BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9894

Length=1051
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011096521.1|  PREDICTED: chlorophyll a-b binding protein 2...    498   3e-174   Sesamum indicum [beniseed]
ref|XP_004145734.1|  PREDICTED: chlorophyll a-b binding protein o...    496   7e-174   Cucumis sativus [cucumbers]
ref|XP_009593856.1|  PREDICTED: chlorophyll a-b binding protein 4...    495   3e-173   Nicotiana tomentosiformis
ref|XP_008456347.1|  PREDICTED: chlorophyll a-b binding protein o...    494   3e-173   Cucumis melo [Oriental melon]
ref|XP_006361530.1|  PREDICTED: chlorophyll a-b binding protein 3...    494   7e-173   Solanum tuberosum [potatoes]
ref|XP_004134608.2|  PREDICTED: chlorophyll a-b binding protein o...    493   2e-172   Cucumis sativus [cucumbers]
ref|XP_009795316.1|  PREDICTED: chlorophyll a-b binding protein 4...    493   2e-172   Nicotiana sylvestris
ref|XP_011658281.1|  PREDICTED: chlorophyll a-b binding protein o...    492   3e-172   Cucumis sativus [cucumbers]
ref|XP_009795315.1|  PREDICTED: chlorophyll a-b binding protein 4...    492   4e-172   Nicotiana sylvestris
ref|XP_009618329.1|  PREDICTED: chlorophyll a-b binding protein 4...    492   5e-172   Nicotiana tomentosiformis
ref|XP_009782924.1|  PREDICTED: chlorophyll a-b binding protein 5...    491   6e-172   Nicotiana sylvestris
ref|XP_009790936.1|  PREDICTED: chlorophyll a-b binding protein 4...    491   7e-172   Nicotiana sylvestris
ref|XP_009597417.1|  PREDICTED: chlorophyll a-b binding protein 5...    491   8e-172   Nicotiana tomentosiformis
ref|XP_010916097.1|  PREDICTED: chlorophyll a-b binding protein o...    491   1e-171   Elaeis guineensis
ref|XP_009628754.1|  PREDICTED: chlorophyll a-b binding protein 1...    491   1e-171   Nicotiana tomentosiformis
ref|XP_009772885.1|  PREDICTED: chlorophyll a-b binding protein 5...    491   1e-171   Nicotiana sylvestris
ref|XP_009790934.1|  PREDICTED: chlorophyll a-b binding protein 4...    491   1e-171   Nicotiana sylvestris
sp|P27492.1|CB21_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    490   1e-171   Nicotiana tabacum [American tobacco]
ref|XP_009782921.1|  PREDICTED: chlorophyll a-b binding protein 5...    490   2e-171   Nicotiana sylvestris
sp|P07369.1|CB2G_SOLLC  RecName: Full=Chlorophyll a-b binding pro...    490   2e-171   Solanum lycopersicum
sp|P08221.1|CB21_CUCSA  RecName: Full=Chlorophyll a-b binding pro...    489   2e-171   Cucumis sativus [cucumbers]
ref|XP_006356077.1|  PREDICTED: chlorophyll a-b binding protein 3...    490   3e-171   Solanum tuberosum [potatoes]
ref|XP_011096520.1|  PREDICTED: chlorophyll a-b binding protein 2...    489   3e-171   Sesamum indicum [beniseed]
ref|XP_009628755.1|  PREDICTED: chlorophyll a-b binding protein 4...    489   3e-171   Nicotiana tomentosiformis
ref|XP_009782922.1|  PREDICTED: chlorophyll a-b binding protein 5...    489   3e-171   Nicotiana sylvestris
ref|XP_011085268.1|  PREDICTED: chlorophyll a-b binding protein 2...    489   4e-171   Sesamum indicum [beniseed]
gb|ABF17940.1|  putative chloroplast chlorophyll a/b-binding protein    489   4e-171   Carya cathayensis
ref|XP_009782923.1|  PREDICTED: chlorophyll a-b binding protein 5...    489   4e-171   Nicotiana sylvestris
ref|XP_009795314.1|  PREDICTED: chlorophyll a-b binding protein 1...    489   5e-171   Nicotiana sylvestris
ref|XP_006356073.1|  PREDICTED: chlorophyll a-b binding protein 3...    489   6e-171   Solanum tuberosum [potatoes]
ref|XP_006364025.1|  PREDICTED: chlorophyll a-b binding protein 5...    489   7e-171   Solanum tuberosum [potatoes]
sp|P04783.1|CB25_PETSP  RecName: Full=Chlorophyll a-b binding pro...    489   8e-171   Petunia sp.
ref|XP_009606802.1|  PREDICTED: chlorophyll a-b binding protein 1...    488   9e-171   Nicotiana tomentosiformis
ref|XP_006356078.1|  PREDICTED: chlorophyll a-b binding protein 3...    488   1e-170   
ref|XP_008784387.1|  PREDICTED: chlorophyll a-b binding protein o...    488   1e-170   Phoenix dactylifera
ref|XP_009606800.1|  PREDICTED: chlorophyll a-b binding protein 5...    488   1e-170   Nicotiana tomentosiformis
ref|XP_009396492.1|  PREDICTED: chlorophyll a-b binding protein o...    488   1e-170   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009628757.1|  PREDICTED: chlorophyll a-b binding protein 1...    488   1e-170   Nicotiana tomentosiformis
ref|XP_009782905.1|  PREDICTED: chlorophyll a-b binding protein 7...    488   1e-170   Nicotiana sylvestris
ref|XP_002316737.1|  Chlorophyll a-b binding protein 2                  488   2e-170   Populus trichocarpa [western balsam poplar]
ref|XP_009611577.1|  PREDICTED: chlorophyll a-b binding protein 4...    488   2e-170   Nicotiana tomentosiformis
ref|XP_008439658.1|  PREDICTED: chlorophyll a-b binding protein o...    488   2e-170   Cucumis melo [Oriental melon]
ref|XP_011011531.1|  PREDICTED: chlorophyll a-b binding protein o...    487   2e-170   Populus euphratica
ref|XP_010243713.1|  PREDICTED: chlorophyll a-b binding protein o...    487   2e-170   Nelumbo nucifera [Indian lotus]
gb|AAA34148.1|  chlorophyll a/b-binding protein Cab-3C                  487   4e-170   Solanum lycopersicum
ref|XP_010317413.1|  PREDICTED: chlorophyll a-b binding protein 3...    487   4e-170   Solanum lycopersicum
ref|XP_009775533.1|  PREDICTED: chlorophyll a-b binding protein 7...    487   4e-170   Nicotiana sylvestris
ref|XP_009421488.1|  PREDICTED: chlorophyll a-b binding protein o...    487   4e-170   Musa acuminata subsp. malaccensis [pisang utan]
sp|P12470.1|CB25_NICPL  RecName: Full=Chlorophyll a-b binding pro...    486   5e-170   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|P27496.1|CB25_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    486   5e-170   Nicotiana tabacum [American tobacco]
ref|XP_002519724.1|  chlorophyll A/B binding protein, putative          486   7e-170   Ricinus communis
ref|XP_006356075.1|  PREDICTED: chlorophyll a-b binding protein 3...    486   8e-170   Solanum tuberosum [potatoes]
gb|ABB55370.1|  chlorophyll a-b binding protein 3C-like                 486   9e-170   Solanum tuberosum [potatoes]
ref|XP_010052093.1|  PREDICTED: chlorophyll a-b binding protein o...    486   9e-170   Eucalyptus grandis [rose gum]
ref|XP_009618330.1|  PREDICTED: chlorophyll a-b binding protein 4...    486   1e-169   Nicotiana tomentosiformis
sp|P27491.1|CB27_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    486   1e-169   Nicotiana tabacum [American tobacco]
ref|XP_009759685.1|  PREDICTED: chlorophyll a-b binding protein 4...    485   1e-169   Nicotiana sylvestris
ref|XP_008779641.1|  PREDICTED: chlorophyll a-b binding protein o...    485   2e-169   Phoenix dactylifera
ref|XP_006356074.1|  PREDICTED: chlorophyll a-b binding protein 3...    485   2e-169   Solanum tuberosum [potatoes]
emb|CAA78379.1|  chlorophyll a/b-binding protein PS II-Type I           484   3e-169   Solanum tuberosum [potatoes]
sp|P12469.1|CB23_NICPL  RecName: Full=Chlorophyll a-b binding pro...    484   5e-169   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_012072080.1|  PREDICTED: chlorophyll a-b binding protein o...    484   6e-169   Jatropha curcas
ref|XP_009395692.1|  PREDICTED: chlorophyll a-b binding protein o...    484   6e-169   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006356076.1|  PREDICTED: chlorophyll a-b binding protein 3...    484   6e-169   
ref|XP_009782821.1|  PREDICTED: chlorophyll a-b binding protein 7...    484   7e-169   Nicotiana sylvestris
ref|XP_004147416.1|  PREDICTED: chlorophyll a-b binding protein o...    483   9e-169   Cucumis sativus [cucumbers]
gb|AFC91647.1|  chloroplast chlorophyll A/B binding protein             483   1e-168   Hevea brasiliensis [jebe]
gb|KJB66916.1|  hypothetical protein B456_010G165100                    483   1e-168   Gossypium raimondii
ref|XP_008444193.1|  PREDICTED: chlorophyll a-b binding protein o...    483   2e-168   Cucumis melo [Oriental melon]
gb|KCW75952.1|  hypothetical protein EUGRSUZ_D00320                     483   2e-168   Eucalyptus grandis [rose gum]
ref|XP_010924306.1|  PREDICTED: chlorophyll a-b binding protein o...    483   2e-168   Elaeis guineensis
ref|XP_010052095.1|  PREDICTED: chlorophyll a-b binding protein o...    482   2e-168   Eucalyptus grandis [rose gum]
ref|XP_010247422.1|  PREDICTED: chlorophyll a-b binding protein o...    482   2e-168   Nelumbo nucifera [Indian lotus]
ref|XP_008439659.1|  PREDICTED: chlorophyll a-b binding protein o...    485   2e-168   
ref|XP_010056879.1|  PREDICTED: chlorophyll a-b binding protein o...    482   2e-168   Eucalyptus grandis [rose gum]
gb|KCW75953.1|  hypothetical protein EUGRSUZ_D00321                     483   3e-168   Eucalyptus grandis [rose gum]
ref|XP_008800689.1|  PREDICTED: chlorophyll a-b binding protein o...    482   3e-168   Phoenix dactylifera
gb|AHB24929.1|  chloroplast light-harvesting complex II chlorophy...    482   3e-168   Sedum alfredii
ref|XP_002524616.1|  chlorophyll A/B binding protein, putative          482   4e-168   Ricinus communis
ref|XP_010904844.1|  PREDICTED: chlorophyll a-b binding protein o...    481   4e-168   Elaeis guineensis
ref|XP_006356080.1|  PREDICTED: chlorophyll a-b binding protein 3...    481   5e-168   Solanum tuberosum [potatoes]
gb|ACO51067.1|  chloroplast chlorophyll A-B binding protein             481   5e-168   Gossypium hirsutum [American cotton]
ref|XP_010275593.1|  PREDICTED: chlorophyll a-b binding protein o...    481   6e-168   Nelumbo nucifera [Indian lotus]
gb|AIR93785.1|  chloroplast light harvesting chlorophyll A/B bind...    481   7e-168   Kalanchoe fedtschenkoi [lavender-scallops]
gb|KJB69716.1|  hypothetical protein B456_011G041600                    481   8e-168   Gossypium raimondii
sp|P04781.1|CB23_PETSP  RecName: Full=Chlorophyll a-b binding pro...    481   8e-168   Petunia sp.
gb|EYU28462.1|  hypothetical protein MIMGU_mgv1a012008mg                480   1e-167   Erythranthe guttata [common monkey flower]
ref|XP_002306927.1|  Chlorophyll a-b binding protein 2                  480   2e-167   Populus trichocarpa [western balsam poplar]
gb|EYU28187.1|  hypothetical protein MIMGU_mgv1a009948mg                482   2e-167   Erythranthe guttata [common monkey flower]
ref|XP_008229430.1|  PREDICTED: chlorophyll a-b binding protein o...    480   2e-167   Prunus mume [ume]
ref|XP_004234241.1|  PREDICTED: uncharacterized protein LOC101245729    491   2e-167   
gb|KCW75954.1|  hypothetical protein EUGRSUZ_D00322                     483   2e-167   Eucalyptus grandis [rose gum]
gb|AEQ67395.1|  chloroplast chlorophyll A/B binding protein             479   3e-167   Canarium album [Chinese white-olive]
emb|CAJ77390.1|  major chlorophyll a/b binding protein LHCb1.2          479   3e-167   Spinacia oleracea
gb|AAA18529.1|  chlorophyll A/B binding protein                         479   4e-167   Gossypium hirsutum [American cotton]
ref|XP_004294267.1|  PREDICTED: chlorophyll a-b binding protein o...    479   4e-167   Fragaria vesca subsp. vesca
ref|XP_009775649.1|  PREDICTED: chlorophyll a-b binding protein 2...    479   6e-167   Nicotiana sylvestris
ref|XP_010685893.1|  PREDICTED: chlorophyll a-b binding protein, ...    479   6e-167   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009630190.1|  PREDICTED: chlorophyll a-b binding protein 2...    479   6e-167   Nicotiana tomentosiformis
gb|ABF70112.1|  chlorophyll A-B binding protein (CAB), putative         478   7e-167   Musa balbisiana [starchy banana]
sp|P04782.1|CB24_PETSP  RecName: Full=Chlorophyll a-b binding pro...    478   9e-167   Petunia sp.
ref|XP_002307725.1|  Chlorophyll a-b binding protein 2                  478   9e-167   Populus trichocarpa [western balsam poplar]
gb|EYU28186.1|  hypothetical protein MIMGU_mgv1a012011mg                478   9e-167   Erythranthe guttata [common monkey flower]
gb|AAA80593.1|  chlorophyll a/b binding protein                         478   1e-166   Solanum tuberosum [potatoes]
emb|CAX64458.1|  major chlorophyll a/b binding protein LHCb1.4 pr...    478   1e-166   Spinacia oleracea
ref|XP_009598574.1|  PREDICTED: chlorophyll a-b binding protein 2...    478   1e-166   Nicotiana tomentosiformis
ref|NP_001266111.1|  chlorophyll a-b binding protein AB80, chloro...    478   1e-166   Cicer arietinum [garbanzo]
gb|EYU28185.1|  hypothetical protein MIMGU_mgv1a012021mg                478   1e-166   Erythranthe guttata [common monkey flower]
sp|P12333.1|CB2A_SPIOL  RecName: Full=Chlorophyll a-b binding pro...    478   1e-166   Spinacia oleracea
gb|KJB57287.1|  hypothetical protein B456_009G156900                    478   1e-166   Gossypium raimondii
ref|XP_009389379.1|  PREDICTED: chlorophyll a-b binding protein o...    478   2e-166   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009786355.1|  PREDICTED: chlorophyll a-b binding protein 2...    477   2e-166   Nicotiana sylvestris
gb|ACR08639.1|  chloroplast chlorophyll A/B binding protein             477   2e-166   Mangifera indica
gb|AGJ50622.1|  chlorophyll a/b binding protein                         477   2e-166   Salicornia brachiata
ref|XP_009416547.1|  PREDICTED: chlorophyll a-b binding protein o...    477   2e-166   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001240146.1|  chlorophyll a-b binding protein 21, chloropl...    477   2e-166   Glycine max [soybeans]
ref|XP_010231410.1|  PREDICTED: chlorophyll a-b binding protein o...    477   3e-166   Brachypodium distachyon [annual false brome]
ref|XP_007215816.1|  hypothetical protein PRUPE_ppa010034mg             477   3e-166   Prunus persica
ref|XP_007217260.1|  hypothetical protein PRUPE_ppa010015mg             477   3e-166   Prunus persica
ref|XP_011045092.1|  PREDICTED: chlorophyll a-b binding protein o...    476   4e-166   Populus euphratica
ref|XP_007211869.1|  hypothetical protein PRUPE_ppa010099mg             476   4e-166   Prunus persica
gb|AAA33396.1|  light-harvesting chlorophyll a/b protein precursor      476   4e-166   Lemna gibba
ref|XP_008229429.1|  PREDICTED: chlorophyll a-b binding protein o...    476   4e-166   Prunus mume [ume]
ref|XP_006467509.1|  PREDICTED: chlorophyll a-b binding protein 3...    476   4e-166   Citrus sinensis [apfelsine]
ref|XP_007211864.1|  hypothetical protein PRUPE_ppa010081mg             476   4e-166   Prunus persica
ref|XP_009775645.1|  PREDICTED: chlorophyll a-b binding protein 2...    476   4e-166   Nicotiana sylvestris
ref|XP_009598577.1|  PREDICTED: chlorophyll a-b binding protein 2...    476   5e-166   Nicotiana tomentosiformis
ref|XP_007025148.1|  Chlorophyll a-b binding protein, chloroplastic     476   5e-166   Theobroma cacao [chocolate]
dbj|BAA25389.1|  light harvesting chlorophyll a/b-binding protein       476   5e-166   Nicotiana sylvestris
gb|AAC25775.1|  chlorophyll a/b binding protein                         476   5e-166   Medicago sativa [alfalfa]
gb|ACN41907.1|  chlorophyll A/B binding protein                         476   5e-166   Gardenia jasminoides
ref|XP_012072079.1|  PREDICTED: chlorophyll a-b binding protein o...    476   6e-166   Jatropha curcas
gb|AFK40061.1|  unknown                                                 476   7e-166   Medicago truncatula
gb|AAB61238.1|  chlorophyll a/b-binding protein                         476   7e-166   Mesembryanthemum crystallinum
gb|ABD38707.1|  chloroplast chlorophyll a/b binding protein             476   7e-166   Pachysandra terminalis
ref|XP_007025143.1|  Chlorophyll a-b binding protein, chloroplastic     476   8e-166   
ref|XP_009775650.1|  PREDICTED: chlorophyll a-b binding protein 2...    476   8e-166   Nicotiana sylvestris
ref|XP_008364191.1|  PREDICTED: chlorophyll a-b binding protein o...    476   9e-166   
ref|XP_008356026.1|  PREDICTED: chlorophyll a-b binding protein o...    476   9e-166   Malus domestica [apple tree]
sp|P04780.1|CB22_PETSP  RecName: Full=Chlorophyll a-b binding pro...    476   1e-165   Petunia sp.
ref|XP_003548104.1|  PREDICTED: chlorophyll a-b binding protein 2...    475   1e-165   
gb|KDP37944.1|  hypothetical protein JCGZ_04587                         475   1e-165   Jatropha curcas
emb|CAJ77391.1|  major chlorophyll a/b binding protein LHCb1.1          475   2e-165   Spinacia oleracea
gb|AAB61237.1|  chlorophyll a/b-binding protein                         475   2e-165   Mesembryanthemum crystallinum
gb|EYU28183.1|  hypothetical protein MIMGU_mgv1a012019mg                475   2e-165   Erythranthe guttata [common monkey flower]
ref|XP_006449644.1|  hypothetical protein CICLE_v10016074mg             476   2e-165   
ref|XP_003548106.1|  PREDICTED: chlorophyll a/b-binding protein p...    475   2e-165   
ref|XP_006449645.1|  hypothetical protein CICLE_v10016286mg             475   2e-165   
gb|AAB61236.1|  chlorophyll a/b-binding protein                         475   2e-165   Mesembryanthemum crystallinum
ref|XP_002285646.1|  PREDICTED: chlorophyll a-b binding protein o...    475   2e-165   Vitis vinifera
ref|XP_006449643.1|  hypothetical protein CICLE_v10016287mg             474   2e-165   Citrus clementina [clementine]
ref|XP_004961193.1|  PREDICTED: chlorophyll a-b binding protein M...    474   2e-165   Setaria italica
ref|XP_006365560.1|  PREDICTED: chlorophyll a-b binding protein 1...    474   2e-165   Solanum tuberosum [potatoes]
gb|AFI60242.1|  light harvesting chlorophyll a/b binding protein        474   3e-165   Panicum virgatum
ref|XP_011045093.1|  PREDICTED: chlorophyll a-b binding protein o...    474   3e-165   Populus euphratica
emb|CDP06328.1|  unnamed protein product                                474   3e-165   Coffea canephora [robusta coffee]
ref|XP_008356022.1|  PREDICTED: chlorophyll a-b binding protein o...    474   4e-165   
ref|XP_008364187.1|  PREDICTED: chlorophyll a-b binding protein o...    474   4e-165   
ref|XP_004303878.1|  PREDICTED: chlorophyll a-b binding protein o...    474   5e-165   Fragaria vesca subsp. vesca
ref|XP_010926397.1|  PREDICTED: chlorophyll a-b binding protein o...    474   5e-165   Elaeis guineensis
gb|AHM26643.1|  a-b binding protein                                     474   6e-165   Pyrus x bretschneideri [bai li]
ref|XP_008366007.1|  PREDICTED: chlorophyll a-b binding protein o...    474   6e-165   
ref|XP_008371581.1|  PREDICTED: chlorophyll a-b binding protein o...    474   6e-165   
ref|XP_007158464.1|  hypothetical protein PHAVU_002G154500g             473   6e-165   Phaseolus vulgaris [French bean]
ref|XP_006365572.1|  PREDICTED: chlorophyll a-b binding protein 1...    473   7e-165   Solanum tuberosum [potatoes]
gb|AAR10886.1|  chlorophyll a/b binding protein                         473   7e-165   Trifolium pratense [peavine clover]
ref|XP_004303877.1|  PREDICTED: chlorophyll a-b binding protein o...    473   7e-165   Fragaria vesca subsp. vesca
ref|XP_006368026.1|  PREDICTED: chlorophyll a-b binding protein 1...    473   8e-165   Solanum tuberosum [potatoes]
ref|XP_009598575.1|  PREDICTED: chlorophyll a-b binding protein 2...    473   8e-165   Nicotiana tomentosiformis
ref|XP_006365573.1|  PREDICTED: chlorophyll a-b binding protein 1...    473   9e-165   
ref|XP_010052094.1|  PREDICTED: chlorophyll a-b binding protein o...    478   1e-164   
gb|AAA80591.1|  chlorophyll a/b binding protein                         473   1e-164   Solanum tuberosum [potatoes]
gb|AAH53854.1|  Unknown (protein for IMAGE:5194336)                     474   1e-164   Homo sapiens [man]
ref|XP_008371583.1|  PREDICTED: chlorophyll a-b binding protein o...    474   1e-164   
gb|EYU38943.1|  hypothetical protein MIMGU_mgv1a012024mg                473   2e-164   Erythranthe guttata [common monkey flower]
emb|CDP06329.1|  unnamed protein product                                473   2e-164   Coffea canephora [robusta coffee]
gb|ABQ81856.1|  chloroplast chlorophyll a/b binding protein             473   2e-164   Phyllostachys edulis [kikko-chiku]
ref|XP_002283566.1|  PREDICTED: chlorophyll a-b binding protein o...    473   2e-164   Vitis vinifera
dbj|BAJ08392.1|  light harvesting chlorophyll a/b-binding protein...    473   2e-164   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADL41158.1|  chloroplast light-harvesting chlorophyll a/b bind...    473   2e-164   Triticum aestivum [Canadian hard winter wheat]
gb|EYU28184.1|  hypothetical protein MIMGU_mgv1a011918mg                472   2e-164   Erythranthe guttata [common monkey flower]
gb|EMT29002.1|  Chlorophyll a-b binding protein, chloroplastic          472   2e-164   
ref|XP_006856963.1|  PREDICTED: chlorophyll a-b binding protein o...    472   2e-164   Amborella trichopoda
ref|XP_004233096.1|  PREDICTED: chlorophyll a-b binding protein 1...    472   3e-164   
gb|AAA80592.1|  chlorophyll a/b binding protein                         472   3e-164   Solanum tuberosum [potatoes]
ref|XP_007151996.1|  hypothetical protein PHAVU_004G093000g             472   3e-164   Phaseolus vulgaris [French bean]
ref|XP_009377335.1|  PREDICTED: chlorophyll a-b binding protein o...    472   3e-164   Pyrus x bretschneideri [bai li]
gb|AGV54498.1|  LHCII type I chlorophyll a/b-binding protein            471   3e-164   Phaseolus vulgaris [French bean]
ref|XP_007151979.1|  hypothetical protein PHAVU_004G091600g             471   4e-164   Phaseolus vulgaris [French bean]
gb|AAF89206.1|AF279249_1  LHCII type I chlorophyll a/b-binding pr...    471   4e-164   Vigna radiata [mung bean]
ref|XP_009377344.1|  PREDICTED: chlorophyll a-b binding protein o...    471   4e-164   Pyrus x bretschneideri [bai li]
ref|XP_010097596.1|  Chlorophyll a-b binding protein 40                 471   5e-164   Morus notabilis
dbj|BAA24493.1|  chlorophyll a/b-binding protein                        471   5e-164   Fagus crenata
gb|ACU23974.1|  unknown                                                 471   6e-164   Glycine max [soybeans]
gb|AAA80594.1|  chlorophyll a/b binding protein                         471   6e-164   Solanum tuberosum [potatoes]
prf||1204205B  protein 1B,chlorophyll binding                           471   6e-164
dbj|BAJ93064.1|  predicted protein                                      471   9e-164   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP06330.1|  unnamed protein product                                471   9e-164   Coffea canephora [robusta coffee]
gb|ACD64978.1|  chloroplast chlorophyll a/b-binding protein             471   1e-163   Ophiopogon japonicus
gb|AAF89207.1|AF279250_1  LHCII type I chlorophyll a/b-binding pr...    470   1e-163   Vigna radiata [mung bean]
gb|AEO51755.1|  chloroplast chlorophyll A/B binding protein             470   1e-163   Dimocarpus longan [longan]
gb|AGV54521.1|  LHCII type I chlorophyll a/b-binding protein            470   1e-163   Phaseolus vulgaris [French bean]
ref|XP_010231015.1|  PREDICTED: chlorophyll a-b binding protein o...    470   1e-163   Brachypodium distachyon [annual false brome]
gb|ABW70800.1|  chloroplast light harvesting chlorophyll a/b bind...    470   1e-163   Populus euphratica
ref|XP_004233101.1|  PREDICTED: chlorophyll a-b binding protein 1...    470   1e-163   
ref|XP_007151990.1|  hypothetical protein PHAVU_004G092600g             470   1e-163   Phaseolus vulgaris [French bean]
ref|XP_010666512.1|  PREDICTED: chlorophyll a-b binding protein, ...    470   1e-163   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010097597.1|  Chlorophyll a-b binding protein 40                 470   2e-163   Morus notabilis
ref|XP_004293579.1|  PREDICTED: chlorophyll a-b binding protein o...    470   2e-163   Fragaria vesca subsp. vesca
gb|EYU29602.1|  hypothetical protein MIMGU_mgv1a019986mg                469   2e-163   Erythranthe guttata [common monkey flower]
gb|EYU19613.1|  hypothetical protein MIMGU_mgv1a011885mg                470   2e-163   Erythranthe guttata [common monkey flower]
gb|EYU29604.1|  hypothetical protein MIMGU_mgv1a023200mg                469   2e-163   Erythranthe guttata [common monkey flower]
sp|P07371.1|CB22_PEA  RecName: Full=Chlorophyll a-b binding prote...    470   2e-163   Pisum sativum [garden pea]
gb|ABQ81857.1|  chloroplast chlorophyll a/b binding protein             469   3e-163   Phyllostachys edulis [kikko-chiku]
ref|XP_002515206.1|  chlorophyll A/B binding protein, putative          469   3e-163   Ricinus communis
ref|XP_004302854.1|  PREDICTED: chlorophyll a-b binding protein o...    469   3e-163   Fragaria vesca subsp. vesca
ref|XP_006467511.1|  PREDICTED: chlorophyll a-b binding protein 3...    474   3e-163   
ref|XP_010316912.1|  PREDICTED: chlorophyll a-b binding protein 1...    469   3e-163   
sp|P12329.1|CB21_MAIZE  RecName: Full=Chlorophyll a-b binding pro...    469   3e-163   Zea mays [maize]
sp|P04779.1|CB21_PETSP  RecName: Full=Chlorophyll a-b binding pro...    469   4e-163   Petunia sp.
gb|ABN49454.2|  chloroplast chlorophyll a/b binding protein             469   4e-163   Pisum sativum [garden pea]
ref|XP_010316911.1|  PREDICTED: chlorophyll a-b binding protein 1...    469   4e-163   
ref|NP_001241277.1|  uncharacterized protein LOC100805310               469   5e-163   Glycine max [soybeans]
dbj|BAJ90643.1|  predicted protein                                      469   5e-163   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT29003.1|  Chlorophyll a-b binding protein, chloroplastic          469   5e-163   
gb|EMS50796.1|  Chlorophyll a-b binding protein, chloroplastic          469   5e-163   Triticum urartu
gb|EMS51039.1|  Chlorophyll a-b binding protein 3C, chloroplastic       469   6e-163   Triticum urartu
ref|XP_010237260.1|  PREDICTED: chlorophyll a-b binding protein o...    469   6e-163   Brachypodium distachyon [annual false brome]
ref|XP_004957570.1|  PREDICTED: chlorophyll a-b binding protein 1...    468   7e-163   Setaria italica
gb|AAF26741.1|AF220527_1  chlorophyll a/b binding protein precursor     468   7e-163   Euphorbia esula [wolf's milk]
gb|KHN28981.1|  Chlorophyll a-b binding protein 3, chloroplastic        468   7e-163   Glycine soja [wild soybean]
gb|AAB18209.1|  chlorophyll a/b-binding protein WCAB precursor          468   9e-163   Triticum aestivum [Canadian hard winter wheat]
gb|AFV34722.1|  light harvesting chlorophyll a/b-binding protein 1-1    468   9e-163   Dendrocalamus latiflorus [sweet bamboo]
gb|AAZ79657.1|  putative chlorophyll a/b-binding protein                468   1e-162   Fagus sylvatica
ref|NP_001147639.1|  chlorophyll a-b binding protein 1, chloropla...    468   1e-162   
ref|XP_010666522.1|  PREDICTED: uncharacterized protein LOC104883672    481   2e-162   
gb|AAW31511.1|  light-harvesting chlorophyll-a/b binding protein ...    467   2e-162   Pisum sativum [garden pea]
gb|EYU19649.1|  hypothetical protein MIMGU_mgv1a011927mg                467   2e-162   Erythranthe guttata [common monkey flower]
ref|XP_002455902.1|  hypothetical protein SORBIDRAFT_03g027040          467   2e-162   Sorghum bicolor [broomcorn]
ref|XP_008358195.1|  PREDICTED: chlorophyll a-b binding protein o...    467   2e-162   Malus domestica [apple tree]
ref|XP_011460161.1|  PREDICTED: chlorophyll a-b binding protein o...    467   2e-162   Fragaria vesca subsp. vesca
ref|XP_009377327.1|  PREDICTED: chlorophyll a-b binding protein o...    467   3e-162   Pyrus x bretschneideri [bai li]
ref|XP_009400578.1|  PREDICTED: chlorophyll a-b binding protein o...    467   3e-162   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004969083.1|  PREDICTED: chlorophyll a-b binding protein 2...    466   3e-162   Setaria italica
gb|EYU35814.1|  hypothetical protein MIMGU_mgv1a011908mg                466   5e-162   Erythranthe guttata [common monkey flower]
gb|AES74698.2|  light-harvesting complex I chlorophyll A/B-bindin...    466   5e-162   Medicago truncatula
ref|XP_002455901.1|  hypothetical protein SORBIDRAFT_03g027030          466   6e-162   Sorghum bicolor [broomcorn]
gb|EMS67016.1|  Chlorophyll a-b binding protein, chloroplastic          466   6e-162   Triticum urartu
gb|EMT02412.1|  Chlorophyll a-b binding protein, chloroplastic          466   6e-162   
ref|XP_007221496.1|  hypothetical protein PRUPE_ppa010066mg             466   6e-162   Prunus persica
sp|P09756.1|CB23_SOYBN  RecName: Full=Chlorophyll a-b binding pro...    466   7e-162   Glycine max [soybeans]
gb|EPS64140.1|  chlorophyll a-b binding protein 21, chloroplastic       466   7e-162   Genlisea aurea
gb|EYU43289.1|  hypothetical protein MIMGU_mgv11b019945mg               466   8e-162   Erythranthe guttata [common monkey flower]
ref|NP_001142284.1|  uncharacterized protein LOC100274453               466   8e-162   Zea mays [maize]
gb|AFW90512.1|  chlorophyll a/b-binding protein                         466   8e-162   Phaseolus vulgaris [French bean]
gb|EMS57503.1|  Chlorophyll a-b binding protein, chloroplastic          466   8e-162   Triticum urartu
gb|EYU43278.1|  hypothetical protein MIMGU_mgv1a011933mg                466   8e-162   Erythranthe guttata [common monkey flower]
dbj|BAJ89881.1|  predicted protein                                      466   8e-162   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAB87573.1|  chlorophyll a/b binding protein of LHCII type I p...    466   9e-162   Panax ginseng [Asiatic ginseng]
dbj|BAJ85110.1|  predicted protein                                      466   9e-162   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACU23816.1|  unknown                                                 465   9e-162   Glycine max [soybeans]
gb|ABM66819.1|  chloroplast light-harvesting chlorophyll a/b bind...    465   1e-161   Bambusa oldhamii
ref|XP_009363087.1|  PREDICTED: chlorophyll a-b binding protein o...    465   1e-161   
dbj|BAK02173.1|  predicted protein                                      465   1e-161   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002460622.1|  hypothetical protein SORBIDRAFT_02g032040          465   1e-161   Sorghum bicolor [broomcorn]
gb|AAD21625.1|  putative chlorophyll a/b-binding protein                465   2e-161   Phalaenopsis hybrid cultivar
gb|ABQ32304.1|  chloroplast light-harvesting chlorophyll a/b-bind...    464   2e-161   Artemisia annua [sweet Annie]
ref|XP_008343203.1|  PREDICTED: chlorophyll a-b binding protein o...    467   2e-161   
ref|XP_007158961.1|  hypothetical protein PHAVU_002G196400g             464   3e-161   Phaseolus vulgaris [French bean]
gb|KEH25006.1|  light-harvesting complex I chlorophyll A/B-bindin...    464   4e-161   Medicago truncatula
gb|EMS50797.1|  Chlorophyll a-b binding protein, chloroplastic          464   5e-161   Triticum urartu
gb|KEH25007.1|  light-harvesting complex I chlorophyll A/B-bindin...    463   6e-161   Medicago truncatula
dbj|BAJ87045.1|  predicted protein                                      463   6e-161   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|P27490.1|CB28_PEA  RecName: Full=Chlorophyll a-b binding prote...    463   7e-161   Pisum sativum [garden pea]
gb|AEY85026.1|  light-harvesting complex II protein                     463   7e-161   Cajanus cajan
ref|XP_003578592.1|  PREDICTED: chlorophyll a-b binding protein o...    463   9e-161   Brachypodium distachyon [annual false brome]
dbj|BAJ90772.1|  predicted protein                                      463   1e-160   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH25005.1|  light-harvesting complex I chlorophyll A/B-bindin...    462   1e-160   Medicago truncatula
dbj|BAA03104.1|  light-harvesting chlorophyll a/b-binding protein...    462   1e-160   Lactuca sativa [cultivated lettuce]
gb|AHA84197.1|  chlorophyll a/b-binding protein                         462   1e-160   
ref|XP_006368025.1|  PREDICTED: chlorophyll a-b binding protein 1...    462   2e-160   
gb|ACN31249.1|  unknown                                                 461   2e-160   
gb|EMT04380.1|  Chlorophyll a-b binding protein, chloroplastic          467   2e-160   
ref|NP_001235283.1|  chlorophyll a/b-binding protein                    462   3e-160   
gb|AEV59640.1|  chloroplast photosystem II light harvesting compl...    461   3e-160   
ref|XP_002275075.1|  PREDICTED: chlorophyll a-b binding protein o...    462   3e-160   
ref|XP_009360962.1|  PREDICTED: chlorophyll a-b binding protein o...    462   3e-160   
ref|XP_003633024.1|  PREDICTED: chlorophyll a-b binding protein o...    461   3e-160   
gb|EMS45686.1|  Chlorophyll a-b binding protein, chloroplastic          461   4e-160   
gb|AEV59639.1|  chloroplast photosystem II light harvesting compl...    460   4e-160   
gb|AHA84168.1|  chlorophyll a/b-binding protein                         461   4e-160   
dbj|BAJ86427.1|  predicted protein                                      461   4e-160   
gb|AAA60965.1|  light-harvesting chlorophyll a/b binding protein ...    461   4e-160   
gb|EMT02225.1|  Chlorophyll a-b binding protein, chloroplastic          461   5e-160   
ref|NP_001043493.1|  Os01g0600900                                       461   5e-160   
sp|P08963.1|CB22_HORVU  RecName: Full=Chlorophyll a-b binding pro...    461   6e-160   
ref|NP_001062939.1|  Os09g0346500                                       461   6e-160   
ref|XP_002302798.2|  hypothetical protein POPTR_0002s19010g             461   7e-160   
emb|CAN78667.1|  hypothetical protein VITISV_031287                     461   7e-160   
gb|AEV59645.1|  chloroplast photosystem II light harvesting compl...    459   7e-160   
gb|ADC35579.1|  chloroplast chlorophyll a/b binding protein             461   7e-160   
ref|XP_006365561.1|  PREDICTED: chlorophyll a-b binding protein 1...    461   8e-160   
ref|NP_001148439.1|  chlorophyll a-b binding protein 2                  461   9e-160   
gb|ACL50948.1|  putative chloroplast chlorophyll a/b binding protein    460   9e-160   
gb|AAD27879.2|AF139467_1  LHCII type I chlorophyll a/b binding pr...    460   1e-159   
gb|EMT04379.1|  Chlorophyll a-b binding protein, chloroplastic          460   1e-159   
dbj|BAJ87240.1|  predicted protein                                      460   1e-159   
ref|XP_004489391.1|  PREDICTED: chlorophyll a-b binding protein 3...    460   1e-159   
ref|XP_004148579.1|  PREDICTED: chlorophyll a-b binding protein o...    460   2e-159   
tpg|DAA58853.1|  TPA: hypothetical protein ZEAMMB73_924562              459   2e-159   
gb|AFK39586.1|  unknown                                                 459   3e-159   
gb|EMS51257.1|  Chlorophyll a-b binding protein 1, chloroplastic        460   3e-159   
ref|XP_008675448.1|  PREDICTED: chlorophyll a-b binding protein o...    459   4e-159   
gb|EMT25652.1|  hypothetical protein F775_43704                         473   5e-159   
gb|AEV59643.1|  chloroplast photosystem II light harvesting compl...    457   5e-159   
dbj|BAK03973.1|  predicted protein                                      459   5e-159   
ref|XP_006660556.1|  PREDICTED: chlorophyll a-b binding protein 2...    458   5e-159   
gb|AFW90565.1|  chlorophyll a-b binding protein 3C-like mRNA            457   5e-159   
prf||1503276A  chlorophyll a/b binding protein                          457   7e-159
ref|XP_006415534.1|  hypothetical protein EUTSA_v10008479mg             458   8e-159   
sp|P92919.1|CB23_APIGR  RecName: Full=Chlorophyll a-b binding pro...    458   9e-159   
gb|AEV59642.1|  chloroplast photosystem II light harvesting compl...    457   1e-158   
gb|EYU43279.1|  hypothetical protein MIMGU_mgv1a011871mg                457   2e-158   
dbj|BAA00536.1|  type I light-harvesting chlorophyll a/b-binding ...    457   2e-158   
ref|XP_002273106.2|  PREDICTED: chlorophyll a-b binding protein o...    457   2e-158   
ref|XP_008447450.1|  PREDICTED: chlorophyll a-b binding protein o...    457   2e-158   
ref|XP_010538237.1|  PREDICTED: chlorophyll a-b binding protein 1...    456   3e-158   
gb|EMS59660.1|  Chlorophyll a-b binding protein, chloroplastic          458   4e-158   
ref|XP_006840304.2|  PREDICTED: chlorophyll a-b binding protein o...    456   4e-158   
gb|ERN01979.1|  hypothetical protein AMTR_s00045p00069900               456   5e-158   
ref|XP_010549470.1|  PREDICTED: chlorophyll a-b binding protein 1...    456   6e-158   
gb|KHN41291.1|  Chlorophyll a-b binding protein of LHCII type I, ...    454   8e-158   
ref|XP_010091411.1|  Chlorophyll a-b binding protein 16                 455   1e-157   
sp|P12471.1|CB21_SOYBN  RecName: Full=Chlorophyll a-b binding pro...    454   1e-157   
emb|CDY66768.1|  BnaAnng22920D                                          455   1e-157   
ref|XP_006304391.1|  hypothetical protein CARUB_v10010908mg             455   1e-157   
gb|AEV59641.1|  chloroplast photosystem II light harvesting compl...    454   1e-157   
gb|ABK20976.1|  unknown                                                 455   1e-157   
gb|ACF84273.1|  unknown                                                 455   1e-157   
ref|XP_006305533.1|  hypothetical protein CARUB_v10010022mg             455   2e-157   
ref|XP_009141380.1|  PREDICTED: chlorophyll a-b binding protein 1...    454   2e-157   
gb|AHB24928.1|  chloroplast chlorophyll a-b binding protein 2/3         454   2e-157   
ref|XP_010460769.1|  PREDICTED: chlorophyll a-b binding protein 1...    454   3e-157   
emb|CDY26306.1|  BnaA09g26570D                                          454   3e-157   
ref|XP_010499509.1|  PREDICTED: chlorophyll a-b binding protein 1...    454   3e-157   
emb|CDY35271.1|  BnaC03g59520D                                          454   4e-157   
ref|NP_174286.1|  chlorophyll A/B binding protein 1                     454   4e-157   
gb|EMS67017.1|  Chlorophyll a-b binding protein, chloroplastic          454   4e-157   
ref|XP_010460768.1|  PREDICTED: chlorophyll a-b binding protein 2...    454   4e-157   
emb|CAC38830.1|  chlorophyll a/b binding protein                        454   4e-157   
ref|XP_002890838.1|  hypothetical protein ARALYDRAFT_473204             453   5e-157   
sp|P04784.1|CB21_WHEAT  RecName: Full=Chlorophyll a-b binding pro...    453   5e-157   
pdb|1RWT|A  Chain A, Crystal Structure Of Spinach Major Light-har...    452   5e-157   
gb|KFK36334.1|  hypothetical protein AALP_AA4G109200                    453   6e-157   
gb|KFK44818.1|  hypothetical protein AALP_AA1G306800                    453   6e-157   
gb|ACN40194.1|  unknown                                                 453   7e-157   
ref|XP_002440263.1|  hypothetical protein SORBIDRAFT_09g028720          453   8e-157   
ref|XP_009102798.1|  PREDICTED: chlorophyll a-b binding protein 1...    453   8e-157   
ref|XP_006844081.1|  PREDICTED: chlorophyll a-b binding protein o...    452   1e-156   
ref|NP_564339.1|  chlorophyll A/B binding protein 3                     452   2e-156   
gb|AFW81158.1|  light harvesting chlorophyll a/b binding protein3       454   2e-156   
gb|EMT09894.1|  Chlorophyll a-b binding protein, chloroplastic          452   2e-156   
ref|XP_010499505.1|  PREDICTED: chlorophyll a-b binding protein 2...    452   2e-156   
gb|ACF85694.1|  unknown                                                 452   2e-156   
emb|CAA47950.1|  chlorophyll a/b binding protein                        452   2e-156   
ref|XP_002893588.1|  hypothetical protein ARALYDRAFT_473203             452   2e-156   
ref|XP_006415537.1|  hypothetical protein EUTSA_v10008476mg             452   2e-156   
emb|CAA32108.1|  chlorophyll a/b-binding preprotein (AA -31 to 235)     452   2e-156   
emb|CAA57408.1|  light harvesting chlorophyll a /b-binding protei...    452   3e-156   
emb|CDX99866.1|  BnaC05g22880D                                          451   3e-156   
ref|XP_006840305.1|  PREDICTED: chlorophyll a-b binding protein o...    450   3e-156   
gb|ABK22510.1|  unknown                                                 452   4e-156   
ref|XP_010478366.1|  PREDICTED: chlorophyll a-b binding protein 1...    451   4e-156   
gb|ABG29728.1|  chloroplast chlorophyll a/b binding protein             451   4e-156   
emb|CAA57409.1|  light harvesting chlorophyll a /b-binding protei...    451   4e-156   
ref|XP_010374558.1|  PREDICTED: chlorophyll a-b binding protein o...    450   5e-156   
ref|XP_006410587.1|  hypothetical protein EUTSA_v10017088mg             451   5e-156   
ref|NP_001105545.1|  chlorophyll a-b binding protein M9, chloropl...    451   7e-156   
gb|AAL38341.1|  chlorophyll a/b-binding protein                         451   8e-156   
emb|CAA61432.1|  LHCII type I protein                                   450   9e-156   
emb|CAA32109.1|  chlorophyll a/b-binding preprotein (AA -28 to 235)     450   1e-155   
gb|AAC78690.1|  chlorophyll a/b-binding protein                         450   2e-155   
ref|XP_010509751.1|  PREDICTED: chlorophyll a-b binding protein 1...    449   2e-155   
ref|XP_003618482.1|  Chlorophyll a/b-binding protein                    449   2e-155   
pdb|1VCR|A  Chain A, An Icosahedral Assembly Of Light-Harvesting ...    448   2e-155   
emb|CDX84316.1|  BnaC04g10780D                                          449   2e-155   
sp|P15193.1|CB2A_PINSY  RecName: Full=Chlorophyll a-b binding pro...    449   3e-155   
sp|P13851.1|CB21_SINAL  RecName: Full=Chlorophyll a-b binding pro...    449   3e-155   
ref|NP_565786.1|  photosystem II light harvesting complex protein...    449   3e-155   
emb|CDY17247.1|  BnaA05g09410D                                          449   4e-155   
ref|XP_010504897.1|  PREDICTED: chlorophyll a-b binding protein 1...    449   4e-155   
gb|AAL67432.1|AF458406_1  chlorophyll a/b binding protein               449   4e-155   
ref|XP_006295385.1|  hypothetical protein CARUB_v10024479mg             448   5e-155   
ref|XP_010509756.1|  PREDICTED: chlorophyll a-b binding protein 1...    448   5e-155   
sp|P15194.1|CB2B_PINSY  RecName: Full=Chlorophyll a-b binding pro...    449   5e-155   
ref|XP_006293384.1|  hypothetical protein CARUB_v10023856mg             448   6e-155   
gb|KCW73782.1|  hypothetical protein EUGRSUZ_E02381                     447   7e-155   
emb|CDX98158.1|  BnaC07g09400D                                          448   8e-155   
emb|CDX79562.1|  BnaC03g18980D                                          447   1e-154   
gb|ACN40044.1|  unknown                                                 448   1e-154   
dbj|BAD97888.1|  CAB homologue1                                         446   2e-154   
ref|XP_009132986.1|  PREDICTED: chlorophyll a-b binding protein 1...    447   2e-154   
ref|XP_002879498.1|  LHB1B1                                             447   2e-154   
gb|KFK44817.1|  hypothetical protein AALP_AA1G306700                    447   2e-154   
gb|AFW90594.1|  chloroplast chlorophyll a/b binding protein             447   2e-154   
ref|NP_565787.1|  light-harvesting chlorophyll protein complex II...    447   2e-154   
sp|P24006.1|CB2A_PYRPY  RecName: Full=Chlorophyll a-b binding pro...    447   3e-154   
ref|XP_010504898.1|  PREDICTED: chlorophyll a-b binding protein 1...    446   3e-154   
pdb|2BHW|A  Chain A, Pea Light-Harvesting Complex Ii At 2.5 Angst...    445   3e-154   
ref|NP_001105427.1|  light harvesting chlorophyll a /b binding pr...    446   4e-154   
gb|ACY66805.1|  chlorophyll a/b-binding protein                         446   5e-154   
gb|ADV19258.1|  chlorophyll a/b-binding protein-like protein            444   5e-154   
ref|XP_009143778.1|  PREDICTED: chlorophyll a-b binding protein 1...    446   5e-154   
gb|KFK36335.1|  hypothetical protein AALP_AA4G109300                    446   7e-154   
gb|AAM64379.1|  putative photosystem II type I chlorophyll a b bi...    445   8e-154   
gb|EMT23952.1|  Chlorophyll a-b binding protein 1B, chloroplastic       444   1e-153   
emb|CDY17248.1|  BnaA05g09400D                                          445   1e-153   
ref|XP_009109634.1|  PREDICTED: chlorophyll a-b binding protein 2...    445   1e-153   
sp|P06671.1|CB22_MAIZE  RecName: Full=Chlorophyll a-b binding pro...    445   1e-153   
emb|CAG25596.1|  putative chlorophyll a/b binding protein               443   3e-153   
gb|EYU28189.1|  hypothetical protein MIMGU_mgv1a020664mg                443   5e-153   
gb|AAP44089.1|  chlorophyll a/b binding protein                         444   5e-153   
gb|EMS50795.1|  Chlorophyll a-b binding protein, chloroplastic          445   7e-153   
emb|CAA57407.1|  light harvesting chlorophyll a /b-binding protei...    443   9e-153   
ref|XP_009102801.1|  PREDICTED: chlorophyll a-b binding protein 1...    442   1e-152   
gb|ABK23849.1|  unknown                                                 443   1e-152   
gb|ABK23263.1|  unknown                                                 443   1e-152   
gb|ABK26071.1|  unknown                                                 442   1e-152   
gb|AAG52048.1|AC022455_2  chlorophyll A-B-binding protein 2 precu...    441   1e-152   
emb|CDX84315.1|  BnaC04g10770D                                          444   2e-152   
ref|XP_009143774.1|  PREDICTED: chlorophyll a-b binding protein 1...    441   5e-152   
gb|ABK22330.1|  unknown                                                 441   5e-152   
sp|P09755.1|CB22_SOYBN  RecName: Full=Chlorophyll a-b binding pro...    440   6e-152   
gb|ACN40027.1|  unknown                                                 441   9e-152   
gb|EMS53958.1|  Chlorophyll a-b binding protein 3C, chloroplastic       440   9e-152   
gb|KFK42335.1|  hypothetical protein AALP_AA2G243100                    440   1e-151   
ref|NP_001044090.1|  Os01g0720500                                       439   2e-151   
ref|XP_002960494.1|  light-harvesting complex                           439   4e-151   
pdb|4LCZ|A  Chain A, Crystal Structure Of A Multilayer-packed Maj...    437   4e-151   
ref|XP_002881334.1|  chlorophyll A-B-binding protein 2 precursor        437   5e-151   
prf||1615137B  chlorophyll a/b binding protein P27                      437   6e-151
ref|XP_002967230.1|  light-harvesting complex                           438   7e-151   
emb|CAH59405.1|  light harvesting protein 1                             435   2e-150   
gb|EMT02753.1|  Chlorophyll a-b binding protein 3C, chloroplastic       436   3e-150   
ref|XP_010412864.1|  PREDICTED: uncharacterized protein LOC104699228    446   6e-150   
gb|AAT08647.1|  chloroplast chlorophyll A-B binding protein 3C          431   1e-148   
ref|XP_010235395.1|  PREDICTED: chlorophyll a-b binding protein o...    431   5e-148   
gb|AAB18404.1|  chlorophyll a/b binding protein                         429   1e-147   
gb|EYU29603.1|  hypothetical protein MIMGU_mgv1a025305mg                429   1e-147   
sp|P04159.1|CB21_PEA  RecName: Full=Chlorophyll a-b binding prote...    428   2e-147   
emb|CAA27542.1|  chlorophyll a/b binding protein (LHCP AB 180)          428   2e-147   
ref|XP_011003152.1|  PREDICTED: chlorophyll a-b binding protein o...    428   5e-147   
sp|Q00827.1|CB48_MAIZE  RecName: Full=Chlorophyll a-b binding pro...    427   8e-147   
dbj|BAA32346.1|  light-harvesting chlorophyll a/b-binding protein...    424   3e-145   
ref|XP_001774812.1|  predicted protein                                  421   2e-144   
ref|XP_001774452.1|  predicted protein                                  421   2e-144   
sp|P15195.1|CB23_POLMU  RecName: Full=Chlorophyll a-b binding pro...    421   3e-144   
ref|XP_001755762.1|  predicted protein                                  421   3e-144   
ref|XP_004144543.1|  PREDICTED: chlorophyll a-b binding protein 1...    421   3e-144   
gb|AAU89263.1|  chloroplast light harvesting chlorophyll a/b bind...    420   4e-144   
ref|XP_001779318.1|  predicted protein                                  421   4e-144   
gb|AAU89264.1|  chloroplast light harvesting chlorophyll a/b bind...    420   4e-144   
gb|AHC95482.1|  chlorophyll A/B binding protein                         420   5e-144   
ref|XP_008462084.1|  PREDICTED: chlorophyll a-b binding protein 1...    420   6e-144   
gb|AAB19040.1|  type 2 light-harvesting chlorophyll a/b-binding p...    419   6e-144   
ref|XP_001751426.1|  predicted protein                                  420   7e-144   
ref|XP_001762089.1|  predicted protein                                  420   8e-144   
gb|AAU89261.1|  chloroplast light harvesting chlorophyll a/b bind...    419   1e-143   
ref|XP_001757271.1|  predicted protein                                  419   1e-143   
gb|AAU89257.1|  chloroplast light harvesting chlorophyll a/b bind...    419   2e-143   
gb|AAU89262.1|  chloroplast light harvesting chlorophyll a/b bind...    419   2e-143   
ref|XP_001754234.1|  predicted protein                                  419   2e-143   
gb|AAU89254.1|  chloroplast light harvesting chlorophyll a/b bind...    419   2e-143   
ref|XP_001761868.1|  predicted protein                                  419   2e-143   
gb|AAU89255.1|  chloroplast light harvesting chlorophyll a/b bind...    418   3e-143   
ref|XP_006447758.1|  hypothetical protein CICLE_v10016280mg             419   3e-143   
emb|CAA43907.1|  chlorophyll a/b-binding protein                        419   3e-143   
gb|KDO58421.1|  hypothetical protein CISIN_1g024579mg                   418   4e-143   
ref|XP_001751359.1|  predicted protein                                  418   4e-143   
gb|AAU89252.1|  chloroplast light harvesting chlorophyll a/b bind...    417   4e-143   
gb|AEY78525.1|  chlorophyll a/b-binding protein                         418   5e-143   
gb|ADI88502.1|  protoporphyrin IX magnesium chelatase                   418   6e-143   
gb|AAU89256.1|  chloroplast light harvesting chlorophyll a/b bind...    417   6e-143   
gb|AAU89251.1|  chloroplast light harvesting chlorophyll a/b bind...    417   7e-143   
ref|XP_001775090.1|  predicted protein                                  417   7e-143   
gb|AIW07979.1|  chloroplast light harvesting chlorophyll a/b bind...    417   7e-143   
ref|XP_007049308.1|  Photosystem II light harvesting complex gene...    417   7e-143   
gb|AAU89253.1|  chloroplast light harvesting chlorophyll a/b bind...    417   9e-143   
ref|XP_002531690.1|  chlorophyll A/B binding protein, putative          417   1e-142   
ref|XP_009365212.1|  PREDICTED: chlorophyll a-b binding protein 1...    418   1e-142   
gb|AIW08054.1|  chloroplast light harvesting chlorophyll a/b bind...    417   1e-142   
gb|ABK22382.1|  unknown                                                 417   1e-142   
gb|KHN25879.1|  Chlorophyll a-b binding protein 3, chloroplastic        416   1e-142   
gb|KJB10748.1|  hypothetical protein B456_001G220900                    416   2e-142   
emb|CAA52750.1|  chlorophyll a/b binding protein                        416   2e-142   
sp|P27518.2|CB21_GOSHI  RecName: Full=Chlorophyll a-b binding pro...    416   2e-142   
ref|XP_001751602.1|  predicted protein                                  416   3e-142   
sp|P08222.1|CB22_CUCSA  RecName: Full=Chlorophyll a-b binding pro...    414   3e-142   
ref|XP_011100602.1|  PREDICTED: chlorophyll a-b binding protein 5...    416   3e-142   
gb|KJB06589.1|  hypothetical protein B456_001G192000                    416   3e-142   



>ref|XP_011096521.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Sesamum indicum]
Length=286

 Score =   498 bits (1282),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 239/255 (94%), Positives = 246/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS PE TGN + +MRKT  KPKP SSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  32   FAGQAVKLSPSAPEITGNGRVSMRKTVAKPKPASSGSPWYGPDRVKYLGPFSGEPPSYLT  91

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  92   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  151

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  152  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  211

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  212  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  271

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  272  NNNAWAYATNFVPGK  286



>ref|XP_004145734.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis sativus]
 gb|KGN46826.1| hypothetical protein Csa_6G139750 [Cucumis sativus]
Length=267

 Score =   496 bits (1277),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 240/255 (94%), Positives = 247/255 (97%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SP+  +  G  + TMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGQAVKLSPTASDLLGEGRITMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDP+YP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPIYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_009593856.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score =   495 bits (1274),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 239/255 (94%), Positives = 245/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_008456347.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Cucumis 
melo]
Length=267

 Score =   494 bits (1273),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 239/255 (94%), Positives = 246/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+AVK SP+  +  G  + TMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGQAVKLSPTASDLLGEGRITMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDP+YP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPIYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_006361530.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006361531.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=267

 Score =   494 bits (1271),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 238/255 (93%), Positives = 246/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN +FTMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGRFTMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  253  NNNAWAFATNFVPGK  267



>ref|XP_004134608.2| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
[Cucumis sativus]
 gb|KGN49375.1| hypothetical protein Csa_6G522690 [Cucumis sativus]
Length=265

 Score =   493 bits (1268),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 240/255 (94%), Positives = 246/255 (96%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+AVK SP+ PE  GNAKFTMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGQAVKLSPTAPEIQGNAKFTMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>ref|XP_009795316.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25392.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   493 bits (1268),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 237/255 (93%), Positives = 245/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_011658281.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic 
[Cucumis sativus]
 gb|KGN49374.1| hypothetical protein Csa_6G522680 [Cucumis sativus]
Length=265

 Score =   492 bits (1266),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 240/255 (94%), Positives = 246/255 (96%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+AVK SP+ PE  GNAKFTMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGQAVKLSPNAPEIQGNAKFTMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>ref|XP_009795315.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic 
[Nicotiana sylvestris]
Length=267

 Score =   492 bits (1266),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 237/255 (93%), Positives = 245/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_009618329.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
 ref|XP_009628756.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score =   492 bits (1266),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 245/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNG+KFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGIKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_009782924.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   491 bits (1265),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 244/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            F GKAVK SPS+ E TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FVGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  253  NNNAWSYATNFVPGK  267



>ref|XP_009790936.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   491 bits (1265),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 237/255 (93%), Positives = 245/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_009597417.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic 
[Nicotiana tomentosiformis]
Length=267

 Score =   491 bits (1264),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 244/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  253  NNNAWSYATNFVPGK  267



>ref|XP_010916097.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=266

 Score =   491 bits (1263),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 237/255 (93%), Positives = 244/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS  E  G  + TMRKT  KPKPV++GSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FAGKAVKLSPSASEINGEGRITMRKTVPKPKPVAAGSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  132  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  252  NNNAWAYATNFVPGK  266



>ref|XP_009628754.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic 
[Nicotiana tomentosiformis]
Length=266

 Score =   491 bits (1263),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 245/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  12   FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  252  NNNAWSYATNFVPGK  266



>ref|XP_009772885.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   491 bits (1263),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 243/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            F GKAVK SPS+ E TGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FVGKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_009790934.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25396.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   491 bits (1263),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 244/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            F GKAVK SPS+ E TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FVGKAVKLSPSSSEITGNGKVTMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>sp|P27492.1|CB21_TOBAC RecName: Full=Chlorophyll a-b binding protein 16, chloroplastic; 
AltName: Full=LHCII type I CAB-16; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36955.1| unnamed protein product [Nicotiana tabacum]
Length=266

 Score =   490 bits (1262),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 245/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  12   FAGKAVKLSPSSSEVTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  252  NNNAWSYATNFVPGK  266



>ref|XP_009782921.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   490 bits (1262),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 243/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E  GN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEIIGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>sp|P07369.1|CB2G_SOLLC RecName: Full=Chlorophyll a-b binding protein 3C, chloroplastic; 
AltName: Full=LHCII type I CAB-3C; Short=LHCP; Flags: Precursor 
[Solanum lycopersicum]
 prf||1204205G protein 3C,chlorophyll binding
Length=267

 Score =   490 bits (1262),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 244/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  253  NNNAWAFATNFVPGK  267



>sp|P08221.1|CB21_CUCSA RecName: Full=Chlorophyll a-b binding protein of LHCII type I, 
chloroplastic; Short=CAB; Short=LHCP; Flags: Precursor, partial 
[Cucumis sativus]
 gb|AAA33124.1| chlorophyll a/b-binding protein, partial [Cucumis sativus]
Length=255

 Score =   489 bits (1260),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 240/255 (94%), Positives = 246/255 (96%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+AVK SP+ PE  GNAKFTMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  3    LAGQAVKLSPNAPEIQGNAKFTMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  60

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  61   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  120

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  121  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYP  180

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  181  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  240

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  241  NNNAWAYATNFVPGK  255



>ref|XP_006356077.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   490 bits (1261),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 244/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGRVTMRKTAAKAKPASSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  253  NNNAWAFATNFVPGK  267



>ref|XP_011096520.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Sesamum indicum]
Length=265

 Score =   489 bits (1260),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 238/255 (93%), Positives = 245/255 (96%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS PE TGN + +MRKT  KP  VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGQAVKLSPSAPEITGNGRVSMRKTVAKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>ref|XP_009628755.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic 
[Nicotiana tomentosiformis]
 sp|P27495.1|CB24_TOBAC RecName: Full=Chlorophyll a-b binding protein 40, chloroplastic; 
AltName: Full=LHCII type I CAB-40; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36958.1| unnamed protein product [Nicotiana tabacum]
Length=267

 Score =   489 bits (1260),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 244/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN K TMRKTA K K VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTASKAKTVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_009782922.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic 
[Nicotiana sylvestris]
Length=267

 Score =   489 bits (1260),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 244/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  253  NNNAWSYATNFVPGK  267



>ref|XP_011085268.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Sesamum indicum]
Length=265

 Score =   489 bits (1260),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 239/255 (94%), Positives = 245/255 (96%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPST E TGN + +MRKT  KP  VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGQAVKLSPSTSEITGNGRVSMRKTVAKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>gb|ABF17940.1| putative chloroplast chlorophyll a/b-binding protein [Carya cathayensis]
Length=267

 Score =   489 bits (1259),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 246/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+A+K +PS+ +  G  + TMRKTAG+PKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGQAIKLAPSSSDLLGEGRVTMRKTAGRPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_009782923.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   489 bits (1259),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 243/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            F GKAVK SPS+ E TGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FVGKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_009795314.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25393.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=266

 Score =   489 bits (1259),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 244/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN K TMRKTA K KPVSSGS WYGPDRVKYLGPFSGE PSYLT
Sbjct  12   FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSLWYGPDRVKYLGPFSGESPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  252  NNNAWAYATNFVPGK  266



>ref|XP_006356073.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   489 bits (1259),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 243/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            F GKAVK SPS+ E TGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FVGKAVKLSPSSSEITGNGRITMRKTAAKAKPASSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEA+W
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAIW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  253  NNNAWAFATNFVPGK  267



>ref|XP_006364025.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   489 bits (1258),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 243/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN K  MRKT  K KP+SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVMMRKTVTKAKPISSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  253  NNNAWSYATNFVPGK  267



>sp|P04783.1|CB25_PETSP RecName: Full=Chlorophyll a-b binding protein 91R, chloroplastic; 
AltName: Full=LHCII type I CAB-91R; Short=LHCP; Flags: 
Precursor [Petunia sp.]
 emb|CAA26209.1| unnamed protein product [Petunia sp.]
Length=267

 Score =   489 bits (1258),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 244/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVKFSPS+ E TGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKFSPSSSEITGNGKATMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTA LSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAELSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  253  NNNAWSYATNFVPGK  267



>ref|XP_009606802.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=266

 Score =   488 bits (1257),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 233/255 (91%), Positives = 243/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN K TMRKTA K KP+SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  12   FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FK G+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  132  FKVGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAF ELKVKE+KNGRLAMFSMFGFF+QAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLADDPEAFTELKVKEIKNGRLAMFSMFGFFIQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  252  NNNAWSYATNFVPGK  266



>ref|XP_006356078.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   488 bits (1257),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 244/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEVTGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFSKNRELEVIHGRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  253  NNNAWAFATNFVPGK  267



>ref|XP_008784387.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Phoenix dactylifera]
Length=266

 Score =   488 bits (1257),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 243/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK +PS  E  G  + TMRKT  +PKPV+SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   LAGKAVKLAPSASEILGEGRITMRKTFSRPKPVASGSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  132  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  252  NNNAWAYATNFVPGK  266



>ref|XP_009606800.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score =   488 bits (1257),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 242/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAML ALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLAALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR++GGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVSGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHL DPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLVDPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_009396492.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score =   488 bits (1256),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 244/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK +PS  +  G  + TMRKT  KPKPV+SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FAGQAVKLAPSASDVLGGGRVTMRKTGAKPKPVASGSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  132  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  252  NNNAWAYATNFVPGK  266



>ref|XP_009628757.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=266

 Score =   488 bits (1256),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 243/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAV+ SPS+ E  GN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  12   FAGKAVRLSPSSSEIIGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  252  NNNAWAYATNFVPGK  266



>ref|XP_009782905.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   488 bits (1256),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 243/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG AVK SPS+ E TGN K  MRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGE+TDPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_002316737.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|EEE97349.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   488 bits (1255),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 240/255 (94%), Positives = 244/255 (96%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+PE  GN + +MRKT    KPVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVKLSPSSPELMGNGRVSMRKTT---KPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGEITDP+YP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPIYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNF PGK
Sbjct  250  NNNAWAYATNFAPGK  264



>ref|XP_009611577.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=262

 Score =   488 bits (1255),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 243/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            F GKAVK SPS+ E TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  8    FVGKAVKLSPSSSEITGNGKATMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  67

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  68   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  127

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGE+ DPLYP
Sbjct  128  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVVDPLYP  187

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  188  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  247

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNF PGK
Sbjct  248  NNNAWAYATNFAPGK  262



>ref|XP_008439658.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=265

 Score =   488 bits (1255),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 237/255 (93%), Positives = 244/255 (96%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK SP+ PE  G  + TMRKTA   KPVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLSPNAPEIQGTGRITMRKTA--TKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>ref|XP_011011531.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
 ref|XP_011016419.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
Length=264

 Score =   487 bits (1254),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 239/255 (94%), Positives = 244/255 (96%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK +PS+PE  GN + +MRKT    KPVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLTPSSPELMGNGRVSMRKTT---KPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGEITDP+YP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPIYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>ref|XP_010243713.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Nelumbo nucifera]
Length=267

 Score =   487 bits (1254),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 242/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK +PS  E  G  + TMRKT  KPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLAPSASELLGEGRITMRKTVAKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYR+AGGPLGE+TDPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRVAGGPLGEVTDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>gb|AAA34148.1| chlorophyll a/b-binding protein Cab-3C [Solanum lycopersicum]
Length=267

 Score =   487 bits (1253),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 243/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLG ADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGPADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  253  NNNAWAFATNFVPGK  267



>ref|XP_010317413.1| PREDICTED: chlorophyll a-b binding protein 3A, chloroplastic-like 
[Solanum lycopersicum]
Length=267

 Score =   487 bits (1253),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 244/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGK VK +PS+ E +GN + TMRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKTVKLAPSSSEISGNGRITMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  253  NNNAWAFATNFVPGK  267



>ref|XP_009775533.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Nicotiana 
sylvestris]
 dbj|BAA25395.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   487 bits (1253),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 242/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG AVK SPS+ E TGN K  MRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGE+TDPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENL DHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLVDHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_009421488.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score =   487 bits (1253),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 243/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK +PS  +  G  + TMRK+A + KPVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   LAGKAVKLAPSASDILGEGRITMRKSAARSKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  132  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  252  NNNAWAYATNFVPGK  266



>sp|P12470.1|CB25_NICPL RecName: Full=Chlorophyll a-b binding protein E, chloroplastic; 
AltName: Full=LHCII type I CAB-E; Short=LHCP; Flags: Precursor 
[Nicotiana plumbaginifolia]
 gb|AAA34056.1| chlorophyll a/b-binding protein-E [Nicotiana plumbaginifolia]
Length=266

 Score =   486 bits (1252),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 244/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  12   FAGKAVKLSPSSSEVTGNGKVTMRKTANKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AG PLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGEPLGEVVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQA+VTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQALVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  252  NNNAWSYATNFVPGK  266



>sp|P27496.1|CB25_TOBAC RecName: Full=Chlorophyll a-b binding protein 50, chloroplastic; 
AltName: Full=LHCII type I CAB-50; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36956.1| unnamed protein product [Nicotiana tabacum]
Length=267

 Score =   486 bits (1252),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 233/255 (91%), Positives = 243/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN K TMRKT  K KP+SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVK +KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKHIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  253  NNNAWSYATNFVPGK  267



>ref|XP_002519724.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF42697.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=265

 Score =   486 bits (1251),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 244/255 (96%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS PE  GN + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVKLSPSAPELMGNGRVSMRKTAAKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYR+AGGPLGE+TDP+YP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPIYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>ref|XP_006356075.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X1 [Solanum tuberosum]
Length=267

 Score =   486 bits (1251),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 233/255 (91%), Positives = 243/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQ+ILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQNILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNF PGK
Sbjct  253  NNNAWAFATNFAPGK  267



>gb|ABB55370.1| chlorophyll a-b binding protein 3C-like [Solanum tuberosum]
Length=267

 Score =   486 bits (1251),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 243/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN + TMRK+  K KP SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGRITMRKSVAKAKPASSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  253  NNNAWAFATNFVPGK  267



>ref|XP_010052093.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
 gb|KCW75951.1| hypothetical protein EUGRSUZ_D00319 [Eucalyptus grandis]
Length=265

 Score =   486 bits (1250),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 244/255 (96%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+AVK SPSTPE  GN + +MRKT GKP  VSSGSPWYGPDR KYLGPFSGEPPSYLT
Sbjct  13   LAGQAVKLSPSTPELLGNGRVSMRKTVGKP--VSSGSPWYGPDRAKYLGPFSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNG+KFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGIKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNP+LIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>ref|XP_009618330.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   486 bits (1250),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 237/255 (93%), Positives = 244/255 (96%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS  E TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPS--ETTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>sp|P27491.1|CB27_TOBAC RecName: Full=Chlorophyll a-b binding protein 7, chloroplastic; 
AltName: Full=LHCII type I CAB-7; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA41187.1| chlorophyll a /b binding protein [Nicotiana tabacum]
Length=267

 Score =   486 bits (1250),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 233/255 (91%), Positives = 242/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG AVK SPS+ E TGN K  MRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGE+TDPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPL+NL DHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLDNLVDHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_009759685.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25394.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   485 bits (1249),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 242/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E  GN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSG  PSYLT
Sbjct  13   FAGKAVKLSPSSYEIIGNGKVTMRKTVIKAKPVSSGSPWYGPDRVKYLGPFSGNSPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_008779641.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Phoenix dactylifera]
Length=266

 Score =   485 bits (1248),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 243/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK +PS  +  G  + TMRK+ G+PKP++SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   LAGKAVKLAPSASDIIGEGRITMRKSVGRPKPIASGSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  132  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLG ADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGPADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  252  NNNAWAYATNFVPGK  266



>ref|XP_006356074.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   485 bits (1248),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 242/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGK VK SPS+ E TGN + TMRKT  K KP SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKTVKLSPSSYEITGNGRVTMRKTTTKAKPASSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  253  NNNAWAFATNFVPGK  267



>emb|CAA78379.1| chlorophyll a/b-binding protein PS II-Type I [Solanum tuberosum]
Length=267

 Score =   484 bits (1247),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 242/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN +FTMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGRFTMRKTAAKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GE PGDYGWDTAGLSADPETFAKNRELEVIH RWA+L  LGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEKPGDYGWDTAGLSADPETFAKNRELEVIHCRWAILERLGCVFPELLSRNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FK G+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKVGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  253  NNNAWAFATNFVPGK  267



>sp|P12469.1|CB23_NICPL RecName: Full=Chlorophyll a-b binding protein C, chloroplastic; 
AltName: Full=LHCII type I CAB-C; Short=LHCP; Flags: Precursor 
[Nicotiana plumbaginifolia]
 gb|AAA34055.1| chlorophyll a/b-binding protein-C [Nicotiana plumbaginifolia]
Length=267

 Score =   484 bits (1245),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 242/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN K TMRKTA K KPVSS SPWYGP+RVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSSSPWYGPNRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FK G+QIFS+GGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AG PLGE+ DPLYP
Sbjct  133  FKGGSQIFSQGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGEPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_012072080.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Jatropha 
curcas]
 gb|KDP37945.1| hypothetical protein JCGZ_04588 [Jatropha curcas]
Length=265

 Score =   484 bits (1245),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 242/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK  PS PE  GN + TMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLGPSAPELMGNGRVTMRKTASKN--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYR+AGGPLGE+TDP+YP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPIYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>ref|XP_009395692.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score =   484 bits (1245),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 240/255 (94%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVKF PS  +  G  + TMRKT  KPK   SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   LAGKAVKFGPSVADVLGGGRVTMRKTGAKPKSAPSGSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  132  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  252  NNNAWAYATNFVPGK  266



>ref|XP_006356076.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=267

 Score =   484 bits (1245),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 231/255 (91%), Positives = 242/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN + TMRK+  K KP SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEVTGNGRVTMRKSVAKAKPASSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQ+ILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQNILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNF PGK
Sbjct  253  NNNAWAFATNFAPGK  267



>ref|XP_009782821.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   484 bits (1245),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 241/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG AVK SPS+ E TGN K  MRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGE+TDPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPL+NL DHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLDNLVDHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_004147416.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis sativus]
 gb|KGN65549.1| Chlorophyll A/B binding protein [Cucumis sativus]
Length=265

 Score =   483 bits (1244),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 244/255 (96%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGK VK +PS+PE  GN++ TMRK+A   K VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKVVKLTPSSPELFGNSRVTMRKSA--TKSVSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVVLMGAVEGYRIAGGPLGEVTDPIYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL DPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLTDPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>gb|AFC91647.1| chloroplast chlorophyll A/B binding protein [Hevea brasiliensis]
Length=265

 Score =   483 bits (1243),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 244/255 (96%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK +PS P   GNA+ +MRK+ GKP  VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVKLTPSAPGLMGNARVSMRKSVGKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVTDPIYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>gb|KJB66916.1| hypothetical protein B456_010G165100 [Gossypium raimondii]
Length=265

 Score =   483 bits (1243),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 244/255 (96%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVKFSPSTP+  GN + +MRKTA   KP +SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKFSPSTPKIQGNGRVSMRKTA--TKPAASGSPWYGPDRVLYLGPLSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>ref|XP_008444193.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=265

 Score =   483 bits (1242),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 244/255 (96%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK +PS+PE  GN++  MRK+A K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLTPSSPELFGNSRVNMRKSAAKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVVLMGAVEGYRIAGGPLGEVTDPIYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>gb|KCW75952.1| hypothetical protein EUGRSUZ_D00320 [Eucalyptus grandis]
Length=265

 Score =   483 bits (1242),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 233/255 (91%), Positives = 244/255 (96%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+AVK SPSTPE  GN + +MRKT GKP  VSSGSPWYGPDR K+LGPFSGEPPSYLT
Sbjct  13   LAGQAVKLSPSTPELLGNGRVSMRKTVGKP--VSSGSPWYGPDRAKHLGPFSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNG+KFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGIKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNP+LIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            +NNAWAYATNFVPGK
Sbjct  251  SNNAWAYATNFVPGK  265



>ref|XP_010924306.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Elaeis 
guineensis]
Length=264

 Score =   483 bits (1242),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 242/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK +PST    G  + TMRKT GKP  VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   LAGKAVKLAPSTSPILGEGRVTMRKTVGKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYR+AGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>ref|XP_010052095.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Eucalyptus 
grandis]
Length=264

 Score =   482 bits (1241),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 242/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SP+TP+  GN + TMRK     KP SSGSPWYGPDR KYLGPFSGEPPSYLT
Sbjct  13   FAGKAVKLSPATPDLLGNGRVTMRKAV---KPASSGSPWYGPDRAKYLGPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>ref|XP_010247422.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Nelumbo nucifera]
Length=268

 Score =   482 bits (1241),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 235/256 (92%), Positives = 242/256 (95%), Gaps = 1/256 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPE-FTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYL  760
            FAGKAVK +PS  E   G  + TMRKT  KPKPVSSGSPWYGPDRVKYLGPFSGEPPSYL
Sbjct  13   FAGKAVKLAPSASEKLLGEGRVTMRKTVAKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYL  72

Query  759  TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  580
            TGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAV
Sbjct  73   TGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAV  132

Query  579  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLY  400
            WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYR+AGGPLGE+TDPLY
Sbjct  133  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRVAGGPLGEVTDPLY  192

Query  399  PGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP  220
            PGGSFDPLGLADDPE FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP
Sbjct  193  PGGSFDPLGLADDPEKFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP  252

Query  219  VNNNAWAYATNFVPGK  172
            VNNNAWAYATNFVPGK
Sbjct  253  VNNNAWAYATNFVPGK  268



>ref|XP_008439659.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=338

 Score =   485 bits (1249),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 237/255 (93%), Positives = 243/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK SP+ PE  G  + TMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  86   LAGKAVKLSPNAPEIQGTGRITMRKTATKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  143

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  144  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  203

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  204  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYP  263

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  264  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  323

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  324  NNNAWAYATNFVPGK  338



>ref|XP_010056879.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
Length=265

 Score =   482 bits (1241),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 242/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAV+ SPSTPE  G  + TMRKT    K VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVQLSPSTPELFGKGRVTMRKTV--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>gb|KCW75953.1| hypothetical protein EUGRSUZ_D00321 [Eucalyptus grandis]
Length=300

 Score =   483 bits (1244),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 233/255 (91%), Positives = 242/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+AVK SPSTPE  GN + +MRK   KP  VSSGSPWYGPDR KYLGPFSGEPPSYLT
Sbjct  48   LAGQAVKLSPSTPELLGNGRISMRKAVRKP--VSSGSPWYGPDRAKYLGPFSGEPPSYLT  105

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  106  GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  165

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNP+LIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  166  FKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  225

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  226  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  285

Query  216  NNNAWAYATNFVPGK  172
            +NNAWAYATNFVPGK
Sbjct  286  SNNAWAYATNFVPGK  300



>ref|XP_008800689.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Phoenix 
dactylifera]
Length=264

 Score =   482 bits (1240),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 242/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK +PST    G  + TMRKT GKP P  SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FAGKAVKLAPSTSTILGEGRVTMRKTIGKPVP--SGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>gb|AHB24929.1| chloroplast light-harvesting complex II chlorophyll a/b binding 
protein 1 [Sedum alfredii]
Length=267

 Score =   482 bits (1240),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 241/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+AVK +P+  +  GN+K TMRKTA K KP  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAVKLTPTVSDLYGNSKVTMRKTAAKSKPTVSSSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  253  NNNAWAFATNFVPGK  267



>ref|XP_002524616.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF37824.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=265

 Score =   482 bits (1240),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 243/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS PE  GN + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVKLSPSAPELMGNGRVSMRKTAAKN--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYR+AGGPLGE+TDP+YP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVVLMGAVEGYRVAGGPLGEVTDPIYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>ref|XP_010904844.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=266

 Score =   481 bits (1239),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 241/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK +PS  +  G  + TMRK+ G+ +PV S SPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   LAGKAVKLAPSASDIIGEGRITMRKSVGRSRPVVSDSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+TDPLYP
Sbjct  132  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  252  NNNAWAYATNFVPGK  266



>ref|XP_006356080.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   481 bits (1239),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 231/255 (91%), Positives = 241/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGK VK SPS+ E TGN + TMRK+A K KP S GSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKTVKLSPSSSEITGNGRVTMRKSAAKAKPASFGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVP K
Sbjct  253  NNNAWAFATNFVPRK  267



>gb|ACO51067.1| chloroplast chlorophyll A-B binding protein [Gossypium hirsutum]
Length=264

 Score =   481 bits (1239),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 242/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVKFSPSTPE  G  + +MRKT    KPV SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKFSPSTPEIQGTGRVSMRKTT---KPVPSGSPWYGPDRVLYLGPLSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>ref|XP_010275593.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Nelumbo 
nucifera]
Length=269

 Score =   481 bits (1239),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 235/257 (91%), Positives = 242/257 (94%), Gaps = 2/257 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPE--FTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSY  763
             AGKAVK +PS       G  + TMRKT  KPKPVSSGSPWYGPDRVKYLGPFSGEPPSY
Sbjct  13   LAGKAVKLAPSAASELLLGQGRVTMRKTVVKPKPVSSGSPWYGPDRVKYLGPFSGEPPSY  72

Query  762  LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEA  583
            LTGEFPGDYGWDTAGLSADPETFAKNRELEVIH+RWAMLGALGCVFPELL+RNGVKFGEA
Sbjct  73   LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHARWAMLGALGCVFPELLARNGVKFGEA  132

Query  582  VWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPL  403
            VWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPL
Sbjct  133  VWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPL  192

Query  402  YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLAD  223
            YPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLAD
Sbjct  193  YPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLAD  252

Query  222  PVNNNAWAYATNFVPGK  172
            PVNNNAWAYATNFVPGK
Sbjct  253  PVNNNAWAYATNFVPGK  269



>gb|AIR93785.1| chloroplast light harvesting chlorophyll A/B binding protein 
[Kalanchoe fedtschenkoi]
Length=267

 Score =   481 bits (1238),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 241/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+A+K +PS  +  G  + +MRKT  KPKPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAIKLAPSASDILGEGRISMRKTGAKPKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>gb|KJB69716.1| hypothetical protein B456_011G041600 [Gossypium raimondii]
Length=264

 Score =   481 bits (1237),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 242/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVKFSPSTPE  G  + +MRKT    KPV SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKFSPSTPEIRGTGRVSMRKTT---KPVPSGSPWYGPDRVLYLGPLSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>sp|P04781.1|CB23_PETSP RecName: Full=Chlorophyll a-b binding protein 22R, chloroplastic; 
AltName: Full=LHCII type I CAB-22R; Short=LHCP; Flags: 
Precursor [Petunia sp.]
 emb|CAA26213.1| unnamed protein product [Petunia sp.]
Length=267

 Score =   481 bits (1238),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 239/255 (94%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK S S+ E TGN K TMRKT  K KP SS SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSSSSSEITGNGKVTMRKTVTKAKPASSSSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFP DYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPEL +RNG+KFGEAVW
Sbjct  73   GEFPSDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGIKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  253  NNNAWSYATNFVPGK  267



>gb|EYU28462.1| hypothetical protein MIMGU_mgv1a012008mg [Erythranthe guttata]
Length=264

 Score =   480 bits (1236),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 233/255 (91%), Positives = 244/255 (96%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK   STPEFTGN + +MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVK---STPEFTGNGRISMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  250  NNNAWAFATNFVPGK  264



>ref|XP_002306927.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK95787.1| unknown [Populus trichocarpa]
 gb|ABK96559.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96723.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96730.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE93923.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   480 bits (1235),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 242/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK +PS+ E  GN + +MRKT    KPV SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLNPSSSEIMGNGRVSMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>gb|EYU28187.1| hypothetical protein MIMGU_mgv1a009948mg [Erythranthe guttata]
Length=326

 Score =   482 bits (1241),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 247/281 (88%), Positives = 261/281 (93%), Gaps = 3/281 (1%)
 Frame = -2

Query  1014  HTSLVFAFHF*RstmaastmalsspSFAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVS  835
             H+  +    F  +TMAAS+MALSSPSFAG+AVK   STPEFTGN + +MRKTA KPKP S
Sbjct  49    HSLQIHILSFDNTTMAASSMALSSPSFAGQAVK---STPEFTGNGRVSMRKTAAKPKPAS  105

Query  834   SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRW  655
             SGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRW
Sbjct  106   SGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRW  165

Query  654   AMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQ  475
             AMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  Q
Sbjct  166   AMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQ  225

Query  474   VVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSM  295
             VVLMGA+EGYRIAGGPLGE+ DPLYPG SFDPLGLA+DPEAFAELKVKELKNGRLAMFSM
Sbjct  226   VVLMGAIEGYRIAGGPLGEVVDPLYPGASFDPLGLAEDPEAFAELKVKELKNGRLAMFSM  285

Query  294   FGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  172
             FGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  286   FGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  326



>ref|XP_008229430.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score =   480 bits (1235),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 233/255 (91%), Positives = 239/255 (94%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+AVK   S     G  + TMRKTA KPK VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAVKLGSSVSNIVGEGRVTMRKTASKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_004234241.1| PREDICTED: uncharacterized protein LOC101245729 [Solanum lycopersicum]
Length=554

 Score =   491 bits (1263),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 244/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E TGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  300  FAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLT  359

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  360  GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  419

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  420  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  479

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  480  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  539

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  540  NNNAWAFATNFVPGK  554


 Score =   491 bits (1263),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 245/255 (96%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS+ E +GN + TMRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEISGNGRITMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  253  NNNAWAFATNFVPGK  267



>gb|KCW75954.1| hypothetical protein EUGRSUZ_D00322 [Eucalyptus grandis]
Length=358

 Score =   483 bits (1244),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 242/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SP+TP+  GN + TMRK     KP SSGSPWYGPDR KYLGPFSGEPPSYLT
Sbjct  107  FAGKAVKLSPATPDLLGNGRVTMRKAV---KPASSGSPWYGPDRAKYLGPFSGEPPSYLT  163

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  164  GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  223

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+TDPLYP
Sbjct  224  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYP  283

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  284  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  343

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  344  NNNAWAYATNFVPGK  358



>gb|AEQ67395.1| chloroplast chlorophyll A/B binding protein [Canarium album]
Length=264

 Score =   479 bits (1234),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 240/255 (94%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS PE  GN +  MRKT  KP    SGSPWYGPDRVKYLGP SGEPPSYLT
Sbjct  13   FAGKAVKLSPSAPELMGNGRVNMRKTFNKPP---SGSPWYGPDRVKYLGPLSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>emb|CAJ77390.1| major chlorophyll a/b binding protein LHCb1.2 [Spinacia oleracea]
Length=267

 Score =   479 bits (1234),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 241/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKA+K  P+  E  G  + TMRKTAGKPK VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGKAIKLGPTASEILGEGRVTMRKTAGKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW++ATNFVPGK
Sbjct  253  NNNAWSFATNFVPGK  267



>gb|AAA18529.1| chlorophyll A/B binding protein [Gossypium hirsutum]
Length=264

 Score =   479 bits (1233),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 233/255 (91%), Positives = 241/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVKFSPSTPE  G  + +MRKT    KPV SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKFSPSTPEIQGTGRVSMRKTT---KPVPSGSPWYGPDRVLYLGPLSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLG ADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGFADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>ref|XP_004294267.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   479 bits (1233),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 240/255 (94%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+AVK SPST    G  + TMRKTA K K VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAVKLSPSTSTLFGEGRVTMRKTAAKSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  253  NNNAWSYATNFVPGK  267



>ref|XP_009775649.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25390.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   479 bits (1232),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 242/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS PE TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSAPEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFS+GGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSDGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  251  NNNAWSYATNFVPGK  265



>ref|XP_010685893.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=267

 Score =   479 bits (1232),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 228/255 (89%), Positives = 240/255 (94%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGK +K  P+  E  G  + TMRKTAGKPKP+SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGKPIKLGPTPSEILGEGRITMRKTAGKPKPISSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW YATNFVPGK
Sbjct  253  NNNAWNYATNFVPGK  267



>ref|XP_009630190.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Nicotiana tomentosiformis]
 sp|P27493.1|CB22_TOBAC RecName: Full=Chlorophyll a-b binding protein 21, chloroplastic; 
AltName: Full=LHCII type I CAB-21; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36957.1| unnamed protein product [Nicotiana tabacum]
Length=265

 Score =   479 bits (1232),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 242/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS PE TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSAPEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>gb|ABF70112.1| chlorophyll A-B binding protein (CAB), putative [Musa balbisiana]
Length=267

 Score =   478 bits (1231),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 232/256 (91%), Positives = 241/256 (94%), Gaps = 1/256 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVS-SGSPWYGPDRVKYLGPFSGEPPSYL  760
             AGKAVK +PS  +  G  + TMRK+  K KP + SGSPWYGPDRVKYLGPFSGEPPSYL
Sbjct  12   LAGKAVKLAPSASDVLGEGRVTMRKSTAKAKPAAASGSPWYGPDRVKYLGPFSGEPPSYL  71

Query  759  TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  580
            TGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAV
Sbjct  72   TGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAV  131

Query  579  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLY  400
            WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLY
Sbjct  132  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLY  191

Query  399  PGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP  220
            PGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP
Sbjct  192  PGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP  251

Query  219  VNNNAWAYATNFVPGK  172
            VNNNAWAYATNFVPGK
Sbjct  252  VNNNAWAYATNFVPGK  267



>sp|P04782.1|CB24_PETSP RecName: Full=Chlorophyll a-b binding protein 25, chloroplastic; 
AltName: Full=LHCII type I CAB-25; Short=LHCP; Flags: Precursor 
[Petunia sp.]
 emb|CAA26211.1| unnamed protein product [Petunia sp.]
Length=266

 Score =   478 bits (1231),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 241/255 (95%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAV   PS+ + TGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVNV-PSSSQITGNGKATMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPEL +RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  252  NNNAWAFATNFVPGK  266



>ref|XP_002307725.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK94788.1| unknown [Populus trichocarpa]
 gb|EEE94721.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   478 bits (1231),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 241/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK +PS+ E  GN + +MRKT    KPV SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLNPSSSEIMGNGRVSMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNF PGK
Sbjct  250  NNNAWAYATNFAPGK  264



>gb|EYU28186.1| hypothetical protein MIMGU_mgv1a012011mg [Erythranthe guttata]
Length=264

 Score =   478 bits (1231),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 243/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK   STPEFT   +F+MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVK---STPEFTTTGRFSMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  250  NNNAWAFATNFVPGK  264



>gb|AAA80593.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   478 bits (1230),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 239/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPST E TGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSTSEITGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVIDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>emb|CAX64458.1| major chlorophyll a/b binding protein LHCb1.4 precursor [Spinacia 
oleracea]
Length=267

 Score =   478 bits (1230),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 228/255 (89%), Positives = 240/255 (94%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKA+K  P+  E     + TMRKTAGKPK VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGKAIKLGPTASEILSEGRVTMRKTAGKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW++ATNFVPGK
Sbjct  253  NNNAWSFATNFVPGK  267



>ref|XP_009598574.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   478 bits (1230),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 242/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS PE TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSAPEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  251  NNNAWSYATNFVPGK  265



>ref|NP_001266111.1| chlorophyll a-b binding protein AB80, chloroplastic-like [Cicer 
arietinum]
 emb|CAA10284.1| chlorophyll a/b binding protein [Cicer arietinum]
Length=266

 Score =   478 bits (1230),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 242/255 (95%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGK VK SPS+ E  G ++FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKPVKLSPSSQEL-GASRFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  252  NNNAWAYATNFVPGK  266



>gb|EYU28185.1| hypothetical protein MIMGU_mgv1a012021mg [Erythranthe guttata]
Length=264

 Score =   478 bits (1229),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 243/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK   STPEFT   +F+MRKTA KPKP +SGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVK---STPEFTTTGRFSMRKTAAKPKPAASGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  250  NNNAWAFATNFVPGK  264



>sp|P12333.1|CB2A_SPIOL RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor 
[Spinacia oleracea]
 emb|CAA32526.1| chlorophyll a/b binding protein precursor [Spinacia oleracea]
 emb|CAJ77389.3| major chlorophyll a/b binding protein LHCb1.3 [Spinacia oleracea]
Length=267

 Score =   478 bits (1230),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 238/255 (93%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK  P+  E  G  + TMRKTAGKPK V S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGKAVKLGPTASEIIGEGRITMRKTAGKPKTVQSSSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW +ATNFVPGK
Sbjct  253  NNNAWNFATNFVPGK  267



>gb|KJB57287.1| hypothetical protein B456_009G156900 [Gossypium raimondii]
Length=265

 Score =   478 bits (1229),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 241/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SPS P+  GN + +MRKTA K  P  SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKLSPSAPKIQGNGRVSMRKTATKAAP--SGSPWYGPDRVLYLGPLSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>ref|XP_009389379.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=267

 Score =   478 bits (1229),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 231/256 (90%), Positives = 241/256 (94%), Gaps = 1/256 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVS-SGSPWYGPDRVKYLGPFSGEPPSYL  760
             AGKAVK +PS  +  G  + TMRK+  K KP + SGSPWYGPDRVKYLGPFSGEPPSYL
Sbjct  12   LAGKAVKLAPSASDVLGEGRVTMRKSTAKAKPAAASGSPWYGPDRVKYLGPFSGEPPSYL  71

Query  759  TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  580
            TGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAV
Sbjct  72   TGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAV  131

Query  579  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLY  400
            WFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLY
Sbjct  132  WFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLY  191

Query  399  PGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP  220
            PGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP
Sbjct  192  PGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP  251

Query  219  VNNNAWAYATNFVPGK  172
            VNNNAWAYATNFVPGK
Sbjct  252  VNNNAWAYATNFVPGK  267



>ref|XP_009786355.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25388.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   477 bits (1228),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 241/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS  E TGN + +MRKTA KP  VSS SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEITGNGRVSMRKTAAKP--VSSSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
             EFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   SEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>gb|ACR08639.1| chloroplast chlorophyll A/B binding protein [Mangifera indica]
Length=264

 Score =   477 bits (1228),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 241/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SP+  E  GN + +MR+TA   KP  SGSPWYGPDRVKYL PFSGEPPSYLT
Sbjct  13   FAGKAVKLSPAPRELMGNGRVSMRRTA---KPTPSGSPWYGPDRVKYLSPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>gb|AGJ50622.1| chlorophyll a/b binding protein [Salicornia brachiata]
Length=267

 Score =   477 bits (1228),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 227/255 (89%), Positives = 239/255 (94%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGK +K  P+  E  G  + TMRKTAGKPK V+SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKPIKLGPNAAEILGEGRVTMRKTAGKPKQVASGSPWYGPDRVKYLGPFSGEPPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GE PGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GELPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF+QAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFIQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATN VPGK
Sbjct  253  NNNAWSYATNLVPGK  267



>ref|XP_009416547.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
 gb|ABF69952.1| chlorophyll A-B binding protein (CAB), putative [Musa acuminata]
Length=265

 Score =   477 bits (1228),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 233/255 (91%), Positives = 239/255 (94%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK +PS     G  + TMRK  GKP   SSGSPWYGPDRVKYLGP SGEPPSYLT
Sbjct  12   FAGKAVKLAPSASGVLGQGRVTMRKAGGKPA-ASSGSPWYGPDRVKYLGPLSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>ref|NP_001240146.1| chlorophyll a-b binding protein 21, chloroplastic-like [Glycine 
max]
 gb|AAA50172.1| photosystem II type I chlorophyll a/b-binding protein [Glycine 
max]
 gb|ACU18421.1| unknown [Glycine max]
 gb|KHN41285.1| Chlorophyll a-b binding protein 21, chloroplastic [Glycine soja]
Length=264

 Score =   477 bits (1228),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 243/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+A+K +PSTPE  G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGQAIKLAPSTPEL-GVGRVSMRKTASKT--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>ref|XP_010231410.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Brachypodium 
distachyon]
Length=266

 Score =   477 bits (1228),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 242/255 (95%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK  PS+  F G A+ TMRKTA K KPVSSGSPWYG DRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNLPSSALF-GEARVTMRKTAAKAKPVSSGSPWYGSDRVLYLGPLSGEPPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELE+IHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELELIHSRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  252  NNNAWAFATNFVPGK  266



>ref|XP_007215816.1| hypothetical protein PRUPE_ppa010034mg [Prunus persica]
 gb|EMJ17015.1| hypothetical protein PRUPE_ppa010034mg [Prunus persica]
Length=267

 Score =   477 bits (1227),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 238/255 (93%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+AVK   S     G  + TMRKTA + K VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAVKLGSSVSNIVGEGRVTMRKTASRSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_007217260.1| hypothetical protein PRUPE_ppa010015mg [Prunus persica]
 gb|AAA50310.1| light-harvesting chlorophyll a/b-binding protein [Prunus persica]
 gb|EMJ18459.1| hypothetical protein PRUPE_ppa010015mg [Prunus persica]
Length=267

 Score =   477 bits (1227),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 238/255 (93%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+AVK   S     G  + TMRKTA K K VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAVKLGSSVSNIVGEGRITMRKTASKSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AGGPLGEITDPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGGPLGEITDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  253  NNNAWSYATNFVPGK  267



>ref|XP_011045092.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Populus 
euphratica]
Length=263

 Score =   476 bits (1226),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 242/255 (95%), Gaps = 4/255 (2%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK +PS+ E  GN + +MRKT    KPV SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLNPSSSEI-GNGRISMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLT  68

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  69   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  128

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  129  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYP  188

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  189  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  248

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  249  NNNAWAYATNFVPGK  263



>ref|XP_007211869.1| hypothetical protein PRUPE_ppa010099mg [Prunus persica]
 ref|XP_008225347.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Prunus 
mume]
 gb|EMJ13068.1| hypothetical protein PRUPE_ppa010099mg [Prunus persica]
Length=264

 Score =   476 bits (1226),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 241/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAV+ +P   E  GN + +MRKT  K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FAGKAVQLAPGATELFGNGRVSMRKTGAKQ--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGEITDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  250  NNNAWSYATNFVPGK  264



>gb|AAA33396.1| light-harvesting chlorophyll a/b protein precursor [Lemna gibba]
Length=266

 Score =   476 bits (1226),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 241/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
              GKAVK +P+  E  G  + +MRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  12   LVGKAVKLAPAASEVFGEGRVSMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEF GDYGWDTAGLSADPETFAKNRELEVIH+RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFAGDYGWDTAGLSADPETFAKNRELEVIHARWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRVAGGPLGEVVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  252  NNNAWAFATNFVPGK  266



>ref|XP_008229429.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score =   476 bits (1226),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 238/255 (93%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+AVK   S     G  + TMRKTA K K VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAVKLGSSVSNIVGEGRVTMRKTASKSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AGGPLGEITDPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGGPLGEITDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  253  NNNAWSYATNFVPGK  267



>ref|XP_006467509.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Citrus sinensis]
Length=264

 Score =   476 bits (1226),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 233/255 (91%), Positives = 240/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            F GKAV  +PS  E +   + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FVGKAVNLAPSGNELSNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>ref|XP_007211864.1| hypothetical protein PRUPE_ppa010081mg [Prunus persica]
 ref|XP_008225346.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
 gb|EMJ13063.1| hypothetical protein PRUPE_ppa010081mg [Prunus persica]
Length=265

 Score =   476 bits (1226),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 241/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAV+ +P   E  GN + +MRKT  K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVQLAPGATELFGNGRVSMRKTGAKQ--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGEITDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  251  NNNAWSYATNFVPGK  265



>ref|XP_009775645.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25391.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   476 bits (1226),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 241/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS  E TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGEAPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>ref|XP_009598577.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   476 bits (1226),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 241/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS  E TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  251  NNNAWSYATNFVPGK  265



>ref|XP_007025148.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
 gb|EOY27770.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
Length=264

 Score =   476 bits (1226),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 242/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKA+KFSPSTPE  G+ + +MRKT  KP    SGSPWYGPDRV YLGP SG+PPSYLT
Sbjct  13   FAGKALKFSPSTPEIQGSGRVSMRKTGTKPP---SGSPWYGPDRVLYLGPLSGDPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>dbj|BAA25389.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   476 bits (1226),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 241/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS  E TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  251  NNNAWSYATNFVPGK  265



>gb|AAC25775.1| chlorophyll a/b binding protein [Medicago sativa]
Length=266

 Score =   476 bits (1226),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 233/255 (91%), Positives = 241/255 (95%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGK VK +PS+ E  G A+FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKPVKLTPSSQEL-GAARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  252  NNNAWAYATNFVPGK  266



>gb|ACN41907.1| chlorophyll A/B binding protein [Gardenia jasminoides]
Length=264

 Score =   476 bits (1226),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 241/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS PE  GN + +M++T    +PVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGQAVKLSPSAPELMGNGRISMKRTT---RPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAM GALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMPGALGCVFPELLSRNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIF EGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFQEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPIYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLAD PEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADVPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>ref|XP_012072079.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Jatropha curcas]
Length=265

 Score =   476 bits (1225),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 240/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK  PS PE  GN + TMRKTA K   VSSGSPWYGPD VK LGPFSGEPPSYLT
Sbjct  13   LAGKAVKLGPSPPELMGNGRVTMRKTASKN--VSSGSPWYGPDGVKNLGPFSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYR+AGGPLGE+TDP+YP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPIYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>gb|AFK40061.1| unknown [Medicago truncatula]
 gb|KEH31368.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=266

 Score =   476 bits (1225),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 233/255 (91%), Positives = 240/255 (94%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGK VK +PS+ E  G A+FTMRK A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKPVKLTPSSQEL-GAARFTMRKAATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  252  NNNAWAYATNFVPGK  266



>gb|AAB61238.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum]
Length=267

 Score =   476 bits (1225),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 227/255 (89%), Positives = 240/255 (94%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK +P+T +  G  + TMRKTAGK K VSS SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGKAVKLNPTTSQILGEGRITMRKTAGKTKNVSSDSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGA+EGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAIEGYRVAGGPLGEVIDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNF PGK
Sbjct  253  NNNAWAFATNFAPGK  267



>gb|ABD38707.1| chloroplast chlorophyll a/b binding protein [Pachysandra terminalis]
Length=267

 Score =   476 bits (1225),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 240/255 (94%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK +PS  E  G  + +MRKT G+PKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLAPSASELLGVGRVSMRKTGGRPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPNLVHAQSILAIWATQVLLMGAVEGYRIAGGPLGEVIDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAY TNFV GK
Sbjct  253  NNNAWAYPTNFVSGK  267



>ref|XP_007025143.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
 gb|EOY27765.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
Length=264

 Score =   476 bits (1224),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 240/255 (94%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SP TPE  GN + +MRKT  +P    SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKLSPLTPEIQGNGRVSMRKTGTRPP---SGSPWYGPDRVLYLGPLSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>ref|XP_009775650.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Nicotiana sylvestris]
Length=265

 Score =   476 bits (1224),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 228/255 (89%), Positives = 241/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS  E TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  251  NNNAWSYATNFVPGK  265



>ref|XP_008364191.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_009360860.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Pyrus 
x bretschneideri]
Length=264

 Score =   476 bits (1224),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 240/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAV+ SP   E  GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FAGKAVQLSPGATELFGNGRVSMRKTA--TKKVSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
             NNAW YATNFVPGK
Sbjct  250  ANNAWNYATNFVPGK  264



>ref|XP_008356026.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
 ref|XP_008364190.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   476 bits (1224),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 240/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAV+ SP   E  GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVQLSPGATELFGNGRVSMRKTA--TKKVSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
             NNAW YATNFVPGK
Sbjct  251  ANNAWNYATNFVPGK  265



>sp|P04780.1|CB22_PETSP RecName: Full=Chlorophyll a-b binding protein 22L, chloroplastic; 
AltName: Full=LHCII type I CAB-22L; Short=LHCP; Flags: 
Precursor [Petunia sp.]
 emb|CAA26212.1| unnamed protein product [Petunia sp.]
Length=267

 Score =   476 bits (1224),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 228/255 (89%), Positives = 238/255 (93%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGK VK SPS+ E TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKVVKLSPSSSEITGNGKATMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPEL +RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
             KAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLG + DPLYP
Sbjct  133  LKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVLLMGAVEGYRVAGGPLGVVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE KNGRLAMFSMFGFF+QAIVTGKGPLENLADHL DPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKETKNGRLAMFSMFGFFIQAIVTGKGPLENLADHLVDPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVP K
Sbjct  253  NNNAWSYATNFVPRK  267



>ref|XP_003548104.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Glycine max]
Length=264

 Score =   475 bits (1223),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 243/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+A+K +PSTP+  G  + +MRKTA K   V+SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGQAIKLAPSTPQL-GVGRVSMRKTASKT--VTSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>gb|KDP37944.1| hypothetical protein JCGZ_04587 [Jatropha curcas]
Length=260

 Score =   475 bits (1222),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 240/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK  PS PE  GN + TMRKTA K   VSSGSPWYGPD VK LGPFSGEPPSYLT
Sbjct  8    LAGKAVKLGPSPPELMGNGRVTMRKTASKN--VSSGSPWYGPDGVKNLGPFSGEPPSYLT  65

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  66   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  125

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYR+AGGPLGE+TDP+YP
Sbjct  126  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPIYP  185

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  186  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  245

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  246  NNNAWAYATNFVPGK  260



>emb|CAJ77391.1| major chlorophyll a/b binding protein LHCb1.1 [Spinacia oleracea]
 emb|CAX64457.1| major chlorophyll a/b binding protein LHCb1.1 precursor [Spinacia 
oleracea]
Length=267

 Score =   475 bits (1223),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 226/255 (89%), Positives = 241/255 (95%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            F GKAVK +PST +  G  + +MRK+AGKPK VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FGGKAVKLNPSTSDMIGEGRISMRKSAGKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW +ATNFVPG 
Sbjct  253  NNNAWNFATNFVPGN  267



>gb|AAB61237.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum]
Length=267

 Score =   475 bits (1223),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 226/255 (89%), Positives = 238/255 (93%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGK VK +P+  E  G  + TMRKTAGK K VSS SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGKMVKLAPTASEILGEGRITMRKTAGKTKSVSSDSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETF KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFTKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGA+EGYR+AGGPLGE+TDPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNF PGK
Sbjct  253  NNNAWAFATNFAPGK  267



>gb|EYU28183.1| hypothetical protein MIMGU_mgv1a012019mg [Erythranthe guttata]
 gb|EYU28188.1| hypothetical protein MIMGU_mgv1a012022mg [Erythranthe guttata]
Length=264

 Score =   475 bits (1222),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 242/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK   STPEFT + + +MRKTA KPKP +S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVK---STPEFTSSGRISMRKTAAKPKPAASSSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  250  NNNAWAFATNFVPGK  264



>ref|XP_006449644.1| hypothetical protein CICLE_v10016074mg [Citrus clementina]
 gb|ESR62884.1| hypothetical protein CICLE_v10016074mg [Citrus clementina]
Length=303

 Score =   476 bits (1226),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 239/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            F GKAV  +PS  E +   + +MRKT  K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  51   FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  108

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  109  GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  168

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  169  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYP  228

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  229  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  288

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  289  NNNAWAYATNFVPGK  303



>ref|XP_003548106.1| PREDICTED: chlorophyll a/b-binding protein precursor isoform 
1 [Glycine max]
 gb|KHN41288.1| Chlorophyll a-b binding protein 21, chloroplastic [Glycine soja]
Length=264

 Score =   475 bits (1222),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 243/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+A+K +PSTP+  G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGQAIKLAPSTPQL-GVGRVSMRKTASKT--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>ref|XP_006449645.1| hypothetical protein CICLE_v10016286mg [Citrus clementina]
 gb|ESR62885.1| hypothetical protein CICLE_v10016286mg [Citrus clementina]
Length=264

 Score =   475 bits (1222),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 233/255 (91%), Positives = 239/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            F GKAV  +PS  E     + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FVGKAVNLAPSGNELGNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>gb|AAB61236.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum]
Length=267

 Score =   475 bits (1222),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 228/255 (89%), Positives = 239/255 (94%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK SP+  E  G  + TMRK AGK K  +  SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPTASETLGEGRITMRKAAGKSKVATIDSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGE+TDPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  253  NNNAWAFATNFVPGK  267



>ref|XP_002285646.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Vitis 
vinifera]
 emb|CAN73057.1| hypothetical protein VITISV_007597 [Vitis vinifera]
Length=267

 Score =   475 bits (1222),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 228/255 (89%), Positives = 239/255 (94%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKA+K +PS  +  G  + TMRKT G+ KPVSSGSPWYG DRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKALKLAPSASDLLGEGRVTMRKTGGRAKPVSSGSPWYGTDRVKYLGPFSGEPPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMGAVEGYRI GGPLGE+ DPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVILMGAVEGYRIGGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  253  NNNAWAYATNFVPGK  267



>ref|XP_006449643.1| hypothetical protein CICLE_v10016287mg [Citrus clementina]
 ref|XP_006467513.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X1 [Citrus sinensis]
 ref|XP_006467514.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X2 [Citrus sinensis]
 gb|ESR62883.1| hypothetical protein CICLE_v10016287mg [Citrus clementina]
 gb|KDO78114.1| hypothetical protein CISIN_1g024654mg [Citrus sinensis]
Length=264

 Score =   474 bits (1221),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 239/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            F GKAV  +PS  E +   + +MRKT  K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>ref|XP_004961193.1| PREDICTED: chlorophyll a-b binding protein M9, chloroplastic-like 
[Setaria italica]
Length=264

 Score =   474 bits (1221),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 233/255 (91%), Positives = 238/255 (93%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            F GKAV    S     G A+ TMRKTA KPKP +SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  13   FVGKAVNVPSS---LFGEARVTMRKTAAKPKPAASGSPWYGPDRVLYLGPLSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>ref|XP_006365560.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   474 bits (1221),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 238/255 (93%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS  E TGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEITGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  251  NNNAWAFATNFVPGK  265



>gb|AFI60242.1| light harvesting chlorophyll a/b binding protein, partial [Panicum 
virgatum]
Length=260

 Score =   474 bits (1220),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 239/255 (94%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAV    S     G A+ TMRKTA KPKP +SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  9    FAGKAVNVPSS---LFGEARVTMRKTAAKPKPAASGSPWYGPDRVLYLGPLSGEPPSYLT  65

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  66   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  125

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  126  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  185

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  186  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  245

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  246  NNNAWAYATNFVPGK  260



>ref|XP_011045093.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
Length=263

 Score =   474 bits (1220),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 241/255 (95%), Gaps = 4/255 (2%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK +P + E  GN + +MRKT    KPV SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLNPFS-EIMGNGRISMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLT  68

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  69   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  128

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  129  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYP  188

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  189  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  248

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  249  NNNAWAYATNFVPGK  263



>emb|CDP06328.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   474 bits (1220),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 228/255 (89%), Positives = 242/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK +PS PE  GN + +M++T+   +P  SGSPWYGPDRVKYLGPFSG+PPSYLT
Sbjct  13   FAGKAVKLNPSAPELMGNGRISMKRTS---RPAPSGSPWYGPDRVKYLGPFSGDPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIF EGGL+YLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLG++TDP+YP
Sbjct  130  FKAGSQIFQEGGLNYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGDVTDPIYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>ref|XP_008356022.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   474 bits (1220),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 239/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAV+ SP   E  GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYL 
Sbjct  13   FAGKAVQLSPGATELFGNGRVSMRKTA--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLK  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
             NNAW YATNFVPGK
Sbjct  251  ANNAWXYATNFVPGK  265



>ref|XP_008364187.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   474 bits (1220),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 239/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAV+ SP   E  GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYL 
Sbjct  13   FAGKAVQLSPGATELFGNGRVSMRKTA--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLK  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
             NNAW YATNFVPGK
Sbjct  251  ANNAWXYATNFVPGK  265



>ref|XP_004303878.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   474 bits (1220),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 228/255 (89%), Positives = 238/255 (93%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+AV+ SP+     G  + TMRKT  K K VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAVQLSPAASNIFGEGRITMRKTGAKSKAVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  253  NNNAWSYATNFVPGK  267



>ref|XP_010926397.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=264

 Score =   474 bits (1219),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 231/255 (91%), Positives = 239/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK +PS     GN + TMRKT+ K  P  SGSPWYGPDRVKYLGP SGEPPSYLT
Sbjct  12   LAGKAVKLAPSASPILGNGRVTMRKTSTKRVP--SGSPWYGPDRVKYLGPLSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>gb|AHM26643.1| a-b binding protein [Pyrus x bretschneideri]
Length=264

 Score =   474 bits (1219),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 239/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAV+ SP   E  GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYL 
Sbjct  12   FAGKAVQLSPGATELFGNGRVSMRKTA--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLK  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
             NNAW YATNFVPGK
Sbjct  250  ANNAWNYATNFVPGK  264



>ref|XP_008366007.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
Length=265

 Score =   474 bits (1219),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 239/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAV+ SP   E  GN + +MRK A   K VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVQLSPGATELFGNGRVSMRKXA--TKKVSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
             NNAW YATNFVPGK
Sbjct  251  ANNAWNYATNFVPGK  265



>ref|XP_008371581.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
Length=265

 Score =   474 bits (1219),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 239/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAV+ SP   E  GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYL 
Sbjct  13   FAGKAVQLSPGATELFGNGRVSMRKTA--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLK  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
             NNAW YATNFVPGK
Sbjct  251  ANNAWNYATNFVPGK  265



>ref|XP_007158464.1| hypothetical protein PHAVU_002G154500g [Phaseolus vulgaris]
 ref|XP_007158466.1| hypothetical protein PHAVU_002G154700g [Phaseolus vulgaris]
 gb|ESW30458.1| hypothetical protein PHAVU_002G154500g [Phaseolus vulgaris]
 gb|ESW30460.1| hypothetical protein PHAVU_002G154700g [Phaseolus vulgaris]
Length=264

 Score =   473 bits (1218),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 231/255 (91%), Positives = 242/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+A+K SPSTP+ +   + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAIKLSPSTPDLS-TGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVLLMGAVEGYRIAGGPLGEVTDPIYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>ref|XP_006365572.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
 gb|AAA80589.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   473 bits (1218),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 238/255 (93%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS  E +GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  251  NNNAWAFATNFVPGK  265



>gb|AAR10886.1| chlorophyll a/b binding protein [Trifolium pratense]
Length=266

 Score =   473 bits (1218),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 233/255 (91%), Positives = 240/255 (94%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGK VK +PS+ E  G AKFTMRK A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKPVKLTPSSQEL-GVAKFTMRKGATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  252  NNNAWAFATNFVPGK  266



>ref|XP_004303877.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   473 bits (1218),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 237/255 (93%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+AVK   ST    G  + TMRKTA K K VSS SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAVKLGSSTSNLLGEGRVTMRKTAAKSKNVSSVSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPV
Sbjct  193  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  253  NNNAWSYATNFVPGK  267



>ref|XP_006368026.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   473 bits (1218),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 238/255 (93%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS  E +GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEISGNGRITMRKAVSKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  251  NNNAWAFATNFVPGK  265



>ref|XP_009598575.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   473 bits (1218),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 228/255 (89%), Positives = 240/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS  E TG  + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEITGYGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  251  NNNAWSYATNFVPGK  265



>ref|XP_006365573.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006365574.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=265

 Score =   473 bits (1217),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 238/255 (93%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS  E TGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEITGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  251  NNNAWAFATNFVPGK  265



>ref|XP_010052094.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
Length=400

 Score =   478 bits (1231),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 241/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+AVK SPSTPE  GN + +MRK     KPVSSGSPWYGPDR KYLGPFSGEPPSYLT
Sbjct  13   LAGQAVKLSPSTPELLGNGRISMRKAV--RKPVSSGSPWYGPDRAKYLGPFSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNP+LIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            +NNAWAYATNFVPG 
Sbjct  251  SNNAWAYATNFVPGN  265


 Score =   275 bits (702),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 158/207 (76%), Gaps = 20/207 (10%)
 Frame = -2

Query  732  WDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNG----------VKFGEA  583
            +D  GL+ DPE FA+ +  E+ + R AM    G     +++  G                
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVSNN  253

Query  582  VW----------FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG  433
             W          F AGAQIFSEGGLDYLGNP+LIHAQSILAIWACQV+LMGAVEGYRIAG
Sbjct  254  AWAYATNFVPGNFFAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVILMGAVEGYRIAG  313

Query  432  GPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP  253
            GPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP
Sbjct  314  GPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP  373

Query  252  LENLADHLADPVNNNAWAYATNFVPGK  172
            LENLADHLADPV+NNAWAYATNFVPGK
Sbjct  374  LENLADHLADPVSNNAWAYATNFVPGK  400



>gb|AAA80591.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   473 bits (1217),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 238/255 (93%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS  E +GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  251  NNNAWAFATNFVPGK  265



>gb|AAH53854.1| Unknown (protein for IMAGE:5194336), partial [Homo sapiens]
 gb|AAI11385.1| Unknown (protein for IMAGE:5198300), partial [Homo sapiens]
Length=287

 Score =   474 bits (1219),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 231/255 (91%), Positives = 241/255 (95%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK  PS+  F G A+ TMRKTA K KPVSSGSPWYG DRV YLGP SG+PPSYLT
Sbjct  34   FAGKAVKDLPSSALF-GEARVTMRKTAAKAKPVSSGSPWYGSDRVLYLGPLSGDPPSYLT  92

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  93   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  152

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYP
Sbjct  153  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYP  212

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPV
Sbjct  213  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPV  272

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  273  NNNAWAFATNFVPGK  287



>ref|XP_008371583.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_008356023.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_008364186.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=291

 Score =   474 bits (1219),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 239/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAV+ SP   E  GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYL 
Sbjct  39   FAGKAVQLSPGATELFGNGRVSMRKTA--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLK  96

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  97   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  156

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  157  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYP  216

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  217  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  276

Query  216  NNNAWAYATNFVPGK  172
             NNAW YATNFVPGK
Sbjct  277  ANNAWNYATNFVPGK  291



>gb|EYU38943.1| hypothetical protein MIMGU_mgv1a012024mg [Erythranthe guttata]
Length=264

 Score =   473 bits (1216),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 242/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK   STPE TGN + +MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVK---STPEITGNGRISMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QV+LMGAVEGYRIAGGPLG++ DPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGFQVLLMGAVEGYRIAGGPLGDVVDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
             NNAWA+ATNFVPGK
Sbjct  250  GNNAWAFATNFVPGK  264



>emb|CDP06329.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   473 bits (1216),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 227/255 (89%), Positives = 242/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK +PS PE  GN + +M++T+   +P  SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVKLNPSAPELMGNGRISMKRTS---RPSPSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGV+FGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVQFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIF EGGL+YLGNP+LIHAQSILAIWACQVVLMGAVEGYRIAGGPLG++TDP+YP
Sbjct  130  FKAGSQIFQEGGLNYLGNPNLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGDVTDPIYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>gb|ABQ81856.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=265

 Score =   473 bits (1216),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 242/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK  PS+  F G+A+ TMRKT  KPK V+SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNMPSSALF-GDARMTMRKTGAKPK-VASGSPWYGPDRVLYLGPLSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEF GDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGV+FGEAVW
Sbjct  71   GEFAGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVQFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>ref|XP_002283566.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Vitis 
vinifera]
 emb|CAN74831.1| hypothetical protein VITISV_023674 [Vitis vinifera]
Length=270

 Score =   473 bits (1216),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 229/257 (89%), Positives = 239/257 (93%), Gaps = 2/257 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTG--NAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSY  763
             AG+AVK +P+  E       + TMRK+  K K VSSGSPWYGPDRVKYLGPFSGEPPSY
Sbjct  14   LAGQAVKLAPNVTELLAGDQGRVTMRKSVAKSKAVSSGSPWYGPDRVKYLGPFSGEPPSY  73

Query  762  LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEA  583
            LTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEA
Sbjct  74   LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEA  133

Query  582  VWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPL  403
            VWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPL
Sbjct  134  VWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPL  193

Query  402  YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLAD  223
            YPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLAD
Sbjct  194  YPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLAD  253

Query  222  PVNNNAWAYATNFVPGK  172
            PVNNNAWAYATNFVPGK
Sbjct  254  PVNNNAWAYATNFVPGK  270



>dbj|BAJ08392.1| light harvesting chlorophyll a/b-binding protein Lhcb1 [Hordeum 
vulgare subsp. vulgare]
Length=266

 Score =   473 bits (1216),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 231/255 (91%), Positives = 240/255 (94%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK  PS+  F G A+ TMRKTA K KPVSS SPWYG DRV YLGP SG+PPSYLT
Sbjct  13   FAGKAVKDLPSSALF-GEARVTMRKTAAKAKPVSSSSPWYGSDRVLYLGPLSGDPPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  252  NNNAWAFATNFVPGK  266



>gb|ADL41158.1| chloroplast light-harvesting chlorophyll a/b binding protein 
[Triticum aestivum]
Length=266

 Score =   473 bits (1216),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 231/255 (91%), Positives = 241/255 (95%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK  PS+  F G A+ TMRKTA K KPVSSGSPWYG DRV YLGP SG+PPSYLT
Sbjct  13   FAGKAVKDLPSSALF-GEARVTMRKTAAKAKPVSSGSPWYGSDRVLYLGPLSGDPPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  252  NNNAWAFATNFVPGK  266



>gb|EYU28184.1| hypothetical protein MIMGU_mgv1a011918mg [Erythranthe guttata]
Length=266

 Score =   472 bits (1215),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 240/255 (94%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SP     TG  + +MRKT+ KPKP SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPEVTG-TGTGRISMRKTSAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  252  NNNAWAFATNFVPGK  266



>gb|EMT29002.1| Chlorophyll a-b binding protein, chloroplastic [Aegilops tauschii]
Length=266

 Score =   472 bits (1215),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 240/255 (94%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK  PS+  F G A+ TMRKTA K K V+SGSPWYG DRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNLPSSSVF-GEARVTMRKTAAKAKQVASGSPWYGSDRVLYLGPLSGEPPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEI DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEIIDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  252  NNNAWAFATNFVPGK  266



>ref|XP_006856963.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Amborella 
trichopoda]
 gb|ERN18430.1| hypothetical protein AMTR_s00189p00032350 [Amborella trichopoda]
Length=268

 Score =   472 bits (1215),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 232/258 (90%), Positives = 242/258 (94%), Gaps = 3/258 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEF--TGNAKFTMRKTAGKP-KPVSSGSPWYGPDRVKYLGPFSGEPPS  766
            FAGKA+  SP++ E   +G  + +MRK  GKP K VSSGSPWYGPDRVKYLGP SGEPPS
Sbjct  11   FAGKALALSPASSELLGSGEGRVSMRKPVGKPSKAVSSGSPWYGPDRVKYLGPLSGEPPS  70

Query  765  YLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGE  586
            YLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGE
Sbjct  71   YLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGE  130

Query  585  AVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDP  406
            AVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP
Sbjct  131  AVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWASQVILMGAVEGYRIAGGPLGEVTDP  190

Query  405  LYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLA  226
            LYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLA
Sbjct  191  LYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLA  250

Query  225  DPVNNNAWAYATNFVPGK  172
            DPVNNNAWAYATNFVPGK
Sbjct  251  DPVNNNAWAYATNFVPGK  268



>ref|XP_004233096.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_004233099.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_004233100.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_010316910.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_010316913.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 sp|P07370.1|CB2B_SOLLC RecName: Full=Chlorophyll a-b binding protein 1B, chloroplastic; 
AltName: Full=LHCII type I CAB-1B; Short=LHCP; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA34147.1| chlorophyll a/b-binding protein Cab-1B [Solanum lycopersicum]
Length=265

 Score =   472 bits (1215),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 228/255 (89%), Positives = 238/255 (93%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS  E +GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  251  NNNAWAFATNFVPGK  265



>gb|AAA80592.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   472 bits (1214),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 228/255 (89%), Positives = 237/255 (93%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS  E TGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEITGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIF EGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ +PLYP
Sbjct  131  FKAGSQIFREGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVNPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  251  NNNAWSYATNFVPGK  265



>ref|XP_007151996.1| hypothetical protein PHAVU_004G093000g [Phaseolus vulgaris]
 gb|ESW23990.1| hypothetical protein PHAVU_004G093000g [Phaseolus vulgaris]
Length=264

 Score =   472 bits (1214),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 243/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+A+K SP+TP+ +G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAIKLSPATPDLSG-GRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            G+FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GQFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>ref|XP_009377335.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=267

 Score =   472 bits (1214),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 224/255 (88%), Positives = 238/255 (93%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             +G+AVK +PS+    G  + TMRKTA K K VSSGSPWYGPDR KYLGPFSGE PSYLT
Sbjct  13   LSGQAVKLNPSSSNLLGEGRVTMRKTAAKSKKVSSGSPWYGPDRAKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGC+FPELLSRNGVKFGEA W
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSRNGVKFGEATW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFS+GGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AGGPLGEITDPLYP
Sbjct  133  FKAGAQIFSQGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGGPLGEITDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNF PG+
Sbjct  253  NNNAWSYATNFAPGQ  267



>gb|AGV54498.1| LHCII type I chlorophyll a/b-binding protein [Phaseolus vulgaris]
Length=264

 Score =   471 bits (1213),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 241/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+A+K SPSTP+ +   + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAIKLSPSTPDLS-TGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVLLMGAVEGYRIAGGPLGEVTDPIYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSM GFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMVGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>ref|XP_007151979.1| hypothetical protein PHAVU_004G091600g [Phaseolus vulgaris]
 gb|ESW23973.1| hypothetical protein PHAVU_004G091600g [Phaseolus vulgaris]
Length=264

 Score =   471 bits (1213),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 243/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+A+K SP+TP+ +G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAIKLSPATPDISG-GRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            G+FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GQFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>gb|AAF89206.1|AF279249_1 LHCII type I chlorophyll a/b-binding protein [Vigna radiata]
Length=264

 Score =   471 bits (1213),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 242/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+A+K SPSTPE +G  + +MRK A K   VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAIKLSPSTPELSG-GRISMRKAASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFS+FGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSIFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>ref|XP_009377344.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=267

 Score =   471 bits (1213),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 226/255 (89%), Positives = 237/255 (93%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+AVK S ST    G  + TMRKTA K K VS GSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAVKLSKSTSTLRGEGRITMRKTAAKSKNVSCGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGC+FPELLSRN VKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSRNRVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPLYP  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GG FDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFF+QAIVTGKGP+ENLADHL+DPV
Sbjct  193  GGKFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFLQAIVTGKGPIENLADHLSDPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  253  NNNAWSYATNFVPGK  267



>ref|XP_010097596.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
 gb|EXB69297.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
Length=265

 Score =   471 bits (1213),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 241/255 (95%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAV+ +P+  + TG  + +MRKT  +    SSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVELTPTANKVTGGGRVSMRKTGSRG--ASSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVILMGAVEGYRIAGGPLGEVTDPIYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>dbj|BAA24493.1| chlorophyll a/b-binding protein [Fagus crenata]
Length=264

 Score =   471 bits (1212),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 241/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK +PSTPE     + +MRK+A +   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLAPSTPELN-VGRVSMRKSASRN--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
             NNAWAYATNFVPGK
Sbjct  250  TNNAWAYATNFVPGK  264



>gb|ACU23974.1| unknown [Glycine max]
Length=264

 Score =   471 bits (1212),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 242/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+A+K +PSTP+  G  + +MRKTA K   V+SGSPWYGPDRVKYLGPFSGEPPSY T
Sbjct  13   LAGQAIKLAPSTPQL-GVGRVSMRKTASKT--VTSGSPWYGPDRVKYLGPFSGEPPSYRT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELK+GRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKHGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>gb|AAA80594.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   471 bits (1212),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 227/255 (89%), Positives = 237/255 (93%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS  E +GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGE VW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEVVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  251  NNNAWSYATNFVPGK  265



>prf||1204205B protein 1B,chlorophyll binding
Length=265

 Score =   471 bits (1212),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 227/255 (89%), Positives = 238/255 (93%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS  E +GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFS+GGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSQGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  251  NNNAWAFATNFVPGK  265



>dbj|BAJ93064.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   471 bits (1211),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 231/255 (91%), Positives = 240/255 (94%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK  PS+  F G A+ TMRKTA K K V+SGSPWYG DRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNLPSSSLF-GEARVTMRKTAAKVKQVASGSPWYGSDRVLYLGPLSGEPPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEI DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  252  NNNAWAFATNFVPGK  266



>emb|CDP06330.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   471 bits (1211),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 226/255 (89%), Positives = 241/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK +PS PE  GN + +M++T+   +P  SGSPWYG DRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVKLNPSAPELMGNGRISMKRTS---RPAPSGSPWYGRDRVKYLGPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGV+FGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVQFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIF +GGL+YLGNP+LIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFQQGGLNYLGNPNLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>gb|ACD64978.1| chloroplast chlorophyll a/b-binding protein [Ophiopogon japonicus]
Length=264

 Score =   471 bits (1211),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 232/256 (91%), Positives = 240/256 (94%), Gaps = 4/256 (2%)
 Frame = -2

Query  936  FAGKAVKFSPS-TPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYL  760
             AGKAVK +PS   E  GN + +MRKT    K VSSGSPWYGPDRVKYLGPFSGEPPSYL
Sbjct  12   LAGKAVKLAPSPASELMGNGRISMRKTG---KSVSSGSPWYGPDRVKYLGPFSGEPPSYL  68

Query  759  TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  580
            TGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAV
Sbjct  69   TGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAV  128

Query  579  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLY  400
            WFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLY
Sbjct  129  WFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWASQVVLMGAVEGYRIAGGPLGEVTDPLY  188

Query  399  PGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP  220
            PGGSFDPLGLADDPEAF+ELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP
Sbjct  189  PGGSFDPLGLADDPEAFSELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP  248

Query  219  VNNNAWAYATNFVPGK  172
            VNNNAWAYATNFVPGK
Sbjct  249  VNNNAWAYATNFVPGK  264



>gb|AAF89207.1|AF279250_1 LHCII type I chlorophyll a/b-binding protein [Vigna radiata]
Length=264

 Score =   470 bits (1210),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 242/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+A+K SPSTP+ +G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAIKLSPSTPDLSG-GRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALG VFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGSVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVILMGAVEGYRIAGGPLGEVTDPIYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>gb|AEO51755.1| chloroplast chlorophyll A/B binding protein [Dimocarpus longan]
Length=263

 Score =   470 bits (1210),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 239/255 (94%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            F GKAV+ +P+  +  GN + TMRKT    + VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FIGKAVQLAPTGNDLMGNGRVTMRKTG---RQVSSGSPWYGPDRVKYLGPFSGEPPSYLT  68

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWD AGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  69   GEFPGDYGWDAAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  128

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLG++TDPLYP
Sbjct  129  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGKVTDPLYP  188

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGR AMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  189  GGSFDPLGLADDPEAFAELKVKEIKNGRSAMFSMFGFFVQAIVTGKGPLENLADHLADPV  248

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  249  NNNAWAYATNFVPGK  263



>gb|AGV54521.1| LHCII type I chlorophyll a/b-binding protein [Phaseolus vulgaris]
Length=264

 Score =   470 bits (1210),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 241/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+A+K SPSTP+ +   + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAIKLSPSTPDLS-TGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVLLMGAVEGYRIAGGPLGEVTDPIYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYA NFVPGK
Sbjct  250  NNNAWAYAPNFVPGK  264



>ref|XP_010231015.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Brachypodium distachyon]
Length=263

 Score =   470 bits (1210),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 238/255 (93%), Gaps = 4/255 (2%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK  P+     G A+ TMRKT  K KPVSSGSPWYG DRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNLPAL----GEARITMRKTVAKAKPVSSGSPWYGSDRVLYLGPLSGEPPSYLT  68

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  69   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  128

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYP
Sbjct  129  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYP  188

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  189  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  248

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  249  NNNAWAFATNFVPGK  263



>gb|ABW70800.1| chloroplast light harvesting chlorophyll a/b binding protein 
[Populus euphratica]
Length=263

 Score =   470 bits (1210),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 234/255 (92%), Positives = 239/255 (94%), Gaps = 4/255 (2%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK +P + E  GN   +MRKT    KPV SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLNPFS-EIMGNGCISMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLT  68

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  69   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  128

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  129  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYP  188

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSM GFFVQAIVTGKGPLENLADHLADPV
Sbjct  189  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMLGFFVQAIVTGKGPLENLADHLADPV  248

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  249  NNNAWAYATNFVPGK  263



>ref|XP_004233101.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum lycopersicum]
Length=265

 Score =   470 bits (1210),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 227/255 (89%), Positives = 237/255 (93%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            F G+AVK SPS  E +GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FVGQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  251  NNNAWAFATNFVPGK  265



>ref|XP_007151990.1| hypothetical protein PHAVU_004G092600g [Phaseolus vulgaris]
 ref|XP_007151998.1| hypothetical protein PHAVU_004G093200g [Phaseolus vulgaris]
 gb|ESW23984.1| hypothetical protein PHAVU_004G092600g [Phaseolus vulgaris]
 gb|ESW23992.1| hypothetical protein PHAVU_004G093200g [Phaseolus vulgaris]
Length=264

 Score =   470 bits (1210),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 228/255 (89%), Positives = 242/255 (95%), Gaps = 3/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+A+K SP+TP+ +G  + +MRKTA K   VSSGSPWYGPDR KYLGPFSGE PSYLT
Sbjct  13   LAGQAIKLSPATPDLSGG-RISMRKTASKS--VSSGSPWYGPDRAKYLGPFSGEAPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            G+FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GQFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264



>ref|XP_010666512.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=268

 Score =   470 bits (1210),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 228/256 (89%), Positives = 238/256 (93%), Gaps = 1/256 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPV-SSGSPWYGPDRVKYLGPFSGEPPSYL  760
             AGKAVK  P+  E  G  + TMRKT GK KP  SS SPWYGPDRVKYLGPFSGE PSYL
Sbjct  13   LAGKAVKLGPTAWEILGEGRVTMRKTGGKTKPAASSSSPWYGPDRVKYLGPFSGEAPSYL  72

Query  759  TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  580
            TGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAV
Sbjct  73   TGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAV  132

Query  579  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLY  400
            WFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLY
Sbjct  133  WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLY  192

Query  399  PGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP  220
            PGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP
Sbjct  193  PGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP  252

Query  219  VNNNAWAYATNFVPGK  172
            VNNNAWA+ATNFVPGK
Sbjct  253  VNNNAWAFATNFVPGK  268



>ref|XP_010097597.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
 gb|EXB69298.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
Length=265

 Score =   470 bits (1209),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 228/255 (89%), Positives = 239/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAV+ +P+    TG  + +MRKT  +    SSGSPWYGPDRVKYLGP SGEPPSYLT
Sbjct  13   FAGKAVELTPTANRVTGGGRVSMRKTGSRV--ASSGSPWYGPDRVKYLGPLSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVILMGAVEGYRIAGGPLGEVTDPIYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>ref|XP_004293579.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Fragaria 
vesca subsp. vesca]
Length=263

 Score =   470 bits (1209),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 241/255 (95%), Gaps = 4/255 (2%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAV+ +P+  E  G  + +MRKT GK   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVQLAPT--EVFGTGRISMRKTVGKA--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  68

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  69   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  128

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  129  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVEDPLYP  188

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  189  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  248

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  249  NNNAWSYATNFVPGK  263



>gb|EYU29602.1| hypothetical protein MIMGU_mgv1a019986mg [Erythranthe guttata]
Length=260

 Score =   469 bits (1208),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 230/256 (90%), Positives = 242/256 (95%), Gaps = 4/256 (2%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGN-AKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYL  760
            FAG+AVK SP   E T N ++ +MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYL
Sbjct  8    FAGQAVKLSP---EITANYSRVSMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYL  64

Query  759  TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  580
            TGEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAV
Sbjct  65   TGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAV  124

Query  579  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLY  400
            WFKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLY
Sbjct  125  WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLY  184

Query  399  PGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP  220
            PGGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP
Sbjct  185  PGGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP  244

Query  219  VNNNAWAYATNFVPGK  172
            VNNNAWA+ATNFVPGK
Sbjct  245  VNNNAWAFATNFVPGK  260



>gb|EYU19613.1| hypothetical protein MIMGU_mgv1a011885mg [Erythranthe guttata]
Length=267

 Score =   470 bits (1209),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 229/257 (89%), Positives = 241/257 (94%), Gaps = 5/257 (2%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNA--KFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSY  763
            FAG+AVK +P   E T N+  + +MRKTA KPK VSS SPWYGPDRVKYLGPFSGE PSY
Sbjct  14   FAGQAVKIAP---EITANSVGRVSMRKTAAKPKQVSSSSPWYGPDRVKYLGPFSGEAPSY  70

Query  762  LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEA  583
            LTGEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEA
Sbjct  71   LTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEA  130

Query  582  VWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPL  403
            VWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPL
Sbjct  131  VWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPL  190

Query  402  YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLAD  223
            YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLAD
Sbjct  191  YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLAD  250

Query  222  PVNNNAWAYATNFVPGK  172
            PVNNNAW+YATNFVPGK
Sbjct  251  PVNNNAWSYATNFVPGK  267



>gb|EYU29604.1| hypothetical protein MIMGU_mgv1a023200mg [Erythranthe guttata]
 gb|EYU30287.1| hypothetical protein MIMGU_mgv1a011913mg [Erythranthe guttata]
 gb|EYU30288.1| hypothetical protein MIMGU_mgv1a020332mg [Erythranthe guttata]
Length=267

 Score =   469 bits (1208),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 230/256 (90%), Positives = 242/256 (95%), Gaps = 4/256 (2%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGN-AKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYL  760
            FAG+AVK SP   E T N ++ +MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYL
Sbjct  15   FAGQAVKLSP---EITANYSRVSMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYL  71

Query  759  TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  580
            TGEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAV
Sbjct  72   TGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAV  131

Query  579  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLY  400
            WFKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLY
Sbjct  132  WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLY  191

Query  399  PGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP  220
            PGGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP
Sbjct  192  PGGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP  251

Query  219  VNNNAWAYATNFVPGK  172
            VNNNAWA+ATNFVPGK
Sbjct  252  VNNNAWAFATNFVPGK  267



>sp|P07371.1|CB22_PEA RecName: Full=Chlorophyll a-b binding protein AB80, chloroplastic; 
AltName: Full=LHCII type I CAB-AB80; Short=LHCP; Flags: 
Precursor [Pisum sativum]
 gb|AAA63413.1| cab precursor [Pisum sativum]
 gb|AAA33651.1| polypeptide 15 precursor [Pisum sativum]
 prf||1006296A protein,chlorophyll a/b binding
Length=269

 Score =   470 bits (1209),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 240/255 (94%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGK +K +PS+ E  G A+FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  16   LAGKQLKLNPSSQEL-GAARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLT  74

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  75   GEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  134

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  135  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYP  194

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  195  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  254

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  255  NNNAWSYATNFVPGK  269



>gb|ABQ81857.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=265

 Score =   469 bits (1208),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 240/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK  PS+  F G A+ TMRKT  KPK  +SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNVPSSALF-GEARVTMRKTGAKPK-ATSGSPWYGPDRVLYLGPLSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGV+FGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVQFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTG GP+ENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGNGPIENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>ref|XP_002515206.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF47190.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=267

 Score =   469 bits (1208),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 234/259 (90%), Positives = 239/259 (92%), Gaps = 5/259 (2%)
 Frame = -2

Query  936  FAGKAVKFSPST----PEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPP  769
            F GKAV  S  T       + N + TMRKTAGKP   SSGSPWYGPDRVKYLGPFSGEPP
Sbjct  10   FTGKAVPLSAQTELPATVRSSNGRVTMRKTAGKPA-ASSGSPWYGPDRVKYLGPFSGEPP  68

Query  768  SYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFG  589
            SYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFG
Sbjct  69   SYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFG  128

Query  588  EAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITD  409
            EAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TD
Sbjct  129  EAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTD  188

Query  408  PLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL  229
            PLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHL
Sbjct  189  PLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL  248

Query  228  ADPVNNNAWAYATNFVPGK  172
            ADPVNNNAWAYATNFVPGK
Sbjct  249  ADPVNNNAWAYATNFVPGK  267



>ref|XP_004302854.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   469 bits (1208),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 226/254 (89%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = -2

Query  933  AGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  754
            AG+AVK +PS+    G  + TMRKTA K K VSSGS WYGPDRVKYLGPFSGE PSYLTG
Sbjct  14   AGQAVKLNPSSSNINGEGRVTMRKTASKSKTVSSGSLWYGPDRVKYLGPFSGEAPSYLTG  73

Query  753  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWF  574
            EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWF
Sbjct  74   EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWF  133

Query  573  KAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPG  394
            KAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPG
Sbjct  134  KAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVIDPLYPG  193

Query  393  GSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVN  214
            GSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DHLADPVN
Sbjct  194  GSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLTDHLADPVN  253

Query  213  NNAWAYATNFVPGK  172
            NNAW++ATNFVPGK
Sbjct  254  NNAWSFATNFVPGK  267



>ref|XP_006467511.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Citrus sinensis]
Length=399

 Score =   474 bits (1221),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 232/255 (91%), Positives = 239/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            F G AV  +PS  E +   + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FVGMAVNLAPSGNELSNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYP  189

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  190  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  249

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  250  NNNAWAYATNFVPGK  264


 Score =   276 bits (707),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 159/207 (77%), Gaps = 20/207 (10%)
 Frame = -2

Query  732  WDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLS---------------RNGV  598
            +D  GL+ DPE FA+ +  E+ + R AM    G     +++                N  
Sbjct  193  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  252

Query  597  KFGEAVWFK-----AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG  433
             +  A  F      AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG
Sbjct  253  AWAYATNFVPGKKFAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG  312

Query  432  GPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP  253
            GPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP
Sbjct  313  GPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP  372

Query  252  LENLADHLADPVNNNAWAYATNFVPGK  172
            LENLADHLADPVNNNAWAYATNFVPGK
Sbjct  373  LENLADHLADPVNNNAWAYATNFVPGK  399



>ref|XP_010316912.1| PREDICTED: chlorophyll a-b binding protein 1A, chloroplastic 
[Solanum lycopersicum]
Length=265

 Score =   469 bits (1207),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 228/255 (89%), Positives = 238/255 (93%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK SPS  E +GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASENSGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  251  NNNAWAFATNFVPGK  265



>sp|P12329.1|CB21_MAIZE RecName: Full=Chlorophyll a-b binding protein 1, chloroplastic; 
AltName: Full=LHCII type I CAB-1; Short=LHCP; Flags: Precursor 
[Zea mays]
 emb|CAA32900.1| unnamed protein product [Zea mays]
 gb|ACF83754.1| unknown [Zea mays]
 gb|ACG25538.1| chlorophyll a-b binding protein 2 [Zea mays]
 gb|ACG28560.1| chlorophyll a-b binding protein 2 [Zea mays]
 tpg|DAA62636.1| TPA: light harvesting chlorophyll a/b binding protein2 [Zea mays]
Length=262

 Score =   469 bits (1207),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  888  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  709
            G  + TMRKT GKPK  +SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  24   GEGRITMRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  83

Query  708  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  529
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  84   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  143

Query  528  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  349
            GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  144  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  203

Query  348  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  172
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPG 
Sbjct  204  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGN  262



>sp|P04779.1|CB21_PETSP RecName: Full=Chlorophyll a-b binding protein 13, chloroplastic; 
AltName: Full=LHCII type I CAB-13; Short=LHCP; Flags: Precursor 
[Petunia sp.]
 emb|CAA26210.1| unnamed protein product [Petunia sp.]
Length=266

 Score =   469 bits (1207),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 227/255 (89%), Positives = 237/255 (93%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAV   PS+ E T N K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVNV-PSSSEITRNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADP TFAKNR+LEVIH RW MLGALGCVFPEL +RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPATFAKNRKLEVIHCRWTMLGALGCVFPELFARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIF EGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFKEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAEL+VKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLADDPEAFAELEVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  252  NNNAWAFATNFVPGK  266



>gb|ABN49454.2| chloroplast chlorophyll a/b binding protein [Pisum sativum]
Length=266

 Score =   469 bits (1207),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 228/255 (89%), Positives = 239/255 (94%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
              GK VK +PS+ E  G A+FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LTGKPVKLNPSSQEL-GGARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  252  NNNAWSYATNFVPGK  266



>ref|XP_010316911.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum lycopersicum]
Length=265

 Score =   469 bits (1207),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 227/255 (89%), Positives = 236/255 (93%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AVK  PS  E TGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYL 
Sbjct  13   FAGQAVKLLPSASEITGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLN  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  251  NNNAWSYATNFVPGK  265



>ref|NP_001241277.1| uncharacterized protein LOC100805310 [Glycine max]
 gb|ACU24438.1| unknown [Glycine max]
Length=263

 Score =   469 bits (1206),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 233/254 (92%), Positives = 239/254 (94%), Gaps = 5/254 (2%)
 Frame = -2

Query  933  AGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  754
            AGKAVK  PS PE     + +MRKT    K VSSGSPWYGPDRVKYLGPFSGEPPSYLTG
Sbjct  15   AGKAVKLGPSAPEV---GRVSMRKTV--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  69

Query  753  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWF  574
            EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWF
Sbjct  70   EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWF  129

Query  573  KAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPG  394
            KAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YPG
Sbjct  130  KAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPG  189

Query  393  GSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVN  214
            GSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVN
Sbjct  190  GSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVN  249

Query  213  NNAWAYATNFVPGK  172
            NNAWAYATNFVPGK
Sbjct  250  NNAWAYATNFVPGK  263



>dbj|BAJ90643.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=265

 Score =   469 bits (1206),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 239/255 (94%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGK+VK   S+  F G A+ TMRKTA K K VSSGSPWYG DRV YLGP SGEPPSYLT
Sbjct  12   FAGKSVKNVASSALF-GEARVTMRKTAAKAKQVSSGSPWYGADRVLYLGPLSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFS+GGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSDGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEVKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  251  NNNAWAFATNFVPGK  265



>gb|EMT29003.1| Chlorophyll a-b binding protein, chloroplastic [Aegilops tauschii]
Length=266

 Score =   469 bits (1206),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 238/255 (93%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK  PS+  F G+A+ TMRKTA K K V SGSPWYG DRV YLGP SGEPPSYL 
Sbjct  13   FAGKAVKNLPSSSLF-GDARVTMRKTAAKAKQVVSGSPWYGSDRVLYLGPLSGEPPSYLN  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEI DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHL DPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLTDPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  252  NNNAWAFATNFVPGK  266



>gb|EMS50796.1| Chlorophyll a-b binding protein, chloroplastic [Triticum urartu]
Length=266

 Score =   469 bits (1206),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 238/255 (93%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK  PS   F G A+ TMRKTA K K VSSGSPWYG DRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNVPSLALF-GEARVTMRKTAAKAKQVSSGSPWYGADRVLYLGPLSGEPPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RN VKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNDVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  252  NNNAWAFATNFVPGK  266



>gb|EMS51039.1| Chlorophyll a-b binding protein 3C, chloroplastic [Triticum urartu]
Length=265

 Score =   469 bits (1206),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 239/255 (94%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGK+VK   S+  F G A+ TMRKTA K KPVSSGSPWYG DRV YLGP SGEPPSYLT
Sbjct  12   FAGKSVKNVASSALF-GEARVTMRKTAAKAKPVSSGSPWYGADRVLYLGPLSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKF EAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFREAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEVKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  251  NNNAWAFATNFVPGK  265



>ref|XP_010237260.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Brachypodium distachyon]
Length=266

 Score =   469 bits (1206),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 229/255 (90%), Positives = 239/255 (94%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK  PS+  F G A+ TMRKTA K KPV SGSPWYG DRV YLGP SG+PPSYLT
Sbjct  13   FAGKAVKNLPSSALF-GEARVTMRKTAAKAKPVPSGSPWYGADRVLYLGPLSGQPPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ DPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKEVKNGRLAMFSMFGFFVQAIVTGKGPLENLADHITDPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  252  NNNAWAFATNFVPGK  266



>ref|XP_004957570.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Setaria italica]
Length=261

 Score =   468 bits (1205),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  888  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  709
            G  + TMRKTA KPK  +SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  23   GEGRITMRKTAAKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  82

Query  708  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  529
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  83   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  142

Query  528  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  349
            GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  143  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  202

Query  348  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  172
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG 
Sbjct  203  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGN  261



>gb|AAF26741.1|AF220527_1 chlorophyll a/b binding protein precursor [Euphorbia esula]
Length=268

 Score =   468 bits (1205),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 232/256 (91%), Positives = 241/256 (94%), Gaps = 2/256 (1%)
 Frame = -2

Query  936  FAGKAVKFSPST-PEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYL  760
            FAG+AVK SPS+  E  GN + +MRK A K K   SGSPWYGPDRVKYLGPFSGEPPSYL
Sbjct  14   FAGQAVKLSPSSASELMGNGRVSMRKAATK-KVAPSGSPWYGPDRVKYLGPFSGEPPSYL  72

Query  759  TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  580
            TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAV
Sbjct  73   TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAV  132

Query  579  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLY  400
            WFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DP+Y
Sbjct  133  WFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPIY  192

Query  399  PGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP  220
            PGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL DP
Sbjct  193  PGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLFDP  252

Query  219  VNNNAWAYATNFVPGK  172
            VNNNAWA+ATNFVPGK
Sbjct  253  VNNNAWAFATNFVPGK  268



>gb|KHN28981.1| Chlorophyll a-b binding protein 3, chloroplastic [Glycine soja]
Length=263

 Score =   468 bits (1205),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 232/254 (91%), Positives = 239/254 (94%), Gaps = 5/254 (2%)
 Frame = -2

Query  933  AGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  754
            AGKAVK  PS PE     + +MRKT    K VSSGSPWYGPDRVKYLGPFSGEPPSYLTG
Sbjct  15   AGKAVKLGPSAPEV---GRVSMRKTV--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  69

Query  753  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWF  574
            EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWF
Sbjct  70   EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWF  129

Query  573  KAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPG  394
            KAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YPG
Sbjct  130  KAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPG  189

Query  393  GSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVN  214
            GSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVN
Sbjct  190  GSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVN  249

Query  213  NNAWAYATNFVPGK  172
            NNAWAYATNFVPGK
Sbjct  250  NNAWAYATNFVPGK  263



>gb|AAB18209.1| chlorophyll a/b-binding protein WCAB precursor [Triticum aestivum]
Length=266

 Score =   468 bits (1204),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 228/255 (89%), Positives = 238/255 (93%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK  PS     G A+ TMRKTA K K VSSGSPWYG DRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNVPSL-ALLGEARVTMRKTAAKAKQVSSGSPWYGADRVLYLGPLSGEPPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADPV
Sbjct  192  GGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  252  NNNAWAFATNFVPGK  266



>gb|AFV34722.1| light harvesting chlorophyll a/b-binding protein 1-1 [Dendrocalamus 
latiflorus]
Length=265

 Score =   468 bits (1204),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 233/255 (91%), Positives = 240/255 (94%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK  PS+  F G A+ TMRKT  KPKP +SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNVPSSAIF-GEARVTMRKTGAKPKP-ASGSPWYGPDRVLYLGPLSGEPPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAFQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWAYATNFVPGK
Sbjct  251  NNNAWAYATNFVPGK  265



>gb|AAZ79657.1| putative chlorophyll a/b-binding protein [Fagus sylvatica]
Length=260

 Score =   468 bits (1203),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 231/254 (91%), Positives = 240/254 (94%), Gaps = 3/254 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAVK +PSTPE     + +MRK+A +   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  10   LAGKAVKLAPSTPELN-VGRVSMRKSASRN--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  66

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  67   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  126

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  127  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVLLMGAVEGYRIAGGPLGEVTDPLYP  186

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPV
Sbjct  187  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPV  246

Query  216  NNNAWAYATNFVPG  175
             NNAWAYATNFVPG
Sbjct  247  TNNAWAYATNFVPG  260



>ref|NP_001147639.1| chlorophyll a-b binding protein 1, chloroplastic precursor [Zea 
mays]
 gb|ACG28217.1| chlorophyll a-b binding protein 2 [Zea mays]
Length=262

 Score =   468 bits (1203),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  888  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  709
            G  + TMRKT GKPK  +SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  24   GEGRITMRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  83

Query  708  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  529
            DP+TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  84   DPKTFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  143

Query  528  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  349
            GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  144  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  203

Query  348  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  172
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPG 
Sbjct  204  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGN  262



>ref|XP_010666522.1| PREDICTED: uncharacterized protein LOC104883672 [Beta vulgaris 
subsp. vulgaris]
Length=624

 Score =   481 bits (1237),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 240/255 (94%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AGKAV   P+  E  G  + TMRKTAGKPK VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  370  LAGKAVNLGPNASEILGEGRITMRKTAGKPKQVSSGSPWYGPDRVKYLGPFSGEAPSYLT  429

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  430  GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  489

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  490  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  549

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  550  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  609

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  610  NNNAWAFATNFVPGK  624


 Score =   471 bits (1213),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 228/256 (89%), Positives = 238/256 (93%), Gaps = 1/256 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPV-SSGSPWYGPDRVKYLGPFSGEPPSYL  760
             AGKAVK  P+  E  G  + TMRKT GK KP  SS SPWYGPDRVKYLGPFSGE PSYL
Sbjct  13   LAGKAVKLGPTAWEILGEGRVTMRKTGGKTKPAASSSSPWYGPDRVKYLGPFSGEAPSYL  72

Query  759  TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  580
            TGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAV
Sbjct  73   TGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAV  132

Query  579  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLY  400
            WFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLY
Sbjct  133  WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLY  192

Query  399  PGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP  220
            PGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP
Sbjct  193  PGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP  252

Query  219  VNNNAWAYATNFVPGK  172
            VNNNAWA+ATNFVPGK
Sbjct  253  VNNNAWAFATNFVPGK  268



>gb|AAW31511.1| light-harvesting chlorophyll-a/b binding protein Lhcb1 [Pisum 
sativum]
Length=266

 Score =   467 bits (1202),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 227/255 (89%), Positives = 239/255 (94%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
              GK VK +PS+ E  G A+FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LTGKPVKLNPSSQEL-GGARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPV
Sbjct  192  GGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  252  NNNAWSYATNFVPGK  266



>gb|EYU19649.1| hypothetical protein MIMGU_mgv1a011927mg [Erythranthe guttata]
Length=266

 Score =   467 bits (1202),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 227/255 (89%), Positives = 237/255 (93%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAG+AV  SP      G  + +MRKTA KPKP SS SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVNLSPEISTANG-GRISMRKTAAKPKPASSSSPWYGPDRVKYLGPFSGEAPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  252  NNNAWAFATNFVPGK  266



>ref|XP_002455902.1| hypothetical protein SORBIDRAFT_03g027040 [Sorghum bicolor]
 gb|EES01022.1| hypothetical protein SORBIDRAFT_03g027040 [Sorghum bicolor]
Length=265

 Score =   467 bits (1202),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 225/247 (91%), Positives = 234/247 (95%), Gaps = 0/247 (0%)
 Frame = -2

Query  912  SPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYG  733
            + ST +  G  + TMRKTA KPKP +SGSPWYG DRV YLGPFSGEPPSYLTGEFPGDYG
Sbjct  19   TTSTRDVFGEGRITMRKTAAKPKPAASGSPWYGADRVLYLGPFSGEPPSYLTGEFPGDYG  78

Query  732  WDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIF  553
            WDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIF
Sbjct  79   WDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIF  138

Query  552  SEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLG  373
            SEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLG
Sbjct  139  SEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLG  198

Query  372  LADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYA  193
            LADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYA
Sbjct  199  LADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYA  258

Query  192  TNFVPGK  172
            TNFVPGK
Sbjct  259  TNFVPGK  265



>ref|XP_008358195.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   467 bits (1202),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 234/258 (91%), Positives = 241/258 (93%), Gaps = 5/258 (2%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFT---GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPS  766
            F GKA+  +  T EF+   GN + +MRKTA KP  VSSGSPWYGPDRVKYLGPFSGE PS
Sbjct  10   FTGKAIPLNTQT-EFSAVQGNGRVSMRKTAKKPA-VSSGSPWYGPDRVKYLGPFSGEAPS  67

Query  765  YLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGE  586
            YLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGE
Sbjct  68   YLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGE  127

Query  585  AVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDP  406
            AVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGEITDP
Sbjct  128  AVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDP  187

Query  405  LYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLA  226
            LYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLA
Sbjct  188  LYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLA  247

Query  225  DPVNNNAWAYATNFVPGK  172
            DPV NNAWAYATNFVPGK
Sbjct  248  DPVTNNAWAYATNFVPGK  265



>ref|XP_011460161.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=263

 Score =   467 bits (1201),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 240/255 (94%), Gaps = 4/255 (2%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAV+ +P+  E  G  + +MRKT GK   VSSGSPWYGPDRVKYLGPFSGEPPSYL 
Sbjct  13   FAGKAVQLAPA--EVFGTGRISMRKTVGKA--VSSGSPWYGPDRVKYLGPFSGEPPSYLK  68

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  69   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  128

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  129  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVEDPLYP  188

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  189  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  248

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  249  NNNAWSYATNFVPGK  263



>ref|XP_009377327.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=267

 Score =   467 bits (1201),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 223/255 (87%), Positives = 235/255 (92%), Gaps = 0/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
             AG+AVK S ST    G  + TM KTA K K VS+G  WYGPDRV+YLGPFSG+ PSYLT
Sbjct  13   LAGQAVKLSQSTSTLLGEGRITMHKTAAKSKNVSAGREWYGPDRVRYLGPFSGQSPSYLT  72

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGC+FPELLSRNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSRNGVKFGEAVW  132

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRI GGPLGE+TDPLY 
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIVGGPLGEVTDPLYT  192

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPV
Sbjct  193  GGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPV  252

Query  216  NNNAWAYATNFVPGK  172
            NNNAW+YATNFVPGK
Sbjct  253  NNNAWSYATNFVPGK  267



>ref|XP_009400578.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Musa 
acuminata subsp. malaccensis]
Length=267

 Score =   467 bits (1201),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 234/256 (91%), Positives = 243/256 (95%), Gaps = 1/256 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSS-GSPWYGPDRVKYLGPFSGEPPSYL  760
             AGKAVK +PS  E  G  + TMRK+A K KP ++ GSPWYGPDRVKYLGPFSGEPPSYL
Sbjct  12   LAGKAVKLAPSVSEILGEGRVTMRKSAAKAKPAAASGSPWYGPDRVKYLGPFSGEPPSYL  71

Query  759  TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  580
            TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV
Sbjct  72   TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  131

Query  579  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLY  400
            WFKAGAQIFS+GGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLY
Sbjct  132  WFKAGAQIFSDGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLY  191

Query  399  PGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP  220
            PGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP
Sbjct  192  PGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP  251

Query  219  VNNNAWAYATNFVPGK  172
            VNNNAWAYATNFVPGK
Sbjct  252  VNNNAWAYATNFVPGK  267



>ref|XP_004969083.1| PREDICTED: chlorophyll a-b binding protein 2, chloroplastic-like 
[Setaria italica]
Length=265

 Score =   466 bits (1200),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 229/250 (92%), Positives = 236/250 (94%), Gaps = 1/250 (0%)
 Frame = -2

Query  918  KFSPSTPEFTGNAKFTMRKTAG-KPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPG  742
            K + ST +  G  + TMRKT G KPKP +SGSPWYGPDRV YLGP SGEPPSYLTGEFPG
Sbjct  16   KPAASTRDVFGEGRITMRKTGGAKPKPAASGSPWYGPDRVLYLGPLSGEPPSYLTGEFPG  75

Query  741  DYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGA  562
            DYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+
Sbjct  76   DYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGS  135

Query  561  QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFD  382
            QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFD
Sbjct  136  QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFD  195

Query  381  PLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW  202
            PLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW
Sbjct  196  PLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW  255

Query  201  AYATNFVPGK  172
            AYATNFVPGK
Sbjct  256  AYATNFVPGK  265



>gb|EYU35814.1| hypothetical protein MIMGU_mgv1a011908mg [Erythranthe guttata]
Length=267

 Score =   466 bits (1199),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 231/258 (90%), Positives = 243/258 (94%), Gaps = 6/258 (2%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEF-TGNAKFTMRKTAGKPKP--VSSGSPWYGPDRVKYLGPFSGEPPS  766
            FAG+AVK   STPEF +   + +MRKTAGKPKP   SSGSPWYGPDRVKYLGPFSGE PS
Sbjct  13   FAGQAVK---STPEFASSGGRISMRKTAGKPKPKPASSGSPWYGPDRVKYLGPFSGEAPS  69

Query  765  YLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGE  586
            YL+GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGE
Sbjct  70   YLSGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGE  129

Query  585  AVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDP  406
            AVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DP
Sbjct  130  AVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDP  189

Query  405  LYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLA  226
            LYPGGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLA
Sbjct  190  LYPGGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLA  249

Query  225  DPVNNNAWAYATNFVPGK  172
            DPVNNNAWA+ATNFVPGK
Sbjct  250  DPVNNNAWAFATNFVPGK  267



>gb|AES74698.2| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=265

 Score =   466 bits (1199),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 228/255 (89%), Positives = 237/255 (93%), Gaps = 2/255 (1%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
              GKA+K SPSTP+     + TMRKT  K K V SGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   MVGKAIKLSPSTPDLV-MGRITMRKTTNK-KNVPSGSPWYGPDRVKYLGPFSGEAPSYLT  70

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWAVQVILMGAVEGYRIAGGPLGEVVDPLYP  190

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ DPV
Sbjct  191  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHITDPV  250

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  251  NNNAWAFATNFVPGK  265



>ref|XP_002455901.1| hypothetical protein SORBIDRAFT_03g027030 [Sorghum bicolor]
 gb|EES01021.1| hypothetical protein SORBIDRAFT_03g027030 [Sorghum bicolor]
Length=266

 Score =   466 bits (1199),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 225/247 (91%), Positives = 234/247 (95%), Gaps = 0/247 (0%)
 Frame = -2

Query  912  SPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYG  733
            + ST +  G  + TMRKTA KPKP +SGSPWYG DRV YLGPFSGEPPSYLTGEFPGDYG
Sbjct  20   TTSTRDVFGEGRITMRKTAAKPKPAASGSPWYGADRVLYLGPFSGEPPSYLTGEFPGDYG  79

Query  732  WDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIF  553
            WDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIF
Sbjct  80   WDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIF  139

Query  552  SEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLG  373
            SEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLG
Sbjct  140  SEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLG  199

Query  372  LADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYA  193
            LADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYA
Sbjct  200  LADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYA  259

Query  192  TNFVPGK  172
            TNFVPGK
Sbjct  260  TNFVPGK  266



>gb|EMS67016.1| Chlorophyll a-b binding protein, chloroplastic [Triticum urartu]
Length=266

 Score =   466 bits (1199),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 227/255 (89%), Positives = 238/255 (93%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK  PS+  F G A+ TMRKTA K K V+S SPWYG DR+ YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNLPSSSLF-GEARVTMRKTAAKAKQVTSSSPWYGSDRLLYLGPLSGEPPSYLT  71

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RN VKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNSVKFGEAVW  131

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYP  191

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF+QAIVTGKGPLENLADHLADPV
Sbjct  192  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFMQAIVTGKGPLENLADHLADPV  251

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  252  NNNAWAFATNFVPGK  266



>gb|EMT02412.1| Chlorophyll a-b binding protein, chloroplastic [Aegilops tauschii]
Length=261

 Score =   466 bits (1198),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 230/255 (90%), Positives = 240/255 (94%), Gaps = 1/255 (0%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  757
            FAGKAVK  PS+  F G A+ TMRKTA K K V+SGSPWYG DRV YLGP SGEPPSYLT
Sbjct  8    FAGKAVKNLPSSFLF-GEARVTMRKTAAKAKQVASGSPWYGSDRVLYLGPLSGEPPSYLT  66

Query  756  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  577
            GEFPGDYGWDTAGLSADP+TFAKNRELEVIH RWAMLGALGCVFPELL+R+GVKFGEAVW
Sbjct  67   GEFPGDYGWDTAGLSADPKTFAKNRELEVIHCRWAMLGALGCVFPELLARDGVKFGEAVW  126

Query  576  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  397
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEI DPLYP
Sbjct  127  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYP  186

Query  396  GGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  217
            GGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV
Sbjct  187  GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV  246

Query  216  NNNAWAYATNFVPGK  172
            NNNAWA+ATNFVPGK
Sbjct  247  NNNAWAFATNFVPGK  261



>ref|XP_007221496.1| hypothetical protein PRUPE_ppa010066mg [Prunus persica]
 ref|XP_008227797.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
 gb|EMJ22695.1| hypothetical protein PRUPE_ppa010066mg [Prunus persica]
Length=265

 Score =   466 bits (1199),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 232/258 (90%), Positives = 241/258 (93%), Gaps = 5/258 (2%)
 Frame = -2

Query  936  FAGKAVKFSPSTPEFT---GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPS  766
            F GKA+  +  T EF+   GN + +MR+ A KP  VSSGSPWYGPDRVKYLGPFSGE PS
Sbjct  10   FTGKAIPLNTQT-EFSTVQGNGRVSMRRAARKPA-VSSGSPWYGPDRVKYLGPFSGEAPS  67

Query  765  YLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGE  586
            YLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGE
Sbjct  68   YLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGE  127

Query  585  AVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDP  406
            AVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP
Sbjct  128  AVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDP  187

Query  405  LYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLA  226
            LYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLA
Sbjct  188  LYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLA  247

Query  225  DPVNNNAWAYATNFVPGK  172
            DPVNNNAWAYATNFVPGK
Sbjct  248  DPVNNNAWAYATNFVPGK  265



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2720187578200