLMELRKLGIEHRLWE SRK  DQDSS +
Sbjct  513  SHDAVDVEEGLMELRKLGIEHRLWEESRKTIDQDSSTV  550



>ref|XP_006438862.1| hypothetical protein CICLE_v10031153mg [Citrus clementina]
 gb|ESR52102.1| hypothetical protein CICLE_v10031153mg [Citrus clementina]
Length=547

 Score =   363 bits (931),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 192/209 (92%), Gaps = 1/209 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDE-NPER  721
            CWLAR WGLAA+YGIC+D+A++KYEYWSSLAPLPFE+V+SAGQKAKEECW+KGD+ N +R
Sbjct  338  CWLARYWGLAAKYGICADVAVSKYEYWSSLAPLPFEVVISAGQKAKEECWEKGDDDNEKR  397

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V+D++DLTGEGNIESMLSVEMGLKEL + KVEDAIVLALAQQRR N+ R SISD+KS
Sbjct  398  SKLVVDVNDLTGEGNIESMLSVEMGLKELAASKVEDAIVLALAQQRRANSLRVSISDIKS  457

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE IA ++L+FWI RS  SP+
Sbjct  458  PGDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEHIAKERLEFWISRSGHSPS  517

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRK  274
            SHDAVDVEQGLMELRKLGIEHRLWEASR+
Sbjct  518  SHDAVDVEQGLMELRKLGIEHRLWEASRR  546



>gb|KDO83179.1| hypothetical protein CISIN_1g008906mg [Citrus sinensis]
Length=472

 Score =   359 bits (922),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 191/209 (91%), Gaps = 1/209 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDE-NPER  721
            CWLAR WGLAA+YGIC D+A++KYEYWSSLAPLPFE+V+SAGQKAKEECW+KGD+ N +R
Sbjct  263  CWLARYWGLAAKYGICVDVAVSKYEYWSSLAPLPFEVVISAGQKAKEECWEKGDDDNEKR  322

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K ++D++DLTGEGNIESMLSVEMGLKEL + KVEDAIVLALAQQRR N+ R SISD+KS
Sbjct  323  SKLLVDINDLTGEGNIESMLSVEMGLKELAASKVEDAIVLALAQQRRANSLRVSISDIKS  382

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE IA ++L+FWI RS  SP+
Sbjct  383  PGDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEHIAKERLEFWISRSGHSPS  442

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRK  274
            SHDAVDVEQGLMELRKLGIEHRLWEASR+
Sbjct  443  SHDAVDVEQGLMELRKLGIEHRLWEASRR  471



>ref|XP_006483009.1| PREDICTED: myosin-9-like isoform X3 [Citrus sinensis]
Length=472

 Score =   359 bits (921),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 191/209 (91%), Gaps = 1/209 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDE-NPER  721
            CWLAR WGLAA+YGIC D+A++KYEYWSSLAPLPFE+V+SAGQKAKEECW+KGD+ N +R
Sbjct  263  CWLARYWGLAAKYGICVDVAVSKYEYWSSLAPLPFEVVISAGQKAKEECWEKGDDDNEKR  322

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K ++D++DLTGEGNIESMLSVEMGLKEL + KVEDAIVLALAQQRR N+ R SISD+KS
Sbjct  323  SKLLVDINDLTGEGNIESMLSVEMGLKELAASKVEDAIVLALAQQRRANSLRVSISDIKS  382

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE IA ++L+FWI RS  SP+
Sbjct  383  PGDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEHIAKERLEFWISRSGHSPS  442

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRK  274
            SHDAVDVEQGLMELRKLGIEHRLWEASR+
Sbjct  443  SHDAVDVEQGLMELRKLGIEHRLWEASRR  471



>gb|KDO83174.1| hypothetical protein CISIN_1g008906mg [Citrus sinensis]
Length=547

 Score =   361 bits (926),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 191/209 (91%), Gaps = 1/209 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDE-NPER  721
            CWLAR WGLAA+YGIC D+A++KYEYWSSLAPLPFE+V+SAGQKAKEECW+KGD+ N +R
Sbjct  338  CWLARYWGLAAKYGICVDVAVSKYEYWSSLAPLPFEVVISAGQKAKEECWEKGDDDNEKR  397

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K ++D++DLTGEGNIESMLSVEMGLKEL + KVEDAIVLALAQQRR N+ R SISD+KS
Sbjct  398  SKLLVDINDLTGEGNIESMLSVEMGLKELAASKVEDAIVLALAQQRRANSLRVSISDIKS  457

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE IA ++L+FWI RS  SP+
Sbjct  458  PGDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEHIAKERLEFWISRSGHSPS  517

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRK  274
            SHDAVDVEQGLMELRKLGIEHRLWEASR+
Sbjct  518  SHDAVDVEQGLMELRKLGIEHRLWEASRR  546



>ref|XP_004497431.1| PREDICTED: uncharacterized protein LOC101507286 isoform X1 [Cicer 
arietinum]
Length=534

 Score =   360 bits (925),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 172/218 (79%), Positives = 193/218 (89%), Gaps = 2/218 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQK-GDENPE-  724
            CWLAR WGLAA+YGIC+D+A++KYE WSSLAPLPFE+V+SAGQKAKEECW+K GD+  E 
Sbjct  316  CWLARYWGLAAKYGICADVAVSKYELWSSLAPLPFEVVVSAGQKAKEECWEKAGDDATEK  375

Query  723  RVKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLK  544
            R   V D++DLTGEGNIESMLSVEMGLKEL SLKVEDAIV ALAQQRRPN+AR  +SD+K
Sbjct  376  RSNLVPDINDLTGEGNIESMLSVEMGLKELVSLKVEDAIVQALAQQRRPNSARQLVSDIK  435

Query  543  SPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESP  364
            SPGDPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE+IA ++ QFWIGRS  SP
Sbjct  436  SPGDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEDIAKERFQFWIGRSGHSP  495

Query  363  TSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  250
            TSHDAVDVEQGL ELRKLG+E RLWE SRKE DQD ++
Sbjct  496  TSHDAVDVEQGLSELRKLGVERRLWEESRKEVDQDFAI  533



>ref|XP_006483007.1| PREDICTED: myosin-9-like isoform X1 [Citrus sinensis]
Length=547

 Score =   360 bits (924),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 191/209 (91%), Gaps = 1/209 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDE-NPER  721
            CWLAR WGLAA+YGIC D+A++KYEYWSSLAPLPFE+V+SAGQKAKEECW+KGD+ N +R
Sbjct  338  CWLARYWGLAAKYGICVDVAVSKYEYWSSLAPLPFEVVISAGQKAKEECWEKGDDDNEKR  397

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K ++D++DLTGEGNIESMLSVEMGLKEL + KVEDAIVLALAQQRR N+ R SISD+KS
Sbjct  398  SKLLVDINDLTGEGNIESMLSVEMGLKELAASKVEDAIVLALAQQRRANSLRVSISDIKS  457

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE IA ++L+FWI RS  SP+
Sbjct  458  PGDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEHIAKERLEFWISRSGHSPS  517

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRK  274
            SHDAVDVEQGLMELRKLGIEHRLWEASR+
Sbjct  518  SHDAVDVEQGLMELRKLGIEHRLWEASRR  546



>ref|XP_011020859.1| PREDICTED: uncharacterized protein LOC105123085 [Populus euphratica]
Length=559

 Score =   360 bits (923),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 174/215 (81%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLAR WGLAA+YGIC D+A++K+EYWSSLAPLPFE+V+SAGQKAKEECW+KG+E+ E R
Sbjct  345  CWLARYWGLAAKYGICGDVAVSKHEYWSSLAPLPFEVVVSAGQKAKEECWEKGEEDSEKR  404

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
                 DLSDLTGEGNIESMLSVEMGLKEL SLKVE AIVLALAQQRR N  R SISD+KS
Sbjct  405  STLAHDLSDLTGEGNIESMLSVEMGLKELASLKVEVAIVLALAQQRRANALRLSISDVKS  464

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
             GDPKYMEA ELSPEESEDVLFKEAWLTYFWRRA+A GIEE+ A ++LQFWI RS  SP+
Sbjct  465  HGDPKYMEAFELSPEESEDVLFKEAWLTYFWRRAEAHGIEEDTAKERLQFWISRSVHSPS  524

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            SHDAVDVEQGLMELRKLGIEHRLWEASRKE DQ S
Sbjct  525  SHDAVDVEQGLMELRKLGIEHRLWEASRKEIDQGS  559



>ref|XP_007043822.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX99653.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=567

 Score =   360 bits (923),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 195/220 (89%), Gaps = 1/220 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGD-ENPER  721
            CWLAR WGLAARYGIC+DIA++KYEYWSSLAPLPFE+V+SAGQKAKEE  +KGD EN +R
Sbjct  345  CWLARYWGLAARYGICADIALSKYEYWSSLAPLPFEVVVSAGQKAKEEFSEKGDDENEKR  404

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DL+DLTGEGNIESMLSVEMGLKEL SLKVE+AIV ALAQQRR N+ R S+SD+KS
Sbjct  405  SKLVEDLNDLTGEGNIESMLSVEMGLKELASLKVEEAIVHALAQQRRANSVRLSLSDIKS  464

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            P DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIE++ A ++L+FWI RS  SP+
Sbjct  465  PRDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEDDTAKERLKFWISRSGHSPS  524

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK  241
            SHDAVDVE+GLMELRKLGIEHRLWEASRKE DQD+S   K
Sbjct  525  SHDAVDVEEGLMELRKLGIEHRLWEASRKEIDQDNSTSKK  564



>ref|XP_002267942.2| PREDICTED: uncharacterized protein LOC100260846 [Vitis vinifera]
 emb|CBI35662.3| unnamed protein product [Vitis vinifera]
Length=553

 Score =   358 bits (919),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/216 (81%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLAR WGLAAR+GIC+DIA++K+E+WSSLAPLPFE+V+SAGQKAKEE W++G+++PE R
Sbjct  330  CWLARYWGLAARHGICADIAVSKHEHWSSLAPLPFEVVISAGQKAKEE-WRRGEDDPETR  388

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DL+DLTG+GNIESMLSVEMGLKEL SLKVE+AIVLALAQ RRPN+AR S SDLKS
Sbjct  389  SKLVQDLNDLTGDGNIESMLSVEMGLKELASLKVEEAIVLALAQLRRPNSARLSSSDLKS  448

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPKYMEA ELS EESEDVLFKEAWLTYFWRRAKA GIEE+IA ++LQFWI RS  +PT
Sbjct  449  PGDPKYMEAFELSTEESEDVLFKEAWLTYFWRRAKAHGIEEDIAKERLQFWISRSGHAPT  508

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            SHDAVDVEQGLMELRKLGIEH LWEASRKE D+DSS
Sbjct  509  SHDAVDVEQGLMELRKLGIEHWLWEASRKEIDEDSS  544



>ref|XP_008459909.1| PREDICTED: uncharacterized protein LOC103498889 [Cucumis melo]
Length=541

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 173/211 (82%), Positives = 191/211 (91%), Gaps = 1/211 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLAR WGLAA+YGIC DIA+TKYE+WSSLAPLPFEIV+SAGQKAKEE  QKGD +PE R
Sbjct  330  CWLARYWGLAAKYGICMDIAVTKYEHWSSLAPLPFEIVISAGQKAKEEFSQKGDLDPESR  389

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
               V D+SDLTGEGNIESMLSVEMGLKEL SLKVE+AIVLALAQ RRPN+AR S+SD+KS
Sbjct  390  SNLVPDISDLTGEGNIESMLSVEMGLKELASLKVEEAIVLALAQLRRPNSARQSLSDVKS  449

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            P DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE+IA ++LQFWI RSA SP+
Sbjct  450  PVDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEDIAKERLQFWISRSAHSPS  509

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKET  268
            SHDAVDVEQGL+ELRKLGIE R+WEASRKE+
Sbjct  510  SHDAVDVEQGLVELRKLGIERRMWEASRKES  540



>ref|XP_011656790.1| PREDICTED: coiled-coil domain-containing protein SCD2 [Cucumis 
sativus]
 gb|KGN46417.1| hypothetical protein Csa_6G091900 [Cucumis sativus]
Length=541

 Score =   353 bits (907),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 173/211 (82%), Positives = 190/211 (90%), Gaps = 1/211 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLAR WGLAA+YGIC DIA+TKYE+WSSLAPLPFEIV+SAGQKAKEE  QKGD +PE R
Sbjct  330  CWLARYWGLAAKYGICMDIAVTKYEHWSSLAPLPFEIVISAGQKAKEEFSQKGDLDPESR  389

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
               V D+SDLTGEGNIESMLSVEMGLKEL SLKVE+AIVLALAQ RRPN+AR S+SDLKS
Sbjct  390  SNLVPDISDLTGEGNIESMLSVEMGLKELASLKVEEAIVLALAQLRRPNSARQSLSDLKS  449

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            P DPK+MEA ELS EESEDVLFKEAWLTYFWRRAKA GIEE+IA ++LQFWI RSA SP+
Sbjct  450  PVDPKFMEAFELSAEESEDVLFKEAWLTYFWRRAKAHGIEEDIAKERLQFWISRSAHSPS  509

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKET  268
            SHDAVDVEQGL+ELRKLGIE R+WEASRKE+
Sbjct  510  SHDAVDVEQGLIELRKLGIERRMWEASRKES  540



>ref|XP_009359892.1| PREDICTED: uncharacterized protein LOC103950414 isoform X2 [Pyrus 
x bretschneideri]
Length=479

 Score =   351 bits (901),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/216 (78%), Positives = 193/216 (89%), Gaps = 1/216 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLAA+ GIC+DIA++KYEYWSSLAPLPFE+V+SAGQKAKEE W+KG+++ ER 
Sbjct  253  CWLARNWGLAAKLGICADIAVSKYEYWSSLAPLPFEVVISAGQKAKEERWEKGNDDVERR  312

Query  717  -KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DL+DLTGEGNIESML+VEMGLKEL SLKVED IVLALA+QRRPN+AR S+S +KS
Sbjct  313  NKLVQDLNDLTGEGNIESMLAVEMGLKELASLKVEDEIVLALAEQRRPNSARLSLSGIKS  372

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            P DPK+MEAIELSPEESEDVLFKEAWLTYFWRRAK LGIEE+IA +++QFWI RS  +PT
Sbjct  373  PVDPKFMEAIELSPEESEDVLFKEAWLTYFWRRAKVLGIEEDIAKERVQFWINRSRHAPT  432

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            SHDAVDVE+GLMELRKLGIE RLWE SRK  DQ+ S
Sbjct  433  SHDAVDVEEGLMELRKLGIESRLWEESRKAIDQEYS  468



>ref|XP_009359891.1| PREDICTED: uncharacterized protein LOC103950414 isoform X1 [Pyrus 
x bretschneideri]
Length=563

 Score =   352 bits (904),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 169/216 (78%), Positives = 193/216 (89%), Gaps = 1/216 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLAA+ GIC+DIA++KYEYWSSLAPLPFE+V+SAGQKAKEE W+KG+++ ER 
Sbjct  337  CWLARNWGLAAKLGICADIAVSKYEYWSSLAPLPFEVVISAGQKAKEERWEKGNDDVERR  396

Query  717  -KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DL+DLTGEGNIESML+VEMGLKEL SLKVED IVLALA+QRRPN+AR S+S +KS
Sbjct  397  NKLVQDLNDLTGEGNIESMLAVEMGLKELASLKVEDEIVLALAEQRRPNSARLSLSGIKS  456

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            P DPK+MEAIELSPEESEDVLFKEAWLTYFWRRAK LGIEE+IA +++QFWI RS  +PT
Sbjct  457  PVDPKFMEAIELSPEESEDVLFKEAWLTYFWRRAKVLGIEEDIAKERVQFWINRSRHAPT  516

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            SHDAVDVE+GLMELRKLGIE RLWE SRK  DQ+ S
Sbjct  517  SHDAVDVEEGLMELRKLGIESRLWEESRKAIDQEYS  552



>ref|XP_009597749.1| PREDICTED: uncharacterized protein LOC104093670 isoform X2 [Nicotiana 
tomentosiformis]
Length=553

 Score =   352 bits (903),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 185/208 (89%), Gaps = 0/208 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLAA++GIC+DIA +K+EYWSS APLPFE+V+SAGQKAKEE  +KG +NPER 
Sbjct  346  CWLARYWGLAAQFGICADIAASKHEYWSSFAPLPFELVISAGQKAKEEFLEKGYDNPERG  405

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
              V DL+DLTGEGNIESMLSVEMGL EL SLKVEDAIVLALA QRRPN+ RTSISD+KSP
Sbjct  406  NLVQDLNDLTGEGNIESMLSVEMGLNELVSLKVEDAIVLALAHQRRPNSTRTSISDIKSP  465

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPKYMEA ELSPEESEDVLFKEAWLTYFWRRAKA GI+E+ ANK+LQFW  RS  +PTS
Sbjct  466  IDPKYMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIQEDKANKRLQFWSSRSGHAPTS  525

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRK  274
            HDAVDVEQGLMELRKLGIE +LWE+SR+
Sbjct  526  HDAVDVEQGLMELRKLGIEQKLWESSRR  553



>ref|XP_009781777.1| PREDICTED: uncharacterized protein LOC104230617 isoform X1 [Nicotiana 
sylvestris]
Length=557

 Score =   350 bits (898),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 184/208 (88%), Gaps = 0/208 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLAA++GIC+DIA +K+EYWSS APLPFE+V+SAGQKAKEE  +KG +NPER 
Sbjct  350  CWLARYWGLAAQFGICADIAASKHEYWSSFAPLPFELVISAGQKAKEEFLEKGYDNPERG  409

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
              V DL+DLTGEGNIESMLSVEMGL EL SLKVEDAIVLALAQQRRPN+ RTSISD+KSP
Sbjct  410  NLVRDLNDLTGEGNIESMLSVEMGLNELVSLKVEDAIVLALAQQRRPNSTRTSISDIKSP  469

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPKY+EA ELSPEESEDVLFKEAWLTYFWRRAKA GI+E+ ANK  QFW  RS  +PTS
Sbjct  470  IDPKYIEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIQEDKANKNFQFWSSRSGHAPTS  529

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRK  274
            HDAVDVEQGLMELRKLGIE +LWE+SR+
Sbjct  530  HDAVDVEQGLMELRKLGIEQKLWESSRR  557



>ref|XP_008390187.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103452479 
[Malus domestica]
Length=563

 Score =   350 bits (897),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 166/218 (76%), Positives = 189/218 (87%), Gaps = 2/218 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDEN--PE  724
            CWLAR WGLAA+ GIC+DIA+ KYEYWSSLAPLPFE+V+SAGQ+AKEE W+K       +
Sbjct  337  CWLARNWGLAAKLGICADIAVAKYEYWSSLAPLPFEVVISAGQRAKEELWEKASNGGLEK  396

Query  723  RVKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLK  544
            R K V DL+DLTGEGNIESML+VEMGLKEL+SLKVE+ IVLALAQQRRPN+ R S SD+K
Sbjct  397  RNKLVQDLNDLTGEGNIESMLAVEMGLKELSSLKVENEIVLALAQQRRPNSVRLSFSDIK  456

Query  543  SPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESP  364
            SP DPK+ EAIELSPEESEDVLFKEAWLTYFWRRAK LGIEE+IA +++QFWI RS  +P
Sbjct  457  SPADPKFTEAIELSPEESEDVLFKEAWLTYFWRRAKVLGIEEDIAKERVQFWINRSGHAP  516

Query  363  TSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  250
            +SHDAVDVE+GLMELRKLGIE RLWE SRK  DQDSS+
Sbjct  517  SSHDAVDVEEGLMELRKLGIESRLWEESRKAIDQDSSV  554



>gb|KHN27159.1| hypothetical protein glysoja_032927 [Glycine soja]
Length=372

 Score =   342 bits (878),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/227 (76%), Positives = 191/227 (84%), Gaps = 14/227 (6%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLAR WGLAA+YGIC+D+A++KYE WSSLAPLPFE+V+SAGQKAK      GD+  E R
Sbjct  149  CWLARYWGLAAKYGICADVAVSKYELWSSLAPLPFEVVVSAGQKAK------GDDATEKR  202

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKV-------EDAIVLALAQQRRPNTART  562
             K V DL+DLTGEGNIESMLSVEMGLKEL SLKV       EDAIV ALAQQRRPN+AR 
Sbjct  203  SKLVPDLNDLTGEGNIESMLSVEMGLKELASLKVFFKYLKVEDAIVRALAQQRRPNSARQ  262

Query  561  SISDLKSPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIG  382
             +SD+KSPGDPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE+IA ++L+FWIG
Sbjct  263  LVSDIKSPGDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEDIAKERLRFWIG  322

Query  381  RSAESPTSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK  241
            RS  SPTSHDAVD EQGL ELRKLGIEHRLWEASRKE DQD ++  K
Sbjct  323  RSGHSPTSHDAVDAEQGLSELRKLGIEHRLWEASRKEVDQDFTIARK  369



>ref|XP_009378816.1| PREDICTED: uncharacterized protein LOC103967265 [Pyrus x bretschneideri]
Length=562

 Score =   349 bits (895),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 166/218 (76%), Positives = 187/218 (86%), Gaps = 2/218 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDEN--PE  724
            CWLAR WGLAA+ GIC+DIA+ KYEYWSSLAPLPFE+V+SAGQ+AKEE W+K       +
Sbjct  336  CWLARNWGLAAKLGICADIAVAKYEYWSSLAPLPFEVVISAGQRAKEELWEKASNGGLEK  395

Query  723  RVKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLK  544
            R K + DL DLTGEGNIESML+VEMGLKEL SLKVED IVLALAQQRRPN+ R S SD+K
Sbjct  396  RNKLLQDLDDLTGEGNIESMLAVEMGLKELASLKVEDEIVLALAQQRRPNSVRLSFSDIK  455

Query  543  SPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESP  364
            SP DPK+ EAIELSPEESEDVLFKEAWLTYFWRRAK LGIEE+IA +++QFWI RS  +P
Sbjct  456  SPADPKFTEAIELSPEESEDVLFKEAWLTYFWRRAKVLGIEEDIAKERVQFWINRSGHAP  515

Query  363  TSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  250
            +SHDAVDVE+GLMELRKLGIE RLWE SRK  DQDSS+
Sbjct  516  SSHDAVDVEEGLMELRKLGIESRLWEESRKAIDQDSSV  553



>ref|XP_006483008.1| PREDICTED: myosin-9-like isoform X2 [Citrus sinensis]
Length=543

 Score =   347 bits (890),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 188/209 (90%), Gaps = 5/209 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDE-NPER  721
            CWLAR WGLAA+Y    D+A++KYEYWSSLAPLPFE+V+SAGQKAKEECW+KGD+ N +R
Sbjct  338  CWLARYWGLAAKY----DVAVSKYEYWSSLAPLPFEVVISAGQKAKEECWEKGDDDNEKR  393

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K ++D++DLTGEGNIESMLSVEMGLKEL + KVEDAIVLALAQQRR N+ R SISD+KS
Sbjct  394  SKLLVDINDLTGEGNIESMLSVEMGLKELAASKVEDAIVLALAQQRRANSLRVSISDIKS  453

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE IA ++L+FWI RS  SP+
Sbjct  454  PGDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEHIAKERLEFWISRSGHSPS  513

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRK  274
            SHDAVDVEQGLMELRKLGIEHRLWEASR+
Sbjct  514  SHDAVDVEQGLMELRKLGIEHRLWEASRR  542



>gb|EYU37358.1| hypothetical protein MIMGU_mgv1a004629mg [Erythranthe guttata]
Length=517

 Score =   343 bits (880),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 166/218 (76%), Positives = 187/218 (86%), Gaps = 11/218 (5%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLAA+YGIC+DIA  K+EYWSSLAPLP EIVLSAGQKAKEE            
Sbjct  310  CWLARYWGLAAQYGICADIASAKHEYWSSLAPLPLEIVLSAGQKAKEES-----------  358

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V D +DLTG+GNIESML+VEMGLKEL SLKVE+++VLA AQQRRPN++RTS+ D KSP
Sbjct  359  KLVDDFNDLTGDGNIESMLTVEMGLKELASLKVEESMVLAFAQQRRPNSSRTSMPDFKSP  418

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPKYMEA ELSPEESEDVLFKEAWL YFWRRAKA GIEEEIAN++L+FWIGRS +SPTS
Sbjct  419  IDPKYMEAFELSPEESEDVLFKEAWLMYFWRRAKAYGIEEEIANERLKFWIGRSGQSPTS  478

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIG  244
            HDAVDVEQGLME+RKLGI+ RLWEASRKE +QD+SL+ 
Sbjct  479  HDAVDVEQGLMEIRKLGIKQRLWEASRKEIEQDTSLLN  516



>ref|XP_008369644.1| PREDICTED: uncharacterized protein LOC103433181 [Malus domestica]
Length=563

 Score =   345 bits (884),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 188/216 (87%), Gaps = 1/216 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPER-  721
            CWLAR WG + + GIC+DIA++KYEYWSSLAPLPFE+V+SAGQKAKEE W+KG+++ ER 
Sbjct  337  CWLARNWGFSCKVGICADIAVSKYEYWSSLAPLPFEVVISAGQKAKEERWEKGNDDVERR  396

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DL+DLTGEGNIESML+VEMGLKEL SLKVE  IVLALAQQR PN+AR S SD+KS
Sbjct  397  NKLVQDLNDLTGEGNIESMLAVEMGLKELASLKVEGEIVLALAQQRCPNSARLSFSDIKS  456

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            P DPK+MEAIELSPEESEDVLFKEAWLTYFWRRAK LGIEE+IA +++QFWI R   +PT
Sbjct  457  PADPKFMEAIELSPEESEDVLFKEAWLTYFWRRAKVLGIEEDIAKERVQFWINRGRHAPT  516

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            SHDAVDVE+GLMELRKLGIE RLWE SRK  DQ+ S
Sbjct  517  SHDAVDVEEGLMELRKLGIESRLWEESRKAIDQEYS  552



>ref|XP_002304646.2| hypothetical protein POPTR_0003s16260g [Populus trichocarpa]
 gb|EEE79625.2| hypothetical protein POPTR_0003s16260g [Populus trichocarpa]
Length=553

 Score =   344 bits (882),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 184/215 (86%), Gaps = 5/215 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLAR WGLAA+YGIC D+A++K+EYWSSLAPLPFE+V+SAGQKAKEEC    DE+ E R
Sbjct  343  CWLARYWGLAAKYGICGDVAVSKHEYWSSLAPLPFEVVVSAGQKAKEEC----DEDSEKR  398

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
                 DLSDLTGEGNIESMLSVEMGLKEL SLKVE AIVLALAQQRR N  R SI D+KS
Sbjct  399  STLAHDLSDLTGEGNIESMLSVEMGLKELVSLKVEVAIVLALAQQRRANALRLSILDVKS  458

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
             GD KYMEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE+ A ++LQFWI RSA SP+
Sbjct  459  SGDQKYMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEDTAKERLQFWISRSAHSPS  518

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            SHDAVDVEQGL ELRKLGIEHRLWEASRKE DQ S
Sbjct  519  SHDAVDVEQGLTELRKLGIEHRLWEASRKEIDQGS  553



>gb|KDO51298.1| hypothetical protein CISIN_1g008306mg [Citrus sinensis]
Length=422

 Score =   339 bits (869),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 188/215 (87%), Gaps = 0/215 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++G C+DIA++K+E WS+LAPLPFE+V+SAGQKA+EE W++   +P+R 
Sbjct  192  CWLARYWGLAVQHGTCADIAVSKHELWSALAPLPFEVVISAGQKAREESWERASGDPDRS  251

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            KH  +LSDLTGEGNIE+MLSVEMGL+EL SLKVEDA+VLALAQQRRPN  + SISD KSP
Sbjct  252  KHARELSDLTGEGNIETMLSVEMGLRELASLKVEDAVVLALAQQRRPNMVQQSISDSKSP  311

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK++EA ELS +E+EDVLFKEAWLTYFWRRAK  G+EE+IA ++LQFWI RS +SPTS
Sbjct  312  GDPKFIEAFELSEDEAEDVLFKEAWLTYFWRRAKVHGVEEDIAEERLQFWISRSGQSPTS  371

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVDVE+GL+ELRKLGIE +LWEASR+E D  SS
Sbjct  372  HDAVDVERGLLELRKLGIEQQLWEASRREIDFPSS  406



>ref|XP_006485111.1| PREDICTED: dynactin subunit 1-like isoform X2 [Citrus sinensis]
Length=422

 Score =   339 bits (869),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 188/215 (87%), Gaps = 0/215 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++G C+DIA++K+E WS+LAPLPFE+V+SAGQKA+EE W++   +P+R 
Sbjct  192  CWLARYWGLAVQHGTCADIAVSKHELWSALAPLPFEVVISAGQKAREESWERASGDPDRS  251

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            KH  +LSDLTGEGNIE+MLSVEMGL+EL SLKVEDA+VLALAQQRRPN  + SISD KSP
Sbjct  252  KHARELSDLTGEGNIETMLSVEMGLRELASLKVEDAVVLALAQQRRPNMVQQSISDSKSP  311

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK++EA ELS +E+EDVLFKEAWLTYFWRRAK  G+EE+IA ++LQFWI RS +SPTS
Sbjct  312  GDPKFIEAFELSEDEAEDVLFKEAWLTYFWRRAKVHGVEEDIAEERLQFWISRSGQSPTS  371

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVDVE+GL+ELRKLGIE +LWEASR+E D  SS
Sbjct  372  HDAVDVERGLLELRKLGIEQQLWEASRREIDFPSS  406



>gb|KJB15173.1| hypothetical protein B456_002G163500 [Gossypium raimondii]
Length=400

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 185/209 (89%), Gaps = 1/209 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGD-ENPER  721
            CWLAR WGLA RYGIC+DIA++K+EYWSSLAPLPFE+V+SAGQKAKEE  +KGD EN +R
Sbjct  191  CWLARYWGLAVRYGICADIAVSKHEYWSSLAPLPFEVVVSAGQKAKEEFSEKGDDENEKR  250

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DLSDLTGEGNIESMLSVEMGLKEL SLKVE+AIV ALAQQRR ++ R S+SD+KS
Sbjct  251  SKLVEDLSDLTGEGNIESMLSVEMGLKELASLKVEEAIVNALAQQRRASSVRISLSDIKS  310

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            P DPK+MEA ELSPEESEDVLFKEAWLTY WRRAK+ GIEE+ A ++L+FWI RS  SP+
Sbjct  311  PRDPKFMEAFELSPEESEDVLFKEAWLTYIWRRAKSHGIEEDTAKERLKFWISRSVHSPS  370

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRK  274
            SHDAVDVE+GLMELRKLGIE RLWEASR+
Sbjct  371  SHDAVDVEEGLMELRKLGIERRLWEASRR  399



>ref|XP_006485110.1| PREDICTED: dynactin subunit 1-like isoform X1 [Citrus sinensis]
Length=569

 Score =   340 bits (873),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 188/215 (87%), Gaps = 0/215 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++G C+DIA++K+E WS+LAPLPFE+V+SAGQKA+EE W++   +P+R 
Sbjct  339  CWLARYWGLAVQHGTCADIAVSKHELWSALAPLPFEVVISAGQKAREESWERASGDPDRS  398

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            KH  +LSDLTGEGNIE+MLSVEMGL+EL SLKVEDA+VLALAQQRRPN  + SISD KSP
Sbjct  399  KHARELSDLTGEGNIETMLSVEMGLRELASLKVEDAVVLALAQQRRPNMVQQSISDSKSP  458

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK++EA ELS +E+EDVLFKEAWLTYFWRRAK  G+EE+IA ++LQFWI RS +SPTS
Sbjct  459  GDPKFIEAFELSEDEAEDVLFKEAWLTYFWRRAKVHGVEEDIAEERLQFWISRSGQSPTS  518

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVDVE+GL+ELRKLGIE +LWEASR+E D  SS
Sbjct  519  HDAVDVERGLLELRKLGIEQQLWEASRREIDFPSS  553



>ref|XP_006436938.1| hypothetical protein CICLE_v10031078mg [Citrus clementina]
 gb|ESR50178.1| hypothetical protein CICLE_v10031078mg [Citrus clementina]
Length=574

 Score =   340 bits (873),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 188/215 (87%), Gaps = 0/215 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++G C+DIA++K+E WS+LAPLPFE+V+SAGQKA+EE W++   +P+R 
Sbjct  344  CWLARYWGLAVQHGTCADIAVSKHELWSALAPLPFEVVISAGQKAREESWERASGDPDRS  403

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            KH  +LSDLTGEGNIE+MLSVEMGL+EL SLKVEDA+VLALAQQRRPN  + SISD KSP
Sbjct  404  KHARELSDLTGEGNIETMLSVEMGLRELASLKVEDAVVLALAQQRRPNMVQQSISDSKSP  463

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK++EA ELS +E+EDVLFKEAWLTYFWRRAK  G+EE+IA ++LQFWI RS +SPTS
Sbjct  464  GDPKFIEAFELSEDEAEDVLFKEAWLTYFWRRAKVHGVEEDIAEERLQFWISRSGQSPTS  523

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVDVE+GL+ELRKLGIE +LWEASR+E D  SS
Sbjct  524  HDAVDVERGLLELRKLGIEQQLWEASRREIDFPSS  558



>gb|KDO51296.1| hypothetical protein CISIN_1g008306mg [Citrus sinensis]
Length=569

 Score =   340 bits (873),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 188/215 (87%), Gaps = 0/215 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++G C+DIA++K+E WS+LAPLPFE+V+SAGQKA+EE W++   +P+R 
Sbjct  339  CWLARYWGLAVQHGTCADIAVSKHELWSALAPLPFEVVISAGQKAREESWERASGDPDRS  398

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            KH  +LSDLTGEGNIE+MLSVEMGL+EL SLKVEDA+VLALAQQRRPN  + SISD KSP
Sbjct  399  KHARELSDLTGEGNIETMLSVEMGLRELASLKVEDAVVLALAQQRRPNMVQQSISDSKSP  458

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK++EA ELS +E+EDVLFKEAWLTYFWRRAK  G+EE+IA ++LQFWI RS +SPTS
Sbjct  459  GDPKFIEAFELSEDEAEDVLFKEAWLTYFWRRAKVHGVEEDIAEERLQFWISRSGQSPTS  518

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVDVE+GL+ELRKLGIE +LWEASR+E D  SS
Sbjct  519  HDAVDVERGLLELRKLGIEQQLWEASRREIDFPSS  553



>ref|XP_009597748.1| PREDICTED: uncharacterized protein LOC104093670 isoform X1 [Nicotiana 
tomentosiformis]
Length=571

 Score =   340 bits (871),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 185/226 (82%), Gaps = 18/226 (8%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLAA++GIC+DIA +K+EYWSS APLPFE+V+SAGQKAKEE  +KG +NPER 
Sbjct  346  CWLARYWGLAAQFGICADIAASKHEYWSSFAPLPFELVISAGQKAKEEFLEKGYDNPERG  405

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
              V DL+DLTGEGNIESMLSVEMGL EL SLKVEDAIVLALA QRRPN+ RTSISD+KSP
Sbjct  406  NLVQDLNDLTGEGNIESMLSVEMGLNELVSLKVEDAIVLALAHQRRPNSTRTSISDIKSP  465

Query  537  GDPKYMEAI------------------ELSPEESEDVLFKEAWLTYFWRRAKALGIEEEI  412
             DPKYMEA                   ELSPEESEDVLFKEAWLTYFWRRAKA GI+E+ 
Sbjct  466  IDPKYMEAFAFWNPFWREYYVKFSLFSELSPEESEDVLFKEAWLTYFWRRAKAHGIQEDK  525

Query  411  ANKQLQFWIGRSAESPTSHDAVDVEQGLMELRKLGIEHRLWEASRK  274
            ANK+LQFW  RS  +PTSHDAVDVEQGLMELRKLGIE +LWE+SR+
Sbjct  526  ANKRLQFWSSRSGHAPTSHDAVDVEQGLMELRKLGIEQKLWESSRR  571



>ref|XP_010249187.1| PREDICTED: uncharacterized protein LOC104591834 [Nelumbo nucifera]
Length=561

 Score =   339 bits (869),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 189/216 (88%), Gaps = 2/216 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLAR W LA RYGIC+D+A++K+E+WSSLAPLPFE+V+SAGQKAKEE W +G ++PE R
Sbjct  332  CWLARYWCLAVRYGICADVAVSKHEHWSSLAPLPFEVVISAGQKAKEESWSQGGDDPEKR  391

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
            +K V D SDLTGEG+IESMLSVEMGL+EL SLKVEDA+V+AL Q RRPN  R SISD +S
Sbjct  392  IKLVRDSSDLTGEGSIESMLSVEMGLRELASLKVEDAVVIALGQHRRPNLVRQSISDPQS  451

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PG PK+MEA ELS EESEDVLFKEAWLTYFWRRAKA G+EE+IA ++L+FWI RS +SPT
Sbjct  452  PG-PKFMEAFELSQEESEDVLFKEAWLTYFWRRAKAHGVEEDIAEERLRFWISRSGQSPT  510

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            SHDAVDVE+GLMELRKLGIE +LWEASRKE DQ S+
Sbjct  511  SHDAVDVERGLMELRKLGIEQQLWEASRKEIDQASA  546



>gb|KJB15171.1| hypothetical protein B456_002G163500 [Gossypium raimondii]
Length=553

 Score =   338 bits (867),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 185/209 (89%), Gaps = 1/209 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGD-ENPER  721
            CWLAR WGLA RYGIC+DIA++K+EYWSSLAPLPFE+V+SAGQKAKEE  +KGD EN +R
Sbjct  344  CWLARYWGLAVRYGICADIAVSKHEYWSSLAPLPFEVVVSAGQKAKEEFSEKGDDENEKR  403

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DLSDLTGEGNIESMLSVEMGLKEL SLKVE+AIV ALAQQRR ++ R S+SD+KS
Sbjct  404  SKLVEDLSDLTGEGNIESMLSVEMGLKELASLKVEEAIVNALAQQRRASSVRISLSDIKS  463

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            P DPK+MEA ELSPEESEDVLFKEAWLTY WRRAK+ GIEE+ A ++L+FWI RS  SP+
Sbjct  464  PRDPKFMEAFELSPEESEDVLFKEAWLTYIWRRAKSHGIEEDTAKERLKFWISRSVHSPS  523

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRK  274
            SHDAVDVE+GLMELRKLGIE RLWEASR+
Sbjct  524  SHDAVDVEEGLMELRKLGIERRLWEASRR  552



>gb|KDO51297.1| hypothetical protein CISIN_1g008306mg [Citrus sinensis]
Length=570

 Score =   336 bits (861),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 188/216 (87%), Gaps = 1/216 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYG-ICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPER  721
            CWLAR WGLA ++G  C+DIA++K+E WS+LAPLPFE+V+SAGQKA+EE W++   +P+R
Sbjct  339  CWLARYWGLAVQHGSTCADIAVSKHELWSALAPLPFEVVISAGQKAREESWERASGDPDR  398

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             KH  +LSDLTGEGNIE+MLSVEMGL+EL SLKVEDA+VLALAQQRRPN  + SISD KS
Sbjct  399  SKHARELSDLTGEGNIETMLSVEMGLRELASLKVEDAVVLALAQQRRPNMVQQSISDSKS  458

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPK++EA ELS +E+EDVLFKEAWLTYFWRRAK  G+EE+IA ++LQFWI RS +SPT
Sbjct  459  PGDPKFIEAFELSEDEAEDVLFKEAWLTYFWRRAKVHGVEEDIAEERLQFWISRSGQSPT  518

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            SHDAVDVE+GL+ELRKLGIE +LWEASR+E D  SS
Sbjct  519  SHDAVDVERGLLELRKLGIEQQLWEASRREIDFPSS  554



>emb|CBI15742.3| unnamed protein product [Vitis vinifera]
Length=551

 Score =   332 bits (852),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 182/214 (85%), Gaps = 1/214 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA  + IC+DIA++K+E+WSSLAPLPFE+V+SAGQKAKEE W  G E+P+R 
Sbjct  312  CWLARYWGLAVHHAICADIALSKHEHWSSLAPLPFEVVISAGQKAKEESWNGGGEDPDRS  371

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DLSDLTGEGNIESMLSVEMGL+EL SLKVEDAIVLALA  RRPN  R   SD KSP
Sbjct  372  KLVRDLSDLTGEGNIESMLSVEMGLRELASLKVEDAIVLALALHRRPNLVRQYSSD-KSP  430

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK ME+ EL+ EE+EDVLFKEAWLTYFWRRAK  G+EE+IA ++LQFWI RS ++PTS
Sbjct  431  GDPKSMESFELNQEEAEDVLFKEAWLTYFWRRAKVHGVEEDIAEERLQFWISRSGQTPTS  490

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HDAVDVE+GL ELRKLGIE +LWEASRKE DQ S
Sbjct  491  HDAVDVERGLRELRKLGIEQQLWEASRKENDQPS  524



>ref|XP_002284492.1| PREDICTED: uncharacterized protein LOC100256039 [Vitis vinifera]
Length=571

 Score =   332 bits (852),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 182/214 (85%), Gaps = 1/214 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA  + IC+DIA++K+E+WSSLAPLPFE+V+SAGQKAKEE W  G E+P+R 
Sbjct  332  CWLARYWGLAVHHAICADIALSKHEHWSSLAPLPFEVVISAGQKAKEESWNGGGEDPDRS  391

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DLSDLTGEGNIESMLSVEMGL+EL SLKVEDAIVLALA  RRPN  R   SD KSP
Sbjct  392  KLVRDLSDLTGEGNIESMLSVEMGLRELASLKVEDAIVLALALHRRPNLVRQYSSD-KSP  450

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK ME+ EL+ EE+EDVLFKEAWLTYFWRRAK  G+EE+IA ++LQFWI RS ++PTS
Sbjct  451  GDPKSMESFELNQEEAEDVLFKEAWLTYFWRRAKVHGVEEDIAEERLQFWISRSGQTPTS  510

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HDAVDVE+GL ELRKLGIE +LWEASRKE DQ S
Sbjct  511  HDAVDVERGLRELRKLGIEQQLWEASRKENDQPS  544



>emb|CAN81274.1| hypothetical protein VITISV_021176 [Vitis vinifera]
Length=582

 Score =   332 bits (850),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 182/214 (85%), Gaps = 1/214 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA  + IC+DIA++K+E+WSSLAPLPFE+V+SAGQKAKEE W  G E+P+R 
Sbjct  343  CWLARYWGLAVHHAICADIALSKHEHWSSLAPLPFEVVISAGQKAKEESWNGGGEDPDRS  402

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DLSDLTGEGNIESMLSVEMGL+EL SLKVEDAIVLALA  RRPN  R   SD KSP
Sbjct  403  KLVRDLSDLTGEGNIESMLSVEMGLRELASLKVEDAIVLALALHRRPNLVRQYSSD-KSP  461

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK ME+ EL+ EE+EDVLFKEAWLTYFWRRAK  G+EE+IA ++LQFWI RS ++PTS
Sbjct  462  GDPKSMESFELNQEEAEDVLFKEAWLTYFWRRAKVHGVEEDIAEERLQFWISRSGQTPTS  521

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HDAVDVE+GL ELRKLGIE +LWEASRKE DQ S
Sbjct  522  HDAVDVERGLRELRKLGIEQQLWEASRKENDQPS  555



>ref|XP_008239546.1| PREDICTED: uncharacterized protein LOC103338138 isoform X1 [Prunus 
mume]
 ref|XP_008239547.1| PREDICTED: uncharacterized protein LOC103338138 isoform X2 [Prunus 
mume]
Length=564

 Score =   330 bits (847),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/216 (72%), Positives = 183/216 (85%), Gaps = 0/216 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YGIC+DIA++K+E+WSSLAPLPFE+V+SAGQKAKE+ W +G ++P+R 
Sbjct  335  CWLARYWGLAVQYGICADIALSKHEHWSSLAPLPFEVVISAGQKAKEDSWDRGSDDPDRS  394

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DLSDLTGEGNIESMLSVEMGL+EL SLKVEDA+ LALAQ+RRPN+ R S  D KSP
Sbjct  395  KIVRDLSDLTGEGNIESMLSVEMGLRELASLKVEDAVALALAQRRRPNSVRQSGLDSKSP  454

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+EE+I   +LQ WI RSA++PT 
Sbjct  455  GDPKFMEAFDLSEEEVEDISFKVAWLTYFWRRAKEHGVEEDIGEDRLQLWISRSAQTPTC  514

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  250
            HDAVDVE+GL ELRKLGIE +LWEASRKE DQ  S+
Sbjct  515  HDAVDVERGLYELRKLGIEQQLWEASRKEIDQPISV  550



>ref|XP_010682658.1| PREDICTED: uncharacterized protein LOC104897472 [Beta vulgaris 
subsp. vulgaris]
Length=593

 Score =   331 bits (849),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/212 (74%), Positives = 181/212 (85%), Gaps = 1/212 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQK-GDENPER  721
            CWLAR WGLAA+ GICSDIA +KYE+WSS APLPFE+V+SAGQKAKE+ W+K G+++  +
Sbjct  381  CWLARYWGLAAQLGICSDIATSKYEHWSSFAPLPFEVVISAGQKAKEKSWEKDGEDSESK  440

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K   DL+D TGEGNIE+MLSVEMGLKEL SLKVE++I  A AQQRRPN++R S SD KS
Sbjct  441  NKLNQDLNDFTGEGNIENMLSVEMGLKELASLKVEESIAYAFAQQRRPNSSRLSNSDFKS  500

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGD KYMEA EL+PEESEDVLFKEAWLTYFWRRA  +GIE++ A ++LQFWIGRS  SPT
Sbjct  501  PGDAKYMEAFELTPEESEDVLFKEAWLTYFWRRALNVGIEKDTAKERLQFWIGRSRHSPT  560

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETD  265
            SHDAVDV+QGL ELRKLGIE RLWEASR+E D
Sbjct  561  SHDAVDVDQGLTELRKLGIERRLWEASRREND  592



>ref|XP_010453387.1| PREDICTED: uncharacterized protein LOC104735325 [Camelina sativa]
Length=526

 Score =   327 bits (839),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 179/208 (86%), Gaps = 1/208 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQK-GDENPER  721
            CWLAR WGLAARYGICSDIA +KYEYWSSLAPLPFEIVLSAGQKAKEE W+K  +EN +R
Sbjct  316  CWLARYWGLAARYGICSDIATSKYEYWSSLAPLPFEIVLSAGQKAKEESWEKDSEENEKR  375

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             + V DL+DLTGEGNIESMLSVEMGLKELTSLKVE AI   LAQ R  N+AR S  +LKS
Sbjct  376  SQLVQDLNDLTGEGNIESMLSVEMGLKELTSLKVEVAITFTLAQLRLVNSARLSDIELKS  435

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PG PK ME +ELSPEESEDVLFKEAWLTYFWRRA++LGIE +IA + L+FWIGRSA SP+
Sbjct  436  PGGPKIMETLELSPEESEDVLFKEAWLTYFWRRAESLGIEVDIAREHLRFWIGRSAHSPS  495

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASR  277
            SHDA++VEQGL ELRKL IE RLWEASR
Sbjct  496  SHDAIEVEQGLTELRKLRIERRLWEASR  523



>ref|XP_010419899.1| PREDICTED: uncharacterized protein LOC104705575 [Camelina sativa]
Length=541

 Score =   328 bits (841),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 180/208 (87%), Gaps = 1/208 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQK-GDENPER  721
            CWLAR WGLAARYGICSDIA +KYEYWSSLAPLPFEIVLSAGQKAKEE W+K  +EN +R
Sbjct  331  CWLARYWGLAARYGICSDIATSKYEYWSSLAPLPFEIVLSAGQKAKEESWEKDSEENEKR  390

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             + V DL+DLTGEGNIESMLSVEMGLKELTSLKVE AI   LAQ R  NTAR S  +LKS
Sbjct  391  SQLVQDLNDLTGEGNIESMLSVEMGLKELTSLKVEVAITNTLAQLRLANTARLSDIELKS  450

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PG PK  EA+ELSPEESEDVLFKEAWLTYFWRRA++LGIE +IA ++L+FWIGRSA SP+
Sbjct  451  PGGPKITEALELSPEESEDVLFKEAWLTYFWRRAESLGIEVDIARERLRFWIGRSAHSPS  510

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASR  277
            SHDA++VEQGL ELRKL IE RLWEASR
Sbjct  511  SHDAIEVEQGLTELRKLRIERRLWEASR  538



>gb|AFK47824.1| unknown [Lotus japonicus]
Length=228

 Score =   317 bits (812),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 161/217 (74%), Positives = 178/217 (82%), Gaps = 15/217 (7%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLA  WGLAA+YGIC+D+A++KYE WSSLAPLPFE+V+SAGQKA+EECW+KG++  E R
Sbjct  20   CWLACYWGLAAKYGICADVAVSKYELWSSLAPLPFEVVVSAGQKAEEECWEKGEDAMEKR  79

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DL+DL GEGNIESMLSVEMGLKEL SLKVEDAIV ALAQQRRPN+AR   S    
Sbjct  80   SKLVPDLNDLIGEGNIESMLSVEMGLKELASLKVEDAIVQALAQQRRPNSARQLAS----  135

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
                      ELSPEESEDVLFKEAWLTYFWRRAKA  IEE+IA  +L FWIGRS  SPT
Sbjct  136  ----------ELSPEESEDVLFKEAWLTYFWRRAKAHSIEEDIAKDRLHFWIGRSGHSPT  185

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  250
            SHDAVDVEQGL ELRKLGIEHRLWEASRKE DQD ++
Sbjct  186  SHDAVDVEQGLSELRKLGIEHRLWEASRKEVDQDHTI  222



>ref|XP_007209092.1| hypothetical protein PRUPE_ppa003575mg [Prunus persica]
 gb|EMJ10291.1| hypothetical protein PRUPE_ppa003575mg [Prunus persica]
Length=564

 Score =   328 bits (841),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 181/216 (84%), Gaps = 0/216 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YGIC+DIA++K+E+WSSLAPLPFE+V+SAGQKAKE+ W +G ++P+R 
Sbjct  335  CWLARYWGLAVQYGICADIALSKHEHWSSLAPLPFEVVISAGQKAKEDSWDRGSDDPDRS  394

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DLSDLTGEGNIESMLSVEMGL+EL SLKVEDA+ LALAQ RRPN+ R S  D KSP
Sbjct  395  KIVRDLSDLTGEGNIESMLSVEMGLRELASLKVEDAVALALAQHRRPNSVRQSGLDSKSP  454

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+EE+I   +L  WI RSA++PT 
Sbjct  455  GDPKFMEAFDLSEEEVEDISFKVAWLTYFWRRAKEHGVEEDIGEDRLHLWISRSAQTPTC  514

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  250
            HDAVDVE+GL ELRKLGIE +LWEASRKE DQ  S+
Sbjct  515  HDAVDVERGLYELRKLGIEQQLWEASRKEIDQPISV  550



>ref|XP_006399817.1| hypothetical protein EUTSA_v10013191mg [Eutrema salsugineum]
 gb|ESQ41270.1| hypothetical protein EUTSA_v10013191mg [Eutrema salsugineum]
Length=542

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 181/208 (87%), Gaps = 1/208 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQK-GDENPER  721
            CWLAR WGLAA+YGICSDIA +KYEYWSSLAPLPFEIVLSAGQKAKEE W+K  +EN +R
Sbjct  332  CWLARYWGLAAKYGICSDIATSKYEYWSSLAPLPFEIVLSAGQKAKEENWEKDSEENEKR  391

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             + V D++DLTGEGNIESMLSVEMGLKELTSLKVE AI + LAQ R  NT R S S+LKS
Sbjct  392  SQLVQDINDLTGEGNIESMLSVEMGLKELTSLKVEVAITITLAQLRLANTLRLSDSELKS  451

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PG PK+MEA+ELSPEESEDVLFKEAWLTYFWRRA +LGIE +IA ++L+FWI RSA SP+
Sbjct  452  PGGPKFMEALELSPEESEDVLFKEAWLTYFWRRALSLGIEVDIARERLRFWISRSAHSPS  511

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASR  277
            SHDA++VEQGL ELRKL IE RLWEASR
Sbjct  512  SHDAMEVEQGLTELRKLRIERRLWEASR  539



>gb|KFK25562.1| hypothetical protein AALP_AA8G131000 [Arabis alpina]
Length=550

 Score =   327 bits (837),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 179/208 (86%), Gaps = 1/208 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQK-GDENPER  721
            CWLAR WGLAARYGICSDIA +KYEYWSSLAPLPFEIVLSAGQKAKEE W+K  DEN ++
Sbjct  340  CWLARYWGLAARYGICSDIATSKYEYWSSLAPLPFEIVLSAGQKAKEESWEKDSDENEKK  399

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             + V D++DLTGEGNIESMLSVEMGLKELTSLKVE AI + LAQ R  NTAR   S+LKS
Sbjct  400  SQLVQDINDLTGEGNIESMLSVEMGLKELTSLKVEVAITIILAQLRLANTARQPDSELKS  459

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PG PKYME +ELS EESEDVLFKEAWLTYFWRRA +LGIE EIA ++L+FWI RSA SP+
Sbjct  460  PGGPKYMEVLELSHEESEDVLFKEAWLTYFWRRALSLGIEVEIARERLRFWISRSAHSPS  519

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASR  277
            SHDA++VEQGL ELRKL IE RLWEASR
Sbjct  520  SHDAMEVEQGLTELRKLRIERRLWEASR  547



>ref|XP_007038109.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY22610.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=421

 Score =   322 bits (825),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 152/217 (70%), Positives = 182/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+EYWS+LAPLPFE+V+SAGQKAKEE W +G  +P+R 
Sbjct  190  CWLARYWGLAVQHGICADIAVSKHEYWSALAPLPFEVVVSAGQKAKEEAWDRGGGDPDRS  249

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DL+DLTGEGNIESMLSVEMGL+EL SLKVEDA+V AL + RR +    S++D KSP
Sbjct  250  KLVRDLNDLTGEGNIESMLSVEMGLRELASLKVEDAVVHALGKHRRLSLLHQSVADSKSP  309

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK ++A ELS EE EDVLFKEAWLTY WRRAK  G+EE+IA ++LQFWI RS +SPTS
Sbjct  310  GDPKLIDAFELSEEEGEDVLFKEAWLTYLWRRAKVHGVEEDIAEERLQFWIRRSGQSPTS  369

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  247
            HDAVDV +GL ELRKLGIE +LWEASRKE DQ S+ +
Sbjct  370  HDAVDVNRGLFELRKLGIEQQLWEASRKEIDQPSAAL  406



>ref|XP_010556094.1| PREDICTED: GRIP1-associated protein 1 [Tarenaya hassleriana]
Length=563

 Score =   326 bits (835),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/218 (75%), Positives = 183/218 (84%), Gaps = 11/218 (5%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQK-GDENPER  721
            CWLAR WGLAARYGICSDIA +KYEYWSSLAPLPFEIVLSAGQKAKEE W+K  +EN +R
Sbjct  343  CWLARYWGLAARYGICSDIATSKYEYWSSLAPLPFEIVLSAGQKAKEESWEKDSEENEKR  402

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             + V D++DLTGEGNIESMLSVEMGLKEL SLKVEDAI++ALAQQR  N+AR S SD+KS
Sbjct  403  SELVQDMNDLTGEGNIESMLSVEMGLKELVSLKVEDAIIVALAQQRLANSARLSGSDIKS  462

Query  540  P-GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESP  364
            P GDPK+MEA+ELSPEESEDVLFKEAWLTYFWRRA +LGIE  IA ++L+FWI RSA SP
Sbjct  463  PGGDPKFMEALELSPEESEDVLFKEAWLTYFWRRALSLGIEVHIARERLRFWISRSAHSP  522

Query  363  TSHDA---------VDVEQGLMELRKLGIEHRLWEASR  277
            +SH           + VEQGL ELRKL IEHRLWEASR
Sbjct  523  SSHSRGGGFLCLVLISVEQGLTELRKLRIEHRLWEASR  560



>ref|XP_006286776.1| hypothetical protein CARUB_v10003326mg [Capsella rubella]
 gb|EOA19674.1| hypothetical protein CARUB_v10003326mg [Capsella rubella]
Length=542

 Score =   325 bits (832),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 180/208 (87%), Gaps = 1/208 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQK-GDENPER  721
            CWLAR WGLA RYGICSDIA +KYEYWSSLAPLPFEIVLSAGQKAKEE W+K  +EN +R
Sbjct  332  CWLARYWGLATRYGICSDIATSKYEYWSSLAPLPFEIVLSAGQKAKEESWEKDSEENEKR  391

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             + V D++DLTGEGNIESMLSVEMGLKELTSLKVE AI + LAQ R  N+ R S  +LKS
Sbjct  392  SQLVQDINDLTGEGNIESMLSVEMGLKELTSLKVEVAITITLAQLRLANSTRLSDIELKS  451

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PG PK MEA+EL+PEESEDVLFKEAWLTYFWRRA+++GIE +IA ++L+FWIGRSA SP+
Sbjct  452  PGGPKIMEALELTPEESEDVLFKEAWLTYFWRRAESVGIEVDIARERLRFWIGRSAHSPS  511

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASR  277
            SHDA++VEQGL ELRKL IE RLWEASR
Sbjct  512  SHDAIEVEQGLTELRKLRIERRLWEASR  539



>gb|KEH35693.1| ripening-regulated protein [Medicago truncatula]
Length=405

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 178/214 (83%), Gaps = 0/214 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGL+ ++GIC+DIA +KYE+WSSLAPLPFE+V+SAGQKAKEE W K  +  +R 
Sbjct  175  CWLARYWGLSVKHGICADIAQSKYEHWSSLAPLPFELVISAGQKAKEESWNKSTDGSDRS  234

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            + V D++DL GEGNIESMLSVEMGL+EL SLKVEDA+VLALAQ RRPN  R S+ D KSP
Sbjct  235  QTVRDINDLAGEGNIESMLSVEMGLRELASLKVEDAVVLALAQHRRPNLIRQSVLDSKSP  294

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GD KY EA ELS EE+EDVLFKEAWLTYFWRRA   G+EE+IA  +L+FWI RS +SPTS
Sbjct  295  GDAKYSEAFELSEEEAEDVLFKEAWLTYFWRRALFHGVEEDIAEDRLRFWIARSGQSPTS  354

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HDAVDVE+ L+ELRKLGIE +LWEASRK  DQ S
Sbjct  355  HDAVDVERDLLELRKLGIEQQLWEASRKGIDQPS  388



>gb|KJB15172.1| hypothetical protein B456_002G163500 [Gossypium raimondii]
Length=549

 Score =   325 bits (832),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 181/209 (87%), Gaps = 5/209 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGD-ENPER  721
            CWLAR WGLA RYGIC+DIA++K+EYWSSLAPLPFE+V+SAGQKAKEE  +KGD EN +R
Sbjct  344  CWLARYWGLAVRYGICADIAVSKHEYWSSLAPLPFEVVVSAGQKAKEEFSEKGDDENEKR  403

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DLSDLTGEGNIESMLSVEMGLKEL SLKVE+AIV ALAQQRR ++ R S+SD+KS
Sbjct  404  SKLVEDLSDLTGEGNIESMLSVEMGLKELASLKVEEAIVNALAQQRRASSVRISLSDIKS  463

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            P DPK+MEA E    ESEDVLFKEAWLTY WRRAK+ GIEE+ A ++L+FWI RS  SP+
Sbjct  464  PRDPKFMEAFE----ESEDVLFKEAWLTYIWRRAKSHGIEEDTAKERLKFWISRSVHSPS  519

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRK  274
            SHDAVDVE+GLMELRKLGIE RLWEASR+
Sbjct  520  SHDAVDVEEGLMELRKLGIERRLWEASRR  548



>ref|XP_007038108.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY22609.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=515

 Score =   323 bits (829),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/217 (70%), Positives = 182/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+EYWS+LAPLPFE+V+SAGQKAKEE W +G  +P+R 
Sbjct  289  CWLARYWGLAVQHGICADIAVSKHEYWSALAPLPFEVVVSAGQKAKEEAWDRGGGDPDRS  348

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DL+DLTGEGNIESMLSVEMGL+EL SLKVEDA+V AL + RR +    S++D KSP
Sbjct  349  KLVRDLNDLTGEGNIESMLSVEMGLRELASLKVEDAVVHALGKHRRLSLLHQSVADSKSP  408

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK ++A ELS EE EDVLFKEAWLTY WRRAK  G+EE+IA ++LQFWI RS +SPTS
Sbjct  409  GDPKLIDAFELSEEEGEDVLFKEAWLTYLWRRAKVHGVEEDIAEERLQFWIRRSGQSPTS  468

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  247
            HDAVDV +GL ELRKLGIE +LWEASRKE DQ S+ +
Sbjct  469  HDAVDVNRGLFELRKLGIEQQLWEASRKEIDQPSAAL  505



>ref|XP_008351703.1| PREDICTED: uncharacterized protein LOC103415127 [Malus domestica]
Length=562

 Score =   325 bits (832),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 182/215 (85%), Gaps = 0/215 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+E+WSSLAPLPFE+V SAGQKAKEE W K  ++P+R 
Sbjct  335  CWLARYWGLAVQHGICADIAVSKHEHWSSLAPLPFEVVXSAGQKAKEESWGKSGDDPDRS  394

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DL+DLTGEGNIESMLSVEMG++EL+SLKVEDA+ +ALA+ RRPN+ R SI D KSP
Sbjct  395  KLARDLTDLTGEGNIESMLSVEMGMRELSSLKVEDAVAIALAKHRRPNSVRQSILDSKSP  454

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RSA++PT 
Sbjct  455  GDPKFMEAFDLSDEEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSAQTPTC  514

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVDVE+GL ELRKLGIE +LWEASRKE DQ  S
Sbjct  515  HDAVDVERGLYELRKLGIEQQLWEASRKEIDQPVS  549



>ref|XP_006578723.1| PREDICTED: uncharacterized abhydrolase domain-containing protein 
DDB_G0269086-like [Glycine max]
Length=576

 Score =   324 bits (831),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 179/212 (84%), Gaps = 0/212 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA +K+E+WSSLAPLPFE+V+SAGQKAKEE W K  + P+R 
Sbjct  346  CWLARYWGLAVKHGICADIAQSKHEHWSSLAPLPFELVISAGQKAKEESWNKSADGPDRS  405

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DL+DL GEGNIESMLSVEMGL+EL SLKVEDA+VLALAQ RRPN+ R S+ D KS 
Sbjct  406  KLVRDLNDLAGEGNIESMLSVEMGLRELASLKVEDAVVLALAQHRRPNSVRQSVLDSKSR  465

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GD KY EA ELS EE+EDVLFKEAWLTYFWRRA   G+EE+IA ++LQFWI RS +SP+S
Sbjct  466  GDAKYSEAFELSEEEAEDVLFKEAWLTYFWRRALFHGVEEDIAEERLQFWIARSGQSPSS  525

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            HDAVDVE+GL+ELRKL IE +LWEASRK  DQ
Sbjct  526  HDAVDVERGLLELRKLSIEQQLWEASRKGIDQ  557



>ref|XP_010492074.1| PREDICTED: uncharacterized protein LOC104769543 [Camelina sativa]
Length=537

 Score =   323 bits (828),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 179/208 (86%), Gaps = 2/208 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQK-GDENPER  721
            CWLAR WGLAARYGICSDIA +KYEYWSSLAPLPFEIVLSAGQKAKEE W+K  +EN +R
Sbjct  328  CWLARYWGLAARYGICSDIATSKYEYWSSLAPLPFEIVLSAGQKAKEESWEKDSEENEKR  387

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             + V DL+DLTGEGNIESMLSVEMGLKELTSLKVE AI + L Q R  NT R S  +LKS
Sbjct  388  SQLVQDLNDLTGEGNIESMLSVEMGLKELTSLKVEVAITITLGQLRLANT-RLSDVELKS  446

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PG PK ME +ELSPEESEDVLFKEAWLTYFWRRA++LGIE +IA ++L+FWIGRSA SP+
Sbjct  447  PGGPKIMETLELSPEESEDVLFKEAWLTYFWRRAESLGIEVDIARERLRFWIGRSAHSPS  506

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASR  277
            SHDA++VEQGL ELRKL IE RLWEASR
Sbjct  507  SHDAIEVEQGLTELRKLRIERRLWEASR  534



>gb|KHN09724.1| hypothetical protein glysoja_011998, partial [Glycine soja]
Length=390

 Score =   318 bits (814),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 178/212 (84%), Gaps = 0/212 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA +K+E+WSSLAPLPFE+V+SAGQKAKEE W K  + P+R 
Sbjct  160  CWLARYWGLAVKHGICADIAQSKHEHWSSLAPLPFELVISAGQKAKEESWNKSADGPDRS  219

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DL+DL GEGNIESMLSVEMGL+EL +LKVEDA+VLALAQ RRPN+ R S+ D KS 
Sbjct  220  KLVRDLNDLAGEGNIESMLSVEMGLRELANLKVEDAVVLALAQHRRPNSVRQSVLDSKSH  279

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GD KY EA ELS EE+EDVLFKEAWLTYFWRRA    +EE+IA ++LQFWI RS +SP+S
Sbjct  280  GDAKYSEAFELSEEEAEDVLFKEAWLTYFWRRALFHCVEEDIAEERLQFWIARSGQSPSS  339

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            HDAVDVE+GL+ELRKL IE +LWEASRK  DQ
Sbjct  340  HDAVDVERGLLELRKLSIEQQLWEASRKGIDQ  371



>ref|XP_011073178.1| PREDICTED: macoilin-1 [Sesamum indicum]
 ref|XP_011073180.1| PREDICTED: macoilin-1 [Sesamum indicum]
Length=562

 Score =   323 bits (829),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 181/224 (81%), Gaps = 5/224 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLAAR GIC+DIA +KYE+WSSLAPLPFE+V+SAGQKA+EE W  GD++    
Sbjct  339  CWLARYWGLAARNGICADIAASKYEHWSSLAPLPFEVVVSAGQKAREESWNGGDDSDRST  398

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            +   D +DLTGEGNIESMLSVEMGL+EL SLK+EDA+VLALAQ RR    R S SD K  
Sbjct  399  R---DFNDLTGEGNIESMLSVEMGLRELASLKIEDAVVLALAQNRRSTLVRQSFSDPKLS  455

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPKYMEA ELS EESEDVLFKEAWLTYFWRRAK  G+EE+IA+++LQ WI RS +SPTS
Sbjct  456  GDPKYMEAFELSQEESEDVLFKEAWLTYFWRRAKVHGVEEDIADERLQLWISRSGQSPTS  515

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK*LHPP  226
            HDAVDVE+GL ELRKLGIE +LWEASRKE  Q +   GK  H P
Sbjct  516  HDAVDVERGLTELRKLGIEQQLWEASRKEIGQPAFANGK--HTP  557



>gb|KHN31266.1| hypothetical protein glysoja_012916 [Glycine soja]
Length=576

 Score =   324 bits (830),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 179/212 (84%), Gaps = 0/212 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA +K+E+WSSLAPLPFE+V+SAGQKAKEE W K  + P+R 
Sbjct  346  CWLARYWGLAVKHGICADIAQSKHEHWSSLAPLPFELVISAGQKAKEESWNKSADGPDRS  405

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DL+DL GEGNIESMLSVEMGL+EL SLKVEDA+VLALAQ RRPN+ R S+ D KS 
Sbjct  406  KLVRDLNDLAGEGNIESMLSVEMGLRELASLKVEDAVVLALAQHRRPNSVRQSVLDSKSR  465

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GD KY EA ELS EE+EDVLFKEAWLTYFWRRA   G+EE+IA ++LQFWI RS +SP+S
Sbjct  466  GDAKYSEAFELSEEEAEDVLFKEAWLTYFWRRALFHGVEEDIAEERLQFWIARSGQSPSS  525

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            HDAVDVE+GL+ELRKL IE +LWEASRK  DQ
Sbjct  526  HDAVDVERGLLELRKLSIEQQLWEASRKGIDQ  557



>ref|XP_007038107.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY22608.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=561

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 152/217 (70%), Positives = 182/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+EYWS+LAPLPFE+V+SAGQKAKEE W +G  +P+R 
Sbjct  330  CWLARYWGLAVQHGICADIAVSKHEYWSALAPLPFEVVVSAGQKAKEEAWDRGGGDPDRS  389

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DL+DLTGEGNIESMLSVEMGL+EL SLKVEDA+V AL + RR +    S++D KSP
Sbjct  390  KLVRDLNDLTGEGNIESMLSVEMGLRELASLKVEDAVVHALGKHRRLSLLHQSVADSKSP  449

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK ++A ELS EE EDVLFKEAWLTY WRRAK  G+EE+IA ++LQFWI RS +SPTS
Sbjct  450  GDPKLIDAFELSEEEGEDVLFKEAWLTYLWRRAKVHGVEEDIAEERLQFWIRRSGQSPTS  509

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  247
            HDAVDV +GL ELRKLGIE +LWEASRKE DQ S+ +
Sbjct  510  HDAVDVNRGLFELRKLGIEQQLWEASRKEIDQPSAAL  546



>ref|XP_004501741.1| PREDICTED: uncharacterized abhydrolase domain-containing protein 
DDB_G0269086-like isoform X1 [Cicer arietinum]
Length=569

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 178/212 (84%), Gaps = 0/212 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGL+ ++GIC+DIA +KYE+WS+LAPLPFE+V+SAGQKAKEE W K  +  +R 
Sbjct  339  CWLARYWGLSVKHGICADIAQSKYEHWSALAPLPFELVISAGQKAKEESWNKSADGSDRS  398

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DL+DL GEGNIESMLSVEMGL+EL SLKVEDA+VLALAQ RRPN  R S+ D KSP
Sbjct  399  KIVRDLNDLAGEGNIESMLSVEMGLRELASLKVEDAVVLALAQHRRPNLIRQSVLDSKSP  458

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GD KY EA ELS EE+EDVLFKEAWLTYFWRRA   G+EE+IA  +L+FWI RS +SPTS
Sbjct  459  GDAKYSEAFELSEEEAEDVLFKEAWLTYFWRRALFHGVEEDIAEDRLRFWISRSGQSPTS  518

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            HDAVDVE+GL+ELRKLGIE +LWEASRK  DQ
Sbjct  519  HDAVDVERGLLELRKLGIEQQLWEASRKGIDQ  550



>ref|XP_011652277.1| PREDICTED: coiled-coil domain-containing protein SCD2-like isoform 
X2 [Cucumis sativus]
Length=409

 Score =   317 bits (813),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 182/215 (85%), Gaps = 4/215 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YGIC+DIAI+K+EYWSSLAPLPFE+V+SAGQKAKEE   + D++  R 
Sbjct  192  CWLARYWGLAVQYGICADIAISKHEYWSSLAPLPFEVVISAGQKAKEEPEGRNDQD--RS  249

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K + D++DL+GEGNIESMLSVEMGL+ELTSLKVEDA VLALAQ RRP+    S  D K P
Sbjct  250  KLIQDINDLSGEGNIESMLSVEMGLRELTSLKVEDATVLALAQHRRPSLVHQS--DSKVP  307

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPK+ EA ELS  E+EDVLFKEAWLTYFWRRAKA G++E++A+++LQFWI RS + PTS
Sbjct  308  ADPKFSEAFELSEAEAEDVLFKEAWLTYFWRRAKAYGVDEDVADERLQFWISRSGQPPTS  367

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVDVE+GL+ELRKLGIE +LWEASRKE DQ S+
Sbjct  368  HDAVDVERGLVELRKLGIEQQLWEASRKEIDQSSA  402



>ref|XP_009337519.1| PREDICTED: uncharacterized protein LOC103929969 isoform X1 [Pyrus 
x bretschneideri]
Length=562

 Score =   321 bits (823),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 180/212 (85%), Gaps = 0/212 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K E+WSSLAPLPFE+V+SAGQKAKEE W K  ++P+R 
Sbjct  335  CWLARYWGLAVQHGICADIAVSKREHWSSLAPLPFEVVISAGQKAKEESWGKSGDDPDRS  394

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DL+DLTGEGNIESMLSVEMG++EL+SLKVEDA+ +ALA+  RPN+ R SI D KSP
Sbjct  395  KLARDLTDLTGEGNIESMLSVEMGMRELSSLKVEDAVAIALAKHIRPNSVRQSILDSKSP  454

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RSA++PT 
Sbjct  455  GDPKFMEAFDLSDEEIEDISFKVAWLTYFWRRAKVHGVEDDIADDRLQLWINRSAQTPTC  514

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            HDAVDVE+GL ELRKLGIE +LWEASRKE DQ
Sbjct  515  HDAVDVERGLYELRKLGIEQQLWEASRKEIDQ  546



>ref|XP_006376918.1| hypothetical protein POPTR_0012s10720g [Populus trichocarpa]
 gb|ERP54715.1| hypothetical protein POPTR_0012s10720g [Populus trichocarpa]
Length=565

 Score =   321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 179/214 (84%), Gaps = 1/214 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+E+WS+LAPLPFE+V+SAGQ+AKEE   +G  +P+R 
Sbjct  337  CWLARYWGLAVQHGICADIAVSKHEHWSALAPLPFEVVISAGQRAKEEL-DRGGGDPDRS  395

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DLSDLTGEGNIESMLSVEMGL+EL SLKVEDA+VLALAQ RRPN  R S SD + P
Sbjct  396  KVVRDLSDLTGEGNIESMLSVEMGLRELASLKVEDAVVLALAQHRRPNMVRQSFSDSRPP  455

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK+ EA ELS  E+EDV FKEAWLTY+WRRA   G+EE+IA  +LQFWI RS +SPTS
Sbjct  456  GDPKFTEATELSKAEAEDVDFKEAWLTYYWRRALVHGVEEDIAEDRLQFWISRSGQSPTS  515

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HDAVDVE+G++ELRKL IE +LWEASRKE D  S
Sbjct  516  HDAVDVERGVLELRKLSIEQQLWEASRKEIDHSS  549



>gb|EYU21825.1| hypothetical protein MIMGU_mgv1a021335mg, partial [Erythranthe 
guttata]
Length=319

 Score =   312 bits (800),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 177/219 (81%), Gaps = 2/219 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLAARY IC+DIA+ KYE+WSS APLP+E+V+SAGQKA+EE W  GD++ ER 
Sbjct  96   CWLARYWGLAARYAICADIAVPKYEHWSSFAPLPYEVVISAGQKAREETWDGGDDS-ERS  154

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K+  DL+DLTGEGNIESMLSVEMGL+EL SLKVEDA+VLALAQ RR    R S S + S 
Sbjct  155  KNTRDLNDLTGEGNIESMLSVEMGLRELASLKVEDAVVLALAQNRRSTIVRHSFSGMSSV  214

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPKY EA ELS EESEDVLFKEAWLTYFWRRAK   +EE+IA+++LQ W  RS +SPTS
Sbjct  215  -DPKYTEAFELSQEESEDVLFKEAWLTYFWRRAKVHSVEEDIADERLQLWKSRSGQSPTS  273

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK  241
            HDAVDVE+GL ELRKLGIE +LW+ASRKE    S   GK
Sbjct  274  HDAVDVERGLTELRKLGIEQQLWDASRKEIGHPSFANGK  312



>ref|XP_009368792.1| PREDICTED: uncharacterized protein LOC103958268 isoform X1 [Pyrus 
x bretschneideri]
Length=566

 Score =   320 bits (821),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 181/215 (84%), Gaps = 0/215 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+E+WSSLAPLPFE+V+SAGQKAKEE W+K  ++P+R 
Sbjct  339  CWLARYWGLAVQHGICADIAVSKHEHWSSLAPLPFEVVISAGQKAKEEPWRKSGDDPDRS  398

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DL+DLT EGNIESMLSVEMG++EL+SLKVEDA+V+ALAQ RRPN+ R SI D KSP
Sbjct  399  KLARDLTDLTSEGNIESMLSVEMGMRELSSLKVEDAVVIALAQHRRPNSVRQSILDSKSP  458

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G PK+MEA +LS +E ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT 
Sbjct  459  GAPKFMEAFDLSDDEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTC  518

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVD E+GL ELRKLGIE +LWEASRKE DQ  S
Sbjct  519  HDAVDAERGLSELRKLGIEQQLWEASRKEIDQPVS  553



>gb|KEH35692.1| ripening-regulated protein [Medicago truncatula]
Length=573

 Score =   320 bits (821),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 178/214 (83%), Gaps = 0/214 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGL+ ++GIC+DIA +KYE+WSSLAPLPFE+V+SAGQKAKEE W K  +  +R 
Sbjct  343  CWLARYWGLSVKHGICADIAQSKYEHWSSLAPLPFELVISAGQKAKEESWNKSTDGSDRS  402

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            + V D++DL GEGNIESMLSVEMGL+EL SLKVEDA+VLALAQ RRPN  R S+ D KSP
Sbjct  403  QTVRDINDLAGEGNIESMLSVEMGLRELASLKVEDAVVLALAQHRRPNLIRQSVLDSKSP  462

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GD KY EA ELS EE+EDVLFKEAWLTYFWRRA   G+EE+IA  +L+FWI RS +SPTS
Sbjct  463  GDAKYSEAFELSEEEAEDVLFKEAWLTYFWRRALFHGVEEDIAEDRLRFWIARSGQSPTS  522

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HDAVDVE+ L+ELRKLGIE +LWEASRK  DQ S
Sbjct  523  HDAVDVERDLLELRKLGIEQQLWEASRKGIDQPS  556



>ref|XP_009334312.1| PREDICTED: uncharacterized protein LOC103927142 isoform X1 [Pyrus 
x bretschneideri]
Length=562

 Score =   320 bits (819),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 179/212 (84%), Gaps = 0/212 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K E+WSSLAPLPFE+VLSAGQKAKEE W K  ++P+R 
Sbjct  335  CWLARYWGLAVQHGICADIAVSKREHWSSLAPLPFEVVLSAGQKAKEESWGKSGDDPDRS  394

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DL+DLTGEGNIESMLSVEMG++EL+SLKVEDA+ +ALA+  RPN+ R SI D KSP
Sbjct  395  KLARDLTDLTGEGNIESMLSVEMGMRELSSLKVEDAVAIALAKHIRPNSVRQSILDSKSP  454

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI  SA++PT 
Sbjct  455  GDPKFMEAFDLSDEEIEDISFKVAWLTYFWRRAKVHGVEDDIADDRLQLWISHSAQTPTC  514

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            HDAVDVE+GL ELRKLGIE +LWEASRKE DQ
Sbjct  515  HDAVDVERGLYELRKLGIEQQLWEASRKEIDQ  546



>ref|XP_007137890.1| hypothetical protein PHAVU_009G164500g [Phaseolus vulgaris]
 gb|ESW09884.1| hypothetical protein PHAVU_009G164500g [Phaseolus vulgaris]
Length=575

 Score =   320 bits (820),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 177/212 (83%), Gaps = 0/212 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA +K+E+WSSLAPLPFE+V+SAGQKAKEE W K  + P+R 
Sbjct  345  CWLARYWGLAVKHGICADIAQSKHEHWSSLAPLPFELVISAGQKAKEESWNKSADGPDRS  404

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DL+DL GEGNIE+MLSVEMGL+EL SLKVEDA+VLALAQ RRPN  R SI D KS 
Sbjct  405  KLVRDLNDLAGEGNIETMLSVEMGLRELASLKVEDAVVLALAQHRRPNLVRQSILDSKSQ  464

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GD KY EA ELS EE+EDVLFKE+WLTY WRRA   G+EE+IA +QLQFWI RS ++PTS
Sbjct  465  GDAKYSEAFELSEEEAEDVLFKESWLTYIWRRALFHGVEEDIAEEQLQFWIARSGQAPTS  524

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            HDAVDVE+GL+ELRKL IE +LWEASRK  DQ
Sbjct  525  HDAVDVERGLLELRKLSIEPQLWEASRKGIDQ  556



>ref|XP_008440074.1| PREDICTED: macoilin-1 [Cucumis melo]
 ref|XP_008440082.1| PREDICTED: macoilin-1 [Cucumis melo]
Length=558

 Score =   319 bits (818),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 183/216 (85%), Gaps = 4/216 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YGIC+DIAI+K+EYWSSLAPLPFE+V+SAGQKAKEE   + D++  R 
Sbjct  332  CWLARYWGLAVQYGICADIAISKHEYWSSLAPLPFEVVISAGQKAKEEPEGRNDQD--RS  389

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K + D++DL+GEGNIESMLSVEMGL+ELTSLKVEDA VLALAQ RRP+    S  D K+P
Sbjct  390  KLIQDINDLSGEGNIESMLSVEMGLRELTSLKVEDATVLALAQHRRPSLIHQS--DSKAP  447

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPK+ EA ELS  E+EDVLFKEAWLTYFWRRAKA G++E++A+++LQFWI RS + PTS
Sbjct  448  ADPKFSEAFELSEAEAEDVLFKEAWLTYFWRRAKAYGVDEDVADERLQFWISRSGQPPTS  507

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  250
            HDAVDVE+GL+ELRKLGIE +LWEASRKE DQ S+ 
Sbjct  508  HDAVDVERGLVELRKLGIEQQLWEASRKEIDQSSAF  543



>ref|XP_006844529.1| PREDICTED: coiled-coil domain-containing protein SCD2 [Amborella 
trichopoda]
 gb|ERN06204.1| hypothetical protein AMTR_s00016p00160930 [Amborella trichopoda]
Length=566

 Score =   319 bits (818),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 179/214 (84%), Gaps = 2/214 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGL+ R+GI  DIA  K+E+WSSLAPLP E+V+SAGQKAKEE W +G+++PER 
Sbjct  334  CWLARYWGLSVRHGIYGDIAGPKHEHWSSLAPLPLEVVISAGQKAKEESWNRGNDDPERR  393

Query  717  -KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTART-SISDLK  544
             K   DLSDL GEGNIESMLSVE GL+EL SLKVEDA+  A+AQ RRPN  R  S SD +
Sbjct  394  DKLARDLSDLAGEGNIESMLSVEKGLRELASLKVEDAVAFAMAQHRRPNVVRVGSASDCR  453

Query  543  SPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESP  364
            SPGDPK++EA ELS EE EDVLFK+AWLTYFWRRAK  G+EE+IA+ +LQFWI RS++SP
Sbjct  454  SPGDPKFVEAFELSQEEVEDVLFKQAWLTYFWRRAKTHGVEEDIADDRLQFWISRSSQSP  513

Query  363  TSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            TSHDAVDVE+GLMELRKLG+E +LWEASRKE DQ
Sbjct  514  TSHDAVDVERGLMELRKLGLEAQLWEASRKEIDQ  547



>ref|XP_006581845.1| PREDICTED: plectin-like [Glycine max]
Length=576

 Score =   319 bits (818),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 178/212 (84%), Gaps = 0/212 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA +K+E+WSSLAPLPFE+V+SAGQKAKEE W K  + P+R 
Sbjct  346  CWLARYWGLAVKHGICADIAQSKHEHWSSLAPLPFELVISAGQKAKEESWNKSADGPDRS  405

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DL+DL GEGNIESMLSVEMGL+EL +LKVEDA+VLALAQ RRPN+ R S+ D KS 
Sbjct  406  KLVRDLNDLAGEGNIESMLSVEMGLRELANLKVEDAVVLALAQHRRPNSVRQSVLDSKSH  465

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GD KY EA ELS EE+EDVLFKEAWLTYFWRRA    +EE+IA ++LQFWI RS +SP+S
Sbjct  466  GDAKYSEAFELSEEEAEDVLFKEAWLTYFWRRALFHCVEEDIAEERLQFWIARSGQSPSS  525

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            HDAVDVE+GL+ELRKL IE +LWEASRK  DQ
Sbjct  526  HDAVDVERGLLELRKLSIEQQLWEASRKGIDQ  557



>gb|KJB40055.1| hypothetical protein B456_007G044600 [Gossypium raimondii]
Length=364

 Score =   312 bits (800),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 178/215 (83%), Gaps = 0/215 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+E+WS+LAPLPFEI++SAGQKAKEE W +G  + +R 
Sbjct  137  CWLARYWGLAVQHGICADIAVSKHEHWSALAPLPFEIIVSAGQKAKEEAWDRGGGDLDRS  196

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DL+DLTGEG IESMLSVEM L+EL SLKVEDA++ AL + RR +  R S+SD KSP
Sbjct  197  KLVRDLNDLTGEGTIESMLSVEMALRELASLKVEDAVIQALGRHRRLSLLRQSVSDSKSP  256

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK ++A ELS EE EDVLFKEAWLTYFWRRAK   IEE+IA  +LQFWI RS ++PTS
Sbjct  257  GDPKLIDAFELSEEEGEDVLFKEAWLTYFWRRAKVHCIEEDIAEDRLQFWISRSGQTPTS  316

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVDV++GL ELRKLGIE +LWEASRKE D  S+
Sbjct  317  HDAVDVDRGLFELRKLGIEQQLWEASRKEIDHPSA  351



>ref|XP_004145144.1| PREDICTED: coiled-coil domain-containing protein SCD2-like isoform 
X1 [Cucumis sativus]
 gb|KGN64438.1| hypothetical protein Csa_1G051750 [Cucumis sativus]
Length=551

 Score =   318 bits (816),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 182/215 (85%), Gaps = 4/215 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YGIC+DIAI+K+EYWSSLAPLPFE+V+SAGQKAKEE   + D++  R 
Sbjct  334  CWLARYWGLAVQYGICADIAISKHEYWSSLAPLPFEVVISAGQKAKEEPEGRNDQD--RS  391

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K + D++DL+GEGNIESMLSVEMGL+ELTSLKVEDA VLALAQ RRP+    S  D K P
Sbjct  392  KLIQDINDLSGEGNIESMLSVEMGLRELTSLKVEDATVLALAQHRRPSLVHQS--DSKVP  449

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPK+ EA ELS  E+EDVLFKEAWLTYFWRRAKA G++E++A+++LQFWI RS + PTS
Sbjct  450  ADPKFSEAFELSEAEAEDVLFKEAWLTYFWRRAKAYGVDEDVADERLQFWISRSGQPPTS  509

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVDVE+GL+ELRKLGIE +LWEASRKE DQ S+
Sbjct  510  HDAVDVERGLVELRKLGIEQQLWEASRKEIDQSSA  544



>ref|XP_006368855.1| hypothetical protein POPTR_0001s13160g [Populus trichocarpa]
 gb|ERP65424.1| hypothetical protein POPTR_0001s13160g [Populus trichocarpa]
Length=538

 Score =   318 bits (814),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 166/186 (89%), Gaps = 1/186 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLAR WGLAA+YGIC+D+A++K+EYWSSLAPLPFE+V+SAGQKAKEECW+KGDE+ E R
Sbjct  325  CWLARYWGLAAKYGICADVAVSKHEYWSSLAPLPFEVVVSAGQKAKEECWEKGDEDSEKR  384

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
                 DLSDLTGEGNIESMLSVEMGLKEL SLKVEDAIVLALAQQRR N+ R SISD+KS
Sbjct  385  STLAQDLSDLTGEGNIESMLSVEMGLKELASLKVEDAIVLALAQQRRANSLRLSISDVKS  444

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPKY EA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE+ A ++ QFWI RSA SP+
Sbjct  445  PGDPKYTEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEDTAKERFQFWISRSAHSPS  504

Query  360  SHDAVD  343
            SHDAVD
Sbjct  505  SHDAVD  510



>ref|XP_009121778.1| PREDICTED: uncharacterized protein LOC103846586 [Brassica rapa]
Length=544

 Score =   318 bits (814),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 176/208 (85%), Gaps = 1/208 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQK-GDENPER  721
            CWLAR WGLAARYGICSDIA +KYEYWSSLAPLPFEIVLSAGQKAKEE W+K  +EN +R
Sbjct  334  CWLARYWGLAARYGICSDIATSKYEYWSSLAPLPFEIVLSAGQKAKEESWEKDSEENEKR  393

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             + V D++DLTGEGNIESMLSVEMGLKEL SLKVE  I + LAQ R  NT R S  +LKS
Sbjct  394  SQLVQDINDLTGEGNIESMLSVEMGLKELASLKVEVTITMTLAQLRLANTFRLSDPELKS  453

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PG PK +EA+ELSPEESEDVLFKEAWLTYFWRRA +LGI+ +IA ++LQFWI RSA SP+
Sbjct  454  PGGPKLLEALELSPEESEDVLFKEAWLTYFWRRALSLGIDVDIARERLQFWISRSAHSPS  513

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASR  277
            SHDA++VEQGL ELRK  IE RLWEASR
Sbjct  514  SHDAMEVEQGLTELRKRRIERRLWEASR  541



>ref|XP_009767496.1| PREDICTED: uncharacterized protein LOC104218653 isoform X2 [Nicotiana 
sylvestris]
Length=440

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 180/219 (82%), Gaps = 2/219 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWL+R WGLA  YGIC+DIA  K+E+WSS APLPFE+V+SAGQKA+EE W  GD++ +R 
Sbjct  215  CWLSRYWGLAVHYGICADIAGVKHEHWSSFAPLPFEVVISAGQKAREESWSGGDDS-DRS  273

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V D+SDL+GEGNIESMLSVEM L+EL SLKVEDA++LALAQ RR N  R S SD KS 
Sbjct  274  KRVRDISDLSGEGNIESMLSVEMALRELASLKVEDAVILALAQPRRSNVVRQS-SDPKSS  332

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPK M+A ELS EESEDVLFKEAWLTYFWRRAK   +EE+IA ++LQFWI RS ++PT+
Sbjct  333  ADPKLMDAYELSQEESEDVLFKEAWLTYFWRRAKMHCVEEDIAEERLQFWINRSGQTPTT  392

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK  241
            HD+VDVE+GL+ELRKLGIE +LWEASRKE DQ S   GK
Sbjct  393  HDSVDVERGLIELRKLGIEQQLWEASRKEIDQPSVTNGK  431



>emb|CDX69654.1| BnaA10g20030D [Brassica napus]
Length=541

 Score =   316 bits (810),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 176/208 (85%), Gaps = 1/208 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQK-GDENPER  721
            CWLAR WGLAARYGICSDIA +KYEYWSSLAPLPFEIVLSAGQKAKEE W+K  +EN +R
Sbjct  331  CWLARYWGLAARYGICSDIATSKYEYWSSLAPLPFEIVLSAGQKAKEESWEKDSEENEKR  390

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             + V D++DLTGEGNIESMLSVEMGLKEL SLKVE  I + LAQ R  NT R S  +LKS
Sbjct  391  SQLVQDINDLTGEGNIESMLSVEMGLKELASLKVEVTITMTLAQLRLANTFRLSDPELKS  450

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PG PK +EA+ELSPEESEDVLFKEAWLTYFWRRA +LGI+ +IA ++LQFWI RSA SP+
Sbjct  451  PGCPKLLEALELSPEESEDVLFKEAWLTYFWRRALSLGIDVDIARERLQFWISRSAHSPS  510

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASR  277
            SHDA++VEQGL ELRK  IE RLWEASR
Sbjct  511  SHDAMEVEQGLTELRKRRIERRLWEASR  538



>gb|KJB40053.1| hypothetical protein B456_007G044600 [Gossypium raimondii]
Length=410

 Score =   311 bits (798),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 178/215 (83%), Gaps = 0/215 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+E+WS+LAPLPFEI++SAGQKAKEE W +G  + +R 
Sbjct  183  CWLARYWGLAVQHGICADIAVSKHEHWSALAPLPFEIIVSAGQKAKEEAWDRGGGDLDRS  242

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DL+DLTGEG IESMLSVEM L+EL SLKVEDA++ AL + RR +  R S+SD KSP
Sbjct  243  KLVRDLNDLTGEGTIESMLSVEMALRELASLKVEDAVIQALGRHRRLSLLRQSVSDSKSP  302

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK ++A ELS EE EDVLFKEAWLTYFWRRAK   IEE+IA  +LQFWI RS ++PTS
Sbjct  303  GDPKLIDAFELSEEEGEDVLFKEAWLTYFWRRAKVHCIEEDIAEDRLQFWISRSGQTPTS  362

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVDV++GL ELRKLGIE +LWEASRKE D  S+
Sbjct  363  HDAVDVDRGLFELRKLGIEQQLWEASRKEIDHPSA  397



>gb|KDO83175.1| hypothetical protein CISIN_1g008906mg [Citrus sinensis]
Length=549

 Score =   316 bits (809),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 168/186 (90%), Gaps = 1/186 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDE-NPER  721
            CWLAR WGLAA+YGIC D+A++KYEYWSSLAPLPFE+V+SAGQKAKEECW+KGD+ N +R
Sbjct  338  CWLARYWGLAAKYGICVDVAVSKYEYWSSLAPLPFEVVISAGQKAKEECWEKGDDDNEKR  397

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K ++D++DLTGEGNIESMLSVEMGLKEL + KVEDAIVLALAQQRR N+ R SISD+KS
Sbjct  398  SKLLVDINDLTGEGNIESMLSVEMGLKELAASKVEDAIVLALAQQRRANSLRVSISDIKS  457

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE IA ++L+FWI RS  SP+
Sbjct  458  PGDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEHIAKERLEFWISRSGHSPS  517

Query  360  SHDAVD  343
            SHDAVD
Sbjct  518  SHDAVD  523



>gb|KJB51281.1| hypothetical protein B456_008G210100 [Gossypium raimondii]
Length=556

 Score =   316 bits (809),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 178/212 (84%), Gaps = 0/212 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+EYWS+LAPLPFE+V+SAGQKAKEE W KGD + +R 
Sbjct  329  CWLARYWGLAVQHGICADIAVSKHEYWSALAPLPFEVVVSAGQKAKEEAWDKGDGHSDRS  388

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DL+DLTGEGNIESMLSVEMGL+EL SLKVEDA+V AL + RR      S+SD KSP
Sbjct  389  KIVRDLNDLTGEGNIESMLSVEMGLRELASLKVEDAVVQALGRYRRLGLLHQSVSDSKSP  448

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK ++A ELS EE EDVLFKEAWLTYFWRRAK  G+E++IA ++L+FWI  S ++PTS
Sbjct  449  GDPKLIDAFELSEEEREDVLFKEAWLTYFWRRAKVYGVEDDIAEERLEFWISHSGQTPTS  508

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            HDAVDV++GL ELRKLGIE +LWEASRKE D 
Sbjct  509  HDAVDVDRGLYELRKLGIEQQLWEASRKEIDH  540



>emb|CDO98314.1| unnamed protein product [Coffea canephora]
Length=571

 Score =   316 bits (810),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 177/214 (83%), Gaps = 0/214 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA  YGIC+D+A  K+E+WSSLAPLPFE+V+SAGQKA+EE    GD+   R 
Sbjct  344  CWLARYWGLAVHYGICTDVAALKHEHWSSLAPLPFEVVISAGQKAREESRNGGDDTERRN  403

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            KHV +LSDLTGEGNIESMLSVEMGL+EL SLKVEDA+VLALAQ RR +  R S  + KS 
Sbjct  404  KHVRNLSDLTGEGNIESMLSVEMGLRELASLKVEDAVVLALAQHRRSSLVRHSFLEPKST  463

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             + KYME  ELS EES+DVLFKEAWL YFWRRAK  G+EE+IA+++LQFWI RSA+SPTS
Sbjct  464  IETKYMEPFELSQEESQDVLFKEAWLAYFWRRAKDHGVEEDIADERLQFWISRSAQSPTS  523

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HDAVDVE+GL ELRKLGIE +LWEASR+E +Q S
Sbjct  524  HDAVDVERGLTELRKLGIEQQLWEASRRELEQQS  557



>emb|CDY09779.1| BnaC09g43820D [Brassica napus]
Length=538

 Score =   315 bits (807),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 175/208 (84%), Gaps = 1/208 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLAR WGLAARYGICSDIA +KYEYWSSLAPLPFEIVLSAGQKAKEE W+K  E  E R
Sbjct  328  CWLARYWGLAARYGICSDIATSKYEYWSSLAPLPFEIVLSAGQKAKEESWEKDSEESEKR  387

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             + V D++DLTGEGNIESMLSVEMGLKEL SLKVE ++ L LAQ R  NT R S  +LKS
Sbjct  388  SQLVQDINDLTGEGNIESMLSVEMGLKELASLKVEVSLTLTLAQLRLANTFRLSDPELKS  447

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PG PK +EA+ELSPEESEDVLFKEAWLTYFWRRA +LGI+ +IA ++LQFWI RSA SP+
Sbjct  448  PGGPKLLEALELSPEESEDVLFKEAWLTYFWRRALSLGIDVDIARERLQFWISRSAHSPS  507

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASR  277
            SHDA++VEQGL ELRK  IE RLWEASR
Sbjct  508  SHDAMEVEQGLTELRKRRIERRLWEASR  535



>ref|XP_006341491.1| PREDICTED: uncharacterized protein LOC102585005 isoform X2 [Solanum 
tuberosum]
Length=439

 Score =   312 bits (799),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 177/212 (83%), Gaps = 2/212 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWL+R WGLA +YGIC+DIA TK+E+WSS APLPFE+V+SAGQKA+EE W  GD++ +R 
Sbjct  216  CWLSRYWGLAVQYGICADIAGTKHEHWSSFAPLPFEVVISAGQKAREESWNGGDDS-DRS  274

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   D+SDL+GEGNIESMLSVEM L+EL SLKVEDA++LALAQ RR N  R S SD KS 
Sbjct  275  KRARDISDLSGEGNIESMLSVEMALRELASLKVEDAVILALAQHRRSNVVRQS-SDPKSC  333

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPK M+A EL  EESEDVLFKEAWLTYFWRRAK   +EE+IA ++LQ WIGRS +SPT+
Sbjct  334  ADPKLMDAYELGQEESEDVLFKEAWLTYFWRRAKVHCVEEDIAEERLQVWIGRSGQSPTT  393

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            HDAVDVE+GL+ELRKLGIE +LWEASRKE DQ
Sbjct  394  HDAVDVERGLIELRKLGIEQQLWEASRKEIDQ  425



>ref|XP_011002098.1| PREDICTED: uncharacterized protein LOC105109182 [Populus euphratica]
 ref|XP_011002099.1| PREDICTED: uncharacterized protein LOC105109182 [Populus euphratica]
Length=565

 Score =   315 bits (808),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 180/214 (84%), Gaps = 1/214 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+D+A++K+E+WS+LAPLPFE+V+SAGQKAKEE   +G  + +R 
Sbjct  337  CWLARYWGLAVQHGICADVAVSKHEHWSALAPLPFEVVISAGQKAKEES-DRGGRDSDRS  395

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DLSDLTGEGNIESMLSVEMGL+EL SLKVEDA+VLALAQ RRP+T R + SD + P
Sbjct  396  KIVRDLSDLTGEGNIESMLSVEMGLRELASLKVEDAVVLALAQHRRPSTVRQNFSDSRPP  455

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK+ EAIELS  E++DVLFKEAWLTY+WRRA   G+EE+IA  +LQFWI RS +S TS
Sbjct  456  GDPKFTEAIELSEAEADDVLFKEAWLTYYWRRALVHGVEEDIAEDRLQFWISRSGQSLTS  515

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HDAVDVE+G++ELRKL IE +LWEASR+E D  S
Sbjct  516  HDAVDVERGIVELRKLSIEQQLWEASRREIDHSS  549



>ref|XP_008374187.1| PREDICTED: uncharacterized protein LOC103437491 isoform X4 [Malus 
domestica]
Length=417

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 177/215 (82%), Gaps = 5/215 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+E+WSSLAPLPFE+V+SAGQKAKEE W K      R 
Sbjct  195  CWLARYWGLAVQHGICADIAVSKHEHWSSLAPLPFEVVISAGQKAKEEPWGKN-----RS  249

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DL+DLTGEGNIESMLSVEMG++EL+SLKVEDA+V+ALAQ RRPN+ R SI D KS 
Sbjct  250  KLARDLTDLTGEGNIESMLSVEMGMRELSSLKVEDAVVIALAQHRRPNSVRQSILDSKST  309

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT 
Sbjct  310  GBPKFMEAFDLSDEEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTC  369

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVD E+G+ ELRKLGIE +LWEASRKE DQ  S
Sbjct  370  HDAVDAERGVYELRKLGIEQQLWEASRKEIDQPVS  404



>ref|XP_008356569.1| PREDICTED: uncharacterized protein LOC103420283 isoform X4 [Malus 
domestica]
Length=417

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 177/215 (82%), Gaps = 5/215 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+E+WSSLAPLPFE+V+SAGQKAKEE W K      R 
Sbjct  195  CWLARYWGLAVQHGICADIAVSKHEHWSSLAPLPFEVVISAGQKAKEEPWGKN-----RS  249

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DL+DLTGEGNIESMLSVEMG++EL+SLKVEDA+V+ALAQ RRPN+ R SI D KS 
Sbjct  250  KLARDLTDLTGEGNIESMLSVEMGMRELSSLKVEDAVVIALAQHRRPNSVRQSILDSKST  309

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT 
Sbjct  310  GBPKFMEAFDLSBEEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTC  369

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVD E+G+ ELRKLGIE +LWEASRKE DQ  S
Sbjct  370  HDAVDAERGVYELRKLGIEQQLWEASRKEIDQPVS  404



>ref|XP_009767495.1| PREDICTED: uncharacterized protein LOC104218653 isoform X1 [Nicotiana 
sylvestris]
Length=568

 Score =   314 bits (805),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 180/219 (82%), Gaps = 2/219 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWL+R WGLA  YGIC+DIA  K+E+WSS APLPFE+V+SAGQKA+EE W  GD++ +R 
Sbjct  343  CWLSRYWGLAVHYGICADIAGVKHEHWSSFAPLPFEVVISAGQKAREESWSGGDDS-DRS  401

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V D+SDL+GEGNIESMLSVEM L+EL SLKVEDA++LALAQ RR N  R S SD KS 
Sbjct  402  KRVRDISDLSGEGNIESMLSVEMALRELASLKVEDAVILALAQPRRSNVVRQS-SDPKSS  460

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPK M+A ELS EESEDVLFKEAWLTYFWRRAK   +EE+IA ++LQFWI RS ++PT+
Sbjct  461  ADPKLMDAYELSQEESEDVLFKEAWLTYFWRRAKMHCVEEDIAEERLQFWINRSGQTPTT  520

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK  241
            HD+VDVE+GL+ELRKLGIE +LWEASRKE DQ S   GK
Sbjct  521  HDSVDVERGLIELRKLGIEQQLWEASRKEIDQPSVTNGK  559



>ref|XP_008356568.1| PREDICTED: uncharacterized protein LOC103420283 isoform X3 [Malus 
domestica]
Length=494

 Score =   311 bits (797),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 177/215 (82%), Gaps = 5/215 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+E+WSSLAPLPFE+V+SAGQKAKEE W K      R 
Sbjct  272  CWLARYWGLAVQHGICADIAVSKHEHWSSLAPLPFEVVISAGQKAKEEPWGKN-----RS  326

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DL+DLTGEGNIESMLSVEMG++EL+SLKVEDA+V+ALAQ RRPN+ R SI D KS 
Sbjct  327  KLARDLTDLTGEGNIESMLSVEMGMRELSSLKVEDAVVIALAQHRRPNSVRQSILDSKST  386

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT 
Sbjct  387  GBPKFMEAFDLSBEEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTC  446

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVD E+G+ ELRKLGIE +LWEASRKE DQ  S
Sbjct  447  HDAVDAERGVYELRKLGIEQQLWEASRKEIDQPVS  481



>ref|XP_008374186.1| PREDICTED: uncharacterized protein LOC103437491 isoform X3 [Malus 
domestica]
Length=495

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 177/215 (82%), Gaps = 5/215 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+E+WSSLAPLPFE+V+SAGQKAKEE W K      R 
Sbjct  273  CWLARYWGLAVQHGICADIAVSKHEHWSSLAPLPFEVVISAGQKAKEEPWGKN-----RS  327

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DL+DLTGEGNIESMLSVEMG++EL+SLKVEDA+V+ALAQ RRPN+ R SI D KS 
Sbjct  328  KLARDLTDLTGEGNIESMLSVEMGMRELSSLKVEDAVVIALAQHRRPNSVRQSILDSKST  387

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT 
Sbjct  388  GBPKFMEAFDLSDEEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTC  447

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVD E+G+ ELRKLGIE +LWEASRKE DQ  S
Sbjct  448  HDAVDAERGVYELRKLGIEQQLWEASRKEIDQPVS  482



>ref|XP_006646640.1| PREDICTED: ELKS/Rab6-interacting/CAST family member 1-like [Oryza 
brachyantha]
Length=492

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 181/218 (83%), Gaps = 1/218 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKG-DENPER  721
            CWL+R WGLA +YG+  +IA++K+E+WSSLAPLP E+VLSAGQKAKEE  ++G D+   R
Sbjct  272  CWLSRYWGLAVQYGVYPEIAVSKHEHWSSLAPLPLEVVLSAGQKAKEEPRKQGEDDTQRR  331

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V D+SD+ GEGNIESMLSVEMGL+EL+SLKVEDA+V+AL Q RRP+  R   SD KS
Sbjct  332  NKLVRDMSDIMGEGNIESMLSVEMGLRELSSLKVEDAVVVALGQHRRPSIVRQFTSDFKS  391

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PG+PK++EA +LS EE+EDV FK+AWL YFWRRAK  GIEE+IA ++LQFWIGR+A++P 
Sbjct  392  PGEPKFLEAFDLSHEEAEDVSFKQAWLIYFWRRAKTHGIEEDIAEERLQFWIGRNAQAPN  451

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  247
            SHDA+DVE+GL ELRKLGIE +LWE SR + DQDSS I
Sbjct  452  SHDAIDVERGLTELRKLGIEQQLWEGSRADIDQDSSAI  489



>ref|XP_009781778.1| PREDICTED: uncharacterized protein LOC104230617 isoform X2 [Nicotiana 
sylvestris]
Length=551

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLAA++GIC+DIA +K+EYWSS APLPFE+V+SAGQKAKEE  +KG +NPER 
Sbjct  350  CWLARYWGLAAQFGICADIAASKHEYWSSFAPLPFELVISAGQKAKEEFLEKGYDNPERG  409

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
              V DL+DLTGEGNIESMLSVEMGL EL SLKVEDAIVLALAQQRRPN+ RTSISD+KSP
Sbjct  410  NLVRDLNDLTGEGNIESMLSVEMGLNELVSLKVEDAIVLALAQQRRPNSTRTSISDIKSP  469

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPKY+EA ELSPEESEDVLFKEAWLTYFWRRAKA GI+E+ ANK  QFW  RS  +PTS
Sbjct  470  IDPKYIEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIQEDKANKNFQFWSSRSGHAPTS  529

Query  357  HDAVDVEQGL  328
            HDAVD E+ +
Sbjct  530  HDAVDDERNV  539



>gb|KJB40052.1| hypothetical protein B456_007G044600 [Gossypium raimondii]
Length=555

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 178/215 (83%), Gaps = 0/215 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+E+WS+LAPLPFEI++SAGQKAKEE W +G  + +R 
Sbjct  328  CWLARYWGLAVQHGICADIAVSKHEHWSALAPLPFEIIVSAGQKAKEEAWDRGGGDLDRS  387

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DL+DLTGEG IESMLSVEM L+EL SLKVEDA++ AL + RR +  R S+SD KSP
Sbjct  388  KLVRDLNDLTGEGTIESMLSVEMALRELASLKVEDAVIQALGRHRRLSLLRQSVSDSKSP  447

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK ++A ELS EE EDVLFKEAWLTYFWRRAK   IEE+IA  +LQFWI RS ++PTS
Sbjct  448  GDPKLIDAFELSEEEGEDVLFKEAWLTYFWRRAKVHCIEEDIAEDRLQFWISRSGQTPTS  507

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVDV++GL ELRKLGIE +LWEASRKE D  S+
Sbjct  508  HDAVDVDRGLFELRKLGIEQQLWEASRKEIDHPSA  542



>tpg|DAA56002.1| TPA: hypothetical protein ZEAMMB73_352561 [Zea mays]
Length=348

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 176/214 (82%), Gaps = 0/214 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YG+  +IA++K+E+WSSLAPLP E+VLSAGQKAKEE  ++GD    R 
Sbjct  129  CWLARYWGLAVQYGVYPEIAVSKHEHWSSLAPLPLEVVLSAGQKAKEEPRKQGDNVQGRN  188

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   ++SD+ GEGNIESMLSVEMGL+EL+SLKVEDA+V+A+ Q RRP+  R   SD KSP
Sbjct  189  KLAREMSDVMGEGNIESMLSVEMGLRELSSLKVEDAVVVAVGQHRRPSIVRQFTSDFKSP  248

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PKY+EA +LSPEE+EDV FK+AWL YFWRRAK  G+EE+IA+ +LQ WIGR+A++P S
Sbjct  249  GEPKYLEAFDLSPEEAEDVSFKQAWLIYFWRRAKTHGVEEDIADDRLQLWIGRNAQAPNS  308

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HDA+DVE+GL ELRKLGIE +LWE SR + DQ S
Sbjct  309  HDAIDVERGLTELRKLGIEQQLWEGSRADIDQAS  342



>gb|KJB40054.1| hypothetical protein B456_007G044600 [Gossypium raimondii]
Length=550

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 178/215 (83%), Gaps = 0/215 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+E+WS+LAPLPFEI++SAGQKAKEE W +G  + +R 
Sbjct  323  CWLARYWGLAVQHGICADIAVSKHEHWSALAPLPFEIIVSAGQKAKEEAWDRGGGDLDRS  382

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DL+DLTGEG IESMLSVEM L+EL SLKVEDA++ AL + RR +  R S+SD KSP
Sbjct  383  KLVRDLNDLTGEGTIESMLSVEMALRELASLKVEDAVIQALGRHRRLSLLRQSVSDSKSP  442

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK ++A ELS EE EDVLFKEAWLTYFWRRAK   IEE+IA  +LQFWI RS ++PTS
Sbjct  443  GDPKLIDAFELSEEEGEDVLFKEAWLTYFWRRAKVHCIEEDIAEDRLQFWISRSGQTPTS  502

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVDV++GL ELRKLGIE +LWEASRKE D  S+
Sbjct  503  HDAVDVDRGLFELRKLGIEQQLWEASRKEIDHPSA  537



>ref|XP_009337520.1| PREDICTED: uncharacterized protein LOC103929969 isoform X2 [Pyrus 
x bretschneideri]
Length=557

 Score =   311 bits (798),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 176/212 (83%), Gaps = 5/212 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K E+WSSLAPLPFE+V+SAGQKAKEE W K      R 
Sbjct  335  CWLARYWGLAVQHGICADIAVSKREHWSSLAPLPFEVVISAGQKAKEESWGKN-----RS  389

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DL+DLTGEGNIESMLSVEMG++EL+SLKVEDA+ +ALA+  RPN+ R SI D KSP
Sbjct  390  KLARDLTDLTGEGNIESMLSVEMGMRELSSLKVEDAVAIALAKHIRPNSVRQSILDSKSP  449

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RSA++PT 
Sbjct  450  GDPKFMEAFDLSDEEIEDISFKVAWLTYFWRRAKVHGVEDDIADDRLQLWINRSAQTPTC  509

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            HDAVDVE+GL ELRKLGIE +LWEASRKE DQ
Sbjct  510  HDAVDVERGLYELRKLGIEQQLWEASRKEIDQ  541



>ref|XP_010026209.1| PREDICTED: dynactin subunit 1-like [Eucalyptus grandis]
 gb|KCW83117.1| hypothetical protein EUGRSUZ_B00074 [Eucalyptus grandis]
Length=562

 Score =   311 bits (797),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 178/216 (82%), Gaps = 4/216 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++G+C DIA +K+E+WSSLAPLPFE+V+SAGQKAKE  W +   + ER 
Sbjct  335  CWLARYWGLAVQHGVCPDIAASKHEHWSSLAPLPFEVVISAGQKAKE-SWNERGSDQERS  393

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            KHV DLSDLTGEGNIESMLSVEM L+EL SLKVEDA+VLALA+ RRPN  R   SD KS 
Sbjct  394  KHVRDLSDLTGEGNIESMLSVEMALRELASLKVEDAVVLALARHRRPNLVR---SDSKSN  450

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPK++EA ELS EE+EDVLFKEAWLTYFWRRA    +EE+IA ++LQFWI RS +SPTS
Sbjct  451  VDPKFIEAYELSDEEAEDVLFKEAWLTYFWRRALTHCVEEDIAEERLQFWISRSGQSPTS  510

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  250
             DAVDVE+GL+ELRKLGIE +LWEASRKE D  SSL
Sbjct  511  QDAVDVERGLLELRKLGIEQQLWEASRKEIDNPSSL  546



>ref|XP_008356566.1| PREDICTED: uncharacterized protein LOC103420283 isoform X1 [Malus 
domestica]
Length=561

 Score =   311 bits (797),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 177/215 (82%), Gaps = 5/215 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+E+WSSLAPLPFE+V+SAGQKAKEE W K      R 
Sbjct  339  CWLARYWGLAVQHGICADIAVSKHEHWSSLAPLPFEVVISAGQKAKEEPWGKN-----RS  393

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DL+DLTGEGNIESMLSVEMG++EL+SLKVEDA+V+ALAQ RRPN+ R SI D KS 
Sbjct  394  KLARDLTDLTGEGNIESMLSVEMGMRELSSLKVEDAVVIALAQHRRPNSVRQSILDSKST  453

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT 
Sbjct  454  GBPKFMEAFDLSBEEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTC  513

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVD E+G+ ELRKLGIE +LWEASRKE DQ  S
Sbjct  514  HDAVDAERGVYELRKLGIEQQLWEASRKEIDQPVS  548



>ref|XP_008374184.1| PREDICTED: uncharacterized protein LOC103437491 isoform X1 [Malus 
domestica]
Length=561

 Score =   311 bits (797),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 177/215 (82%), Gaps = 5/215 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+E+WSSLAPLPFE+V+SAGQKAKEE W K      R 
Sbjct  339  CWLARYWGLAVQHGICADIAVSKHEHWSSLAPLPFEVVISAGQKAKEEPWGKN-----RS  393

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DL+DLTGEGNIESMLSVEMG++EL+SLKVEDA+V+ALAQ RRPN+ R SI D KS 
Sbjct  394  KLARDLTDLTGEGNIESMLSVEMGMRELSSLKVEDAVVIALAQHRRPNSVRQSILDSKST  453

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT 
Sbjct  454  GBPKFMEAFDLSDEEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTC  513

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVD E+G+ ELRKLGIE +LWEASRKE DQ  S
Sbjct  514  HDAVDAERGVYELRKLGIEQQLWEASRKEIDQPVS  548



>ref|XP_006341490.1| PREDICTED: uncharacterized protein LOC102585005 isoform X1 [Solanum 
tuberosum]
Length=566

 Score =   311 bits (797),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 179/215 (83%), Gaps = 2/215 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWL+R WGLA +YGIC+DIA TK+E+WSS APLPFE+V+SAGQKA+EE W  GD++ +R 
Sbjct  343  CWLSRYWGLAVQYGICADIAGTKHEHWSSFAPLPFEVVISAGQKAREESWNGGDDS-DRS  401

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   D+SDL+GEGNIESMLSVEM L+EL SLKVEDA++LALAQ RR N  R S SD KS 
Sbjct  402  KRARDISDLSGEGNIESMLSVEMALRELASLKVEDAVILALAQHRRSNVVRQS-SDPKSC  460

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPK M+A EL  EESEDVLFKEAWLTYFWRRAK   +EE+IA ++LQ WIGRS +SPT+
Sbjct  461  ADPKLMDAYELGQEESEDVLFKEAWLTYFWRRAKVHCVEEDIAEERLQVWIGRSGQSPTT  520

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVDVE+GL+ELRKLGIE +LWEASRKE DQ ++
Sbjct  521  HDAVDVERGLIELRKLGIEQQLWEASRKEIDQPNN  555



>ref|XP_004971152.1| PREDICTED: uncharacterized protein LOC101760852 [Setaria italica]
Length=560

 Score =   311 bits (796),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 178/214 (83%), Gaps = 0/214 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YG+  +IA++K+E+WSSLAPLP E+VLSAGQKAKEE  ++GD+   R 
Sbjct  342  CWLARYWGLAVQYGVYPEIAVSKHEHWSSLAPLPLEVVLSAGQKAKEEPRKQGDDAQGRN  401

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   ++SD+ GEGNIESMLSVEMGL+EL+SLKVEDA+V+AL Q RRP+  R   SD KSP
Sbjct  402  KLAREMSDVMGEGNIESMLSVEMGLRELSSLKVEDAVVVALGQHRRPSIVRQFTSDFKSP  461

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PKY+EA +LSPEE+EDV FK+AWL YFWRRAK  G+EE+IA+ +LQFWIGR+A++P S
Sbjct  462  GEPKYLEAFDLSPEEAEDVSFKQAWLIYFWRRAKTHGVEEDIADDRLQFWIGRNAQAPNS  521

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HDA+DVE+GL ELRKLGIE +LWE SR + DQ S
Sbjct  522  HDAIDVERGLTELRKLGIEQQLWEGSRADIDQAS  555



>ref|XP_002459023.1| hypothetical protein SORBIDRAFT_03g044670 [Sorghum bicolor]
 gb|EES04143.1| hypothetical protein SORBIDRAFT_03g044670 [Sorghum bicolor]
Length=562

 Score =   311 bits (796),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 177/214 (83%), Gaps = 0/214 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YG+  +IA++KYE+WSSLAPLP EIVLSAGQKAKEE  ++G+    R 
Sbjct  343  CWLARYWGLAVQYGVYPEIAVSKYEHWSSLAPLPLEIVLSAGQKAKEEPRKQGENGQGRN  402

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   ++SD+ GEGNIESMLSVEMGL+EL+SLKVEDA+V+AL Q RRP+  R   SD KSP
Sbjct  403  KLAREMSDVMGEGNIESMLSVEMGLRELSSLKVEDAVVVALGQHRRPSIVRQFTSDFKSP  462

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PKY+EA +LSPEE+EDV FK+AWL YFWRRAK  G+EE+IA+ +LQFWIGR+A++P S
Sbjct  463  GEPKYLEAFDLSPEEAEDVSFKQAWLIYFWRRAKTHGVEEDIADDRLQFWIGRNAQAPNS  522

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HDA+DVE+GL ELRKLGIE +LWE SR + DQ S
Sbjct  523  HDAIDVERGLTELRKLGIEQQLWEGSRADIDQAS  556



>ref|XP_009368793.1| PREDICTED: uncharacterized protein LOC103958268 isoform X2 [Pyrus 
x bretschneideri]
Length=561

 Score =   311 bits (796),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 177/215 (82%), Gaps = 5/215 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+E+WSSLAPLPFE+V+SAGQKAKEE W+K      R 
Sbjct  339  CWLARYWGLAVQHGICADIAVSKHEHWSSLAPLPFEVVISAGQKAKEEPWRKN-----RS  393

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DL+DLT EGNIESMLSVEMG++EL+SLKVEDA+V+ALAQ RRPN+ R SI D KSP
Sbjct  394  KLARDLTDLTSEGNIESMLSVEMGMRELSSLKVEDAVVIALAQHRRPNSVRQSILDSKSP  453

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G PK+MEA +LS +E ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT 
Sbjct  454  GAPKFMEAFDLSDDEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTC  513

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVD E+GL ELRKLGIE +LWEASRKE DQ  S
Sbjct  514  HDAVDAERGLSELRKLGIEQQLWEASRKEIDQPVS  548



>gb|KJB15175.1| hypothetical protein B456_002G163500 [Gossypium raimondii]
Length=606

 Score =   312 bits (799),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 163/262 (62%), Positives = 185/262 (71%), Gaps = 54/262 (21%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGD-ENPER  721
            CWLAR WGLA RYGIC+DIA++K+EYWSSLAPLPFE+V+SAGQKAKEE  +KGD EN +R
Sbjct  344  CWLARYWGLAVRYGICADIAVSKHEYWSSLAPLPFEVVVSAGQKAKEEFSEKGDDENEKR  403

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DLSDLTGEGNIESMLSVEMGLKEL SLKVE+AIV ALAQQRR ++ R S+SD+KS
Sbjct  404  SKLVEDLSDLTGEGNIESMLSVEMGLKELASLKVEEAIVNALAQQRRASSVRISLSDIKS  463

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            P DPK+MEA ELSPEESEDVLFKEAWLTY WRRAK+ GIEE+ A ++L+FWI RS  SP+
Sbjct  464  PRDPKFMEAFELSPEESEDVLFKEAWLTYIWRRAKSHGIEEDTAKERLKFWISRSVHSPS  523

Query  360  SHDAVD-----------------------------------------------------V  340
            SHDAVD                                                     V
Sbjct  524  SHDAVDGNIYCSINFFKWKYWCNVSYSLNFELKNVNYFLAYTRPNPIFLASKHLSCFSLV  583

Query  339  EQGLMELRKLGIEHRLWEASRK  274
            E+GLMELRKLGIE RLWEASR+
Sbjct  584  EEGLMELRKLGIERRLWEASRR  605



>ref|XP_009334313.1| PREDICTED: uncharacterized protein LOC103927142 isoform X2 [Pyrus 
x bretschneideri]
Length=557

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 175/212 (83%), Gaps = 5/212 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K E+WSSLAPLPFE+VLSAGQKAKEE W K      R 
Sbjct  335  CWLARYWGLAVQHGICADIAVSKREHWSSLAPLPFEVVLSAGQKAKEESWGKN-----RS  389

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DL+DLTGEGNIESMLSVEMG++EL+SLKVEDA+ +ALA+  RPN+ R SI D KSP
Sbjct  390  KLARDLTDLTGEGNIESMLSVEMGMRELSSLKVEDAVAIALAKHIRPNSVRQSILDSKSP  449

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI  SA++PT 
Sbjct  450  GDPKFMEAFDLSDEEIEDISFKVAWLTYFWRRAKVHGVEDDIADDRLQLWISHSAQTPTC  509

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            HDAVDVE+GL ELRKLGIE +LWEASRKE DQ
Sbjct  510  HDAVDVERGLYELRKLGIEQQLWEASRKEIDQ  541



>ref|XP_008356567.1| PREDICTED: uncharacterized protein LOC103420283 isoform X2 [Malus 
domestica]
Length=559

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 177/215 (82%), Gaps = 7/215 (3%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+E+WSSLAPLPFE+V+SAGQKAKEE W       +R 
Sbjct  339  CWLARYWGLAVQHGICADIAVSKHEHWSSLAPLPFEVVISAGQKAKEEPW-------DRS  391

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DL+DLTGEGNIESMLSVEMG++EL+SLKVEDA+V+ALAQ RRPN+ R SI D KS 
Sbjct  392  KLARDLTDLTGEGNIESMLSVEMGMRELSSLKVEDAVVIALAQHRRPNSVRQSILDSKST  451

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT 
Sbjct  452  GBPKFMEAFDLSBEEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTC  511

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVD E+G+ ELRKLGIE +LWEASRKE DQ  S
Sbjct  512  HDAVDAERGVYELRKLGIEQQLWEASRKEIDQPVS  546



>ref|XP_008374185.1| PREDICTED: uncharacterized protein LOC103437491 isoform X2 [Malus 
domestica]
Length=559

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 177/215 (82%), Gaps = 7/215 (3%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+E+WSSLAPLPFE+V+SAGQKAKEE W       +R 
Sbjct  339  CWLARYWGLAVQHGICADIAVSKHEHWSSLAPLPFEVVISAGQKAKEEPW-------DRS  391

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DL+DLTGEGNIESMLSVEMG++EL+SLKVEDA+V+ALAQ RRPN+ R SI D KS 
Sbjct  392  KLARDLTDLTGEGNIESMLSVEMGMRELSSLKVEDAVVIALAQHRRPNSVRQSILDSKST  451

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT 
Sbjct  452  GBPKFMEAFDLSDEEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTC  511

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVD E+G+ ELRKLGIE +LWEASRKE DQ  S
Sbjct  512  HDAVDAERGVYELRKLGIEQQLWEASRKEIDQPVS  546



>ref|XP_011042951.1| PREDICTED: uncharacterized protein LOC105138542 isoform X2 [Populus 
euphratica]
Length=565

 Score =   310 bits (793),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 177/214 (83%), Gaps = 1/214 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC++IA +K+E+WS+LAPLPFE+V+SAGQ+AKEE   +G  +P+R 
Sbjct  338  CWLARYWGLAVQHGICANIAESKHEHWSALAPLPFEVVISAGQRAKEEL-DRGGGDPDRH  396

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DLSDLTGEGNIESMLSVEMGL+EL SLKVEDA+VLALAQ RRPN  R S SD + P
Sbjct  397  KVVRDLSDLTGEGNIESMLSVEMGLRELASLKVEDAVVLALAQHRRPNMVRQSFSDSRPP  456

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK+ EA ELS  E+EDV FKEAWLTY+WRRA   G+EE+IA  +LQFWI RS +S TS
Sbjct  457  GDPKFTEANELSKAEAEDVHFKEAWLTYYWRRALVHGVEEDIAEDRLQFWISRSGQSLTS  516

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HDAVDVE+G++ELRKL IE +LWEASR+E D  S
Sbjct  517  HDAVDVERGVLELRKLSIEQQLWEASRREIDHSS  550



>ref|XP_011042949.1| PREDICTED: uncharacterized protein LOC105138542 isoform X1 [Populus 
euphratica]
 ref|XP_011042950.1| PREDICTED: uncharacterized protein LOC105138542 isoform X1 [Populus 
euphratica]
Length=567

 Score =   310 bits (793),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 177/214 (83%), Gaps = 1/214 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC++IA +K+E+WS+LAPLPFE+V+SAGQ+AKEE   +G  +P+R 
Sbjct  340  CWLARYWGLAVQHGICANIAESKHEHWSALAPLPFEVVISAGQRAKEEL-DRGGGDPDRH  398

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DLSDLTGEGNIESMLSVEMGL+EL SLKVEDA+VLALAQ RRPN  R S SD + P
Sbjct  399  KVVRDLSDLTGEGNIESMLSVEMGLRELASLKVEDAVVLALAQHRRPNMVRQSFSDSRPP  458

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK+ EA ELS  E+EDV FKEAWLTY+WRRA   G+EE+IA  +LQFWI RS +S TS
Sbjct  459  GDPKFTEANELSKAEAEDVHFKEAWLTYYWRRALVHGVEEDIAEDRLQFWISRSGQSLTS  518

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HDAVDVE+G++ELRKL IE +LWEASR+E D  S
Sbjct  519  HDAVDVERGVLELRKLSIEQQLWEASRREIDHSS  552



>ref|XP_010909766.1| PREDICTED: uncharacterized protein LOC105035770 [Elaeis guineensis]
Length=555

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 179/216 (83%), Gaps = 1/216 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GI  +IA++KYE+WSSLAPLP E+V+SAGQKAKEE   + +++ ER 
Sbjct  335  CWLARYWGLAVKHGIYPEIAMSKYEHWSSLAPLPLEVVISAGQKAKEESSNRDEDDSERR  394

Query  717  -KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K + DLSD+TGEGNIESMLSVE GLKEL SLKVEDA+VLALAQ RRPN  R   SD KS
Sbjct  395  NKLIRDLSDITGEGNIESMLSVEKGLKELASLKVEDAVVLALAQHRRPNLLRQLSSDFKS  454

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPK++E+ EL+ EESEDV FK+AWL YFWRRAK  GIEE+IA ++LQFWI RS + PT
Sbjct  455  PGDPKFLESFELNQEESEDVTFKQAWLVYFWRRAKVHGIEEDIAEERLQFWISRSGQPPT  514

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            SHD VDVE+GL+ELRKLGIE +LWEASR++ +Q SS
Sbjct  515  SHDPVDVERGLIELRKLGIEPQLWEASRRDMEQASS  550



>ref|XP_004501742.1| PREDICTED: uncharacterized abhydrolase domain-containing protein 
DDB_G0269086-like isoform X2 [Cicer arietinum]
Length=565

 Score =   308 bits (790),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 174/212 (82%), Gaps = 4/212 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGL+ ++    DIA +KYE+WS+LAPLPFE+V+SAGQKAKEE W K  +  +R 
Sbjct  339  CWLARYWGLSVKH----DIAQSKYEHWSALAPLPFELVISAGQKAKEESWNKSADGSDRS  394

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DL+DL GEGNIESMLSVEMGL+EL SLKVEDA+VLALAQ RRPN  R S+ D KSP
Sbjct  395  KIVRDLNDLAGEGNIESMLSVEMGLRELASLKVEDAVVLALAQHRRPNLIRQSVLDSKSP  454

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GD KY EA ELS EE+EDVLFKEAWLTYFWRRA   G+EE+IA  +L+FWI RS +SPTS
Sbjct  455  GDAKYSEAFELSEEEAEDVLFKEAWLTYFWRRALFHGVEEDIAEDRLRFWISRSGQSPTS  514

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            HDAVDVE+GL+ELRKLGIE +LWEASRK  DQ
Sbjct  515  HDAVDVERGLLELRKLGIEQQLWEASRKGIDQ  546



>ref|XP_004235837.1| PREDICTED: uncharacterized protein LOC101264412 isoform X1 [Solanum 
lycopersicum]
Length=567

 Score =   308 bits (790),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 176/212 (83%), Gaps = 2/212 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWL+R WGLA +YGIC+DIA TK+E+WSS APLPFE+V+SAGQKA+EE W  GD++ +R 
Sbjct  343  CWLSRYWGLAVQYGICADIAGTKHEHWSSFAPLPFEVVISAGQKAREESWNGGDDS-DRS  401

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   D+SDL+GEGNIESMLSVEM L+EL SLKVEDA++LALAQ RR N  R S SD KS 
Sbjct  402  KRARDISDLSGEGNIESMLSVEMALRELASLKVEDAVILALAQHRRSNVVRQS-SDPKSS  460

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPK M+A EL  EESEDVLFKEAWLTYFWRRAK   +EE+IA ++LQ WIGRS ++PT+
Sbjct  461  VDPKLMDAYELGQEESEDVLFKEAWLTYFWRRAKVHCVEEDIAEERLQVWIGRSGQTPTT  520

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            HDAVDVE+GL+ELRKLGIE +LWEASRKE D 
Sbjct  521  HDAVDVERGLIELRKLGIEQQLWEASRKEIDH  552



>ref|NP_001045273.1| Os01g0928100 [Oryza sativa Japonica Group]
 dbj|BAD88164.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF07187.1| Os01g0928100 [Oryza sativa Japonica Group]
 dbj|BAH00139.1| unnamed protein product [Oryza sativa Japonica Group]
Length=570

 Score =   308 bits (790),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 145/218 (67%), Positives = 183/218 (84%), Gaps = 1/218 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWL+R WGLA +YG+  +IA++K+E+WSSLAPLP E+VLSAGQKAKEE  ++G+++ +R 
Sbjct  350  CWLSRYWGLAVQYGVYPEIAVSKHEHWSSLAPLPLEVVLSAGQKAKEEPLKQGEDDAQRR  409

Query  717  -KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V D+SD+ GEGNIESMLSVEMGL+EL+SLKVEDA+V+AL Q RRP+  R   SD KS
Sbjct  410  NKLVRDMSDVMGEGNIESMLSVEMGLRELSSLKVEDAVVVALGQHRRPSIVRQFTSDFKS  469

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PG+PK++EA +LS EE+EDV FK+AWL YFWRRAK  GIEE+IA ++LQFWIGR+A +PT
Sbjct  470  PGEPKFLEAFDLSHEEAEDVSFKQAWLIYFWRRAKTHGIEEDIAEERLQFWIGRNAVAPT  529

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  247
            SHDA+DVE+GL ELRKLGIE +LWE SR + D+DSS I
Sbjct  530  SHDAIDVERGLTELRKLGIEQQLWEGSRADIDEDSSAI  567



>ref|XP_009368795.1| PREDICTED: uncharacterized protein LOC103958268 isoform X3 [Pyrus 
x bretschneideri]
Length=559

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 175/215 (81%), Gaps = 7/215 (3%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA++K+E+WSSLAPLPFE+V+SAGQKAKEE W        R 
Sbjct  339  CWLARYWGLAVQHGICADIAVSKHEHWSSLAPLPFEVVISAGQKAKEEPWH-------RS  391

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DL+DLT EGNIESMLSVEMG++EL+SLKVEDA+V+ALAQ RRPN+ R SI D KSP
Sbjct  392  KLARDLTDLTSEGNIESMLSVEMGMRELSSLKVEDAVVIALAQHRRPNSVRQSILDSKSP  451

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G PK+MEA +LS +E ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT 
Sbjct  452  GAPKFMEAFDLSDDEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTC  511

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVD E+GL ELRKLGIE +LWEASRKE DQ  S
Sbjct  512  HDAVDAERGLSELRKLGIEQQLWEASRKEIDQPVS  546



>ref|XP_008777461.1| PREDICTED: uncharacterized protein LOC103697393 [Phoenix dactylifera]
Length=555

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 178/216 (82%), Gaps = 1/216 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++G+  +IAI+KYE+WSSLAPLP E+V+SAGQKAKEE   + +++ ER 
Sbjct  335  CWLARYWGLAVKHGLYPEIAISKYEHWSSLAPLPLEVVISAGQKAKEESSNQDEDDSERR  394

Query  717  KHVL-DLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
              +L DLSD+TGEGNIESMLSVE GL+EL SLKVED +VLALAQ RRPN  R   SD KS
Sbjct  395  NKLLRDLSDITGEGNIESMLSVEKGLRELASLKVEDTVVLALAQHRRPNLLRQLSSDFKS  454

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPK++E+ EL+ EESEDV FK+AWL Y WRRAK  GIEE+IA ++LQFWI RS + PT
Sbjct  455  PGDPKFLESFELNQEESEDVTFKQAWLVYLWRRAKVHGIEEDIAEERLQFWISRSGQPPT  514

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            SHDAVDVE+GL+ELRKLGIE +LWEASR++ +Q SS
Sbjct  515  SHDAVDVERGLIELRKLGIEQQLWEASRRDIEQASS  550



>ref|XP_002511106.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51708.1| conserved hypothetical protein [Ricinus communis]
Length=555

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 178/215 (83%), Gaps = 10/215 (5%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++GICSDIA TK+E+WS+LAPLPFE+V+SAGQKAKEE    G ++P+R 
Sbjct  336  CWLARYWALAVQHGICSDIAGTKHEHWSALAPLPFEVVISAGQKAKEESL--GGDDPDRG  393

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DLSDL+GEGNIESMLSVEMGL+EL SLKVEDA+VLALAQ RRPN        L+S 
Sbjct  394  KSVRDLSDLSGEGNIESMLSVEMGLRELASLKVEDAVVLALAQHRRPN--------LRSS  445

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPK+ EA ELS EE+EDV+FKEAWLTYFWRRAK   +E++IA ++LQFWI RS +SPTS
Sbjct  446  VDPKFTEAFELSEEEAEDVIFKEAWLTYFWRRAKMHAVEDDIAEERLQFWISRSRQSPTS  505

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVDVE+GL+ELRKL IE +LWEASR+E DQ +S
Sbjct  506  HDAVDVERGLLELRKLSIEQQLWEASRREIDQPTS  540



>ref|XP_003564988.1| PREDICTED: MAP7 domain-containing protein 1-like [Brachypodium 
distachyon]
Length=571

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 183/218 (84%), Gaps = 1/218 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YG+  +IAI+K+E+WSSLAPLP E+VLSAGQKAKEE  ++G+++ +R 
Sbjct  350  CWLARYWGLAVQYGVYPEIAISKHEHWSSLAPLPLEVVLSAGQKAKEEPRKQGEDDAQRR  409

Query  717  -KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V D+SD+ GEGNIESMLSVEMGL+EL+SLKVEDA+V+AL Q RRP+  R   SD K+
Sbjct  410  NKLVRDMSDIMGEGNIESMLSVEMGLRELSSLKVEDAVVVALGQHRRPSIVRQFTSDYKT  469

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PG+PKY+EA +LSPEE+EDV FK AWL YFWRRAK+ GIEE+IA+++LQFWIGR+A +P 
Sbjct  470  PGEPKYLEAFDLSPEEAEDVSFKHAWLIYFWRRAKSHGIEEDIADERLQFWIGRNAHAPN  529

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  247
            SHDA+DVE+GL ELRKLGIE +LWE +R + D+ +S +
Sbjct  530  SHDAIDVERGLTELRKLGIEQQLWEGTRADIDEAASAM  567



>ref|XP_008674618.1| PREDICTED: myosin heavy chain, striated muscle [Zea mays]
 tpg|DAA56001.1| TPA: hypothetical protein ZEAMMB73_352561 [Zea mays]
Length=558

 Score =   306 bits (784),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 176/214 (82%), Gaps = 0/214 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YG+  +IA++K+E+WSSLAPLP E+VLSAGQKAKEE  ++GD    R 
Sbjct  339  CWLARYWGLAVQYGVYPEIAVSKHEHWSSLAPLPLEVVLSAGQKAKEEPRKQGDNVQGRN  398

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   ++SD+ GEGNIESMLSVEMGL+EL+SLKVEDA+V+A+ Q RRP+  R   SD KSP
Sbjct  399  KLAREMSDVMGEGNIESMLSVEMGLRELSSLKVEDAVVVAVGQHRRPSIVRQFTSDFKSP  458

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PKY+EA +LSPEE+EDV FK+AWL YFWRRAK  G+EE+IA+ +LQ WIGR+A++P S
Sbjct  459  GEPKYLEAFDLSPEEAEDVSFKQAWLIYFWRRAKTHGVEEDIADDRLQLWIGRNAQAPNS  518

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HDA+DVE+GL ELRKLGIE +LWE SR + DQ S
Sbjct  519  HDAIDVERGLTELRKLGIEQQLWEGSRADIDQAS  552



>ref|XP_002321743.2| hypothetical protein POPTR_0015s11590g [Populus trichocarpa]
 ref|XP_002321744.2| hypothetical protein POPTR_0015s11590g [Populus trichocarpa]
 gb|EEF05870.2| hypothetical protein POPTR_0015s11590g [Populus trichocarpa]
 gb|EEF05871.2| hypothetical protein POPTR_0015s11590g [Populus trichocarpa]
Length=558

 Score =   305 bits (782),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 180/214 (84%), Gaps = 4/214 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+D+A++K+E+WS+LAPLPFE+V+SAGQKAKEE  + G ++ +R 
Sbjct  333  CWLARYWGLAVQHGICADVAVSKHEHWSALAPLPFEVVISAGQKAKEESDRVGRDS-DRS  391

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DLSDLTGEGNIESMLSVEMGL+EL SLKVEDA+VLALAQ    +T R + SD + P
Sbjct  392  KIVRDLSDLTGEGNIESMLSVEMGLRELASLKVEDAVVLALAQH---STVRQTFSDSRPP  448

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK+ EAIELS  E++DVLFKEAWLTY+WRRA   G+EE+IA  +LQFWI RS ++PTS
Sbjct  449  GDPKFTEAIELSEAEADDVLFKEAWLTYYWRRALVHGVEEDIAEDRLQFWISRSEQAPTS  508

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HDAVDVE+G++ELRKL IE +LWEASR+E DQ S
Sbjct  509  HDAVDVERGVVELRKLSIEQQLWEASRREIDQSS  542



>ref|XP_012090607.1| PREDICTED: coiled-coil domain-containing protein SCD2 [Jatropha 
curcas]
 gb|KDP22551.1| hypothetical protein JCGZ_26382 [Jatropha curcas]
Length=553

 Score =   304 bits (779),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 175/214 (82%), Gaps = 9/214 (4%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+D+A +K+E+WS+LAPLPFE+V+SAGQKAKEE    G ++P+R 
Sbjct  331  CWLARYWGLAVQHGICADVASSKHEHWSALAPLPFEVVISAGQKAKEESLDTGGDDPDRG  390

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DLSDLTGEGNIESMLSVEMGL+EL SLKVEDA+VLALAQ RRPN        L+S 
Sbjct  391  KLSRDLSDLTGEGNIESMLSVEMGLRELASLKVEDAVVLALAQHRRPN--------LRSV  442

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPK+ EA  LS  E+EDV+FKEAWLTYFWRRAK  G+EE+IA ++LQFWI  S +SPTS
Sbjct  443  -DPKFTEAFGLSEGEAEDVIFKEAWLTYFWRRAKVHGVEEDIAEERLQFWISHSGQSPTS  501

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HDAVDVE+GL+ELRKL IE +LWEASRKE DQ S
Sbjct  502  HDAVDVERGLLELRKLSIEQQLWEASRKEIDQPS  535



>ref|XP_008791048.1| PREDICTED: uncharacterized protein LOC103708063 [Phoenix dactylifera]
Length=551

 Score =   303 bits (775),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 177/212 (83%), Gaps = 1/212 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GI  +IA +K+E+WSSLAPLP E+V+SAGQ+AK+E   + D + ER 
Sbjct  332  CWLARYWGLAVKHGIYPEIAASKHEHWSSLAPLPLEVVISAGQRAKQEPSSQRDGDSERR  391

Query  717  -KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DLSD+TGEGN+ESMLSVE GL+EL SLK+EDA+V A+AQ RRPN AR S+SDLKS
Sbjct  392  NKLVRDLSDITGEGNVESMLSVEKGLRELASLKIEDAVVFAMAQHRRPNLARQSVSDLKS  451

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGD K+ EA ELS EE++DVLFK+AWLTYFWRRAK   +EE+IA+++L+FWIGR  + PT
Sbjct  452  PGDQKFAEAFELSEEEAQDVLFKQAWLTYFWRRAKTHVVEEDIADERLEFWIGRIGQPPT  511

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETD  265
            SHDAVDVE+GLMELRKL IE +LWEASR+E D
Sbjct  512  SHDAVDVERGLMELRKLSIEQQLWEASRREID  543



>gb|AFN54517.1| ripening-regulated protein [Fragaria x ananassa]
Length=566

 Score =   301 bits (770),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 177/221 (80%), Gaps = 6/221 (3%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWL+R W LA ++GIC+DIA +K+E+WSSLAPLP+E+++SAGQKAK+E W+K  ++P+R 
Sbjct  331  CWLSRYWALAVQHGICADIAESKHEHWSSLAPLPYEVIISAGQKAKDESWEKSGDDPDRS  390

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
                DLSDLTGEGNIESMLSVEMGL+EL SLKVEDA+ LALA+ RRP++ R S  D KS 
Sbjct  391  NR--DLSDLTGEGNIESMLSVEMGLRELASLKVEDAVALALARHRRPDSIRQSAFDSKST  448

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGR----SAE  370
            GDPK+MEA ELS EE  D+ FKEAWL YFW+RAK  G+E++IA+ +LQ WI      S +
Sbjct  449  GDPKFMEAFELSEEEINDIRFKEAWLAYFWKRAKIHGVEDDIADDRLQLWISHISRSSTQ  508

Query  369  SPTSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  247
            SPTSHDAVDVE GL+ELRKLGIE +LWEASRKE D  SS I
Sbjct  509  SPTSHDAVDVEGGLLELRKLGIEKQLWEASRKEIDHPSSDI  549



>ref|XP_004297498.1| PREDICTED: coiled-coil domain-containing protein SCD2 [Fragaria 
vesca subsp. vesca]
Length=572

 Score =   301 bits (770),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 177/221 (80%), Gaps = 6/221 (3%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWL+R W LA ++GIC+DIA +K+E+WSSLAPLP+E+++SAGQKAK+E W+K  ++P+R 
Sbjct  337  CWLSRYWALAVQHGICADIAESKHEHWSSLAPLPYEVIISAGQKAKDESWEKSGDDPDRS  396

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
                DLSDLTGEGNIESMLSVEMGL+EL SLKVEDA+ LALA+ RRP++ R S  D KS 
Sbjct  397  NR--DLSDLTGEGNIESMLSVEMGLRELASLKVEDAVALALARHRRPDSIRQSAFDSKST  454

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGR----SAE  370
            GDPK+MEA ELS EE  D+ FKEAWL YFW+RAK  G+E++IA+ +LQ WI      S +
Sbjct  455  GDPKFMEAFELSEEEINDIRFKEAWLAYFWKRAKIHGVEDDIADDRLQLWISHISRSSTQ  514

Query  369  SPTSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  247
            SPTSHDAVDVE GL+ELRKLGIE +LWEASRKE D  SS I
Sbjct  515  SPTSHDAVDVEGGLLELRKLGIEKQLWEASRKEIDHPSSDI  555



>ref|XP_010550755.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104821536 
[Tarenaya hassleriana]
Length=573

 Score =   300 bits (767),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 176/214 (82%), Gaps = 2/214 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA +++E+WS+LAPLPFE+V+SA QKAKE    KG  +  + 
Sbjct  344  CWLARYWGLAVQHGICADIAPSRHEHWSALAPLPFELVISAAQKAKELSGDKGGND--QS  401

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DLSDLTGEGNIESMLSVEMGL+EL SLKVEDA+VLA AQ+RRP++ R ++SD K  
Sbjct  402  KAARDLSDLTGEGNIESMLSVEMGLRELASLKVEDAVVLAFAQRRRPSSVRQTVSDPKGH  461

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK++EA  LS EE+EDV FK+AWL YFW RAK   +EE+IA ++LQFWI RS +SPTS
Sbjct  462  GDPKFVEAYALSDEEAEDVAFKQAWLMYFWGRAKLHNVEEDIAEERLQFWISRSGQSPTS  521

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HDAVDVE+GL+E+RKLGIE +LWEASR+E DQ S
Sbjct  522  HDAVDVERGLVEVRKLGIEQQLWEASRREIDQPS  555



>ref|XP_002871557.1| hypothetical protein ARALYDRAFT_488142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47816.1| hypothetical protein ARALYDRAFT_488142 [Arabidopsis lyrata subsp. 
lyrata]
Length=539

 Score =   297 bits (760),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 174/208 (84%), Gaps = 1/208 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLAR WGLAARYGICSDIA +KYEYWSSLAPLPFEIVLSAGQKAKEE W+K  E  E R
Sbjct  329  CWLARYWGLAARYGICSDIATSKYEYWSSLAPLPFEIVLSAGQKAKEESWEKESEENEKR  388

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             +   D++DLTGEGNIESMLSVEMGLKELTSLKVE AI   LAQ R  NT R S  +LKS
Sbjct  389  SQLAQDINDLTGEGNIESMLSVEMGLKELTSLKVEVAITTTLAQLRLANTTRLSDIELKS  448

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PG PK  EA+ELS EESEDVLFKEAWLTYFWRRA++LGIE +IA ++L+FWI RSA SP+
Sbjct  449  PGGPKITEALELSQEESEDVLFKEAWLTYFWRRAQSLGIEVDIARERLRFWISRSAHSPS  508

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASR  277
            SHDA++VEQGL ELRKL IE RLWEASR
Sbjct  509  SHDAMEVEQGLTELRKLRIERRLWEASR  536



>ref|NP_196830.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL36392.1| unknown protein [Arabidopsis thaliana]
 gb|AAM44898.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99384.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED91872.1| uncharacterized protein AT5G13260 [Arabidopsis thaliana]
Length=537

 Score =   295 bits (755),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 174/208 (84%), Gaps = 1/208 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLAR WGLA+RYGICSDIA +KYEYWSSLAPLPFEIVLSAGQKAKEE W+K  E  E R
Sbjct  327  CWLARYWGLASRYGICSDIATSKYEYWSSLAPLPFEIVLSAGQKAKEESWEKESEENEKR  386

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             + V D++DLTGEGNIESMLSVEMGLKELTSLKVE AI + LAQ R  NT R S  +LKS
Sbjct  387  SQLVQDINDLTGEGNIESMLSVEMGLKELTSLKVEVAITITLAQLRLANTTRLSDIELKS  446

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PG PK  E +ELS EESEDVLFKEAWLTYFWRRA++LGIE + A ++L+FWI RSA SP+
Sbjct  447  PGGPKITETLELSQEESEDVLFKEAWLTYFWRRAQSLGIEVDTARERLRFWISRSAHSPS  506

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASR  277
            SHDA++VEQGL ELRKL IE RLWEASR
Sbjct  507  SHDAMEVEQGLTELRKLRIERRLWEASR  534



>ref|XP_006405440.1| hypothetical protein EUTSA_v10028083mg [Eutrema salsugineum]
 gb|ESQ46893.1| hypothetical protein EUTSA_v10028083mg [Eutrema salsugineum]
Length=306

 Score =   287 bits (735),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 169/207 (82%), Gaps = 12/207 (6%)
 Frame = -3

Query  894  WLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQK-GDENPERV  718
            WLAR WGLAARYGICSDIA +KYEYWSSLAPLPFEIVLSAGQKAKEE W+K  +EN +R 
Sbjct  110  WLARYWGLAARYGICSDIATSKYEYWSSLAPLPFEIVLSAGQKAKEESWEKDSEENEKRS  169

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            + V D+++LTGEGNIESMLSVEMGLKELTSLK+           R  NT R S  +LKSP
Sbjct  170  QLVQDINNLTGEGNIESMLSVEMGLKELTSLKL-----------RLANTVRLSDPELKSP  218

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G PK +EA+ELSPE+SEDV FKEAWLTYFWRRA +LGI+ +IA ++L+FWI RSA SP+S
Sbjct  219  GGPKLVEALELSPEDSEDVHFKEAWLTYFWRRALSLGIDVDIARERLRFWISRSAHSPSS  278

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASR  277
            HDA++VEQGL ELRK  IE RLWEASR
Sbjct  279  HDAMEVEQGLTELRKRRIERRLWEASR  305



>gb|EPS59084.1| hypothetical protein M569_15727, partial [Genlisea aurea]
Length=561

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 171/210 (81%), Gaps = 3/210 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWL+R WGLAA YGIC+D++++K+E+WSS APLPFE+V SAGQKA+EE W  G + P++ 
Sbjct  333  CWLSRYWGLAAHYGICADVSVSKHEHWSSFAPLPFEVVTSAGQKAQEETWDAGGDGPDKS  392

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DL+D+ GEGNIE+MLSVEMGLKEL SLK+EDA+++AL Q RR    R S  D KS 
Sbjct  393  KR--DLNDIVGEGNIETMLSVEMGLKELASLKIEDAVLVALYQDRRSTLIRHSFPDPKSS  450

Query  537  -GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
             GD K+++A  L+ EE EDVLFKEAWLTYFWRRAK  G+EE++A  +LQ W+GRS ++PT
Sbjct  451  SGDHKFLDAFALTQEEIEDVLFKEAWLTYFWRRAKVHGVEEDVAEDRLQLWVGRSGQTPT  510

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKE  271
            SHDAVDVE+GL+ELRKLGIE +LWEASRKE
Sbjct  511  SHDAVDVERGLIELRKLGIEQQLWEASRKE  540



>emb|CDM85875.1| unnamed protein product [Triticum aestivum]
Length=572

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 178/217 (82%), Gaps = 2/217 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKA-KEECWQKGDENPER  721
            CWLAR WGLA +YG+  +IA++K+E+WSSLAPLP E+VLSAGQKA KEE  ++G+++ +R
Sbjct  350  CWLARYWGLAVQYGVYPEIAVSKHEHWSSLAPLPLEVVLSAGQKAIKEEPRKQGEDDAQR  409

Query  720  VKH-VLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLK  544
                V ++SD+ GEGNIESMLSVEMGL+EL+SLKVEDA+V+AL Q RRP+  R   SD K
Sbjct  410  RNRLVREMSDVMGEGNIESMLSVEMGLRELSSLKVEDAVVVALGQHRRPSIVRQFTSDYK  469

Query  543  SPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESP  364
            SPG+PK++EA +LS EE+EDV FK AWL YFWRRAK  GIEE+IA+++LQFWI R+A +P
Sbjct  470  SPGEPKFLEAFDLSNEEAEDVSFKHAWLIYFWRRAKTHGIEEDIADERLQFWIARNAVAP  529

Query  363  TSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
             SHDA+DVE+GL ELRKLGIE +LWE +R + D+ +S
Sbjct  530  NSHDAIDVERGLTELRKLGIEQQLWEGTRADIDEAAS  566



>dbj|BAJ93558.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=571

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 178/217 (82%), Gaps = 2/217 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKA-KEECWQKGDENPER  721
            CWLAR WGLA +YG+  +IA++K+E+WSSLAPLP E+VLSAGQKA KEE  ++G+++ +R
Sbjct  349  CWLARYWGLAVQYGVYPEIAVSKHEHWSSLAPLPLEVVLSAGQKAIKEEPRKQGEDDAQR  408

Query  720  VKH-VLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLK  544
                V ++SD+ GEGNIESMLSVEMGL+EL+SLKVEDA+V+AL Q RRP+  R   SD K
Sbjct  409  RNRLVREMSDVMGEGNIESMLSVEMGLRELSSLKVEDAVVVALGQHRRPSIVRQFTSDYK  468

Query  543  SPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESP  364
            SPG+PK++EA +LS EE+EDV FK AWL YFWRRAK  GIEE+IA+++LQFWI R+A +P
Sbjct  469  SPGEPKFLEAFDLSNEEAEDVSFKHAWLIYFWRRAKTHGIEEDIADERLQFWIARNAVAP  528

Query  363  TSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
             SHDA+DVE+GL ELRKLGIE +LWE +R + D+ +S
Sbjct  529  NSHDAIDVERGLTELRKLGIEQQLWEGTRADIDEAAS  565



>ref|XP_010929655.1| PREDICTED: protein Hook homolog 2-like isoform X2 [Elaeis guineensis]
Length=545

 Score =   290 bits (742),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 173/217 (80%), Gaps = 1/217 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA  +GI  +IA +K+E+WSSLAPLP E+V+SAGQKAKE+   + D + ER 
Sbjct  322  CWLARYWGLAVMHGIYPEIAASKHEHWSSLAPLPLEVVISAGQKAKEKPSSQCDGDSERR  381

Query  717  -KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DLSD+TGEGN+ESMLSVE GL+EL SLK+EDA+V A+AQ RRPN  R S SDLKS
Sbjct  382  NKLVRDLSDITGEGNVESMLSVEKGLRELASLKIEDAVVFAMAQYRRPNLPRQSASDLKS  441

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            P D K+ EA ELS EE++DVLFK+AWLTYFWRRA    +EE+IA+++LQFWIGR  + PT
Sbjct  442  PDDQKFTEAFELSEEEAQDVLFKQAWLTYFWRRANTHVVEEDIADERLQFWIGRIGQPPT  501

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  250
            SHD VDVE+GLMEL+KL IE +LWEASR+E D +  L
Sbjct  502  SHDVVDVERGLMELKKLSIELQLWEASRREIDVNQKL  538



>ref|XP_010929654.1| PREDICTED: protein Hook homolog 2-like isoform X1 [Elaeis guineensis]
Length=559

 Score =   291 bits (744),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 173/217 (80%), Gaps = 1/217 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA  +GI  +IA +K+E+WSSLAPLP E+V+SAGQKAKE+   + D + ER 
Sbjct  336  CWLARYWGLAVMHGIYPEIAASKHEHWSSLAPLPLEVVISAGQKAKEKPSSQCDGDSERR  395

Query  717  -KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DLSD+TGEGN+ESMLSVE GL+EL SLK+EDA+V A+AQ RRPN  R S SDLKS
Sbjct  396  NKLVRDLSDITGEGNVESMLSVEKGLRELASLKIEDAVVFAMAQYRRPNLPRQSASDLKS  455

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            P D K+ EA ELS EE++DVLFK+AWLTYFWRRA    +EE+IA+++LQFWIGR  + PT
Sbjct  456  PDDQKFTEAFELSEEEAQDVLFKQAWLTYFWRRANTHVVEEDIADERLQFWIGRIGQPPT  515

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  250
            SHD VDVE+GLMEL+KL IE +LWEASR+E D +  L
Sbjct  516  SHDVVDVERGLMELKKLSIELQLWEASRREIDVNQKL  552



>ref|XP_010545937.1| PREDICTED: uncharacterized protein LOC104818173 isoform X3 [Tarenaya 
hassleriana]
Length=425

 Score =   284 bits (727),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 170/212 (80%), Gaps = 2/212 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA +++E+WS+LAPLPFE+V+SA QKAKE    KG     R 
Sbjct  129  CWLARYWGLAVQHGICADIAPSRHEHWSALAPLPFELVISAAQKAKELSQNKGGSG--RS  186

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DLSDLTGEGNIESMLSVEMGL+EL SLK+EDA+VLA AQ+RRP+  R ++SD K  
Sbjct  187  KTARDLSDLTGEGNIESMLSVEMGLRELASLKIEDAVVLAFAQRRRPSLIRQTVSDPKGH  246

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK+++  ELS EE+EDV FK+AWL Y W RAK  G+EE+I++++L FWIGR  +SP+S
Sbjct  247  GDPKFVDGYELSEEEAEDVAFKQAWLMYLWGRAKLYGVEEDISDERLHFWIGRCGQSPSS  306

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
             DAVDVE+G+ ELRKLG+E  LWEASR+E DQ
Sbjct  307  QDAVDVERGMEELRKLGMEKLLWEASRREMDQ  338



>ref|XP_010066446.1| PREDICTED: dynactin subunit 1 isoform X3 [Eucalyptus grandis]
Length=516

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 154/210 (73%), Gaps = 39/210 (19%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YG                                       D+NPER 
Sbjct  344  CWLARYWGLAVKYG---------------------------------------DDNPERS  364

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DLSDLTGEGNIESMLSVEMGLKEL SLKVE+AIVLALAQQRRPN+ R S SDLKSP
Sbjct  365  KIAHDLSDLTGEGNIESMLSVEMGLKELASLKVEEAIVLALAQQRRPNSTRISASDLKSP  424

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIE E A ++LQFWI RSA SPTS
Sbjct  425  GDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEVETAKERLQFWINRSAHSPTS  484

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKET  268
            HDAVDVEQGLMELRKLGIEHRLWEASRKET
Sbjct  485  HDAVDVEQGLMELRKLGIEHRLWEASRKET  514



>ref|XP_010545934.1| PREDICTED: uncharacterized protein LOC104818173 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010545935.1| PREDICTED: uncharacterized protein LOC104818173 isoform X2 [Tarenaya 
hassleriana]
Length=506

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 170/212 (80%), Gaps = 2/212 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA +++E+WS+LAPLPFE+V+SA QKAKE    KG     R 
Sbjct  210  CWLARYWGLAVQHGICADIAPSRHEHWSALAPLPFELVISAAQKAKELSQNKGGSG--RS  267

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DLSDLTGEGNIESMLSVEMGL+EL SLK+EDA+VLA AQ+RRP+  R ++SD K  
Sbjct  268  KTARDLSDLTGEGNIESMLSVEMGLRELASLKIEDAVVLAFAQRRRPSLIRQTVSDPKGH  327

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK+++  ELS EE+EDV FK+AWL Y W RAK  G+EE+I++++L FWIGR  +SP+S
Sbjct  328  GDPKFVDGYELSEEEAEDVAFKQAWLMYLWGRAKLYGVEEDISDERLHFWIGRCGQSPSS  387

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
             DAVDVE+G+ ELRKLG+E  LWEASR+E DQ
Sbjct  388  QDAVDVERGMEELRKLGMEKLLWEASRREMDQ  419



>ref|XP_010545933.1| PREDICTED: uncharacterized protein LOC104818173 isoform X1 [Tarenaya 
hassleriana]
Length=512

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 170/212 (80%), Gaps = 2/212 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA +++E+WS+LAPLPFE+V+SA QKAKE    KG     R 
Sbjct  216  CWLARYWGLAVQHGICADIAPSRHEHWSALAPLPFELVISAAQKAKELSQNKGGSG--RS  273

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DLSDLTGEGNIESMLSVEMGL+EL SLK+EDA+VLA AQ+RRP+  R ++SD K  
Sbjct  274  KTARDLSDLTGEGNIESMLSVEMGLRELASLKIEDAVVLAFAQRRRPSLIRQTVSDPKGH  333

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK+++  ELS EE+EDV FK+AWL Y W RAK  G+EE+I++++L FWIGR  +SP+S
Sbjct  334  GDPKFVDGYELSEEEAEDVAFKQAWLMYLWGRAKLYGVEEDISDERLHFWIGRCGQSPSS  393

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
             DAVDVE+G+ ELRKLG+E  LWEASR+E DQ
Sbjct  394  QDAVDVERGMEELRKLGMEKLLWEASRREMDQ  425



>emb|CDY64711.1| BnaA06g38700D [Brassica napus]
Length=292

 Score =   275 bits (702),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 170/218 (78%), Gaps = 6/218 (3%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDE-----  733
            CWLAR WGLA +Y I +DIA++++E+WSSLAPLPFE+V SA QKAK+  W KG       
Sbjct  58   CWLARYWGLAVQYDIFADIALSRHEHWSSLAPLPFELVTSAAQKAKDLSWDKGSSKFRFS  117

Query  732  NPERVKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSIS  553
              +R +   DLSDLTGEGNIESMLSVEMGL+EL SLKVEDAIVLA AQQR+P+  R ++S
Sbjct  118  GNDRNRAARDLSDLTGEGNIESMLSVEMGLRELASLKVEDAIVLAFAQQRKPSLIRQTVS  177

Query  552  DLKSPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-  376
            D K  G+ ++++A EL   E EDV FK+AWL YFW RAK LG+EE+IA +++Q WI RS 
Sbjct  178  DHKGHGESRFVDAYELGEAEQEDVAFKQAWLMYFWGRAKLLGVEEDIAEERVQLWISRSN  237

Query  375  AESPTSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
             +S TSHD++DVE+GL+ELRKLGIE +LWEASR+E DQ
Sbjct  238  GKSTTSHDSLDVERGLIELRKLGIEQQLWEASRREIDQ  275



>ref|XP_008790703.1| PREDICTED: uncharacterized protein LOC103707818 isoform X1 [Phoenix 
dactylifera]
Length=554

 Score =   283 bits (723),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 172/216 (80%), Gaps = 1/216 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKG-DENPER  721
            CWLA  WGLA ++GI  +I+ +KYE+WSSLAPLP E+V+SAGQKAKEE   +G D+   R
Sbjct  332  CWLAWYWGLAVKHGIYPEISSSKYEHWSSLAPLPLEVVISAGQKAKEELLNRGEDDFGGR  391

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DLSD TGEGNIESML VE GL+EL  LKVEDA++LALAQ RRP++ R   SD KS
Sbjct  392  NKLVGDLSDKTGEGNIESMLLVEKGLRELAFLKVEDAVMLALAQHRRPSSLRQLSSDFKS  451

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPK +E+ EL+ EES+DV FK+AWL YFWRRAK  GI+E+IA ++LQFWI RS +  T
Sbjct  452  PGDPKLLESFELNQEESQDVTFKQAWLVYFWRRAKVHGIKEDIAEERLQFWISRSGQPQT  511

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            SH+AVDVE+GL+ELRKLGIE  LWEASR++ +Q SS
Sbjct  512  SHEAVDVERGLIELRKLGIEQHLWEASRRDIEQASS  547



>ref|XP_009415853.1| PREDICTED: uncharacterized protein LOC103996631 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=531

 Score =   281 bits (720),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 165/212 (78%), Gaps = 2/212 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA  +GI  +IA  K+EYWSS APLP E+V SAGQK K++ W  G ++ +R 
Sbjct  309  CWLARYWALAVHHGIYPEIAAAKHEYWSSFAPLPLEVVSSAGQKTKDDSWSTGYDDTDRR  368

Query  717  KHV-LDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
              +  D+SD+T EGNIE+ML+VE GL+EL SLKVEDAI+L LAQ RRPN  R S SDL+S
Sbjct  369  NQLDRDISDITAEGNIENMLAVEKGLRELASLKVEDAIMLVLAQHRRPNLIRQSASDLRS  428

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPK+ E  ELS EE+EDVLFK++WLTYFWRRAK  GIEE+IA + L+FWIGR  + PT
Sbjct  429  PGDPKWDE-FELSQEEAEDVLFKQSWLTYFWRRAKTHGIEEDIAEEHLRFWIGRMGQPPT  487

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETD  265
            SHD VDVE+GL+ELRKLGIE +LWEA R E D
Sbjct  488  SHDVVDVERGLIELRKLGIEQQLWEACRMEFD  519



>ref|XP_009415852.1| PREDICTED: uncharacterized protein LOC103996631 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=538

 Score =   281 bits (719),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 165/212 (78%), Gaps = 2/212 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA  +GI  +IA  K+EYWSS APLP E+V SAGQK K++ W  G ++ +R 
Sbjct  316  CWLARYWALAVHHGIYPEIAAAKHEYWSSFAPLPLEVVSSAGQKTKDDSWSTGYDDTDRR  375

Query  717  KHV-LDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
              +  D+SD+T EGNIE+ML+VE GL+EL SLKVEDAI+L LAQ RRPN  R S SDL+S
Sbjct  376  NQLDRDISDITAEGNIENMLAVEKGLRELASLKVEDAIMLVLAQHRRPNLIRQSASDLRS  435

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPK+ E  ELS EE+EDVLFK++WLTYFWRRAK  GIEE+IA + L+FWIGR  + PT
Sbjct  436  PGDPKWDE-FELSQEEAEDVLFKQSWLTYFWRRAKTHGIEEDIAEEHLRFWIGRMGQPPT  494

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETD  265
            SHD VDVE+GL+ELRKLGIE +LWEA R E D
Sbjct  495  SHDVVDVERGLIELRKLGIEQQLWEACRMEFD  526



>ref|XP_009415851.1| PREDICTED: uncharacterized protein LOC103996631 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=555

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 166/214 (78%), Gaps = 2/214 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA  +GI  +IA  K+EYWSS APLP E+V SAGQK K++ W  G ++ +R 
Sbjct  333  CWLARYWALAVHHGIYPEIAAAKHEYWSSFAPLPLEVVSSAGQKTKDDSWSTGYDDTDRR  392

Query  717  KHV-LDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
              +  D+SD+T EGNIE+ML+VE GL+EL SLKVEDAI+L LAQ RRPN  R S SDL+S
Sbjct  393  NQLDRDISDITAEGNIENMLAVEKGLRELASLKVEDAIMLVLAQHRRPNLIRQSASDLRS  452

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPK+ E  ELS EE+EDVLFK++WLTYFWRRAK  GIEE+IA + L+FWIGR  + PT
Sbjct  453  PGDPKWDE-FELSQEEAEDVLFKQSWLTYFWRRAKTHGIEEDIAEEHLRFWIGRMGQPPT  511

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQD  259
            SHD VDVE+GL+ELRKLGIE +LWEA R E D +
Sbjct  512  SHDVVDVERGLIELRKLGIEQQLWEACRMEFDAN  545



>gb|KFK34186.1| hypothetical protein AALP_AA5G111700 [Arabis alpina]
Length=581

 Score =   281 bits (719),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 170/213 (80%), Gaps = 3/213 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YGIC+DIA +++E WS LAPLPFE+V SA QKAK+  W KG  +  R 
Sbjct  354  CWLARYWGLAVQYGICADIAASRHELWSKLAPLPFELVTSAAQKAKDLSWDKGGND--RS  411

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DL+DLTGEGNIESMLSVEMGL+EL+SLKVEDA+VLA AQQR+P+  R ++SD K  
Sbjct  412  KATRDLNDLTGEGNIESMLSVEMGLRELSSLKVEDAVVLAFAQQRKPSLIRQTVSDSKGH  471

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSA-ESPT  361
            G+ ++++A EL   E EDV FK+AWL YFW RAK  G+EE+IA +++Q WI RS+ +S T
Sbjct  472  GESRFIDAYELGEAEQEDVAFKQAWLMYFWGRAKLHGVEEDIAEERVQLWISRSSGKSAT  531

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            SHD++DVE+GL+ELRKLGIE +LWEASR+E DQ
Sbjct  532  SHDSLDVERGLIELRKLGIEQQLWEASRREIDQ  564



>ref|XP_010678340.1| PREDICTED: myosin heavy chain, non-muscle [Beta vulgaris subsp. 
vulgaris]
Length=567

 Score =   280 bits (717),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 166/215 (77%), Gaps = 5/215 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPER-  721
            CWLAR WGLA +YGIC+DIA +KYE+WS  APLPFE+V+SAGQKAKE+   K + N  R 
Sbjct  339  CWLARYWGLAVQYGICADIAGSKYEHWSRYAPLPFEVVISAGQKAKEDSLNKDESNSSRW  398

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K   D SD + EGNIE+MLSVEMGL+E+ SLK+EDA+ L++AQ+RRPN  R    D K 
Sbjct  399  SKSGRDTSDHSAEGNIETMLSVEMGLREMASLKIEDAVALSMAQKRRPNLVR----DFKV  454

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
             GDPK+ME+ ELS EES+DVLFKEAWLTYFW+RA+   +EE+IA +QLQ W  RS +SP 
Sbjct  455  AGDPKFMESFELSQEESDDVLFKEAWLTYFWKRARDHQVEEDIAEEQLQLWTSRSGQSPA  514

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
              DAVDVE+GL+ELRKLG+E +LWE SRKE +  S
Sbjct  515  LQDAVDVERGLIELRKLGLEQQLWETSRKEIENYS  549



>emb|CDP18972.1| unnamed protein product [Coffea canephora]
Length=199

 Score =   266 bits (680),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = -3

Query  738  DENPERVKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTS  559
            D NPER K V D +DLTGEG IESMLSVEMGLKEL SLKVEDAI+LALAQQRRPN++R S
Sbjct  20   DSNPERGKLVQDFNDLTGEGYIESMLSVEMGLKELASLKVEDAIILALAQQRRPNSSRIS  79

Query  558  ISDLKSPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGR  379
            +SD+KSPGDPK+ EA ELSPEESEDVLFKEAWLTYFWRRAK+ GIEEEIANK++QFWI R
Sbjct  80   VSDIKSPGDPKFTEASELSPEESEDVLFKEAWLTYFWRRAKSHGIEEEIANKRVQFWISR  139

Query  378  SAESPTSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQD  259
            S  SPTSHD VDVEQGLMELRKL IE RLWEASRKE D +
Sbjct  140  SVHSPTSHDVVDVEQGLMELRKLDIEQRLWEASRKEIDHN  179



>ref|XP_009149792.1| PREDICTED: uncharacterized protein LOC103873113 [Brassica rapa]
Length=575

 Score =   278 bits (710),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 170/213 (80%), Gaps = 3/213 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +Y I +DIA++++E+WS+LAPLPFE+V SA QKAK+  W KG    +R 
Sbjct  348  CWLARYWGLAVQYDIFADIALSRHEHWSALAPLPFELVTSAAQKAKDLSWDKGGN--DRN  405

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            +   DLSDLTGEGNIESMLSVEMGL+EL SLKVEDAIVLA AQQR+P+  R ++SD K  
Sbjct  406  RAARDLSDLTGEGNIESMLSVEMGLRELASLKVEDAIVLAFAQQRKPSLIRQTVSDHKGH  465

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPT  361
            G+ ++++A EL   E EDV FK+AWL YFW RAK LG+EE+IA +++Q WI RS  +S T
Sbjct  466  GESRFVDAYELGEAEQEDVAFKQAWLMYFWGRAKLLGVEEDIAEERVQLWISRSNGKSTT  525

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            SHD++DVE+GL+ELRKLGIE +LWEASR+E DQ
Sbjct  526  SHDSLDVERGLIELRKLGIEQQLWEASRREIDQ  558



>emb|CAN81746.1| hypothetical protein VITISV_038195 [Vitis vinifera]
Length=516

 Score =   275 bits (704),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 159/216 (74%), Gaps = 40/216 (19%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPE-R  721
            CWLAR WGLAAR+G                                       +++PE R
Sbjct  330  CWLARYWGLAARHG---------------------------------------EDDPETR  350

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DL+DLTG+GNIESMLSVEMGLKEL SLKVE+AIVLALAQ RRPN+AR S SDLKS
Sbjct  351  SKLVQDLNDLTGDGNIESMLSVEMGLKELASLKVEEAIVLALAQLRRPNSARLSSSDLKS  410

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            PGDPKYMEA ELS EESEDVLFKEAWLTYFWRRAKA GIEE+IA ++LQFWI RS  +PT
Sbjct  411  PGDPKYMEAFELSTEESEDVLFKEAWLTYFWRRAKAHGIEEDIAKERLQFWISRSGHAPT  470

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            SHDAVDVEQGLMELRKLGIEH LWEASRKE D+DSS
Sbjct  471  SHDAVDVEQGLMELRKLGIEHWLWEASRKEIDEDSS  506



>ref|XP_010531859.1| PREDICTED: uncharacterized protein LOC104808047 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010531860.1| PREDICTED: uncharacterized protein LOC104808047 isoform X2 [Tarenaya 
hassleriana]
Length=538

 Score =   275 bits (702),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 166/209 (79%), Gaps = 1/209 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YGIC DIA +++EYWS+LAPLPFE+VLSA QK+ E+ WQ G  +    
Sbjct  315  CWLARYWGLAFQYGICDDIATSRHEYWSALAPLPFEVVLSAAQKS-EDSWQPGSNDRAWS  373

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V +L+D  GEGNIESMLSVE+ L+EL SLKVEDA ++A AQ+R  N  R +I+D +  
Sbjct  374  KVVRNLTDANGEGNIESMLSVEVALRELASLKVEDAAMVAFAQKRLTNLIRRTITDPRMQ  433

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GD K++EA ELS EE++DVLFKEAWL YFW+RAKA G+E +IA ++LQFWI R  + P S
Sbjct  434  GDSKFVEAFELSEEEAQDVLFKEAWLMYFWKRAKAHGVESDIAEERLQFWINRIGQPPMS  493

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKE  271
            HDAVDVE+G++ELRKLGIE +LWEASR+E
Sbjct  494  HDAVDVERGMVELRKLGIEQQLWEASRRE  522



>emb|CDY05877.1| BnaC08g20540D [Brassica napus]
Length=567

 Score =   275 bits (704),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 170/218 (78%), Gaps = 6/218 (3%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDE-----  733
            CWLAR WGLA +Y I +DIA++++E+WS+LAPLPFE+V SA QKAK+  W KG       
Sbjct  333  CWLARYWGLAVQYDIFADIALSRHEHWSALAPLPFELVTSAAQKAKDLSWDKGSSKFCFS  392

Query  732  NPERVKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSIS  553
              +R +   DLSDLTGEGNIESMLSVEMGL+EL SLKVEDAIVLA AQQR+P+  R ++S
Sbjct  393  GNDRNRAARDLSDLTGEGNIESMLSVEMGLRELASLKVEDAIVLAFAQQRKPSLIRQTVS  452

Query  552  DLKSPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-  376
            D K  G+ ++++A EL   E EDV FK+AWL YFW RAK LG+EE+IA +++Q WI RS 
Sbjct  453  DHKGHGESRFVDAYELGEAEQEDVAFKQAWLMYFWGRAKLLGVEEDIAEERVQLWISRSN  512

Query  375  AESPTSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
             +S TSHD++DVE+GL+ELRKLGIE +LWEASR+E DQ
Sbjct  513  GKSTTSHDSLDVERGLIELRKLGIEQQLWEASRREIDQ  550



>ref|XP_007222390.1| hypothetical protein PRUPE_ppa004878mg [Prunus persica]
 gb|EMJ23589.1| hypothetical protein PRUPE_ppa004878mg [Prunus persica]
Length=487

 Score =   273 bits (698),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 155/215 (72%), Gaps = 38/215 (18%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLAA +G                                       D+  +R 
Sbjct  301  CWLARNWGLAAMHGY--------------------------------------DDLEKRN  322

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DL+DLTGEGNIESML+VEMGLKEL SLKVE+AIVLALAQQRRPN++R S SD+KSP
Sbjct  323  KLVQDLNDLTGEGNIESMLAVEMGLKELASLKVEEAIVLALAQQRRPNSSRLSFSDIKSP  382

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPK+MEAIELSPEESEDVLFKEAWLTYFWRRAK  GIEEEIA +++QFWI RS  SPTS
Sbjct  383  ADPKFMEAIELSPEESEDVLFKEAWLTYFWRRAKVHGIEEEIAKERVQFWINRSRHSPTS  442

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVDVE+GLMELRKLGIEHRLWE SRK  DQD S
Sbjct  443  HDAVDVEEGLMELRKLGIEHRLWEESRKAIDQDPS  477



>ref|XP_006404211.1| hypothetical protein EUTSA_v10010238mg [Eutrema salsugineum]
 gb|ESQ45664.1| hypothetical protein EUTSA_v10010238mg [Eutrema salsugineum]
Length=579

 Score =   273 bits (698),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 166/213 (78%), Gaps = 3/213 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++GIC+DIA +++E+WS+LAPLPFE+V SA QKAKE    KG  +  R 
Sbjct  352  CWLARYWDLAVQHGICADIAPSRHEHWSALAPLPFELVTSAAQKAKELSSDKGGND--RS  409

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DL+DLTGEGNIESMLSVEMGL+EL SLKVEDAI+LA AQQR+P+  R + SD K  
Sbjct  410  KAARDLNDLTGEGNIESMLSVEMGLRELASLKVEDAIMLAFAQQRKPSLIRHTASDSKGH  469

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPT  361
            G+ ++++A EL   E EDV FK+AWL YFW RAK  G+EE+IA ++ Q WI RS  +SPT
Sbjct  470  GESRFIDAYELGEAEQEDVTFKQAWLLYFWSRAKLHGVEEDIAEERFQLWISRSNGKSPT  529

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            SHD++DVE+GL ELRKLGIE +LWEASR+E DQ
Sbjct  530  SHDSLDVERGLTELRKLGIEQQLWEASRREIDQ  562



>ref|XP_010426384.1| PREDICTED: uncharacterized protein LOC104711382 [Camelina sativa]
Length=574

 Score =   272 bits (696),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 167/214 (78%), Gaps = 4/214 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++GIC+DIA +++E+WS+LAPLPFE+V SA QKAKE  W KG  +  R 
Sbjct  348  CWLARYWDLAVQHGICADIAPSRHEHWSALAPLPFELVTSAAQKAKELSWDKGGND--RS  405

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DLSDLTGEGNIESMLSVEMGL+EL SLKVEDA+VLA AQQR+ +  R ++SD K  
Sbjct  406  KVARDLSDLTGEGNIESMLSVEMGLRELASLKVEDAVVLAFAQQRKLSLVRQTVSDSKGH  465

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSA--ESP  364
            G+ ++++A EL   E EDV FK+AWL YFW RAK  G+EE+IA +++Q WI RS+     
Sbjct  466  GESRFIDAYELGEAEQEDVAFKQAWLMYFWGRAKLHGVEEDIAEERVQLWISRSSGKSQT  525

Query  363  TSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            TSHDA+DVE+GL+ELRKLGIE +LWEASR+E DQ
Sbjct  526  TSHDALDVERGLIELRKLGIEQQLWEASRREIDQ  559



>ref|XP_006292226.1| hypothetical protein CARUB_v10018432mg [Capsella rubella]
 gb|EOA25124.1| hypothetical protein CARUB_v10018432mg [Capsella rubella]
Length=574

 Score =   272 bits (696),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 167/214 (78%), Gaps = 4/214 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++GIC+DIA +++E+WS+LAPLPFE+V SA QKAKE  W KG  +  R 
Sbjct  348  CWLARYWDLAVQHGICADIAPSRHEHWSALAPLPFELVTSAAQKAKELSWDKGRND--RS  405

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DLSDLTGEGNIESMLSVEMGL+EL SLKVEDA+VLA AQQR+ +  R ++SD K  
Sbjct  406  KVARDLSDLTGEGNIESMLSVEMGLRELASLKVEDAVVLAFAQQRKLSLVRQTVSDSKGH  465

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSA--ESP  364
            G+ ++++A EL   E EDV FK+AWL YFW RAK  G+EE+IA +++Q WI RS+     
Sbjct  466  GESRFIDAYELGEAEQEDVAFKQAWLMYFWGRAKLHGVEEDIAEERVQLWISRSSGKSQT  525

Query  363  TSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            TSHDA+DVE+GL+ELRKLGIE +LWEASR+E DQ
Sbjct  526  TSHDALDVERGLIELRKLGIEQQLWEASRREIDQ  559



>ref|XP_009623175.1| PREDICTED: uncharacterized protein LOC104114427 isoform X2 [Nicotiana 
tomentosiformis]
Length=407

 Score =   267 bits (683),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 152/185 (82%), Gaps = 2/185 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWL+R WGLA  YGIC+DIA  K+E+WSS APLPFE+V+SAGQKA+EE W  GD++ +R 
Sbjct  215  CWLSRYWGLAVHYGICADIAGAKHEHWSSFAPLPFEVVISAGQKAREESWSGGDDS-DRS  273

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V D+SDL+GEGNIESMLSVEM L+EL SLKVEDA++LALAQ RR N  R S SD KS 
Sbjct  274  KRVRDISDLSGEGNIESMLSVEMALRELASLKVEDAVILALAQPRRSNVVRQS-SDPKSS  332

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPK M+A ELS EESEDVLFKEAWLTYFWRRAK   +EE+IA ++LQFWI RS ++PT+
Sbjct  333  VDPKLMDAYELSQEESEDVLFKEAWLTYFWRRAKVHCVEEDIAEERLQFWISRSGQTPTT  392

Query  357  HDAVD  343
            HDAVD
Sbjct  393  HDAVD  397



>ref|XP_010503527.1| PREDICTED: uncharacterized protein LOC104780707 isoform X1 [Camelina 
sativa]
Length=574

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 166/214 (78%), Gaps = 4/214 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++GIC+DIA +++E+WS+LAPLPFE+V SA QKAKE  W KG     R 
Sbjct  348  CWLARYWDLAVQHGICADIAPSRHEHWSALAPLPFELVTSAAQKAKELSWDKGGNG--RS  405

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DLSDLTGEGNIESMLSVEMGL+EL SLKVEDA+VLA AQQR+ +  R ++SD K  
Sbjct  406  KVARDLSDLTGEGNIESMLSVEMGLRELASLKVEDAVVLAFAQQRKLSLVRQTVSDSKGH  465

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSA--ESP  364
            G+ ++++A EL   E EDV FK+AWL YFW RAK  G+EE+IA +++Q WI RS+     
Sbjct  466  GESRFIDAYELGEAEQEDVAFKQAWLMYFWGRAKLHGVEEDIAEERVQLWISRSSGKSQT  525

Query  363  TSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            TSHDA+DVE+GL+ELRKLGIE +LWEASR+E DQ
Sbjct  526  TSHDALDVERGLIELRKLGIEQQLWEASRREIDQ  559



>ref|XP_011627464.1| PREDICTED: coiled-coil domain-containing protein SCD2 [Amborella 
trichopoda]
Length=542

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 171/217 (79%), Gaps = 3/217 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W L+ R+GI +DIA  K+EYWSSLAPLPFE+V++AGQ+AK+E W+  D+   R 
Sbjct  319  CWLARYWSLSVRHGIHADIAGPKHEYWSSLAPLPFEVVIAAGQRAKDEPWKADDDLERRA  378

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTART--SISDLK  544
            +   D++DL GEGNIE+ML VE G++EL SLKVEDA+VLA +Q RRP+  R   SISD K
Sbjct  379  EISRDINDLMGEGNIENMLLVEKGMRELASLKVEDAVVLATSQHRRPSLVRVGQSISDQK  438

Query  543  SPGDPKYM-EAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAES  367
             P D + + EA ELS EE EDVLFK+AWLTYFW+RAK  G+EE+IA+++LQFWI  S ++
Sbjct  439  LPIDGQNLVEAFELSQEEYEDVLFKQAWLTYFWKRAKNHGLEEDIADERLQFWISHSTQT  498

Query  366  PTSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            PTSHD VDVE+GL+ELRKL IE +LWEASRK+ + +S
Sbjct  499  PTSHDVVDVERGLIELRKLSIETQLWEASRKDINPES  535



>ref|XP_010503528.1| PREDICTED: uncharacterized protein LOC104780707 isoform X2 [Camelina 
sativa]
Length=574

 Score =   271 bits (694),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 166/214 (78%), Gaps = 4/214 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++GIC+DIA +++E+WS+LAPLPFE+V SA QKAKE  W KG     R 
Sbjct  348  CWLARYWDLAVQHGICADIAPSRHEHWSALAPLPFELVTSAAQKAKELSWDKGGNG--RS  405

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DLSDLTGEGNIESMLSVEMGL+EL SLKVEDA+VLA AQQR+ +  R ++SD K  
Sbjct  406  KVARDLSDLTGEGNIESMLSVEMGLRELASLKVEDAVVLAFAQQRKLSLVRQTVSDSKGH  465

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSA--ESP  364
            G+ ++++A EL   E EDV FK+AWL YFW RAK  G+EE+IA +++Q WI RS+     
Sbjct  466  GESRFIDAYELGEAEQEDVAFKQAWLMYFWGRAKLHGVEEDIAEERVQLWISRSSGKSQT  525

Query  363  TSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            TSHDA+DVE+GL+ELRKLGIE +LWEASR+E DQ
Sbjct  526  TSHDALDVERGLIELRKLGIEQQLWEASRREIDQ  559



>ref|NP_190455.2| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8RWD5.1|SCD2_ARATH RecName: Full=Coiled-coil domain-containing protein SCD2; AltName: 
Full=Protein STOMATAL CYTOKINESIS DEFECTIVE 2 [Arabidopsis 
thaliana]
 gb|AAM13165.1| putative protein [Arabidopsis thaliana]
 gb|ACF41944.1| At3g48860 [Arabidopsis thaliana]
 gb|AEE78464.1| uncharacterized protein AT3G48860 [Arabidopsis thaliana]
 gb|AGI62176.1| stomatal cytokinesis defective [Arabidopsis thaliana]
Length=577

 Score =   270 bits (691),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 165/214 (77%), Gaps = 4/214 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA ++ E+WS LAPLPFE+V SA QKAKE  W KG  +  R 
Sbjct  351  CWLARYWGLAVQHGICADIAPSRQEHWSKLAPLPFELVTSAAQKAKELSWDKGGND--RS  408

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DLSDLTGEGNIESMLSVEMGL+EL SLKVEDA+VL  AQQR+ +  R ++SD K  
Sbjct  409  KAARDLSDLTGEGNIESMLSVEMGLRELASLKVEDAVVLIFAQQRKLSLVRHTVSDSKGH  468

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSA--ESP  364
            G+ ++++A EL   E EDV FK+AWL YFW RAK  G+E++IA +++Q WI RS+     
Sbjct  469  GESRFIDAYELGEAEQEDVAFKQAWLMYFWGRAKLHGVEDDIAEERVQLWISRSSGKSQT  528

Query  363  TSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            TSHDA+DVE+GL+ELRKLGIE +LWEASR+E DQ
Sbjct  529  TSHDALDVERGLIELRKLGIEQQLWEASRREIDQ  562



>ref|XP_009395181.1| PREDICTED: uncharacterized protein LOC103980467 [Musa acuminata 
subsp. malaccensis]
Length=538

 Score =   269 bits (688),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 164/215 (76%), Gaps = 15/215 (7%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGD-ENPER  721
            CWLAR WGLA  +GI  +IA+TK+E+WSSLAPLP E+V+SAGQKAKEE   +G+ E+  R
Sbjct  338  CWLARYWGLAVHHGIYPEIAVTKHEHWSSLAPLPLEVVISAGQKAKEESRNRGNHESERR  397

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DLSD+TGEGNIESMLSVE GL+EL SLKVEDA+VLALAQ  RPN  R   S    
Sbjct  398  NKFVRDLSDITGEGNIESMLSVEKGLRELASLKVEDAVVLALAQHWRPNFVRQFSS----  453

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
                      ELS EE EDV FK+AWL YFWRRAKA G+EE+IA+++LQ WIGR  + PT
Sbjct  454  ----------ELSQEEIEDVTFKQAWLIYFWRRAKAHGVEEDIADERLQSWIGRIGQPPT  503

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            SHD VDVE+GL+EL+KLGIE +LWEASR+E + D+
Sbjct  504  SHDVVDVERGLIELKKLGIEQQLWEASRREIELDT  538



>ref|XP_010247124.1| PREDICTED: uncharacterized protein LOC104590245, partial [Nelumbo 
nucifera]
Length=344

 Score =   263 bits (671),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 165/217 (76%), Gaps = 4/217 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W L  R+GI ++IA  K+EYWSSLAPLP E+VLSAGQKAKEE   +  +  ER 
Sbjct  116  CWLARYWNLCVRHGIHAEIAGAKHEYWSSLAPLPLEVVLSAGQKAKEENPTEKTDAEERD  175

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTAR----TSISD  550
            K    LSDL+G+GNIESML VE G++EL SLKVEDA++LA+AQ RRP+  +     S +D
Sbjct  176  KIPHSLSDLSGDGNIESMLLVEKGMRELASLKVEDAVLLAMAQNRRPHFLKFDNHVSDAD  235

Query  549  LKSPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAE  370
                 D   +EA ELS EESEDV+FK+AWLTYFWRRAK  G+E++IA++ LQFWI  S+ 
Sbjct  236  HLKIQDEGQIEAFELSQEESEDVIFKQAWLTYFWRRAKNHGLEQDIADEHLQFWINHSSR  295

Query  369  SPTSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQD  259
            SPTSHDAVDVE+G++ELRKLGIE +LWE SRK  DQD
Sbjct  296  SPTSHDAVDVERGMVELRKLGIETQLWEESRKWIDQD  332



>ref|XP_009623174.1| PREDICTED: uncharacterized protein LOC104114427 isoform X1 [Nicotiana 
tomentosiformis]
Length=535

 Score =   268 bits (686),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 152/185 (82%), Gaps = 2/185 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWL+R WGLA  YGIC+DIA  K+E+WSS APLPFE+V+SAGQKA+EE W  GD++ +R 
Sbjct  343  CWLSRYWGLAVHYGICADIAGAKHEHWSSFAPLPFEVVISAGQKAREESWSGGDDS-DRS  401

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V D+SDL+GEGNIESMLSVEM L+EL SLKVEDA++LALAQ RR N  R S SD KS 
Sbjct  402  KRVRDISDLSGEGNIESMLSVEMALRELASLKVEDAVILALAQPRRSNVVRQS-SDPKSS  460

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPK M+A ELS EESEDVLFKEAWLTYFWRRAK   +EE+IA ++LQFWI RS ++PT+
Sbjct  461  VDPKLMDAYELSQEESEDVLFKEAWLTYFWRRAKVHCVEEDIAEERLQFWISRSGQTPTT  520

Query  357  HDAVD  343
            HDAVD
Sbjct  521  HDAVD  525



>gb|ERN16866.1| hypothetical protein AMTR_s00057p00146260 [Amborella trichopoda]
Length=541

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 171/217 (79%), Gaps = 4/217 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W L+ R+GI +DIA  K+EYWSSLAPLPFE+V++AGQ+AK+E W K D+   R 
Sbjct  319  CWLARYWSLSVRHGIHADIAGPKHEYWSSLAPLPFEVVIAAGQRAKDEPW-KDDDLERRA  377

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTART--SISDLK  544
            +   D++DL GEGNIE+ML VE G++EL SLKVEDA+VLA +Q RRP+  R   SISD K
Sbjct  378  EISRDINDLMGEGNIENMLLVEKGMRELASLKVEDAVVLATSQHRRPSLVRVGQSISDQK  437

Query  543  SPGDPKYM-EAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAES  367
             P D + + EA ELS EE EDVLFK+AWLTYFW+RAK  G+EE+IA+++LQFWI  S ++
Sbjct  438  LPIDGQNLVEAFELSQEEYEDVLFKQAWLTYFWKRAKNHGLEEDIADERLQFWISHSTQT  497

Query  366  PTSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            PTSHD VDVE+GL+ELRKL IE +LWEASRK+ + +S
Sbjct  498  PTSHDVVDVERGLIELRKLSIETQLWEASRKDINPES  534



>emb|CAB86633.1| putative protein [Arabidopsis thaliana]
Length=576

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 152/250 (61%), Positives = 173/250 (69%), Gaps = 46/250 (18%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA+RYGICSDIA +KYEYWSSLAPLPFEIVLSAGQKAKEE  ++ ++   R 
Sbjct  327  CWLARYWGLASRYGICSDIATSKYEYWSSLAPLPFEIVLSAGQKAKEEKSEENEK---RS  383

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKV--------------------------E  616
            + V D++DLTGEGNIESMLSVEMGLKELTSLKV                          E
Sbjct  384  QLVQDINDLTGEGNIESMLSVEMGLKELTSLKVYSHPLWFWFMRPSFIFSWTILVLLKVE  443

Query  615  DAIVLALAQQRRPNTARTSISDLKSPGDPKYMEAI-----------------ELSPEESE  487
             AI + LAQ R  NT R S  +LKSPG PK  E +                 ELS EESE
Sbjct  444  VAITITLAQLRLANTTRLSDIELKSPGGPKITETLVLVILKDNSDLGLWSFAELSQEESE  503

Query  486  DVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDVEQGLMELRKLG  307
            DVLFKEAWLTYFWRRA++LGIE + A ++L+FWI RSA SP+SHDA++VEQGL ELRKL 
Sbjct  504  DVLFKEAWLTYFWRRAQSLGIEVDTARERLRFWISRSAHSPSSHDAMEVEQGLTELRKLR  563

Query  306  IEHRLWEASR  277
            IE RLWEASR
Sbjct  564  IERRLWEASR  573



>ref|XP_010515221.1| PREDICTED: uncharacterized protein LOC104791110 [Camelina sativa]
Length=574

 Score =   265 bits (676),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 165/214 (77%), Gaps = 4/214 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++GIC+DIA +++E+WS+LAPLPFE+V SA QKAKE  W KG     R 
Sbjct  348  CWLARYWDLAVQHGICADIAPSRHEHWSALAPLPFELVTSAAQKAKELSWDKGGNV--RS  405

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DL+DLTGEGNIESMLSVEMGL+EL SLKVEDA+VLA +QQR+ +  R ++SD K  
Sbjct  406  KVARDLTDLTGEGNIESMLSVEMGLRELASLKVEDAVVLAFSQQRKLSLVRQTVSDSKGH  465

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSA--ESP  364
            G+ ++++A EL   E EDV FK+AWL YFW RAK  G+E++IA +++Q WI RS+     
Sbjct  466  GESRFIDAYELGEAEQEDVAFKQAWLMYFWGRAKLHGVEKDIAEERVQLWISRSSGKSQT  525

Query  363  TSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            TSHDA+DVE+GL+ELRKLGIE +LWEASR+  DQ
Sbjct  526  TSHDALDVERGLIELRKLGIEQQLWEASRRGIDQ  559



>ref|XP_002875929.1| hypothetical protein ARALYDRAFT_485239 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52188.1| hypothetical protein ARALYDRAFT_485239 [Arabidopsis lyrata subsp. 
lyrata]
Length=573

 Score =   264 bits (675),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 165/215 (77%), Gaps = 9/215 (4%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKE-ECWQKGDENPER  721
            CWLAR WGLA ++GIC+DIA +++E+WS+LAPLPFE+V SA QKAK+ +C        +R
Sbjct  350  CWLARYWGLAVQHGICADIAPSRHEHWSALAPLPFELVTSAAQKAKDLKCGN------DR  403

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K   DLSDLTGEGNIESMLSVEMGL+EL SLKVEDA+VL  AQQR+ +  R ++SD K 
Sbjct  404  SKAARDLSDLTGEGNIESMLSVEMGLRELASLKVEDAVVLVFAQQRKLSLVRQTVSDSKG  463

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSA--ES  367
             G+ ++++A EL   E EDV FK+AWL YFW RAK  G+E++IA +++Q WI RS+    
Sbjct  464  HGESRFIDAYELGEAEQEDVAFKQAWLMYFWGRAKLHGVEDDIAEERVQLWISRSSGKSQ  523

Query  366  PTSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
             TSHDA+DVE+GL ELRKLGIE +LWEASRKE DQ
Sbjct  524  TTSHDALDVERGLTELRKLGIEQQLWEASRKEIDQ  558



>ref|XP_002964484.1| hypothetical protein SELMODRAFT_438807 [Selaginella moellendorffii]
 gb|EFJ34817.1| hypothetical protein SELMODRAFT_438807 [Selaginella moellendorffii]
Length=540

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 162/221 (73%), Gaps = 7/221 (3%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA R+G+  + A  KYEYWSS APLP E+VL  GQK   E    GD      
Sbjct  320  CWLARYWGLAVRHGVHPETAPLKYEYWSSFAPLPLEVVLDVGQKGSNESTANGDGK----  375

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTART--SISDLK  544
            K   D++D+TGEGNIESMLSVE GL+EL SLKVED ++LA+A+ RRP+  R   S+ D +
Sbjct  376  KASRDVNDITGEGNIESMLSVEKGLRELASLKVEDGVLLAMAEHRRPSLLRVGHSLPDAR  435

Query  543  -SPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAES  367
             SP  PK +E+++LS EE EDV FK+AWL+YFWRRA+A  IE +IA+++LQ+W  R+A S
Sbjct  436  ASPDGPKLVESMDLSSEEVEDVQFKQAWLSYFWRRARANKIESDIADERLQYWASRNAVS  495

Query  366  PTSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIG  244
            PT HDAVDVE+GLMELRKLGIE +LWEASRKE  Q  +  G
Sbjct  496  PTFHDAVDVERGLMELRKLGIEDQLWEASRKEIAQQQAQKG  536



>ref|XP_002975311.1| hypothetical protein SELMODRAFT_442801 [Selaginella moellendorffii]
 gb|EFJ23512.1| hypothetical protein SELMODRAFT_442801 [Selaginella moellendorffii]
Length=540

 Score =   259 bits (662),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 162/221 (73%), Gaps = 7/221 (3%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA R+G+  + A  KYEYWSS APLP E+VL  GQK   E    GD      
Sbjct  320  CWLARYWGLAVRHGVHPETAPLKYEYWSSFAPLPLEVVLDVGQKGSNESTANGDGK----  375

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTART--SISDLK  544
            K   D++D+TGEGNIESMLSVE GL+EL SLKVED ++LA+++ RRP+  R   S+ D +
Sbjct  376  KASRDVNDITGEGNIESMLSVEKGLRELASLKVEDGVLLAMSEHRRPSLLRVGHSLPDAR  435

Query  543  -SPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAES  367
             SP  PK +E+++LS EE EDV FK+AWL+YFWRRA+A  IE +IA+++LQ+W  R+A S
Sbjct  436  ASPDGPKLVESMDLSSEEVEDVQFKQAWLSYFWRRARANKIESDIADERLQYWASRNAVS  495

Query  366  PTSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIG  244
            PT HDAVDVE+GLMELRKLGIE +LWEASRKE  Q  +  G
Sbjct  496  PTFHDAVDVERGLMELRKLGIEDQLWEASRKEIAQQQAQKG  536



>gb|KCW48522.1| hypothetical protein EUGRSUZ_K02199 [Eucalyptus grandis]
Length=531

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/224 (59%), Positives = 166/224 (74%), Gaps = 18/224 (8%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLAA++GIC+D+A +++EYWSSLAPLPFE+V+SAG KAKEE W  G   P+R 
Sbjct  309  CWLARYWGLAAKHGICTDVAHSRHEYWSSLAPLPFEVVISAGVKAKEESWGAGGNIPDRR  368

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            + V D SDLTGEG IESML VE GLKEL++LK  +A       Q R N AR S ++   P
Sbjct  369  ELVKDTSDLTGEGYIESMLLVEAGLKELSTLKSSNA-------QSRSNLARQS-TNFIFP  420

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GD ++++ +ELS EE+ED+LFK+AWLTYFWRRA    IEE+IA ++LQ WIGRS ++P+ 
Sbjct  421  GDFRFIDTLELSKEEAEDILFKQAWLTYFWRRAVVHHIEEDIARERLQSWIGRSGQTPSP  480

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK*LHPP  226
            HDAV+VE+G  EL+KLGIE +LWEASRK TD          HPP
Sbjct  481  HDAVEVERGSRELQKLGIERQLWEASRKLTD----------HPP  514



>ref|XP_010438932.1| PREDICTED: caldesmon-like [Camelina sativa]
Length=639

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 161/209 (77%), Gaps = 1/209 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++GIC DI+ ++YE+WS+ APLPFE+VLSA QK  E+ WQ G  +    
Sbjct  414  CWLARYWELAIQHGICDDISTSRYEHWSASAPLPFEVVLSAAQKP-EDSWQTGGSDRTWS  472

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V + SD+ GEGNIESML+VE GL+E+ SLKVEDA++LALA+ R+ +  R ++SD +  
Sbjct  473  KVVSNFSDVNGEGNIESMLAVEAGLREIASLKVEDALMLALARYRQTSVVRQTVSDSRVQ  532

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+ K+ EA ELS EE +D+LFKEAWL YFW+RAK  G+E +IA ++LQFWI R  + P+S
Sbjct  533  GESKFSEAFELSEEEQQDILFKEAWLLYFWKRAKIHGVESDIAEERLQFWINRLGQQPSS  592

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKE  271
            HDAVDVE+G+ ELRKLGIE +LWE SRKE
Sbjct  593  HDAVDVERGMRELRKLGIEQQLWETSRKE  621



>ref|XP_010237694.1| PREDICTED: uncharacterized protein LOC100834428 isoform X2 [Brachypodium 
distachyon]
Length=721

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 155/212 (73%), Gaps = 1/212 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YGI  DI+I+KYEYWSS APLP E V +AGQ+AK+     G    E  
Sbjct  496  CWLARYWGLAVQYGIYPDISISKYEYWSSFAPLPLEYVTAAGQRAKDGSHHSGTNGLEET  555

Query  717  KH-VLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
               V DL+   GEGNIE+ML+V+ GLKEL  LKVEDA+++ALAQ  RPN A     D+KS
Sbjct  556  DMLVHDLTVTAGEGNIETMLAVDKGLKELAFLKVEDAVLIALAQHHRPNAAELPDPDIKS  615

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
             GD K+ EA +LS EE EDVLFK+AWL YFWRRAK+  +E++IA ++LQ WI R  + PT
Sbjct  616  SGDEKFTEAFDLSKEEEEDVLFKQAWLIYFWRRAKSHNVEDDIAEERLQMWIDRQDQQPT  675

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETD  265
            SHDAVDVEQG+ ELRKLGIE  LWE SR+E +
Sbjct  676  SHDAVDVEQGMHELRKLGIEQMLWEFSRQEVN  707



>ref|XP_006287432.1| hypothetical protein CARUB_v10000636mg [Capsella rubella]
 gb|EOA20330.1| hypothetical protein CARUB_v10000636mg [Capsella rubella]
Length=546

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 163/213 (77%), Gaps = 5/213 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GICSDIA++++E WS+LAPLPFE+V+SA QKAKE    +G  +  + 
Sbjct  320  CWLARYWGLAVQHGICSDIALSRHEKWSALAPLPFELVISAAQKAKELSQDEGGSDQSKT  379

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
              +   SDLTGEGNIESMLSVEMGL+EL SLKVE+A++LA AQ R P+  R   S  K  
Sbjct  380  ARI--SSDLTGEGNIESMLSVEMGLRELASLKVEEAVMLAFAQGRTPSFVRQDSS--KGH  435

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPT  361
            G+ +++E  E+   E EDV FK+AWL YFW RAK  G+EE++A+++LQFWI RS  +SPT
Sbjct  436  GELRFVETYEIKEGEQEDVAFKQAWLMYFWGRAKLHGVEEDVADERLQFWISRSEGKSPT  495

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            S D VDVE+GL+ELRKLG+E +LWEA RKETDQ
Sbjct  496  SQDIVDVERGLLELRKLGVEQQLWEACRKETDQ  528



>ref|XP_010237693.1| PREDICTED: uncharacterized protein LOC100834428 isoform X1 [Brachypodium 
distachyon]
Length=725

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 155/212 (73%), Gaps = 1/212 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YGI  DI+I+KYEYWSS APLP E V +AGQ+AK+     G    E  
Sbjct  500  CWLARYWGLAVQYGIYPDISISKYEYWSSFAPLPLEYVTAAGQRAKDGSHHSGTNGLEET  559

Query  717  KH-VLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
               V DL+   GEGNIE+ML+V+ GLKEL  LKVEDA+++ALAQ  RPN A     D+KS
Sbjct  560  DMLVHDLTVTAGEGNIETMLAVDKGLKELAFLKVEDAVLIALAQHHRPNAAELPDPDIKS  619

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
             GD K+ EA +LS EE EDVLFK+AWL YFWRRAK+  +E++IA ++LQ WI R  + PT
Sbjct  620  SGDEKFTEAFDLSKEEEEDVLFKQAWLIYFWRRAKSHNVEDDIAEERLQMWIDRQDQQPT  679

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETD  265
            SHDAVDVEQG+ ELRKLGIE  LWE SR+E +
Sbjct  680  SHDAVDVEQGMHELRKLGIEQMLWEFSRQEVN  711



>ref|XP_010448485.1| PREDICTED: uncharacterized protein LOC104730936 isoform X1 [Camelina 
sativa]
Length=644

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 161/209 (77%), Gaps = 1/209 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++GIC DI+ ++YE+WS+ APLPFE+VLSA QK  E+ WQ G  +    
Sbjct  419  CWLARYWELAIQHGICDDISTSRYEHWSASAPLPFEVVLSAAQKP-EDSWQTGGSDRTWS  477

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V + SD+ GEGNIESML+VE GL+E+ SLKVEDA++LALA+ R+ +  R ++SD +  
Sbjct  478  KVVSNFSDVNGEGNIESMLAVEAGLREIASLKVEDALMLALARYRQTSVVRQTVSDSRVQ  537

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+ K+ EA ELS EE +D+LFKEAWL YFW+RAK  G+E +IA ++LQFWI R  + P+S
Sbjct  538  GESKFSEAFELSEEEQQDILFKEAWLLYFWKRAKIHGVESDIAEERLQFWINRLGQQPSS  597

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKE  271
            HDAVDVE+G+ ELRKLGIE +LWE SRKE
Sbjct  598  HDAVDVERGMRELRKLGIEQQLWETSRKE  626



>ref|XP_010448486.1| PREDICTED: uncharacterized protein LOC104730936 isoform X2 [Camelina 
sativa]
Length=642

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 161/209 (77%), Gaps = 1/209 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++GIC DI+ ++YE+WS+ APLPFE+VLSA QK  E+ WQ G  +    
Sbjct  417  CWLARYWELAIQHGICDDISTSRYEHWSASAPLPFEVVLSAAQKP-EDSWQTGGSDRTWS  475

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V + SD+ GEGNIESML+VE GL+E+ SLKVEDA++LALA+ R+ +  R ++SD +  
Sbjct  476  KVVSNFSDVNGEGNIESMLAVEAGLREIASLKVEDALMLALARYRQTSVVRQTVSDSRVQ  535

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+ K+ EA ELS EE +D+LFKEAWL YFW+RAK  G+E +IA ++LQFWI R  + P+S
Sbjct  536  GESKFSEAFELSEEEQQDILFKEAWLLYFWKRAKIHGVESDIAEERLQFWINRLGQQPSS  595

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKE  271
            HDAVDVE+G+ ELRKLGIE +LWE SRKE
Sbjct  596  HDAVDVERGMRELRKLGIEQQLWETSRKE  624



>ref|XP_010433693.1| PREDICTED: uncharacterized protein LOC104717762 [Camelina sativa]
Length=651

 Score =   259 bits (662),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 161/209 (77%), Gaps = 1/209 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++GIC DI+ ++YE+WS+ APLPFE+VLSA QK  E+ WQ G  +    
Sbjct  426  CWLARYWELAIQHGICDDISTSRYEHWSASAPLPFEVVLSAAQKP-EDSWQTGGSDRTWS  484

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V + SD+ GEGNIESML+VE GL+E+ SLKVEDA++LALA+ R+ +  R ++SD +  
Sbjct  485  KVVSNFSDVNGEGNIESMLAVEAGLREIASLKVEDALMLALARYRQTSVVRQTVSDSRVQ  544

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+ K+ EA ELS EE +D+LFKEAWL YFW+RAK  G+E +IA ++LQFWI R  + P+S
Sbjct  545  GESKFSEAFELSEEEQQDILFKEAWLLYFWKRAKIHGVESDIAEERLQFWINRLGQQPSS  604

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKE  271
            HDAVDVE+G+ ELRKLGIE +LWE SRKE
Sbjct  605  HDAVDVERGMRELRKLGIEQQLWETSRKE  633



>ref|XP_006663480.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Oryza 
brachyantha]
Length=660

 Score =   259 bits (661),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 160/214 (75%), Gaps = 5/214 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGD---ENP  727
            CWLAR WGLA +YG+  DI+++K+EYWSS APLPFE V +AGQ+AK+   + G    E+ 
Sbjct  412  CWLARYWGLAVQYGVYPDISMSKHEYWSSFAPLPFEYVTAAGQRAKDGSLRSGSDSLEDS  471

Query  726  ERVKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDL  547
            +R  H L ++   GEGNIE+MLSV+ GL+EL  LKVEDA+++ALAQ  RPN A  +  D+
Sbjct  472  QRFVHELTVT--AGEGNIETMLSVDKGLQELAFLKVEDAVLIALAQNHRPNVAELADPDI  529

Query  546  KSPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAES  367
            KS GD K+ EA +LS EE EDVLFK+AWL YFWRRAK   +E++IA ++LQ WI R  + 
Sbjct  530  KSSGDEKFTEAFDLSKEEEEDVLFKQAWLIYFWRRAKIHNVEDDIAEERLQMWIDRHGQQ  589

Query  366  PTSHDAVDVEQGLMELRKLGIEHRLWEASRKETD  265
            PTSHDAVDV+QG+ ELR+LGIE  LWE SR+E +
Sbjct  590  PTSHDAVDVDQGIRELRRLGIEQLLWELSRREVN  623



>ref|XP_002869690.1| expressed protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45949.1| expressed protein [Arabidopsis lyrata subsp. lyrata]
Length=729

 Score =   259 bits (663),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 161/209 (77%), Gaps = 1/209 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            C LAR W LA ++GIC DIA ++YE+WS+LAPLP E+VLSA QK+ E+ WQ G  +    
Sbjct  504  CRLARYWELAVQHGICEDIATSRYEHWSALAPLPSEVVLSAAQKS-EDSWQTGGSDRTWS  562

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V + SDL GEGNIESML+VE GL+E+ SLKVEDA++LALA+ R+ N AR +I+D +  
Sbjct  563  KVVSNFSDLNGEGNIESMLAVETGLREIASLKVEDAVMLALARYRQTNVARQAITDPRVQ  622

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PK+ E  ELS +E +D+LFKEAWL YFW+RAK  G+E +IA ++LQFWI R  +  +S
Sbjct  623  GEPKFSETFELSHDEQQDILFKEAWLLYFWKRAKIHGVESDIAEERLQFWINRLGQHSSS  682

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKE  271
            HDAVDVE+G+ ELRKLGIE +LWE SRKE
Sbjct  683  HDAVDVERGMRELRKLGIEQQLWETSRKE  711



>emb|CDX80382.1| BnaC07g30620D [Brassica napus]
Length=543

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 167/213 (78%), Gaps = 7/213 (3%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLAA++GIC+DIA +++E WS+LAPLPFE+V+SA Q+AKE     GD+  +  
Sbjct  321  CWLARYWGLAAQHGICADIAPSRHEKWSALAPLPFELVISAAQRAKE---LSGDQGYDES  377

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K    +S+LTGEGNIESMLSVEMGL+EL SLKVEDA++LA++Q R P+  R    + K  
Sbjct  378  KTERFVSELTGEGNIESMLSVEMGLRELASLKVEDAVMLAVSQNRTPSFVR---QESKGN  434

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPT  361
             + +++EA EL  EE EDV+FK+AWL YFW RAK LG+EE+IA+++LQFWI  S  ES T
Sbjct  435  RELRFVEAYELKEEEQEDVVFKQAWLLYFWARAKLLGVEEDIADERLQFWISCSEGESTT  494

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            SHDAVDVE+G++ELRKLGIE +LWEA RKET+ 
Sbjct  495  SHDAVDVERGMLELRKLGIEQQLWEACRKETEH  527



>gb|KHG28186.1| atg11 [Gossypium arboreum]
Length=631

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 148/208 (71%), Gaps = 38/208 (18%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA RYG                                       DEN +R 
Sbjct  461  CWLARYWGLAVRYG--------------------------------------DDENEKRS  482

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DLSDLTGEGNIESMLSVEMGLKEL SLKVE+AIV ALAQQRR ++ R S+SD+KSP
Sbjct  483  KLVEDLSDLTGEGNIESMLSVEMGLKELASLKVEEAIVNALAQQRRASSVRISLSDIKSP  542

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAK+ GIEE+ A  +L+FWI RS  SP+S
Sbjct  543  RDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKSHGIEEDTAKDRLKFWISRSVHSPSS  602

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRK  274
            HDAVDVE+GLMELRKLGIE RLWEASR+
Sbjct  603  HDAVDVEEGLMELRKLGIERRLWEASRR  630



>ref|NP_001119051.1| uncharacterized protein [Arabidopsis thaliana]
 gb|ABK28788.1| expressed protein [Arabidopsis thaliana]
 gb|AEE84999.1| uncharacterized protein AT4G25070 [Arabidopsis thaliana]
Length=767

 Score =   260 bits (664),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 162/209 (78%), Gaps = 1/209 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++GIC DI+ ++YE+WS+LAPLP E+VLSA QK+ E+ WQ G  +    
Sbjct  542  CWLARYWELAVQHGICEDISTSRYEHWSALAPLPSEVVLSAAQKS-EDSWQTGGSDRTWS  600

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K + + SDL GEGNIESML+VE GL+E+ SLKVEDA++LAL++ R+ N AR +++D +  
Sbjct  601  KVISNFSDLNGEGNIESMLAVETGLREIASLKVEDAVMLALSRYRQTNVARQAVTDPRVQ  660

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PK+ E  ELS +E +D+LFKEAWL YFW+RAK  G+E +IA ++LQFWI R  +  +S
Sbjct  661  GEPKFSETFELSHDEQQDILFKEAWLLYFWKRAKIHGVESDIAEERLQFWINRLGQHSSS  720

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKE  271
            HDA+DVE+G+ ELRKLGIE +LWE SRKE
Sbjct  721  HDAIDVERGMRELRKLGIEQQLWETSRKE  749



>ref|NP_194237.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAU44520.1| hypothetical protein AT4G25070 [Arabidopsis thaliana]
 gb|AEE84998.1| uncharacterized protein AT4G25070 [Arabidopsis thaliana]
Length=765

 Score =   260 bits (664),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 162/209 (78%), Gaps = 1/209 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++GIC DI+ ++YE+WS+LAPLP E+VLSA QK+ E+ WQ G  +    
Sbjct  540  CWLARYWELAVQHGICEDISTSRYEHWSALAPLPSEVVLSAAQKS-EDSWQTGGSDRTWS  598

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K + + SDL GEGNIESML+VE GL+E+ SLKVEDA++LAL++ R+ N AR +++D +  
Sbjct  599  KVISNFSDLNGEGNIESMLAVETGLREIASLKVEDAVMLALSRYRQTNVARQAVTDPRVQ  658

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PK+ E  ELS +E +D+LFKEAWL YFW+RAK  G+E +IA ++LQFWI R  +  +S
Sbjct  659  GEPKFSETFELSHDEQQDILFKEAWLLYFWKRAKIHGVESDIAEERLQFWINRLGQHSSS  718

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKE  271
            HDA+DVE+G+ ELRKLGIE +LWE SRKE
Sbjct  719  HDAIDVERGMRELRKLGIEQQLWETSRKE  747



>gb|KHG28185.1| atg11 [Gossypium arboreum]
Length=656

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 148/208 (71%), Gaps = 38/208 (18%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA RYG                                       DEN +R 
Sbjct  486  CWLARYWGLAVRYG--------------------------------------DDENEKRS  507

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DLSDLTGEGNIESMLSVEMGLKEL SLKVE+AIV ALAQQRR ++ R S+SD+KSP
Sbjct  508  KLVEDLSDLTGEGNIESMLSVEMGLKELASLKVEEAIVNALAQQRRASSVRISLSDIKSP  567

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAK+ GIEE+ A  +L+FWI RS  SP+S
Sbjct  568  RDPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKSHGIEEDTAKDRLKFWISRSVHSPSS  627

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRK  274
            HDAVDVE+GLMELRKLGIE RLWEASR+
Sbjct  628  HDAVDVEEGLMELRKLGIERRLWEASRR  655



>ref|XP_010421179.1| PREDICTED: uncharacterized protein LOC104706668 [Camelina sativa]
Length=548

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 160/213 (75%), Gaps = 6/213 (3%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA + GICSDIA++++E WS+LAPLP E+V+SA QKAKE    +G  +  + 
Sbjct  323  CWLARYWGLAVQNGICSDIALSRHEKWSALAPLPLELVISAAQKAKELSQDEGGSDQSKT  382

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
                  SDLTGEGNIESMLSVEMGL+EL SLKVEDA++LA AQ+R P+  R    D K  
Sbjct  383  TRF--SSDLTGEGNIESMLSVEMGLRELASLKVEDAVMLAFAQKRTPSLVR---QDSKGH  437

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPT  361
            G+ +++E  E+   E EDV FK+AWL YFW RAK  G+EE+IA+++LQFWI RS  + PT
Sbjct  438  GELRFVETYEIKEGEQEDVAFKQAWLMYFWGRAKLHGVEEDIADERLQFWISRSEGKFPT  497

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            S D VDVE+GL+ELRKLG+E +LWEA RKETDQ
Sbjct  498  SQDVVDVERGLLELRKLGVEQQLWEACRKETDQ  530



>ref|XP_006283270.1| hypothetical protein CARUB_v10004304mg, partial [Capsella rubella]
 gb|EOA16168.1| hypothetical protein CARUB_v10004304mg, partial [Capsella rubella]
Length=670

 Score =   257 bits (656),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 158/209 (76%), Gaps = 1/209 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++GIC DI+  ++E WS+LAPLPFE+VLSA QK  E+ WQ G  +    
Sbjct  445  CWLARYWELAVQHGICDDISTLRHERWSALAPLPFEVVLSAAQKP-EDSWQTGGSDRTWS  503

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V + SD+ GEGNIESML+VE GL+E+ SLKVEDA++LALA+ R  N  R ++SD +  
Sbjct  504  KIVSNFSDVNGEGNIESMLAVEAGLREIASLKVEDALMLALARSRHRNVVRQAVSDSRVQ  563

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+ K+ +A ELS +E  D+LFKEAWL YFW+RAK  G+E +IA ++LQFWI R  + P+S
Sbjct  564  GESKFSDAFELSEDEQHDILFKEAWLLYFWKRAKIHGVESDIAEERLQFWINRLGQQPSS  623

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKE  271
            HDAVDVE+G+ ELRKLGIE +LWE SRKE
Sbjct  624  HDAVDVERGMRELRKLGIEQQLWETSRKE  652



>gb|ABA93965.1| expressed protein [Oryza sativa Japonica Group]
Length=802

 Score =   259 bits (662),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 157/211 (74%), Gaps = 0/211 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YGI  DI+++K+EYWSS APLPFE V +AGQ+AK+   + GD+  +  
Sbjct  555  CWLARYWGLAVQYGIYPDISMSKHEYWSSFAPLPFEYVTAAGQRAKDGSLRSGDDLEDTE  614

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            + V +L+   GEGNIE+MLSV+ GL+EL  LKVEDA+++ALA   RPN A     D+KS 
Sbjct  615  RFVHELTVTAGEGNIETMLSVDKGLQELAFLKVEDAVLIALAHHHRPNVAELVDPDIKSS  674

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GD K+ EA +LS EE EDVLFK+AWL YFWRRAK   +E++IA ++LQ WI R  + PTS
Sbjct  675  GDEKFTEAFDLSKEEEEDVLFKQAWLVYFWRRAKTHNVEDDIAEERLQMWIDRHGQQPTS  734

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETD  265
            HDAVDV+ G+ ELR+LGIE  LWE SR+E +
Sbjct  735  HDAVDVDMGIRELRRLGIEQLLWELSRREAN  765



>ref|XP_010493493.1| PREDICTED: uncharacterized protein LOC104770731 [Camelina sativa]
Length=555

 Score =   253 bits (647),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 157/213 (74%), Gaps = 6/213 (3%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA + GICSDIA +++E WS+LAPLP E+V+SA QKAKE     G  +  + 
Sbjct  331  CWLARYWGLAVQNGICSDIASSRHEKWSALAPLPLELVISAAQKAKELSQDAGGSDQSKT  390

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
                  SDLTGEGNIESMLSVEMGL+EL SLKVEDA++LA AQ R P+  R    D K  
Sbjct  391  ARY--SSDLTGEGNIESMLSVEMGLRELASLKVEDAVMLAFAQDRTPSVVR---QDSKGH  445

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPT  361
            G+ +++E  EL   E EDV FK+AWL YFW RAK  G+EE+IA+++LQFWI RS  + PT
Sbjct  446  GELRFVETYELKEGEQEDVAFKQAWLMYFWGRAKLHGVEEDIADERLQFWISRSEGKFPT  505

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            S D VDVE+GL+ELRKLG+E +LWEA RKETDQ
Sbjct  506  SQDVVDVERGLLELRKLGVEQQLWEACRKETDQ  538



>ref|XP_006413349.1| hypothetical protein EUTSA_v10024690mg [Eutrema salsugineum]
 gb|ESQ54802.1| hypothetical protein EUTSA_v10024690mg [Eutrema salsugineum]
Length=620

 Score =   255 bits (651),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 161/217 (74%), Gaps = 2/217 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++GIC DIA +++E+WS+LAPLP E+VLSA QK  E+ WQ G  +    
Sbjct  395  CWLARYWELAVQHGICEDIATSRHEHWSALAPLPLEVVLSAAQKP-EDSWQTGGSDRTWS  453

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V   SD  G+GNIESML+VE GL+E+ SLKVEDA++L LA+ R+ N  R S +D ++ 
Sbjct  454  KVVSKFSDANGDGNIESMLAVETGLREIASLKVEDALMLTLARYRQKNLVRQSDTDPRAQ  513

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PK+ EA ELS +E +D+LFKEAWL YFW+RAK  G+E +IA  +L+FWI R  E P+S
Sbjct  514  GEPKFAEAFELSEDERQDILFKEAWLLYFWKRAKIHGVESDIAEDRLKFWISRIGEQPSS  573

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  247
            HDAVDVE+G+ ELRKLGIE +LWE SR E   DS+ I
Sbjct  574  HDAVDVERGMRELRKLGIEQQLWETSRTEL-MDSTFI  609



>ref|XP_010545938.1| PREDICTED: plectin-like isoform X4 [Tarenaya hassleriana]
Length=414

 Score =   249 bits (637),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 148/186 (80%), Gaps = 2/186 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA +++E+WS+LAPLPFE+V+SA QKAKE    KG     R 
Sbjct  216  CWLARYWGLAVQHGICADIAPSRHEHWSALAPLPFELVISAAQKAKELSQNKGGSG--RS  273

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K   DLSDLTGEGNIESMLSVEMGL+EL SLK+EDA+VLA AQ+RRP+  R ++SD K  
Sbjct  274  KTARDLSDLTGEGNIESMLSVEMGLRELASLKIEDAVVLAFAQRRRPSLIRQTVSDPKGH  333

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GDPK+++  ELS EE+EDV FK+AWL Y W RAK  G+EE+I++++L FWIGR  +SP+S
Sbjct  334  GDPKFVDGYELSEEEAEDVAFKQAWLMYLWGRAKLYGVEEDISDERLHFWIGRCGQSPSS  393

Query  357  HDAVDV  340
             DAVDV
Sbjct  394  QDAVDV  399



>ref|XP_004980549.1| PREDICTED: pre-mRNA-splicing factor CWC22 homolog [Setaria italica]
Length=720

 Score =   257 bits (657),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 157/213 (74%), Gaps = 4/213 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKE--ECWQKGDENPE  724
            CWLAR WGLA +YGI  DI+++K+EYWSSLAPLPFE V SAGQ+AK   E    G E+ +
Sbjct  497  CWLARYWGLAVQYGIYPDISMSKHEYWSSLAPLPFEYVTSAGQRAKNGSETGSDGLEDAD  556

Query  723  RVKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLK  544
            ++ H  DL+   GEGN+E+MLSV+ GL+EL  LKVEDA++ ALAQ  R N    +  D+K
Sbjct  557  KLVH--DLTVTAGEGNVETMLSVDKGLQELAFLKVEDAVLFALAQHHRSNVVGPADPDIK  614

Query  543  SPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESP  364
            S GD K+ EA +LS EE EDV FK+AWL YFWRRAK   +EE+IA ++LQ WI R ++ P
Sbjct  615  STGDEKFTEAFDLSKEEEEDVKFKQAWLIYFWRRAKTHNVEEDIAEERLQMWIDRHSQEP  674

Query  363  TSHDAVDVEQGLMELRKLGIEHRLWEASRKETD  265
            TSHDAVDVEQGL ELRKLGIE  LWE SR E +
Sbjct  675  TSHDAVDVEQGLHELRKLGIEQLLWELSRHEVN  707



>emb|CDX88044.1| BnaA06g26350D [Brassica napus]
Length=542

 Score =   253 bits (645),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 166/213 (78%), Gaps = 7/213 (3%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA +++E WS+LAPLP E+V+SA Q+AKE     GD+  ++ 
Sbjct  320  CWLARYWGLAVQHGICADIAPSRHEKWSALAPLPVELVISAAQRAKE---LSGDQGYDQT  376

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K    +S+LTGEGNIESMLSVEMGL+EL SLKVEDA++LA++Q R P+  R    + K  
Sbjct  377  KTERFVSELTGEGNIESMLSVEMGLRELASLKVEDAVMLAVSQNRTPSFVR---QESKGN  433

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPT  361
             + K++EA EL  EE EDV+FK+AWL YFW RAK LG+EE+IA+++LQFWI  S  ES T
Sbjct  434  RELKFVEAYELKEEEQEDVVFKQAWLLYFWARAKLLGVEEDIADERLQFWISCSEGESTT  493

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            SHDAVDVE+G++ELRKLGIE +LWEA RKET+ 
Sbjct  494  SHDAVDVERGMLELRKLGIEQQLWEACRKETEH  526



>dbj|BAJ95178.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=711

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 155/212 (73%), Gaps = 5/212 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YGI  DI+++KYEYWSS APLP E V SAG +AK+     G  + E  
Sbjct  490  CWLARYWGLAVQYGIYPDISMSKYEYWSSFAPLPLEYVTSAGLRAKD----GGSNDLEET  545

Query  717  KH-VLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
               V DL+   GEGNIE+ML+V+ GLKEL  LKVEDA+++ALAQ  RPN A  S  D+KS
Sbjct  546  DMLVHDLTATAGEGNIETMLAVDKGLKELAFLKVEDAVLIALAQHHRPNVAELSDPDIKS  605

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
             GD K+ EA +LS EE EDVLFK+AWL YFWRRAK   +EE+IA ++LQ W+ R  + PT
Sbjct  606  SGDEKFTEAFDLSKEEEEDVLFKQAWLMYFWRRAKTHNVEEDIAEERLQMWVDRHGQQPT  665

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETD  265
            SHDAVDVEQG+ ELRKLGIE  LWE SR+E +
Sbjct  666  SHDAVDVEQGIHELRKLGIEQLLWEFSRQEVN  697



>ref|NP_001067981.2| Os11g0520500 [Oryza sativa Japonica Group]
 dbj|BAF28344.2| Os11g0520500 [Oryza sativa Japonica Group]
Length=831

 Score =   258 bits (660),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 157/211 (74%), Gaps = 0/211 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YGI  DI+++K+EYWSS APLPFE V +AGQ+AK+   + GD+  +  
Sbjct  583  CWLARYWGLAVQYGIYPDISMSKHEYWSSFAPLPFEYVTAAGQRAKDGSLRSGDDLEDTE  642

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            + V +L+   GEGNIE+MLSV+ GL+EL  LKVEDA+++ALA   RPN A     D+KS 
Sbjct  643  RFVHELTVTAGEGNIETMLSVDKGLQELAFLKVEDAVLIALAHHHRPNVAELVDPDIKSS  702

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GD K+ EA +LS EE EDVLFK+AWL YFWRRAK   +E++IA ++LQ WI R  + PTS
Sbjct  703  GDEKFTEAFDLSKEEEEDVLFKQAWLVYFWRRAKTHNVEDDIAEERLQMWIDRHGQQPTS  762

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETD  265
            HDAVDV+ G+ ELR+LGIE  LWE SR+E +
Sbjct  763  HDAVDVDMGIRELRRLGIEQLLWELSRREAN  793



>ref|XP_008790705.1| PREDICTED: uncharacterized protein LOC103707818 isoform X2 [Phoenix 
dactylifera]
Length=540

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 161/216 (75%), Gaps = 15/216 (7%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKG-DENPER  721
            CWLA  WGLA ++GI  +I+ +KYE+WSSLAPLP E+V+SAGQKAKEE   +G D+   R
Sbjct  332  CWLAWYWGLAVKHGIYPEISSSKYEHWSSLAPLPLEVVISAGQKAKEELLNRGEDDFGGR  391

Query  720  VKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKS  541
             K V DLSD TGEGNIESML VE GL+EL  LKVEDA++LALAQ RRP++ R   S    
Sbjct  392  NKLVGDLSDKTGEGNIESMLLVEKGLRELAFLKVEDAVMLALAQHRRPSSLRQLSS----  447

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
                      EL+ EES+DV FK+AWL YFWRRAK  GI+E+IA ++LQFWI RS +  T
Sbjct  448  ----------ELNQEESQDVTFKQAWLVYFWRRAKVHGIKEDIAEERLQFWISRSGQPQT  497

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            SH+AVDVE+GL+ELRKLGIE  LWEASR++ +Q SS
Sbjct  498  SHEAVDVERGLIELRKLGIEQHLWEASRRDIEQASS  533



>ref|XP_009150900.1| PREDICTED: uncharacterized protein LOC103874239 [Brassica rapa]
Length=543

 Score =   251 bits (642),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 165/213 (77%), Gaps = 6/213 (3%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA +++E WS+LAPLP E+V+SA Q+AKE    +G  +  + 
Sbjct  320  CWLARYWGLAVQHGICADIAPSRHEKWSALAPLPVELVISAAQRAKELSGDQGGSDQTKT  379

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            +  +  S+LTGEGNIESMLSVEMGL+EL SLKVEDA++LA++Q R P+  R    + K  
Sbjct  380  ERFV--SELTGEGNIESMLSVEMGLRELASLKVEDAVMLAVSQNRTPSFVR---QESKGN  434

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPT  361
             + K++EA EL  EE EDV+FK+AWL YFW RAK LG+EE+IA+++LQFWI  S  ES T
Sbjct  435  RELKFVEAYELKEEEQEDVVFKQAWLLYFWARAKLLGVEEDIADERLQFWISCSEGESTT  494

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            SHDAVDVE+G++ELRKLGIE +LWEA RKET+ 
Sbjct  495  SHDAVDVERGMLELRKLGIEQQLWEACRKETEH  527



>gb|KFK27654.1| hypothetical protein AALP_AA8G411300 [Arabis alpina]
Length=553

 Score =   251 bits (641),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 162/216 (75%), Gaps = 11/216 (5%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKG---DENP  727
            CWLAR WGLA ++GIC+DIA +++E WS+LAPLPFE+V+SA Q+AKE    +G     N 
Sbjct  325  CWLARYWGLAVQHGICADIAPSRHENWSALAPLPFELVISAAQRAKELSRDQGGSDQSNS  384

Query  726  ERVKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDL  547
            +R      LS+LTGEGNIESMLSVEMGL+EL SLKVEDAI+LA AQ R     R   S  
Sbjct  385  DRF-----LSELTGEGNIESMLSVEMGLRELASLKVEDAIMLAFAQNRTSLVVRQDSS--  437

Query  546  KSPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AE  370
            K  G+ K++E  EL   E E+V FK+AWL YFW RAK  G+EE+IA+++LQFWI RS  +
Sbjct  438  KGHGELKFVETYELKEGEQEEVAFKQAWLMYFWGRAKLHGVEEDIADERLQFWISRSGGK  497

Query  369  SPTSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            S TSHDA+DVE+GL+ELRKLGIE +LWEA RKETDQ
Sbjct  498  SLTSHDAMDVERGLLELRKLGIEQQLWEARRKETDQ  533



>ref|XP_008678157.1| PREDICTED: protein SOGA3-like [Zea mays]
 gb|AFW60866.1| hypothetical protein ZEAMMB73_571867 [Zea mays]
Length=715

 Score =   254 bits (650),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 155/211 (73%), Gaps = 0/211 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YGI  DI+++K+EYWSSLAPLPFE V SAGQ+AK+    +G+   +  
Sbjct  492  CWLARYWGLAVQYGIYPDISMSKHEYWSSLAPLPFEYVTSAGQRAKDGSEAEGNGLEDVD  551

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DL+   GEGN+E+ML+V+ GL+EL  LKVEDA++ ALAQ  R N A  +  D+KS 
Sbjct  552  KLVHDLTVTAGEGNVETMLAVDKGLQELAFLKVEDAVLFALAQHHRTNVAGAADPDIKSS  611

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GD K+ EA +LS EE EDV FK+AWL +FWRRAK   +EE+IA ++L  WI R  + PTS
Sbjct  612  GDEKFTEAFDLSKEEEEDVQFKQAWLIFFWRRAKTNNVEEDIAEERLHMWIDRHGQQPTS  671

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETD  265
            HDAVDVEQG+ ELRKLGIE  LWE SR E +
Sbjct  672  HDAVDVEQGIHELRKLGIEQLLWELSRHEAN  702



>ref|XP_008798921.1| PREDICTED: uncharacterized protein LOC103713683 [Phoenix dactylifera]
Length=325

 Score =   244 bits (622),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 164/215 (76%), Gaps = 1/215 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W L   YGI +D+A TK+EYWSSLAP P E+VLSAGQKA++    +  +  E+ 
Sbjct  103  CWLARYWKLCVSYGIHADVAETKHEYWSSLAPDPMEVVLSAGQKARDGNPSEIADIEEKD  162

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K  L+++DL  EGNIE M+ VE GL+ELTS+KVEDA++LA+A+ RR +    S S     
Sbjct  163  KVQLNVNDLAEEGNIECMILVEKGLRELTSMKVEDAVLLAMARHRRASIKSGSFSGSSIA  222

Query  537  GDPKY-MEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
             + +  +EA+ELS EESEDVLFK+AWLTYFWRR K  G+EE+IA+++LQFWI ++  SPT
Sbjct  223  AEGQNPVEAVELSQEESEDVLFKQAWLTYFWRRVKNHGLEEDIADERLQFWIEQNNHSPT  282

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            SHD V+VE+GL+EL+KLGIE +LWEA+R+ +DQD+
Sbjct  283  SHDVVEVERGLLELKKLGIESQLWEAARRGSDQDA  317



>ref|XP_002449559.1| hypothetical protein SORBIDRAFT_05g019070 [Sorghum bicolor]
 gb|EES08547.1| hypothetical protein SORBIDRAFT_05g019070 [Sorghum bicolor]
Length=830

 Score =   256 bits (653),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 157/213 (74%), Gaps = 4/213 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKE--ECWQKGDENPE  724
            CWLAR WGLA +YGI  DI+++K+EYWSSLAPLPFE V SAGQ+AK   E    G E+ +
Sbjct  607  CWLARYWGLAVQYGIYPDISMSKHEYWSSLAPLPFEYVTSAGQRAKNGSETESNGLEDVD  666

Query  723  RVKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLK  544
            ++ H  DL+   GEGN+E+ML+V+ GL+EL  LKVEDA++ ALAQ  R N A  +  D+K
Sbjct  667  KLVH--DLTVTAGEGNVETMLAVDKGLQELAFLKVEDAVLFALAQHHRSNVAGAADPDIK  724

Query  543  SPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESP  364
            S GD K+ EA +LS EE EDV FK+AWL YFWRRAK   +EE+IA ++LQ WI R  + P
Sbjct  725  SSGDEKFTEAFDLSKEEEEDVQFKQAWLIYFWRRAKTNSVEEDIAEERLQMWIDRHGQQP  784

Query  363  TSHDAVDVEQGLMELRKLGIEHRLWEASRKETD  265
            TSHDAVDVEQG+ ELRKLGIE  LWE SR E +
Sbjct  785  TSHDAVDVEQGIHELRKLGIEQLLWELSRHEAN  817



>ref|XP_010099602.1| hypothetical protein L484_004034 [Morus notabilis]
 gb|EXB79996.1| hypothetical protein L484_004034 [Morus notabilis]
Length=496

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 147/211 (70%), Gaps = 39/211 (18%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA                                        Q G ++ +R 
Sbjct  308  CWLARYWGLAV---------------------------------------QHGADDSDRS  328

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V DLSDLTGEGNIESMLSVEMGL+EL SLKVEDA+VLAL+Q RRPN+ R S  D KSP
Sbjct  329  KPVRDLSDLTGEGNIESMLSVEMGLRELASLKVEDAVVLALSQHRRPNSVRLSTIDSKSP  388

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PK++EA ELS EE+EDVLFKEAWLTYFWRRAK  G+EE+IA ++LQFWI R  +SPTS
Sbjct  389  GEPKFLEAFELSEEEAEDVLFKEAWLTYFWRRAKEHGVEEDIAEERLQFWISRIGQSPTS  448

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETD  265
            HDAVDVE+GL+ELRKLGIE +LWEASRKE D
Sbjct  449  HDAVDVERGLLELRKLGIEQQLWEASRKEID  479



>ref|XP_010454658.1| PREDICTED: uncharacterized protein LOC104736385 [Camelina sativa]
Length=556

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 158/213 (74%), Gaps = 6/213 (3%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA + GICSDIA +++E WS+LAPLP E+V+SA QKAKE    +G  +  + 
Sbjct  333  CWLARYWGLAVQNGICSDIASSRHEKWSALAPLPLELVISAAQKAKELSQDEGGSDHSKT  392

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
                   D+TGEGNIESMLSVEMGL+EL SLKVEDA++LA AQ+R P+  R    D K  
Sbjct  393  ARF--SKDITGEGNIESMLSVEMGLRELASLKVEDAVMLAFAQKRTPSLVR---QDSKGH  447

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPT  361
            G+ +++E  E+   E EDV FK+AWL YFW RAK  G+EE+IA+++LQFWI RS  + P+
Sbjct  448  GELRFVETYEIKEAEQEDVAFKQAWLMYFWGRAKLHGVEEDIADERLQFWISRSEGKFPS  507

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            S D VDVE+GL+ELRKLG+E +LWEA RKETDQ
Sbjct  508  SQDVVDVERGLLELRKLGVEQQLWEACRKETDQ  540



>ref|XP_009615103.1| PREDICTED: uncharacterized protein LOC104107890 [Nicotiana tomentosiformis]
Length=243

 Score =   239 bits (611),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 160/216 (74%), Gaps = 2/216 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W L  RYGI +DIA  K EYWSSLAPLP E+VL AGQKAK+E     ++  ER 
Sbjct  20   CWLARYWSLCVRYGIHTDIAGAKQEYWSSLAPLPLEVVLEAGQKAKDENSLLYNDPEERE  79

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
                DLS+L+G+GN+ESML V+ GL+ELTSLKVE A+ LA+AQQRR  TA  +  D++ P
Sbjct  80   ALPHDLSELSGDGNVESMLLVDKGLRELTSLKVEGAVALAMAQQRRL-TALKATDDMRLP  138

Query  537  GDPK-YMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
             + + + EA ELSPEE+EDV FK+AWLTY WRR K  G+E +IA ++LQFWI +  +  T
Sbjct  139  MEGQNFSEAFELSPEETEDVQFKQAWLTYLWRRTKNHGVEPDIAEERLQFWINQGGQPLT  198

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            SHDAV VE+GL+EL+KLGIE +LW+ SR+  D +++
Sbjct  199  SHDAVHVERGLIELKKLGIETQLWKESRRSIDPENT  234



>ref|XP_012089161.1| PREDICTED: coiled-coil domain-containing protein SCD2-like [Jatropha 
curcas]
Length=653

 Score =   251 bits (641),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 167/214 (78%), Gaps = 3/214 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W L  ++GI ++IA  KYEYWSS APLP E+VL+AGQ A+EE   + ++  ER 
Sbjct  435  CWLARYWSLCVQHGIHAEIAGAKYEYWSSFAPLPVEVVLAAGQTAQEEDSLENNDTNERE  494

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            + + D++DL+G+GNIESML+VE GL+EL SLK+EDA+ LA+AQ RR N  +T   ++K P
Sbjct  495  RVLQDMNDLSGDGNIESMLAVEKGLRELASLKIEDAVALAMAQVRRQNLQKT--DEVKLP  552

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             + ++ EA ELSPEESEDV FK+AWLTYFW+RAK  G+EE+IA+++LQFWI  S    +S
Sbjct  553  AEGQF-EAFELSPEESEDVRFKQAWLTYFWKRAKTHGLEEDIADERLQFWINHSNRFSSS  611

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
             DAVDVE+GL+EL+KLG+E++LW+ASR+  + DS
Sbjct  612  LDAVDVERGLLELKKLGMENQLWQASRRGLETDS  645



>emb|CAB87914.1| putative protein [Arabidopsis thaliana]
Length=609

 Score =   249 bits (636),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 163/249 (65%), Gaps = 42/249 (17%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA ++ E+WS LAPLPFE+V SA QKAKE  W KG     R 
Sbjct  351  CWLARYWGLAVQHGICADIAPSRQEHWSKLAPLPFELVTSAAQKAKELSWDKGSSIAAR-  409

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
                DLSDLTGEGNIESMLSVEMGL+EL SLKVEDA+VL  AQQR+ +  R ++SD K  
Sbjct  410  ----DLSDLTGEGNIESMLSVEMGLRELASLKVEDAVVLIFAQQRKLSLVRHTVSDSKGH  465

Query  537  GDPKYMEAIELSPEESEDVLFK-----------------------------------EAW  463
            G+ ++++A EL   E EDV FK                                   +AW
Sbjct  466  GESRFIDAYELGEAEQEDVAFKQIYVLDDETYESKHCRTVTYQFKSRYRLDSYNYIMQAW  525

Query  462  LTYFWRRAKALGIEEEIANKQLQFWIGRSA--ESPTSHDAVDVEQGLMELRKLGIEHRLW  289
            L YFW RAK  G+E++IA +++Q WI RS+     TSHDA+DVE+GL+ELRKLGIE +LW
Sbjct  526  LMYFWGRAKLHGVEDDIAEERVQLWISRSSGKSQTTSHDALDVERGLIELRKLGIEQQLW  585

Query  288  EASRKETDQ  262
            EASR+E DQ
Sbjct  586  EASRREIDQ  594



>gb|EMT30590.1| hypothetical protein F775_12884 [Aegilops tauschii]
Length=995

 Score =   255 bits (651),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 155/211 (73%), Gaps = 3/211 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YGI  DI+++KYEYWSS APLP E V SAG +AK+      +E  E  
Sbjct  774  CWLARYWGLAVQYGIYPDISMSKYEYWSSFAPLPLEYVTSAGLRAKD---GGSNELEETD  830

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
              V DL+   GEGNIE+ML+V+ GLKEL  LKVEDA+++ALAQ  RPN A  S  D+KS 
Sbjct  831  MLVHDLTVTAGEGNIETMLAVDKGLKELAFLKVEDAVLIALAQHHRPNVAELSDPDIKSS  890

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GD K+ EA +LS EE EDVLFK+AWL YFWRRAK   +EE+IA ++LQ W+ R  + PTS
Sbjct  891  GDEKFTEAFDLSKEEEEDVLFKQAWLMYFWRRAKIHNVEEDIAEERLQMWVDRHGQQPTS  950

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETD  265
            HDAVDVEQG+ ELRKLGIE  LWE SR+E +
Sbjct  951  HDAVDVEQGIHELRKLGIEQLLWEFSRQEVN  981



>gb|EEE52188.1| hypothetical protein OsJ_34062 [Oryza sativa Japonica Group]
Length=693

 Score =   251 bits (640),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 157/222 (71%), Gaps = 11/222 (5%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YGI  DI+++K+EYWSS APLPFE V +AGQ+AK+   + GD+  +  
Sbjct  435  CWLARYWGLAVQYGIYPDISMSKHEYWSSFAPLPFEYVTAAGQRAKDGSLRSGDDLEDTE  494

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            + V +L+   GEGNIE+MLSV+ GL+EL  LKVEDA+++ALA   RPN A     D+KS 
Sbjct  495  RFVHELTVTAGEGNIETMLSVDKGLQELAFLKVEDAVLIALAHHHRPNVAELVDPDIKSS  554

Query  537  GDPKYMEAIELSPEESEDVLFKE-----------AWLTYFWRRAKALGIEEEIANKQLQF  391
            GD K+ EA +LS EE EDVLFK+           AWL YFWRRAK   +E++IA ++LQ 
Sbjct  555  GDEKFTEAFDLSKEEEEDVLFKQEGITNYNIVQNAWLVYFWRRAKTHNVEDDIAEERLQM  614

Query  390  WIGRSAESPTSHDAVDVEQGLMELRKLGIEHRLWEASRKETD  265
            WI R  + PTSHDAVDV+ G+ ELR+LGIE  LWE SR+E +
Sbjct  615  WIDRHGQQPTSHDAVDVDMGIRELRRLGIEQLLWELSRREAN  656



>ref|XP_010904828.1| PREDICTED: uncharacterized protein LOC105032156 [Elaeis guineensis]
Length=510

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 162/214 (76%), Gaps = 0/214 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W L   YGI +D+A TK+E+WSSLAP P EIVLSAGQKA++    +  +  E+ 
Sbjct  289  CWLARYWKLCVNYGIHADVAETKHEHWSSLAPDPMEIVLSAGQKARDGNLSEIADIEEKD  348

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K  L+++DL GE NIESML VE GL+ELTS+KVEDA++ A+AQ R  +    S S   + 
Sbjct  349  KVPLNVNDLPGEENIESMLLVEKGLRELTSMKVEDAVLFAMAQHRHASIKSGSFSGSVAV  408

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
                 +EAIELS EESEDVLFK+AWLTYFWRR K  G+EE+IA+++LQFWI ++  SPTS
Sbjct  409  EGQIPVEAIELSQEESEDVLFKQAWLTYFWRRVKNHGLEEDIADERLQFWIEQNNHSPTS  468

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HD V+VE+GL+EL+KLGIE +LWEA+R+ +DQD+
Sbjct  469  HDVVEVERGLLELKKLGIESQLWEAARRGSDQDA  502



>ref|XP_008218218.1| PREDICTED: uncharacterized protein LOC103318595 [Prunus mume]
Length=708

 Score =   251 bits (641),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 165/215 (77%), Gaps = 2/215 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
             WLAR W L   +GI ++IA ++YE+WS+LAPLP E VL+AG+KAKEE      +  ER 
Sbjct  485  SWLARYWSLCVEHGIHAEIATSRYEFWSALAPLPVEAVLAAGEKAKEEIEHNDLDIDERE  544

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
                DL++L+GE NIESML VE GL+E+ SLKVEDA+ LA+AQ RRP++ +T +S+LK P
Sbjct  545  DSPHDLNELSGERNIESMLLVEKGLREIASLKVEDAVALAMAQHRRPSSMKTGLSELKLP  604

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT-  361
             D ++ EA ELS EESEDVLFK+AWL YFWRRAK  G+E +IA+++LQFWI  +++SPT 
Sbjct  605  IDGQF-EAFELSKEESEDVLFKQAWLAYFWRRAKNHGVEADIADERLQFWINHNSKSPTA  663

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            SHDAVDVE+GL+EL+KLGIE +LW  SRK  + DS
Sbjct  664  SHDAVDVERGLLELKKLGIETQLWRESRKWLEHDS  698



>ref|XP_006394633.1| hypothetical protein EUTSA_v10003911mg [Eutrema salsugineum]
 gb|ESQ31919.1| hypothetical protein EUTSA_v10003911mg [Eutrema salsugineum]
Length=571

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 162/230 (70%), Gaps = 23/230 (10%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GIC+DIA +++E WS+LAPLPFE+V+SA QKAKE    +G  +  + 
Sbjct  328  CWLARYWGLAVQHGICADIAPSRHETWSALAPLPFELVISAAQKAKELSGDQGGSDQSKT  387

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
                 LSDLTGEGNIESMLSVEMGL+EL SLKVEDA++LA AQ+R P+  R    D K  
Sbjct  388  DRF--LSDLTGEGNIESMLSVEMGLRELASLKVEDAVMLAFAQKRTPSLIR---QDSKGN  442

Query  537  GDPKY-----------------MEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIA  409
            G+ ++                     EL   E EDV FK+AWL YFW RA   G+EE+IA
Sbjct  443  GEVRFRIISYLHNHELVTMLSHFSNAELKEGEQEDVAFKQAWLMYFWGRATLHGVEEDIA  502

Query  408  NKQLQFWIGRS-AESPTSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            +++LQFWI RS  ++PTSHDAVDVE+GL+ELRKLGIE +LWEA RK+T+Q
Sbjct  503  DERLQFWISRSGGKTPTSHDAVDVERGLLELRKLGIEQQLWEACRKDTNQ  552



>emb|CAB36749.1| putative protein [Arabidopsis thaliana]
 emb|CAB79416.1| putative protein [Arabidopsis thaliana]
Length=317

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 158/217 (73%), Gaps = 16/217 (7%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++GIC DI+ ++YE+WS+LAPLP E+VLSA QK+ E+ WQ G  +    
Sbjct  106  CWLARYWELAVQHGICEDISTSRYEHWSALAPLPSEVVLSAAQKS-EDSWQTGGSDRTWS  164

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K + + SDL GEGNIESML+VE GL+E+ SLKVEDA++LAL++ R+ N AR +++     
Sbjct  165  KVISNFSDLNGEGNIESMLAVETGLREIASLKVEDAVMLALSRYRQTNVARQAVT-----  219

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
                     ELS +E +D+LFKEAWL YFW+RAK  G+E +IA ++LQFWI R  +  +S
Sbjct  220  ---------ELSHDEQQDILFKEAWLLYFWKRAKIHGVESDIAEERLQFWINRLGQHSSS  270

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  247
            HDA+DVE+G+ ELRKLGIE +LWE SRKE   DSS +
Sbjct  271  HDAIDVERGMRELRKLGIEQQLWETSRKELI-DSSFL  306



>gb|KFK29000.1| hypothetical protein AALP_AA7G076100 [Arabis alpina]
Length=686

 Score =   249 bits (637),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 159/209 (76%), Gaps = 3/209 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LAA++GIC DIA +++ +WS+LAPLPFE+VLSA QK  E+ WQ G  +    
Sbjct  463  CWLARYWELAAQHGICDDIAASRHGHWSALAPLPFEVVLSAAQKP-EDSWQTGGSDRTWS  521

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V + SD TGEGNIESML+VE GL+E+ SLKVEDA++LA+A+ R+ N  R +  D +  
Sbjct  522  KVVSNFSDATGEGNIESMLAVETGLREMASLKVEDALMLAIARYRQTNVVRQA--DPRVQ  579

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+ K+ EA ELS +E +D+LFKEAWL Y+W+RAK  G+E +IA ++LQFWI R  + P+S
Sbjct  580  GESKFSEAFELSEDEHQDILFKEAWLLYYWKRAKIHGVESDIAEERLQFWINRLGQQPSS  639

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKE  271
            HDAVDVE+G+ ELRKLGIE +LWE SR E
Sbjct  640  HDAVDVERGMRELRKLGIEQQLWETSRTE  668



>gb|KFK29001.1| hypothetical protein AALP_AA7G076100 [Arabis alpina]
Length=684

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 159/209 (76%), Gaps = 3/209 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LAA++GIC DIA +++ +WS+LAPLPFE+VLSA QK  E+ WQ G  +    
Sbjct  461  CWLARYWELAAQHGICDDIAASRHGHWSALAPLPFEVVLSAAQKP-EDSWQTGGSDRTWS  519

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V + SD TGEGNIESML+VE GL+E+ SLKVEDA++LA+A+ R+ N  R +  D +  
Sbjct  520  KVVSNFSDATGEGNIESMLAVETGLREMASLKVEDALMLAIARYRQTNVVRQA--DPRVQ  577

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+ K+ EA ELS +E +D+LFKEAWL Y+W+RAK  G+E +IA ++LQFWI R  + P+S
Sbjct  578  GESKFSEAFELSEDEHQDILFKEAWLLYYWKRAKIHGVESDIAEERLQFWINRLGQQPSS  637

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKE  271
            HDAVDVE+G+ ELRKLGIE +LWE SR E
Sbjct  638  HDAVDVERGMRELRKLGIEQQLWETSRTE  666



>ref|XP_010039005.1| PREDICTED: uncharacterized protein LOC104427641 [Eucalyptus grandis]
Length=541

 Score =   245 bits (625),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 162/226 (72%), Gaps = 12/226 (5%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLAA++GIC+D+A +++EYWSSLAPLPFE+V+SAG KAKEE W  G   P+R 
Sbjct  309  CWLARYWGLAAKHGICTDVAHSRHEYWSSLAPLPFEVVISAGVKAKEESWGAGGNIPDRR  368

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            + V D SDLTGEG IESML VE GLKEL++LKVE+A+ LA+ +          IS     
Sbjct  369  ELVKDTSDLTGEGYIESMLLVEAGLKELSTLKVEEAVSLAMLKADPIWLGNPPISYFLVI  428

Query  537  GDP--KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESP  364
             D    ++   +LS EE+ED+LFK+AWLTYFWRRA    IEE+IA ++LQ WIGRS ++P
Sbjct  429  SDSLIHWVRGNQLSKEEAEDILFKQAWLTYFWRRAVVHHIEEDIARERLQSWIGRSGQTP  488

Query  363  TSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK*LHPP  226
            + HDAV+VE+G  EL+KLGIE +LWEASRK TD          HPP
Sbjct  489  SPHDAVEVERGSRELQKLGIERQLWEASRKLTD----------HPP  524



>gb|EEC68259.1| hypothetical protein OsI_36288 [Oryza sativa Indica Group]
Length=813

 Score =   250 bits (639),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 157/222 (71%), Gaps = 11/222 (5%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA +YGI  DI+++K+EYWSS APLPFE V +AGQ+AK+   + GD+  +  
Sbjct  555  CWLARYWGLAVQYGIYPDISMSKHEYWSSFAPLPFEYVTAAGQRAKDGSLRSGDDLEDTE  614

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            + V +L+   GEGNIE+MLSV+ GL+EL  LKVEDA+++ALA   RPN A     D+KS 
Sbjct  615  RFVHELTVTAGEGNIETMLSVDKGLQELAFLKVEDAVLIALAHHHRPNVAELVDPDIKSS  674

Query  537  GDPKYMEAIELSPEESEDVLFKE-----------AWLTYFWRRAKALGIEEEIANKQLQF  391
            GD K+ EA +LS EE EDVLFK+           AWL YFWRRAK   +E++IA ++LQ 
Sbjct  675  GDEKFTEAFDLSKEEEEDVLFKQEGITNYNIVQNAWLVYFWRRAKTHNVEDDIAEERLQM  734

Query  390  WIGRSAESPTSHDAVDVEQGLMELRKLGIEHRLWEASRKETD  265
            WI R  + PTSHDAVDV+ G+ ELR+LGIE  LWE SR+E +
Sbjct  735  WIDRHGQQPTSHDAVDVDMGIRELRRLGIEQLLWELSRREAN  776



>ref|XP_007207715.1| hypothetical protein PRUPE_ppa025957mg [Prunus persica]
 gb|EMJ08914.1| hypothetical protein PRUPE_ppa025957mg [Prunus persica]
Length=659

 Score =   246 bits (629),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 167/215 (78%), Gaps = 9/215 (4%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
             WLAR W L   +GI ++IA ++YE+WS+LAPLP E VL+AG+KAKEE  ++ D +P   
Sbjct  438  SWLARYWSLCVEHGIHAEIATSRYEFWSALAPLPVEAVLAAGEKAKEEIDERED-SPR--  494

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
                +L++L+GE NIESML VE GL+E+ SLKVEDA+ +A+AQ RRP++ +T +S+LK P
Sbjct  495  ----NLNELSGERNIESMLLVEKGLREIASLKVEDAVAMAMAQHRRPSSMKTGLSELKLP  550

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESP-T  361
             D ++ EA ELS EESEDVLFK+AWL YFWRRAK  G+E +IA+++LQFWI  +++SP T
Sbjct  551  IDGQF-EAFELSKEESEDVLFKQAWLAYFWRRAKNHGVEADIADERLQFWINHNSKSPTT  609

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            SHDAVDVE+GL+EL+KLGIE +LW  SRK  + DS
Sbjct  610  SHDAVDVERGLLELKKLGIETQLWRESRKWLEHDS  644



>gb|KCW61705.1| hypothetical protein EUGRSUZ_H04425 [Eucalyptus grandis]
Length=233

 Score =   233 bits (595),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 160/220 (73%), Gaps = 4/220 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W L  +YGI ++IA  K+E+WSSLAP P E+VL+AGQKAKE+     D   ER 
Sbjct  9    CWLARYWSLCIKYGIHAEIAEAKHEHWSSLAPSPMEVVLAAGQKAKEKNSYIYDNMNERD  68

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTART---SISDL  547
            +   D ++ +GE NIESML VE GL+EL SLKVEDAI+LA+AQ RR +  ++    + DL
Sbjct  69   RFPRDKNEHSGELNIESMLLVEKGLRELASLKVEDAILLAMAQHRRKSILKSGDAGVYDL  128

Query  546  KSPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAES  367
            K P + +  E  ELS EESEDVLFK+AWLTYFWRRAK  G+E ++A+++LQF I +S  S
Sbjct  129  KLPIEGQ-TEVFELSKEESEDVLFKQAWLTYFWRRAKNHGLEIDVADERLQFLINQSTRS  187

Query  366  PTSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  247
            PTS DAVDVE+GL ELRKLGIE +LWE SRK +  D+  +
Sbjct  188  PTSQDAVDVERGLTELRKLGIEDQLWEDSRKGSALDNGNV  227



>emb|CDY03383.1| BnaC01g16990D [Brassica napus]
Length=653

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 153/207 (74%), Gaps = 1/207 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++GI  DIA +++E+WS+LAPLPFE+V+SA QK  E+ WQ    +    
Sbjct  430  CWLARYWELAVQHGIYKDIAPSRHEHWSALAPLPFEVVISAAQKP-EDSWQTDGSDRTWS  488

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V   SD  G+GNIESML+VE GL+E+ SLKVEDAI+L  A  R+ +  R S +D +  
Sbjct  489  KVVSKFSDANGDGNIESMLAVETGLREIASLKVEDAIMLVFAGFRQKHVVRQSDTDPRVQ  548

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PK+ EA ELS +E +D+LFKEAWL Y+W+RAK   +E +IA  +L+FWI R AE PTS
Sbjct  549  GEPKFAEAFELSHDEKQDILFKEAWLMYYWKRAKIHSVESDIAEDRLKFWISRIAEQPTS  608

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASR  277
            HDAVDVE+G+ ELRKLGIE +LWEASR
Sbjct  609  HDAVDVERGMRELRKLGIEQQLWEASR  635



>emb|CDY34338.1| BnaA01g14410D [Brassica napus]
Length=651

 Score =   243 bits (621),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 153/207 (74%), Gaps = 1/207 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++GI  DIA +++E+WS+LAPLPFE+V+SA QK  E+ WQ    +    
Sbjct  422  CWLARYWELAVQHGIYKDIAPSRHEHWSALAPLPFEVVISAAQKP-EDSWQTDGSDRTWS  480

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V   SD  G+GNIESML+VE GL+E+ SLKVEDAI+L  A  R+ +  R S +D +  
Sbjct  481  KVVSKFSDANGDGNIESMLAVETGLREIASLKVEDAIMLVFAGFRQKHVVRQSNTDPRVQ  540

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PK+ EA ELS +E +D+LFKEAWL Y+W+RAK   +E +IA  +L+FWI R AE PTS
Sbjct  541  GEPKFAEAFELSHDEKQDILFKEAWLMYYWKRAKIHSVESDIAEDRLKFWISRIAEQPTS  600

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASR  277
            HDAVDVE+G+ ELRKLGIE +LWEASR
Sbjct  601  HDAVDVERGMRELRKLGIEQQLWEASR  627



>ref|XP_010097351.1| hypothetical protein L484_010229 [Morus notabilis]
 gb|EXB67661.1| hypothetical protein L484_010229 [Morus notabilis]
Length=729

 Score =   245 bits (625),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 166/222 (75%), Gaps = 11/222 (5%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W L   +GI ++IA  +YEYWSSLAPLP E+VLSAGQKAKEE   K D + E +
Sbjct  503  CWLARYWSLCVEHGIHAEIAKARYEYWSSLAPLPVEVVLSAGQKAKEE---KKDNDLEEI  559

Query  717  KH-VLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSIS----  553
            +    DL+ L+G+ NIE+ML VE G++EL SLKVEDA+ LA+A  RR N  R+ +S    
Sbjct  560  ESDPRDLNKLSGDVNIENMLLVEKGMRELASLKVEDAVALAMALSRRLNAIRSGLSAYGC  619

Query  552  --DLKSPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGR  379
              DLK P + ++ EA ELS EES+DVLFK+AWLTYFWRRAK  G+E +++ ++L+FW+  
Sbjct  620  VDDLKLPIEGQF-EAFELSKEESDDVLFKQAWLTYFWRRAKNHGLEPDVSEERLEFWVNH  678

Query  378  SAESPTSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            + + PTSHDAVDVE+GL+ELRK GIE++LWE SRKE + D++
Sbjct  679  NTKPPTSHDAVDVERGLIELRKFGIENQLWEESRKELELDTN  720



>gb|EEC72087.1| hypothetical protein OsI_05032 [Oryza sativa Indica Group]
Length=444

 Score =   238 bits (607),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 147/217 (68%), Gaps = 38/217 (18%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWL+R WGLA +YG                                       D+   R 
Sbjct  263  CWLSRYWGLAVQYG--------------------------------------EDDAQRRN  284

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V D+SD+ GEGNIESMLSVEMGL+EL+SLKVEDA+V+AL Q RRP+  R   SD KSP
Sbjct  285  KLVRDMSDVMGEGNIESMLSVEMGLRELSSLKVEDAVVVALGQHRRPSIVRQFTSDFKSP  344

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PK++EA +LS EE+EDV FK+AWL YFWRRAK  GIEE+IA ++LQFWIGR+A +PTS
Sbjct  345  GEPKFLEAFDLSHEEAEDVSFKQAWLIYFWRRAKTHGIEEDIAEERLQFWIGRNAVAPTS  404

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  247
            HDA+DVE+GL ELRKLGIE +LWE SR + D+DSS I
Sbjct  405  HDAIDVERGLTELRKLGIEQQLWEGSRADIDEDSSAI  441



>ref|XP_009138814.1| PREDICTED: triadin isoform X2 [Brassica rapa]
Length=698

 Score =   243 bits (621),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 153/207 (74%), Gaps = 1/207 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++GI  DIA +++E+WS+LAPLPFE+V+SA QK  E+ WQ    +    
Sbjct  469  CWLARYWELAVQHGIYKDIAPSRHEHWSALAPLPFEVVISAAQKP-EDSWQTDGSDRTWS  527

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V   SD  G+GNIESML+VE GL+E+ SLKVEDAI+L  A  R+ +  R S +D +  
Sbjct  528  KVVSKFSDANGDGNIESMLAVETGLREIASLKVEDAIMLVFAGFRQKHVVRQSDTDPRVQ  587

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PK+ EA ELS +E +D+LFKEAWL Y+W+RAK   +E +IA  +L+FWI R AE PTS
Sbjct  588  GEPKFAEAFELSHDEKQDILFKEAWLMYYWKRAKIHSVESDIAEDRLKFWISRIAEQPTS  647

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASR  277
            HDAVDVE+G+ ELRKLGIE +LWEASR
Sbjct  648  HDAVDVERGMRELRKLGIEQQLWEASR  674



>ref|XP_009138807.1| PREDICTED: triadin isoform X1 [Brassica rapa]
Length=700

 Score =   243 bits (621),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 153/207 (74%), Gaps = 1/207 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++GI  DIA +++E+WS+LAPLPFE+V+SA QK  E+ WQ    +    
Sbjct  471  CWLARYWELAVQHGIYKDIAPSRHEHWSALAPLPFEVVISAAQKP-EDSWQTDGSDRTWS  529

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V   SD  G+GNIESML+VE GL+E+ SLKVEDAI+L  A  R+ +  R S +D +  
Sbjct  530  KVVSKFSDANGDGNIESMLAVETGLREIASLKVEDAIMLVFAGFRQKHVVRQSDTDPRVQ  589

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PK+ EA ELS +E +D+LFKEAWL Y+W+RAK   +E +IA  +L+FWI R AE PTS
Sbjct  590  GEPKFAEAFELSHDEKQDILFKEAWLMYYWKRAKIHSVESDIAEDRLKFWISRIAEQPTS  649

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASR  277
            HDAVDVE+G+ ELRKLGIE +LWEASR
Sbjct  650  HDAVDVERGMRELRKLGIEQQLWEASR  676



>ref|XP_006413348.1| hypothetical protein EUTSA_v10024690mg [Eutrema salsugineum]
 gb|ESQ54801.1| hypothetical protein EUTSA_v10024690mg [Eutrema salsugineum]
Length=614

 Score =   241 bits (616),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 158/217 (73%), Gaps = 6/217 (3%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W LA ++    DIA +++E+WS+LAPLP E+VLSA QK  E+ WQ G  +    
Sbjct  393  CWLARYWELAVQH----DIATSRHEHWSALAPLPLEVVLSAAQKP-EDSWQTGGSDRTWS  447

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V   SD  G+GNIESML+VE GL+E+ SLKVEDA++L LA+ R+ N  R S +D ++ 
Sbjct  448  KVVSKFSDANGDGNIESMLAVETGLREIASLKVEDALMLTLARYRQKNLVRQSDTDPRAQ  507

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PK+ EA ELS +E +D+LFKEAWL YFW+RAK  G+E +IA  +L+FWI R  E P+S
Sbjct  508  GEPKFAEAFELSEDERQDILFKEAWLLYFWKRAKIHGVESDIAEDRLKFWISRIGEQPSS  567

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  247
            HDAVDVE+G+ ELRKLGIE +LWE SR E   DS+ I
Sbjct  568  HDAVDVERGMRELRKLGIEQQLWETSRTEL-MDSTFI  603



>ref|XP_009342037.1| PREDICTED: fas-binding factor 1-like [Pyrus x bretschneideri]
Length=695

 Score =   243 bits (620),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 164/217 (76%), Gaps = 8/217 (4%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENP--E  724
             WLAR W L   +GI ++IA ++YE+WSSLAP P E VL+AGQKAK+E     D N   E
Sbjct  474  SWLARYWSLCVEHGIHAEIATSRYEFWSSLAPHPAEAVLAAGQKAKDEI----DNNDLDE  529

Query  723  RVKHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLK  544
            R     DL++L+GE NIESML VE GL+EL SLKVE+A+ +A+AQQRRP++ +T + DLK
Sbjct  530  REDSPRDLNELSGERNIESMLLVEKGLRELASLKVEEAVAVAMAQQRRPSSMKTGVIDLK  589

Query  543  SPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESP  364
             P D ++ EA  LS EESED+LFK+AWL YFWRRAK  G+E +IA+++LQFWI  +++SP
Sbjct  590  LPIDGQF-EAFVLSKEESEDILFKQAWLAYFWRRAKNHGVEPDIADERLQFWINHNSKSP  648

Query  363  -TSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
             TSHDAVDVE+GL+EL+KLGIE +LW  SRK  + DS
Sbjct  649  ATSHDAVDVERGLLELKKLGIETQLWRESRKWLEHDS  685



>ref|XP_009772645.1| PREDICTED: uncharacterized protein LOC104222992 isoform X1 [Nicotiana 
sylvestris]
Length=653

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 160/216 (74%), Gaps = 2/216 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W L   YGI +D+A  K EYWSSLAPLP E+VL AGQKAK+E     ++  ER 
Sbjct  430  CWLARYWSLCVHYGIHTDVAGAKQEYWSSLAPLPLEVVLEAGQKAKDENSLLYNDPEERE  489

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
                DLS+L+G+GN+ESML V+ GL+ELTSLKVE A+ LA+AQQRR  TA  +  D++ P
Sbjct  490  ALPHDLSELSGDGNVESMLLVDKGLRELTSLKVEGAVALAMAQQRR-LTALRATDDMRLP  548

Query  537  GDPK-YMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
             + + + EA ELSPEE+EDV FK+AWLTY WRRAK  G+E +IA ++LQFWI +  +  T
Sbjct  549  MEGQSFSEAFELSPEETEDVQFKQAWLTYLWRRAKNHGVEPDIAEERLQFWINQGGQPLT  608

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            SHDAV VE+GL+EL+KLGIE +LW+ SR+  D +++
Sbjct  609  SHDAVHVERGLIELKKLGIETQLWKESRRSIDPENT  644



>ref|XP_007030136.1| Uncharacterized protein TCM_025951 [Theobroma cacao]
 gb|EOY10638.1| Uncharacterized protein TCM_025951 [Theobroma cacao]
Length=870

 Score =   244 bits (624),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 158/208 (76%), Gaps = 3/208 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W L  ++GI ++IA  K+EYWSS APLP EIVL+AGQ+AKE  +   ++  ER 
Sbjct  650  CWLARYWSLCVQHGIQAEIAGAKHEYWSSFAPLPLEIVLAAGQRAKEGDFSSNNDLEERE  709

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K + D S+L+GE N+ESML VE GL+EL  LKVEDA+  A+AQ RR N+ +T   ++K P
Sbjct  710  KVLQDFSELSGERNVESMLLVEKGLRELALLKVEDAVAFAMAQHRRQNSLKT--DEVKLP  767

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             + ++ EA ELS EESEDV FK+AWLTYFWRRA   G+E +IA+++LQFWI  S+ S TS
Sbjct  768  TEGQF-EAFELSQEESEDVRFKQAWLTYFWRRAMNHGVEPDIADERLQFWINHSSRSSTS  826

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRK  274
            HDAVDVE+GLMELRKLG+E +LW+ SR+
Sbjct  827  HDAVDVERGLMELRKLGLESQLWKKSRE  854



>gb|EEE55938.1| hypothetical protein OsJ_04631 [Oryza sativa Japonica Group]
Length=530

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 147/217 (68%), Gaps = 38/217 (18%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWL+R WGLA +YG                                       D+   R 
Sbjct  349  CWLSRYWGLAVQYG--------------------------------------EDDAQRRN  370

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K V D+SD+ GEGNIESMLSVEMGL+EL+SLKVEDA+V+AL Q RRP+  R   SD KSP
Sbjct  371  KLVRDMSDVMGEGNIESMLSVEMGLRELSSLKVEDAVVVALGQHRRPSIVRQFTSDFKSP  430

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            G+PK++EA +LS EE+EDV FK+AWL YFWRRAK  GIEE+IA ++LQFWIGR+A +PTS
Sbjct  431  GEPKFLEAFDLSHEEAEDVSFKQAWLIYFWRRAKTHGIEEDIAEERLQFWIGRNAVAPTS  490

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  247
            HDA+DVE+GL ELRKLGIE +LWE SR + D+DSS I
Sbjct  491  HDAIDVERGLTELRKLGIEQQLWEGSRADIDEDSSAI  527



>ref|XP_010485897.1| PREDICTED: uncharacterized protein LOC104764138 isoform X2 [Camelina 
sativa]
Length=798

 Score =   243 bits (619),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 161/216 (75%), Gaps = 2/216 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWL+R WGL  R+GI SDIA  K+EYWSS APLPFEIVLSAGQ+AK+   Q  +   ER 
Sbjct  576  CWLSRYWGLCVRHGIQSDIAGAKHEYWSSFAPLPFEIVLSAGQRAKDGISQSNNTKGERE  635

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISD-LKS  541
            K + +L + +GEGN+ESM+ VE GL+EL +LKV++A+   +AQ RR ++++  +SD +K 
Sbjct  636  KSLENLQETSGEGNVESMIWVEKGLRELAALKVQEAVAFVMAQNRRSSSSKFFVSDEVKL  695

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            P D ++ EA ELS EE EDV FK+AWL+YFWRRAK   IE ++A+++LQ+WI +   S T
Sbjct  696  PMDGQF-EAFELSDEEVEDVSFKQAWLSYFWRRAKNHDIESDLADERLQYWINQGTRSAT  754

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            S DAVDVE+GLMELRKL IE +LW+ SRK  D +S+
Sbjct  755  SQDAVDVERGLMELRKLNIESQLWQKSRKGLDHESN  790



>ref|XP_010485896.1| PREDICTED: uncharacterized protein LOC104764138 isoform X1 [Camelina 
sativa]
Length=799

 Score =   243 bits (619),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 161/216 (75%), Gaps = 2/216 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWL+R WGL  R+GI SDIA  K+EYWSS APLPFEIVLSAGQ+AK+   Q  +   ER 
Sbjct  577  CWLSRYWGLCVRHGIQSDIAGAKHEYWSSFAPLPFEIVLSAGQRAKDGISQSNNTKGERE  636

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISD-LKS  541
            K + +L + +GEGN+ESM+ VE GL+EL +LKV++A+   +AQ RR ++++  +SD +K 
Sbjct  637  KSLENLQETSGEGNVESMIWVEKGLRELAALKVQEAVAFVMAQNRRSSSSKFFVSDEVKL  696

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            P D ++ EA ELS EE EDV FK+AWL+YFWRRAK   IE ++A+++LQ+WI +   S T
Sbjct  697  PMDGQF-EAFELSDEEVEDVSFKQAWLSYFWRRAKNHDIESDLADERLQYWINQGTRSAT  755

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            S DAVDVE+GLMELRKL IE +LW+ SRK  D +S+
Sbjct  756  SQDAVDVERGLMELRKLNIESQLWQKSRKGLDHESN  791



>ref|XP_011032546.1| PREDICTED: uncharacterized protein LOC105131319 [Populus euphratica]
Length=703

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 164/215 (76%), Gaps = 3/215 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W L  ++GI ++IA  +YEYWSS APLP E+VLSAG++AK+E     D+  ER 
Sbjct  483  CWLARYWTLCVKHGILAEIAGARYEYWSSFAPLPVEVVLSAGERAKDENSSVNDDVEERE  542

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            + + + S+L+G+GNIESML VE GL+EL SLKV +A+ LA+AQQRR N  ++   ++K  
Sbjct  543  RVLKEGSELSGDGNIESMLLVEKGLRELASLKVGEAVALAMAQQRRTNFMKS--DEIKLA  600

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
            GD   +EA ELS EESEDV FK+AWLTYFWRRAK  G+E +IA ++LQFW   S+ S +S
Sbjct  601  GD-GNLEAFELSQEESEDVRFKQAWLTYFWRRAKNHGLEPDIAEERLQFWTNHSSRSSSS  659

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            HDAVDVE+GLMELRKLGIE++LW+ASR+  + DS+
Sbjct  660  HDAVDVERGLMELRKLGIENQLWQASRRGLEVDSN  694



>ref|XP_011465884.1| PREDICTED: coiled-coil domain-containing protein SCD2-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=666

 Score =   238 bits (608),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 155/214 (72%), Gaps = 4/214 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
             WLAR W L A +GI +DIA  ++E+WSSLAPLP E VL AG KA+E+  ++ ++  ER 
Sbjct  448  SWLARYWSLCAEHGIHADIATARHEFWSSLAPLPVEAVLEAGNKAREQTVEEQNDVYERE  507

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
                D+++L+GEGNIE+ML VE GL+EL SLKVEDA+ + +A+ R PN+     S++K P
Sbjct  508  YSPRDVNELSGEGNIENMLLVEQGLRELASLKVEDAVAIIMARHRHPNSKS---SEVKVP  564

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
               ++ E  ELS EE +DV FK+AWLTYFWRRAK  G+E +I + +LQFW+ R+   PTS
Sbjct  565  AGGQF-EGFELSKEECDDVFFKQAWLTYFWRRAKNHGLEADIVDDRLQFWMNRNTNPPTS  623

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HDAVDVE+GL+ELRKLGIE +LW  SRK  + DS
Sbjct  624  HDAVDVERGLLELRKLGIETKLWAKSRKGLEHDS  657



>ref|XP_011465885.1| PREDICTED: coiled-coil domain-containing protein SCD2-like isoform 
X3 [Fragaria vesca subsp. vesca]
Length=660

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 155/214 (72%), Gaps = 4/214 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
             WLAR W L A +GI +DIA  ++E+WSSLAPLP E VL AG KA+E+  ++ ++  ER 
Sbjct  442  SWLARYWSLCAEHGIHADIATARHEFWSSLAPLPVEAVLEAGNKAREQTVEEQNDVYERE  501

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
                D+++L+GEGNIE+ML VE GL+EL SLKVEDA+ + +A+ R PN+     S++K P
Sbjct  502  YSPRDVNELSGEGNIENMLLVEQGLRELASLKVEDAVAIIMARHRHPNSKS---SEVKVP  558

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
               ++ E  ELS EE +DV FK+AWLTYFWRRAK  G+E +I + +LQFW+ R+   PTS
Sbjct  559  AGGQF-EGFELSKEECDDVFFKQAWLTYFWRRAKNHGLEADIVDDRLQFWMNRNTNPPTS  617

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HDAVDVE+GL+ELRKLGIE +LW  SRK  + DS
Sbjct  618  HDAVDVERGLLELRKLGIETKLWAKSRKGLEHDS  651



>ref|XP_011465883.1| PREDICTED: coiled-coil domain-containing protein SCD2-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=670

 Score =   238 bits (607),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 155/214 (72%), Gaps = 4/214 (2%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
             WLAR W L A +GI +DIA  ++E+WSSLAPLP E VL AG KA+E+  ++ ++  ER 
Sbjct  452  SWLARYWSLCAEHGIHADIATARHEFWSSLAPLPVEAVLEAGNKAREQTVEEQNDVYERE  511

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
                D+++L+GEGNIE+ML VE GL+EL SLKVEDA+ + +A+ R PN+     S++K P
Sbjct  512  YSPRDVNELSGEGNIENMLLVEQGLRELASLKVEDAVAIIMARHRHPNSKS---SEVKVP  568

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
               ++ E  ELS EE +DV FK+AWLTYFWRRAK  G+E +I + +LQFW+ R+   PTS
Sbjct  569  AGGQF-EGFELSKEECDDVFFKQAWLTYFWRRAKNHGLEADIVDDRLQFWMNRNTNPPTS  627

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  256
            HDAVDVE+GL+ELRKLGIE +LW  SRK  + DS
Sbjct  628  HDAVDVERGLLELRKLGIETKLWAKSRKGLEHDS  661



>ref|XP_006471854.1| PREDICTED: golgin candidate 5-like [Citrus sinensis]
Length=881

 Score =   241 bits (615),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 157/213 (74%), Gaps = 2/213 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W    +Y I ++IA  K++YWSS APLP E+VL AGQ+AKEE   +     ER 
Sbjct  662  CWLARYWNFCVQYAIHAEIAKAKHDYWSSFAPLPLEMVLGAGQRAKEENLSESTAAEERE  721

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
            K + DL +L+G+GNIESML VE GL+EL  LKVEDAI L++AQQRR N  + S+ ++K P
Sbjct  722  KVLKDLKELSGDGNIESMLLVEKGLRELAYLKVEDAIALSMAQQRRLNQLK-SVDEVKIP  780

Query  537  GDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTS  358
             + ++ EA ELSPEESED  FK+AWLTYFWRRAK  G+E +IA+ + +FW+  S +S +S
Sbjct  781  SEGQF-EAFELSPEESEDTRFKQAWLTYFWRRAKDHGVESDIADDRFEFWVVHSGQSSSS  839

Query  357  HDAVDVEQGLMELRKLGIEHRLWEASRKETDQD  259
             DAVDVE+GL ELRKLG+E +LW+ SRK  ++D
Sbjct  840  QDAVDVERGLAELRKLGLESQLWQRSRKGLEED  872



>ref|XP_010464000.1| PREDICTED: uncharacterized protein LOC104744625 [Camelina sativa]
Length=799

 Score =   240 bits (612),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 162/216 (75%), Gaps = 2/216 (1%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWL+R WGL  R+GI +DIA  K+EYWSS APLPFEIVLSAGQ+A++   +  +   ER 
Sbjct  577  CWLSRYWGLCVRHGIQADIAGAKHEYWSSFAPLPFEIVLSAGQRARDGVSESNNTKGERE  636

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISD-LKS  541
            K + +L + +GEGN+ESM+ VE GL+EL +LKV++A+   +AQ RR ++++  +SD +K 
Sbjct  637  KSLENLQETSGEGNVESMIWVEKGLRELAALKVQEAVAFVMAQNRRSSSSKFFVSDEVKL  696

Query  540  PGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
            P D ++ EA ELS EE EDV FK+AWL+YFWRRAK   IE ++A+++LQ+WI ++  S T
Sbjct  697  PMDGQF-EAFELSDEEVEDVSFKQAWLSYFWRRAKNHDIESDLADERLQYWINQATRSAT  755

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            S DAVDVE+GLMELRKL IE +LW+ SRK  D +S+
Sbjct  756  SQDAVDVERGLMELRKLNIESQLWQKSRKGLDHESN  791



>ref|XP_002872068.1| hypothetical protein ARALYDRAFT_489231 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48327.1| hypothetical protein ARALYDRAFT_489231 [Arabidopsis lyrata subsp. 
lyrata]
Length=557

 Score =   235 bits (600),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 126/229 (55%), Positives = 160/229 (70%), Gaps = 30/229 (13%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR WGLA ++GICSDIA +++E WS+LAPLPFE+V+SA QKAK++         +R 
Sbjct  324  CWLARYWGLAVQHGICSDIASSRHEKWSALAPLPFELVISAAQKAKDKT--------DRF  375

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSI------  556
                 LSDLTGEGNIESMLSVEMGL+EL SLKVEDA++LA AQ+R P+  R  I      
Sbjct  376  -----LSDLTGEGNIESMLSVEMGLRELASLKVEDAVMLAFAQKRTPSLVRQGIFQRAWR  430

Query  555  ----SDLKSPGDPKYMEAI------ELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIAN  406
                 D+      + +  +      EL   E EDV FK+AWL YFW RAK  G+EE+IA+
Sbjct  431  TQICRDICIIKLDEILTVLSHFLNAELKEGEQEDVAFKQAWLMYFWGRAKLHGVEEDIAD  490

Query  405  KQLQFWIGRS-AESPTSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQ  262
            +++QFWI RS  ++PTS D VDVE+G++ELRKLG+E +LWEA RKETDQ
Sbjct  491  ERMQFWISRSDGKNPTSQDVVDVERGMLELRKLGVEQQLWEACRKETDQ  539



>ref|XP_010659988.1| PREDICTED: uncharacterized protein LOC100260652 [Vitis vinifera]
Length=626

 Score =   237 bits (604),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 152/202 (75%), Gaps = 2/202 (1%)
 Frame = -3

Query  858  GICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERVKHVLDLSDLTGEG  679
            GI +++A  KYEYWSS APLP E+VL+AGQKAKEE      +  ER K   DL++ +GEG
Sbjct  413  GIHAEVAGVKYEYWSSFAPLPVEVVLAAGQKAKEENSSSSSDAEEREKAPRDLNEPSGEG  472

Query  678  NIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSIS-DLK-SPGDPKYMEAIEL  505
            NIESML VE+GL+EL SLKVE+A+V ALA  RR ++ ++  + DLK S      +E+ EL
Sbjct  473  NIESMLLVEIGLRELASLKVEEAVVYALAHHRRSSSLKSDFAGDLKLSTEAHNLLESFEL  532

Query  504  SPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDVEQGLM  325
            S EESEDVLFK+AWLTYFWRRAK LG+E +IA+++LQFWI  +   P  HDAVDVE+GL+
Sbjct  533  SQEESEDVLFKQAWLTYFWRRAKNLGVERDIADERLQFWINHTTRQPAFHDAVDVERGLV  592

Query  324  ELRKLGIEHRLWEASRKETDQD  259
            ELRKLGIEH+LWE SRK   QD
Sbjct  593  ELRKLGIEHQLWEESRKWIGQD  614



>ref|XP_006382705.1| hypothetical protein POPTR_0005s04600g [Populus trichocarpa]
 gb|ERP60502.1| hypothetical protein POPTR_0005s04600g [Populus trichocarpa]
Length=654

 Score =   237 bits (605),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 164/222 (74%), Gaps = 10/222 (5%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W L  ++GI ++IA  +YEYWSS APLP E+VLSAGQ+AK+E     D+  ER 
Sbjct  427  CWLARYWILCVKHGILAEIAGARYEYWSSFAPLPVEVVLSAGQRAKDENSSVNDDAEERE  486

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDA-------IVLALAQQRRPNTARTS  559
            + + + S+L+G+GNIESML VE GL+EL SLKV DA       + L +AQQRR N  ++ 
Sbjct  487  RVLKEGSELSGDGNIESMLLVEKGLRELASLKVSDAPLEVGEAVALVMAQQRRTNFMKSD  546

Query  558  ISDLKSPGDPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGR  379
              ++K  GD   +EA ELS EESEDV FK+AWLTYFWRRAK  G+E +IA ++LQFWI  
Sbjct  547  --EIKLAGD-GNLEAFELSQEESEDVRFKQAWLTYFWRRAKNHGLEPDIAEERLQFWINH  603

Query  378  SAESPTSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            S+ S +SHDAVDVE+GLMELRKLGIE++LW+ASR+  + DS+
Sbjct  604  SSRSSSSHDAVDVERGLMELRKLGIENQLWQASRRGLEVDSN  645



>ref|XP_010327287.1| PREDICTED: uncharacterized protein LOC101260484 [Solanum lycopersicum]
Length=592

 Score =   236 bits (601),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 159/216 (74%), Gaps = 1/216 (0%)
 Frame = -3

Query  897  CWLARXWGLAARYGICSDIAITKYEYWSSLAPLPFEIVLSAGQKAKEECWQKGDENPERV  718
            CWLAR W L   YGI SDIA  K EYWSSLAPLP E+VL AGQKAK++     ++  +R 
Sbjct  368  CWLARYWTLCQTYGIHSDIAAAKQEYWSSLAPLPLEVVLEAGQKAKDDNSSVYNDGEDRE  427

Query  717  KHVLDLSDLTGEGNIESMLSVEMGLKELTSLKVEDAIVLALAQQRRPNTARTSISDLKSP  538
                DL++L+G+ N+ESML V+  L+ELTSLKV+ A+ LA+AQQRRP + R +   ++ P
Sbjct  428  TIGNDLNELSGDKNVESMLLVDKALRELTSLKVDGAVSLAMAQQRRPTSLRATDDMIRLP  487

Query  537  GDPK-YMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT  361
             + + + E+ ELSPEESEDV FK+AWLTYFWRRAK   +E +IA ++LQFWI +S +  T
Sbjct  488  IEGQGFTESYELSPEESEDVQFKQAWLTYFWRRAKNHEVEADIAEERLQFWINQSGQPLT  547

Query  360  SHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  253
            SHDAV VE+GL+EL+KLGIE +LW+ +R+  D +++
Sbjct  548  SHDAVHVERGLIELKKLGIETQLWQETRRSIDPENT  583



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2049935769300