BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9883

Length=970
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU46514.1|  hypothetical protein MIMGU_mgv1a010915mg                262   8e-82   Erythranthe guttata [common monkey flower]
ref|XP_002281626.1|  PREDICTED: transcription factor UNE12              249   4e-77   Vitis vinifera
ref|XP_002520976.1|  DNA binding protein, putative                      246   7e-76   Ricinus communis
gb|KHN02539.1|  Transcription factor UNE12                              243   2e-75   Glycine soja [wild soybean]
ref|XP_006383684.1|  hypothetical protein POPTR_0005s23930g             245   2e-75   Populus trichocarpa [western balsam poplar]
ref|XP_008451266.1|  PREDICTED: transcription factor UNE12              245   4e-75   Cucumis melo [Oriental melon]
ref|XP_007050429.1|  Basic helix-loop-helix DNA-binding superfami...    244   4e-75   
ref|XP_004146956.1|  PREDICTED: transcription factor UNE12              244   9e-75   Cucumis sativus [cucumbers]
ref|XP_003554277.1|  PREDICTED: transcription factor UNE12-like i...    243   9e-75   Glycine max [soybeans]
ref|XP_012092122.1|  PREDICTED: transcription factor UNE12-like         243   1e-74   
ref|XP_010087126.1|  hypothetical protein L484_012559                   243   2e-74   
ref|XP_011042433.1|  PREDICTED: transcription factor UNE12              243   2e-74   Populus euphratica
emb|CDP03688.1|  unnamed protein product                                243   4e-74   Coffea canephora [robusta coffee]
gb|KHF99712.1|  Transcription factor UNE12 -like protein                242   4e-74   Gossypium arboreum [tree cotton]
ref|XP_011082599.1|  PREDICTED: transcription factor UNE12-like         242   9e-74   Sesamum indicum [beniseed]
ref|XP_011026052.1|  PREDICTED: transcription factor UNE12-like         241   1e-73   Populus euphratica
gb|KJB42176.1|  hypothetical protein B456_007G141800                    241   2e-73   Gossypium raimondii
gb|KJB42177.1|  hypothetical protein B456_007G141800                    241   2e-73   Gossypium raimondii
ref|XP_009354865.1|  PREDICTED: transcription factor UNE12              240   2e-73   Pyrus x bretschneideri [bai li]
ref|XP_002302077.1|  basic helix-loop-helix family protein              240   3e-73   Populus trichocarpa [western balsam poplar]
gb|KHG09586.1|  Transcription factor UNE12 -like protein                240   3e-73   Gossypium arboreum [tree cotton]
gb|KHN10703.1|  Transcription factor UNE12                              237   3e-73   Glycine soja [wild soybean]
gb|KJB22947.1|  hypothetical protein B456_004G075200                    240   4e-73   Gossypium raimondii
gb|ACN21630.1|  putative basic helix-loop-helix protein BHLH3           239   4e-73   Lotus japonicus
ref|XP_007144689.1|  hypothetical protein PHAVU_007G176900g             239   4e-73   Phaseolus vulgaris [French bean]
ref|XP_003536810.1|  PREDICTED: transcription factor UNE12              239   5e-73   Glycine max [soybeans]
gb|KHN03837.1|  Transcription factor UNE12                              238   7e-73   Glycine soja [wild soybean]
ref|XP_008372300.1|  PREDICTED: transcription factor UNE12-like         239   7e-73   
ref|XP_008372294.1|  PREDICTED: transcription factor UNE12-like         238   1e-72   
gb|KJB25973.1|  hypothetical protein B456_004G218900                    238   1e-72   Gossypium raimondii
gb|KHG12939.1|  Transcription factor UNE12 -like protein                238   1e-72   Gossypium arboreum [tree cotton]
ref|XP_007162488.1|  hypothetical protein PHAVU_001G156400g             238   1e-72   Phaseolus vulgaris [French bean]
ref|XP_003521266.1|  PREDICTED: transcription factor UNE12-like         238   2e-72   Glycine max [soybeans]
ref|XP_004495148.1|  PREDICTED: transcription factor UNE12-like i...    236   5e-72   Cicer arietinum [garbanzo]
ref|XP_011079946.1|  PREDICTED: transcription factor UNE12              237   8e-72   Sesamum indicum [beniseed]
ref|XP_003590536.1|  Transcription factor UNE12                         234   3e-71   Medicago truncatula
ref|XP_003590537.1|  Transcription factor UNE12                         234   4e-71   Medicago truncatula
ref|XP_006349737.1|  PREDICTED: transcription factor UNE12-like         233   1e-70   Solanum tuberosum [potatoes]
ref|XP_004247209.1|  PREDICTED: transcription factor UNE12              233   2e-70   Solanum lycopersicum
gb|KDO48911.1|  hypothetical protein CISIN_1g040019mg                   228   3e-70   Citrus sinensis [apfelsine]
gb|KHN18841.1|  Transcription factor UNE12                              231   3e-70   Glycine soja [wild soybean]
ref|XP_010274210.1|  PREDICTED: transcription factor UNE12 isofor...    230   2e-69   Nelumbo nucifera [Indian lotus]
ref|XP_008382959.1|  PREDICTED: transcription factor UNE12-like         230   2e-69   Malus domestica [apple tree]
emb|CDY18011.1|  BnaC03g30830D                                          229   3e-69   Brassica napus [oilseed rape]
ref|XP_010274208.1|  PREDICTED: transcription factor UNE12 isofor...    230   5e-69   Nelumbo nucifera [Indian lotus]
ref|XP_009607290.1|  PREDICTED: transcription factor UNE12-like         229   5e-69   Nicotiana tomentosiformis
ref|XP_009776898.1|  PREDICTED: transcription factor UNE12-like         229   6e-69   Nicotiana sylvestris
ref|XP_009134422.1|  PREDICTED: transcription factor UNE12-like         228   1e-68   Brassica rapa
ref|XP_007201836.1|  hypothetical protein PRUPE_ppa009299mg             228   1e-68   Prunus persica
ref|XP_008235331.1|  PREDICTED: transcription factor UNE12              228   2e-68   Prunus mume [ume]
ref|XP_006396471.1|  hypothetical protein EUTSA_v10028824mg             228   2e-68   Eutrema salsugineum [saltwater cress]
ref|XP_004289895.1|  PREDICTED: transcription factor UNE12              227   2e-68   Fragaria vesca subsp. vesca
ref|NP_001118919.1|  transcription factor UNE12                         225   3e-68   Arabidopsis thaliana [mouse-ear cress]
emb|CDY22062.1|  BnaA09g00910D                                          227   3e-68   Brassica napus [oilseed rape]
ref|XP_010422571.1|  PREDICTED: transcription factor UNE12-like         226   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_009111272.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    227   4e-68   Brassica rapa
ref|XP_002872829.1|  hypothetical protein ARALYDRAFT_490301             227   5e-68   
emb|CDY21898.1|  BnaC09g00040D                                          226   6e-68   Brassica napus [oilseed rape]
ref|XP_006443926.1|  hypothetical protein CICLE_v10021443mg             226   7e-68   Citrus clementina [clementine]
emb|CDX90930.1|  BnaA03g26100D                                          226   8e-68   
ref|NP_567245.1|  transcription factor UNE12                            226   9e-68   Arabidopsis thaliana [mouse-ear cress]
gb|KJB11136.1|  hypothetical protein B456_001G242500                    226   1e-67   Gossypium raimondii
gb|AIL24119.1|  basic helix-loop-helix leucine-zipper transcripti...    226   1e-67   Tamarix hispida
ref|XP_010429869.1|  PREDICTED: transcription factor UNE12-like         226   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_009364494.1|  PREDICTED: transcription factor UNE12 isofor...    226   2e-67   Pyrus x bretschneideri [bai li]
ref|XP_008366876.1|  PREDICTED: transcription factor UNE12-like i...    226   2e-67   Malus domestica [apple tree]
emb|CDX91293.1|  BnaC02g27040D                                          225   2e-67   
ref|XP_009364493.1|  PREDICTED: transcription factor UNE12 isofor...    226   2e-67   Pyrus x bretschneideri [bai li]
ref|XP_008218266.1|  PREDICTED: transcription factor UNE12-like i...    226   2e-67   Prunus mume [ume]
ref|XP_006288280.1|  hypothetical protein CARUB_v10001523mg             225   3e-67   
ref|XP_004493736.1|  PREDICTED: transcription factor UNE12-like i...    224   3e-67   Cicer arietinum [garbanzo]
ref|XP_008218265.1|  PREDICTED: transcription factor UNE12-like i...    226   3e-67   Prunus mume [ume]
ref|XP_010456011.1|  PREDICTED: transcription factor UNE12              224   3e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010679161.1|  PREDICTED: transcription factor UNE12              224   3e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007205486.1|  hypothetical protein PRUPE_ppa008172mg             225   4e-67   Prunus persica
dbj|BAJ33851.1|  unnamed protein product                                224   4e-67   Eutrema halophilum
gb|AAM65759.1|  putative bHLH transcription factor                      224   4e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004493737.1|  PREDICTED: transcription factor UNE12-like i...    223   5e-67   Cicer arietinum [garbanzo]
gb|AAM10948.1|AF488592_1  putative bHLH transcription factor            224   6e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010038816.1|  PREDICTED: transcription factor UNE12 isofor...    224   7e-67   Eucalyptus grandis [rose gum]
ref|XP_010038809.1|  PREDICTED: transcription factor UNE12 isofor...    224   1e-66   Eucalyptus grandis [rose gum]
emb|CBI34158.3|  unnamed protein product                                221   3e-66   Vitis vinifera
gb|EYU17893.1|  hypothetical protein MIMGU_mgv1a010769mg                222   3e-66   Erythranthe guttata [common monkey flower]
ref|XP_002284047.1|  PREDICTED: transcription factor UNE12              222   4e-66   Vitis vinifera
ref|XP_007030571.1|  Basic helix-loop-helix DNA-binding superfami...    223   5e-66   Theobroma cacao [chocolate]
ref|XP_003520191.1|  PREDICTED: transcription factor UNE12-like         220   5e-66   
gb|KJB44876.1|  hypothetical protein B456_007G277200                    222   6e-66   Gossypium raimondii
ref|XP_011465955.1|  PREDICTED: transcription factor UNE12 isofor...    222   8e-66   Fragaria vesca subsp. vesca
ref|XP_004302053.1|  PREDICTED: transcription factor UNE12 isofor...    222   9e-66   Fragaria vesca subsp. vesca
ref|XP_009364496.1|  PREDICTED: transcription factor UNE12 isofor...    221   1e-65   Pyrus x bretschneideri [bai li]
ref|XP_008366877.1|  PREDICTED: transcription factor UNE12-like i...    221   1e-65   
ref|XP_006432927.1|  hypothetical protein CICLE_v10001768mg             221   1e-65   Citrus clementina [clementine]
ref|XP_008450747.1|  PREDICTED: transcription factor UNE12-like i...    221   1e-65   Cucumis melo [Oriental melon]
ref|XP_004135655.1|  PREDICTED: transcription factor UNE12-like i...    221   1e-65   Cucumis sativus [cucumbers]
emb|CAN66761.1|  hypothetical protein VITISV_032727                     221   1e-65   Vitis vinifera
emb|CDX97278.1|  BnaA02g20690D                                          220   2e-65   
ref|XP_010659880.1|  PREDICTED: transcription factor UNE12-like         221   2e-65   Vitis vinifera
ref|XP_011659936.1|  PREDICTED: transcription factor UNE12-like i...    219   3e-65   Cucumis sativus [cucumbers]
ref|XP_008450748.1|  PREDICTED: transcription factor UNE12-like i...    219   3e-65   Cucumis melo [Oriental melon]
gb|ACN21631.1|  putative basic helix-loop-helix protein BHLH4           215   6e-64   Lotus japonicus
ref|XP_008370704.1|  PREDICTED: transcription factor UNE12-like i...    217   6e-64   
ref|XP_008370703.1|  PREDICTED: transcription factor UNE12-like i...    217   6e-64   
ref|XP_010522761.1|  PREDICTED: transcription factor UNE12              216   9e-64   Tarenaya hassleriana [spider flower]
ref|XP_012089261.1|  PREDICTED: transcription factor UNE12-like i...    216   1e-63   Jatropha curcas
ref|XP_010025019.1|  PREDICTED: transcription factor UNE12-like i...    213   1e-63   
ref|XP_007144828.1|  hypothetical protein PHAVU_007G187500g             216   2e-63   Phaseolus vulgaris [French bean]
ref|XP_012089258.1|  PREDICTED: transcription factor UNE12-like i...    216   2e-63   Jatropha curcas
gb|KHN04930.1|  Transcription factor UNE12                              215   3e-63   Glycine soja [wild soybean]
ref|XP_012089262.1|  PREDICTED: transcription factor UNE12-like i...    215   3e-63   Jatropha curcas
ref|XP_002531293.1|  conserved hypothetical protein                     214   4e-63   
ref|XP_002306441.2|  hypothetical protein POPTR_0005s05500g             214   5e-63   
ref|XP_012089259.1|  PREDICTED: transcription factor UNE12-like i...    214   8e-63   Jatropha curcas
ref|XP_011032406.1|  PREDICTED: transcription factor UNE12-like i...    213   1e-62   Populus euphratica
ref|XP_011032404.1|  PREDICTED: transcription factor UNE12-like i...    213   1e-62   Populus euphratica
gb|EAZ02995.1|  hypothetical protein OsI_25136                          212   2e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_010025017.1|  PREDICTED: transcription factor UNE12-like i...    212   2e-62   Eucalyptus grandis [rose gum]
ref|XP_006606461.1|  PREDICTED: transcription factor UNE12-like i...    213   2e-62   Glycine max [soybeans]
ref|XP_003556469.1|  PREDICTED: transcription factor UNE12-like i...    213   2e-62   Glycine max [soybeans]
ref|XP_006305432.1|  hypothetical protein CARUB_v10009831mg             212   2e-62   Capsella rubella
ref|XP_010246322.1|  PREDICTED: transcription factor UNE12-like i...    216   3e-62   Nelumbo nucifera [Indian lotus]
ref|XP_010025016.1|  PREDICTED: transcription factor UNE12-like i...    212   3e-62   Eucalyptus grandis [rose gum]
gb|KCW61602.1|  hypothetical protein EUGRSUZ_H04337                     213   4e-62   Eucalyptus grandis [rose gum]
ref|XP_010246321.1|  PREDICTED: transcription factor UNE12-like i...    216   5e-62   Nelumbo nucifera [Indian lotus]
gb|KEH43018.1|  transcription factor UNE12-like protein                 213   5e-62   Medicago truncatula
ref|XP_010674832.1|  PREDICTED: transcription factor UNE12-like         211   9e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002466294.1|  hypothetical protein SORBIDRAFT_01g005130          209   1e-61   Sorghum bicolor [broomcorn]
ref|XP_008788138.1|  PREDICTED: transcription factor UNE12-like i...    209   1e-61   Phoenix dactylifera
gb|EEE66685.1|  hypothetical protein OsJ_23336                          211   1e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008788137.1|  PREDICTED: transcription factor UNE12-like i...    209   1e-61   
ref|XP_010246320.1|  PREDICTED: transcription factor UNE12-like i...    216   1e-61   Nelumbo nucifera [Indian lotus]
ref|XP_006589182.1|  PREDICTED: transcription factor UNE12-like i...    211   1e-61   Glycine max [soybeans]
ref|XP_006589180.1|  PREDICTED: transcription factor UNE12-like i...    211   1e-61   
ref|XP_010246319.1|  PREDICTED: transcription factor UNE12-like i...    216   2e-61   Nelumbo nucifera [Indian lotus]
ref|XP_006589181.1|  PREDICTED: transcription factor UNE12-like i...    210   2e-61   
ref|XP_003536121.1|  PREDICTED: transcription factor UNE12-like i...    210   2e-61   Glycine max [soybeans]
ref|XP_004496017.1|  PREDICTED: transcription factor UNE12-like         215   2e-61   
ref|XP_010228372.1|  PREDICTED: transcription factor UNE12-like i...    206   2e-61   
ref|NP_001184895.1|  transcription factor bHLH7                         209   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|NP_563672.1|  transcription factor bHLH7                            209   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892144.1|  basic helix-loop-helix family protein              209   2e-61   
gb|ACN21629.1|  putative basic helix-loop-helix protein BHLH2           210   3e-61   Lotus japonicus
ref|NP_001152044.1|  LOC100285681                                       208   3e-61   Zea mays [maize]
ref|XP_012089260.1|  PREDICTED: transcription factor UNE12-like i...    210   3e-61   Jatropha curcas
gb|KHN22077.1|  Transcription factor UNE12                              209   4e-61   Glycine soja [wild soybean]
ref|XP_004955662.1|  PREDICTED: transcription factor UNE12-like         208   4e-61   Setaria italica
gb|KFK42664.1|  hypothetical protein AALP_AA1G023700                    208   6e-61   Arabis alpina [alpine rockcress]
ref|XP_009144630.1|  PREDICTED: transcription factor UNE12-like         207   6e-61   Brassica rapa
ref|XP_009418926.1|  PREDICTED: transcription factor UNE12-like i...    208   7e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418925.1|  PREDICTED: transcription factor UNE12-like i...    208   7e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010457313.1|  PREDICTED: transcription factor bHLH7-like         208   8e-61   
ref|XP_004981425.1|  PREDICTED: transcription factor UNE12-like         207   8e-61   Setaria italica
ref|XP_002461549.1|  hypothetical protein SORBIDRAFT_02g004570          207   9e-61   Sorghum bicolor [broomcorn]
ref|XP_010474907.1|  PREDICTED: transcription factor bHLH7-like         207   1e-60   Camelina sativa [gold-of-pleasure]
ref|NP_001059050.1|  Os07g0182200                                       201   2e-60   
gb|EPS57409.1|  hypothetical protein M569_17409                         206   2e-60   Genlisea aurea
ref|XP_009119583.1|  PREDICTED: transcription factor bHLH7              207   2e-60   Brassica rapa
gb|EMT27472.1|  Transcription factor UNE12                              204   2e-60   
ref|XP_009418924.1|  PREDICTED: transcription factor UNE12-like i...    207   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010936103.1|  PREDICTED: transcription factor UNE12 isofor...    206   3e-60   Elaeis guineensis
emb|CDY18143.1|  BnaC05g01660D                                          206   4e-60   Brassica napus [oilseed rape]
ref|XP_010481495.1|  PREDICTED: transcription factor bHLH7-like         206   4e-60   
ref|XP_011038575.1|  PREDICTED: transcription factor UNE12-like         207   4e-60   Populus euphratica
gb|EEE60096.1|  hypothetical protein OsJ_12958                          205   6e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011076653.1|  PREDICTED: transcription factor UNE12-like         206   6e-60   Sesamum indicum [beniseed]
ref|NP_001051563.1|  Os03g0797600                                       205   7e-60   
gb|KHG28438.1|  Transcription factor UNE12 -like protein                207   7e-60   Gossypium arboreum [tree cotton]
ref|XP_010228376.1|  PREDICTED: transcription factor UNE12-like i...    204   8e-60   
ref|XP_010936096.1|  PREDICTED: transcription factor UNE12 isofor...    205   8e-60   Elaeis guineensis
gb|ACG44301.1|  BHLH transcription factor                               199   1e-59   Zea mays [maize]
ref|XP_010923486.1|  PREDICTED: transcription factor UNE12-like i...    205   1e-59   Elaeis guineensis
ref|XP_010923485.1|  PREDICTED: transcription factor UNE12-like i...    205   2e-59   Elaeis guineensis
gb|ABB16991.1|  unknown                                                 204   2e-59   Solanum tuberosum [potatoes]
ref|XP_003561348.1|  PREDICTED: transcription factor UNE12-like i...    204   2e-59   Brachypodium distachyon [annual false brome]
ref|XP_010556765.1|  PREDICTED: transcription factor UNE12              204   3e-59   Tarenaya hassleriana [spider flower]
gb|ADX60279.1|  bHLH transcription factor                               203   4e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004247636.1|  PREDICTED: transcription factor UNE12-like         203   4e-59   Solanum lycopersicum
ref|XP_008786085.1|  PREDICTED: transcription factor UNE12-like i...    203   5e-59   Phoenix dactylifera
ref|XP_010553329.1|  PREDICTED: transcription factor bHLH7-like         204   6e-59   Tarenaya hassleriana [spider flower]
ref|XP_008786084.1|  PREDICTED: transcription factor UNE12-like i...    203   8e-59   
ref|NP_001274947.1|  uncharacterized LOC102577469                       201   3e-58   Solanum tuberosum [potatoes]
ref|XP_010228286.1|  PREDICTED: transcription factor UNE12-like i...    200   5e-58   Brachypodium distachyon [annual false brome]
ref|XP_006650733.1|  PREDICTED: transcription factor UNE12-like         194   8e-58   
ref|XP_010457311.1|  PREDICTED: transcription factor bHLH7              194   9e-58   Camelina sativa [gold-of-pleasure]
ref|XP_006418274.1|  hypothetical protein EUTSA_v10008279mg             199   3e-57   Eutrema salsugineum [saltwater cress]
ref|XP_006418273.1|  hypothetical protein EUTSA_v10008279mg             198   3e-57   
gb|ACF82186.1|  unknown                                                 194   5e-57   Zea mays [maize]
ref|XP_009762993.1|  PREDICTED: transcription factor UNE12-like         199   6e-57   Nicotiana sylvestris
emb|CDP20692.1|  unnamed protein product                                197   1e-56   Coffea canephora [robusta coffee]
ref|NP_001140213.1|  putative HLH DNA-binding domain superfamily ...    195   5e-56   Zea mays [maize]
ref|XP_009398564.1|  PREDICTED: transcription factor UNE12-like i...    194   1e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009612697.1|  PREDICTED: transcription factor UNE12-like         195   2e-55   Nicotiana tomentosiformis
ref|XP_009399361.1|  PREDICTED: transcription factor UNE12-like         193   4e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010553760.1|  PREDICTED: transcription factor bHLH7-like i...    191   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_010553759.1|  PREDICTED: transcription factor bHLH7-like i...    191   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_004234028.1|  PREDICTED: transcription factor UNE12-like         187   6e-53   Solanum lycopersicum
gb|AFW90608.1|  beta-fructofuranosidase protein                         186   2e-52   Solanum tuberosum [potatoes]
ref|XP_012092119.1|  PREDICTED: transcription factor UNE12-like         179   2e-52   Jatropha curcas
ref|XP_002319074.2|  hypothetical protein POPTR_0013s03830g             176   1e-50   
ref|XP_009398565.1|  PREDICTED: transcription factor UNE12-like i...    181   1e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010274209.1|  PREDICTED: transcription factor UNE12 isofor...    178   2e-49   Nelumbo nucifera [Indian lotus]
gb|EMS63234.1|  Transcription factor UNE12                              173   8e-49   Triticum urartu
gb|KHG26252.1|  Transcription factor UNE12 -like protein                163   1e-45   Gossypium arboreum [tree cotton]
ref|XP_010041192.1|  PREDICTED: transcription factor UNE12-like         159   1e-44   Eucalyptus grandis [rose gum]
gb|KHG20614.1|  Transcription factor UNE12 -like protein                158   3e-44   Gossypium arboreum [tree cotton]
ref|XP_006356051.1|  PREDICTED: transcription factor UNE12-like         157   8e-44   
gb|ERN01450.1|  hypothetical protein AMTR_s00002p00267570               163   8e-44   Amborella trichopoda
ref|XP_011621734.1|  PREDICTED: transcription factor UNE12              163   2e-43   
ref|XP_010265624.1|  PREDICTED: transcription factor bHLH66-like        166   2e-43   Nelumbo nucifera [Indian lotus]
ref|XP_011084002.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    163   8e-43   
ref|XP_009358465.1|  PREDICTED: transcription factor bHLH66-like        162   7e-42   Pyrus x bretschneideri [bai li]
ref|XP_009800017.1|  PREDICTED: transcription factor UNE12-like         156   7e-42   Nicotiana sylvestris
ref|XP_008367760.1|  PREDICTED: transcription factor bHLH66-like        162   8e-42   
ref|XP_004507723.1|  PREDICTED: transcription factor bHLH66-like        160   1e-41   Cicer arietinum [garbanzo]
ref|XP_009366166.1|  PREDICTED: transcription factor bHLH66-like        160   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_010275766.1|  PREDICTED: transcription factor bHLH66             161   2e-41   Nelumbo nucifera [Indian lotus]
ref|XP_007154897.1|  hypothetical protein PHAVU_003G157100g             159   3e-41   Phaseolus vulgaris [French bean]
ref|XP_009394940.1|  PREDICTED: transcription factor bHLH82-like ...    159   3e-41   
gb|KJB54936.1|  hypothetical protein B456_009G055200                    160   3e-41   Gossypium raimondii
ref|XP_007154896.1|  hypothetical protein PHAVU_003G157100g             159   3e-41   Phaseolus vulgaris [French bean]
gb|KHG24512.1|  Transcription factor bHLH66 -like protein               160   4e-41   Gossypium arboreum [tree cotton]
ref|XP_004287121.1|  PREDICTED: transcription factor bHLH66-like        159   5e-41   Fragaria vesca subsp. vesca
ref|XP_007011960.1|  LJRHL1-like 1                                      159   5e-41   
ref|XP_006343666.1|  PREDICTED: transcription factor bHLH66-like        159   5e-41   Solanum tuberosum [potatoes]
ref|XP_008242964.1|  PREDICTED: transcription factor bHLH66-like        159   6e-41   Prunus mume [ume]
ref|XP_009394942.1|  PREDICTED: transcription factor bHLH82-like ...    159   7e-41   
ref|XP_007204332.1|  hypothetical protein PRUPE_ppa005254mg             158   2e-40   
ref|NP_001141950.1|  putative HLH DNA-binding domain superfamily ...    158   2e-40   Zea mays [maize]
ref|XP_008667581.1|  PREDICTED: putative HLH DNA-binding domain s...    158   2e-40   Zea mays [maize]
ref|XP_003610348.1|  Transcription factor bHLH66                        157   2e-40   
ref|XP_003610347.1|  Transcription factor bHLH66                        157   2e-40   
gb|KDP38664.1|  hypothetical protein JCGZ_04017                         157   2e-40   Jatropha curcas
ref|XP_004251756.1|  PREDICTED: transcription factor bHLH66-like        156   3e-40   Solanum lycopersicum
ref|XP_011033445.1|  PREDICTED: transcription factor bHLH66-like        157   3e-40   Populus euphratica
ref|XP_012071482.1|  PREDICTED: transcription factor bHLH66-like        157   3e-40   Jatropha curcas
ref|XP_006473971.1|  PREDICTED: transcription factor bHLH66-like        157   3e-40   Citrus sinensis [apfelsine]
ref|XP_002325140.2|  hypothetical protein POPTR_0018s11800g             157   4e-40   Populus trichocarpa [western balsam poplar]
ref|XP_011078667.1|  PREDICTED: transcription factor bHLH66-like        156   4e-40   Sesamum indicum [beniseed]
gb|KHN18326.1|  Transcription factor bHLH66                             154   4e-40   Glycine soja [wild soybean]
ref|XP_003570296.1|  PREDICTED: transcription factor bHLH82-like        154   5e-40   Brachypodium distachyon [annual false brome]
gb|ERN18653.1|  hypothetical protein AMTR_s00065p00184910               157   5e-40   Amborella trichopoda
ref|XP_009795099.1|  PREDICTED: transcription factor bHLH66-like        155   6e-40   Nicotiana sylvestris
ref|XP_011628047.1|  PREDICTED: transcription factor bHLH66             157   6e-40   Amborella trichopoda
ref|XP_006600554.1|  PREDICTED: transcription factor bHLH66-like ...    154   7e-40   Glycine max [soybeans]
ref|XP_006600553.1|  PREDICTED: transcription factor bHLH66-like ...    154   7e-40   Glycine max [soybeans]
ref|XP_002965459.1|  hypothetical protein SELMODRAFT_24892              148   7e-40   
ref|XP_010656597.1|  PREDICTED: transcription factor UNE12-like i...    157   7e-40   Vitis vinifera
ref|XP_010929149.1|  PREDICTED: uncharacterized protein LOC105050...    157   7e-40   Elaeis guineensis
ref|XP_010656596.1|  PREDICTED: uncharacterized protein LOC100243...    157   8e-40   Vitis vinifera
ref|XP_006600552.1|  PREDICTED: transcription factor bHLH66-like ...    154   8e-40   Glycine max [soybeans]
ref|XP_006600551.1|  PREDICTED: transcription factor bHLH66-like ...    154   8e-40   Glycine max [soybeans]
ref|XP_006453668.1|  hypothetical protein CICLE_v10008192mg             156   8e-40   Citrus clementina [clementine]
gb|KDO59403.1|  hypothetical protein CISIN_1g012156mg                   156   8e-40   Citrus sinensis [apfelsine]
ref|XP_002308393.2|  hypothetical protein POPTR_0006s20070g             156   8e-40   
emb|CAN75431.1|  hypothetical protein VITISV_021146                     156   8e-40   Vitis vinifera
gb|KDO59405.1|  hypothetical protein CISIN_1g012156mg                   156   8e-40   Citrus sinensis [apfelsine]
ref|XP_008799645.1|  PREDICTED: transcription factor bHLH66             156   9e-40   Phoenix dactylifera
ref|XP_007138416.1|  hypothetical protein PHAVU_009G207000g             155   1e-39   Phaseolus vulgaris [French bean]
ref|XP_001774188.1|  predicted protein                                  150   2e-39   
gb|ACP28172.1|  roothairless1/slippery                                  154   2e-39   Lotus japonicus
ref|XP_008343903.1|  PREDICTED: transcription factor bHLH66-like        155   2e-39   
ref|XP_010432917.1|  PREDICTED: transcription factor bHLH69-like        152   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010929150.1|  PREDICTED: uncharacterized protein LOC105050...    155   2e-39   Elaeis guineensis
ref|XP_010438099.1|  PREDICTED: transcription factor bHLH69 isofo...    152   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010942107.1|  PREDICTED: transcription factor bHLH66-like        155   2e-39   Elaeis guineensis
gb|KDO59404.1|  hypothetical protein CISIN_1g012156mg                   155   2e-39   Citrus sinensis [apfelsine]
emb|CBI36515.3|  unnamed protein product                                151   3e-39   Vitis vinifera
gb|KHG27662.1|  Transcription factor bHLH66 -like protein               154   3e-39   Gossypium arboreum [tree cotton]
ref|XP_003533887.2|  PREDICTED: transcription factor bHLH66-like        155   3e-39   Glycine max [soybeans]
ref|XP_004146688.1|  PREDICTED: transcription factor bHLH82             154   4e-39   Cucumis sativus [cucumbers]
ref|XP_009140529.1|  PREDICTED: transcription factor bHLH66             152   4e-39   Brassica rapa
ref|XP_008443870.1|  PREDICTED: transcription factor bHLH82             154   4e-39   Cucumis melo [Oriental melon]
ref|XP_009619149.1|  PREDICTED: transcription factor bHLH66-like        153   4e-39   Nicotiana tomentosiformis
ref|XP_010093338.1|  hypothetical protein L484_002940                   154   4e-39   
ref|XP_011018013.1|  PREDICTED: transcription factor bHLH66-like        154   4e-39   Populus euphratica
ref|XP_006350094.1|  PREDICTED: transcription factor bHLH66-like        152   5e-39   Solanum tuberosum [potatoes]
gb|KJB65759.1|  hypothetical protein B456_010G112200                    154   6e-39   Gossypium raimondii
ref|XP_010447636.1|  PREDICTED: transcription factor bHLH69-like        150   8e-39   Camelina sativa [gold-of-pleasure]
ref|XP_002867318.1|  basic helix-loop-helix family protein              150   9e-39   
ref|XP_010682674.1|  PREDICTED: transcription factor bHLH66-like        152   1e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002523493.1|  conserved hypothetical protein                     152   2e-38   
ref|NP_194827.2|  transcription factor bHLH69                           149   2e-38   
ref|XP_006412645.1|  hypothetical protein EUTSA_v10025656mg             150   2e-38   
ref|XP_010525813.1|  PREDICTED: transcription factor bHLH66             150   2e-38   
ref|XP_006404930.1|  hypothetical protein EUTSA_v10000220mg             150   2e-38   
ref|XP_006294501.1|  hypothetical protein CARUB_v10023532mg             150   2e-38   
gb|KJB65758.1|  hypothetical protein B456_010G112200                    152   2e-38   
ref|XP_009790289.1|  PREDICTED: transcription factor bHLH66-like        151   3e-38   
gb|EYU31775.1|  hypothetical protein MIMGU_mgv1a007474mg                151   3e-38   
emb|CAA18195.1|  putative protein                                       150   3e-38   
ref|XP_009596056.1|  PREDICTED: transcription factor bHLH66-like        151   4e-38   
ref|XP_002880568.1|  basic helix-loop-helix family protein              149   4e-38   
ref|XP_001776681.1|  predicted protein                                  146   4e-38   
ref|XP_010429396.1|  PREDICTED: transcription factor bHLH66-like        149   5e-38   
ref|NP_180003.1|  bHLH protein LJRHL1-like 1                            149   7e-38   
emb|CDY28232.1|  BnaA01g06170D                                          148   7e-38   
ref|XP_009127366.1|  PREDICTED: transcription factor bHLH69             148   7e-38   
ref|XP_010238169.1|  PREDICTED: transcription factor bHLH66-like ...    150   8e-38   
ref|XP_010238168.1|  PREDICTED: transcription factor bHLH66-like ...    150   8e-38   
emb|CDX68710.1|  BnaC01g07430D                                          148   8e-38   
gb|AAM10956.1|AF488601_1  putative bHLH transcription factor            147   9e-38   
ref|XP_002986418.1|  hypothetical protein SELMODRAFT_425336             148   1e-37   
ref|XP_010548502.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    148   1e-37   
ref|XP_003546668.1|  PREDICTED: transcription factor bHLH82-like        150   2e-37   
ref|XP_010048828.1|  PREDICTED: transcription factor bHLH66-like        149   2e-37   
ref|XP_006282219.1|  hypothetical protein CARUB_v10028492mg             146   2e-37   
gb|AAM10955.1|AF488599_1  putative bHLH transcription factor            147   3e-37   
emb|CDP10214.1|  unnamed protein product                                149   3e-37   
dbj|BAD44153.1|  putative bHLH transcription factor (bHLH066)           147   3e-37   
ref|XP_002866244.1|  basic helix-loop-helix family protein              145   4e-37   
ref|XP_006401139.1|  hypothetical protein EUTSA_v10014212mg             145   8e-37   
ref|XP_008794343.1|  PREDICTED: uncharacterized protein LOC103710419    148   1e-36   
ref|XP_004956830.1|  PREDICTED: glycine, alanine and asparagine-r...    147   1e-36   
ref|XP_009126798.1|  PREDICTED: transcription factor bHLH82-like        144   1e-36   
gb|KFK32666.1|  hypothetical protein AALP_AA6G272900                    145   1e-36   
ref|XP_010506835.1|  PREDICTED: transcription factor bHLH82-like        144   2e-36   
emb|CDY02785.1|  BnaC02g11040D                                          144   2e-36   
emb|CDY32733.1|  BnaA02g07950D                                          143   2e-36   
gb|KFK29682.1|  hypothetical protein AALP_AA7G165100                    144   3e-36   
ref|NP_200609.1|  bHLH protein LJRHL1-like 3                            143   4e-36   
ref|XP_009390560.1|  PREDICTED: transcription factor bHLH66-like ...    146   4e-36   
ref|XP_010453077.1|  PREDICTED: transcription factor bHLH82-like        143   4e-36   
ref|XP_009390561.1|  PREDICTED: transcription factor bHLH66-like ...    146   4e-36   
emb|CDY11836.1|  BnaC03g12620D                                          142   5e-36   
ref|XP_010483364.1|  PREDICTED: transcription factor bHLH82             143   5e-36   
ref|XP_009380793.1|  PREDICTED: transcription factor bHLH82-like        144   6e-36   
gb|KFK27334.1|  hypothetical protein AALP_AA8G369700                    142   6e-36   
gb|EAY87854.1|  hypothetical protein OsI_09276                          145   6e-36   
ref|XP_009793513.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    144   6e-36   
ref|XP_010472429.1|  PREDICTED: transcription factor bHLH66             143   7e-36   
gb|EEE57973.1|  hypothetical protein OsJ_08713                          145   7e-36   
ref|XP_010917608.1|  PREDICTED: transcription factor UNE12-like         137   8e-36   
ref|XP_010443514.1|  PREDICTED: transcription factor bHLH82-like        141   1e-35   
dbj|BAD19075.1|  basic helix-loop-helix (bHLH) -like                    144   1e-35   
emb|CDY34780.1|  BnaA09g41470D                                          142   1e-35   
ref|XP_009117141.1|  PREDICTED: transcription factor bHLH66-like        142   2e-35   
ref|XP_006284115.1|  hypothetical protein CARUB_v10005248mg             142   2e-35   
dbj|BAK05422.1|  predicted protein                                      142   2e-35   
gb|EYU25352.1|  hypothetical protein MIMGU_mgv1a008095mg                142   3e-35   
ref|NP_001151181.1|  LOC100284814                                       141   6e-35   
ref|XP_006656710.1|  PREDICTED: transcription factor bHLH66-like        140   6e-35   
ref|XP_004242577.1|  PREDICTED: transcription factor bHLH82-like        142   8e-35   
gb|ERM96081.1|  hypothetical protein AMTR_s00129p00124210               142   1e-34   
ref|XP_010419295.1|  PREDICTED: transcription factor bHLH66-like        140   1e-34   
ref|XP_011628588.1|  PREDICTED: uncharacterized protein LOC18424008     142   1e-34   
ref|XP_004139396.1|  PREDICTED: transcription factor bHLH66-like        141   1e-34   
ref|XP_009401065.1|  PREDICTED: transcription factor UNE12-like         140   2e-34   
emb|CDX76819.1|  BnaC08g34050D                                          138   4e-34   
emb|CDX88653.1|  BnaA03g09960D                                          137   4e-34   
ref|XP_009132090.1|  PREDICTED: transcription factor bHLH82-like        137   4e-34   
ref|XP_010261705.1|  PREDICTED: transcription factor bHLH110-like...    139   2e-33   
ref|XP_002982702.1|  hypothetical protein SELMODRAFT_422025             138   2e-33   
ref|XP_010261704.1|  PREDICTED: transcription factor bHLH68-like ...    139   2e-33   
ref|XP_010261699.1|  PREDICTED: transcription factor bHLH68-like ...    138   3e-33   
ref|XP_002462383.1|  hypothetical protein SORBIDRAFT_02g024750          138   3e-33   
ref|XP_002452977.1|  hypothetical protein SORBIDRAFT_04g035890          137   3e-33   
ref|XP_002981234.1|  hypothetical protein SELMODRAFT_444782             137   4e-33   
gb|EPS68388.1|  hypothetical protein M569_06382                         136   4e-33   
gb|EEC84577.1|  hypothetical protein OsI_31377                          137   4e-33   
ref|XP_006649131.1|  PREDICTED: transcription factor bHLH66-like        136   5e-33   
gb|KJB07351.1|  hypothetical protein B456_001G017900                    137   7e-33   
gb|EMT03170.1|  Transcription factor bHLH82                             133   9e-33   
ref|XP_003560994.1|  PREDICTED: transcription factor bHLH82             135   1e-32   
ref|XP_010917385.1|  PREDICTED: transcription factor bHLH78-like        136   2e-32   
ref|NP_001175840.1|  Os09g0417400                                       135   3e-32   
ref|XP_007012525.1|  Transcription factor bHLH69, putative isoform 1    135   4e-32   
ref|XP_009417990.1|  PREDICTED: transcription factor bHLH133-like       134   4e-32   
ref|XP_009381570.1|  PREDICTED: transcription factor bHLH82-like ...    134   4e-32   
ref|XP_009381569.1|  PREDICTED: transcription factor bHLH82-like ...    134   5e-32   
ref|XP_008679227.1|  PREDICTED: transcription factor bHLH66-like        133   5e-32   
emb|CBI27747.3|  unnamed protein product                                133   5e-32   
gb|KHF97539.1|  Transcription factor bHLH82 -like protein               134   6e-32   
ref|XP_009391705.1|  PREDICTED: transcription factor bHLH62-like        134   6e-32   
gb|KCW78923.1|  hypothetical protein EUGRSUZ_C00360                     131   9e-32   
gb|EMS58799.1|  Transcription factor bHLH82                             129   1e-31   
ref|XP_010656080.1|  PREDICTED: uncharacterized protein LOC100257...    134   1e-31   
ref|XP_006452905.1|  hypothetical protein CICLE_v10008008mg             133   1e-31   
ref|XP_006474565.1|  PREDICTED: uncharacterized protein LOC102611...    133   2e-31   
ref|XP_008797366.1|  PREDICTED: transcription factor bHLH10-like        133   2e-31   
gb|EYU31779.1|  hypothetical protein MIMGU_mgv1a009878mg                131   2e-31   
ref|XP_002277344.2|  PREDICTED: uncharacterized protein LOC100257...    133   2e-31   
ref|XP_008784365.1|  PREDICTED: uncharacterized protein LOC103703328    133   2e-31   
ref|XP_008659194.1|  PREDICTED: transcription factor bHLH82-like        131   4e-31   
gb|AHI17691.1|  bHLH4 transcription factor                              130   6e-31   
ref|XP_010047123.1|  PREDICTED: transcription factor bHLH69-like        130   9e-31   
ref|XP_010932342.1|  PREDICTED: uncharacterized protein LOC105053039    131   1e-30   
gb|EMS47179.1|  Transcription factor bHLH82                             130   1e-30   
ref|XP_004954215.1|  PREDICTED: transcription factor bHLH66-like        129   2e-30   
ref|XP_004952733.1|  PREDICTED: uncharacterized protein LOC101783...    130   2e-30   
gb|EMT30437.1|  Transcription factor bHLH82                             129   2e-30   
ref|XP_008242151.1|  PREDICTED: transcription factor bHLH112-like       129   2e-30   
ref|XP_002438003.1|  hypothetical protein SORBIDRAFT_10g006250          129   4e-30   
ref|XP_006655876.1|  PREDICTED: transcription factor SPATULA-like...    129   4e-30   
ref|XP_006655874.1|  PREDICTED: transcription factor SPATULA-like...    129   4e-30   
ref|XP_009594550.1|  PREDICTED: transcription factor UNE12-like         125   4e-30   
ref|NP_001131264.1|  uncharacterized protein LOC100192577               128   5e-30   
gb|EAY99993.1|  hypothetical protein OsI_21996                          129   5e-30   
dbj|BAJ94866.1|  predicted protein                                      129   5e-30   
gb|ABI95371.1|  PTF1                                                    128   6e-30   
ref|XP_008647330.1|  PREDICTED: uncharacterized protein LOC100192...    128   8e-30   
ref|XP_008647333.1|  PREDICTED: uncharacterized protein LOC100192...    128   8e-30   
ref|XP_008645842.1|  PREDICTED: uncharacterized protein LOC103627...    127   1e-29   
ref|XP_008645841.1|  PREDICTED: uncharacterized protein LOC103627...    127   1e-29   
ref|XP_007203011.1|  hypothetical protein PRUPE_ppa017709mg             127   2e-29   
ref|XP_012077119.1|  PREDICTED: uncharacterized protein LOC105638024    125   4e-29   
ref|XP_010547827.1|  PREDICTED: uncharacterized protein LOC104819452    125   5e-29   
ref|XP_006648756.1|  PREDICTED: uncharacterized protein LOC102704398    125   7e-29   
gb|EAY86326.1|  hypothetical protein OsI_07700                          125   7e-29   
dbj|BAD15821.1|  putative bHLH transcription factor PTF1                125   7e-29   
emb|CDY55014.1|  BnaA10g29390D                                          122   9e-29   
emb|CDY20290.1|  BnaC04g36660D                                          120   1e-28   
ref|XP_004964606.1|  PREDICTED: putative transcription factor bHL...    124   1e-28   
emb|CDY62262.1|  BnaCnng39760D                                          122   1e-28   
ref|XP_009120317.1|  PREDICTED: transcription factor bHLH82-like        122   2e-28   
ref|XP_006381552.1|  hypothetical protein POPTR_0006s13790g             124   2e-28   
gb|ACG29975.1|  helix-loop-helix DNA-binding domain containing pr...    124   2e-28   
ref|XP_011039907.1|  PREDICTED: transcription factor bHLH66-like        124   2e-28   
ref|XP_010227911.1|  PREDICTED: uncharacterized protein LOC100841109    124   2e-28   
ref|NP_001105867.1|  bHLH transcription factor PTF1                     124   2e-28   
gb|AAO73566.1|  bHLH transcription factor PTF1                          123   3e-28   
dbj|BAD35276.1|  putative bHLH transcription factor PTF1                123   3e-28   
ref|NP_001057043.1|  Os06g0193400                                       123   4e-28   
gb|ACF60480.1|  bHLH transcription factor                               123   4e-28   
ref|XP_008652713.1|  PREDICTED: transcription factor bHLH66-like ...    121   4e-28   
ref|XP_008652712.1|  PREDICTED: transcription factor bHLH69-like ...    121   4e-28   
gb|KJB54556.1|  hypothetical protein B456_009G038500                    122   8e-28   
ref|XP_008659041.1|  PREDICTED: bHLH transcription factor PTF1 is...    122   9e-28   
gb|EEC80139.1|  hypothetical protein OsI_21931                          119   5e-27   
dbj|BAD72512.1|  bHLH transcription factor PTF1-like                    119   5e-27   
ref|XP_004964663.1|  PREDICTED: transcription factor bHLH66-like        119   6e-27   
gb|EEE65218.1|  hypothetical protein OsJ_20364                          118   9e-27   
ref|XP_002516201.1|  DNA-directed RNA polymerase beta chain, puta...    119   2e-26   
gb|ACG32161.1|  hypothetical protein                                    111   7e-26   
ref|XP_010539140.1|  PREDICTED: transcription factor bHLH82             113   9e-26   
gb|KJB22949.1|  hypothetical protein B456_004G075200                    111   4e-25   
tpg|DAA61472.1|  TPA: putative HLH DNA-binding domain superfamily...    113   4e-25   
tpg|DAA61473.1|  TPA: putative HLH DNA-binding domain superfamily...    113   5e-25   
emb|CDY46132.1|  BnaA04g14200D                                          109   6e-25   
ref|XP_010235563.1|  PREDICTED: uncharacterized protein LOC100834217    113   1e-24   
ref|XP_004952732.1|  PREDICTED: uncharacterized protein LOC101783...    113   2e-24   
ref|XP_006604479.1|  PREDICTED: transcription factor UNE12-like i...    108   2e-24   
ref|XP_004495149.1|  PREDICTED: transcription factor UNE12-like i...    108   4e-24   
ref|XP_008392746.1|  PREDICTED: transcription factor bHLH82-like        109   1e-23   
ref|XP_011461142.1|  PREDICTED: uncharacterized protein LOC101298168    108   2e-23   
gb|ABF06705.1|  Joka8                                                   105   2e-22   
gb|KHN43747.1|  Transcription factor bHLH66                             105   2e-22   
gb|KDO59407.1|  hypothetical protein CISIN_1g012156mg                   105   2e-22   
gb|KDO59406.1|  hypothetical protein CISIN_1g012156mg                   105   3e-22   
gb|KHN28448.1|  Transcription factor bHLH66                             105   4e-22   
ref|XP_009359753.1|  PREDICTED: transcription factor bHLH66-like        102   8e-22   
ref|XP_009343367.1|  PREDICTED: transcription factor bHLH82-like        102   3e-21   
gb|KJB65757.1|  hypothetical protein B456_010G112200                    103   3e-21   
ref|XP_010107083.1|  hypothetical protein L484_019561                   103   4e-21   
gb|AFW64153.1|  putative HLH DNA-binding domain superfamily protein   99.0    1e-20   
gb|EMS48316.1|  Transcription factor bHLH69                           96.3    1e-20   
gb|EMS68381.1|  Transcription factor bHLH66                           95.5    3e-20   
ref|XP_006474566.1|  PREDICTED: uncharacterized protein LOC102611...  99.0    4e-20   
ref|XP_002437967.1|  hypothetical protein SORBIDRAFT_10g005650        97.8    2e-19   
ref|XP_009369813.1|  PREDICTED: transcription factor bHLH82-like      92.8    5e-19   
ref|XP_006661232.1|  PREDICTED: transcription factor UNE12-like       95.5    7e-19   
gb|EEE69709.1|  hypothetical protein OsJ_29376                        95.5    9e-19   
ref|XP_008456521.1|  PREDICTED: transcription factor bHLH66-like      94.0    1e-18   
ref|XP_012092278.1|  PREDICTED: uncharacterized protein LOC105650022  92.0    7e-18   
ref|XP_008775394.1|  PREDICTED: transcription factor UNE12-like i...  86.3    9e-17   
ref|XP_008775393.1|  PREDICTED: transcription factor UNE12-like i...  81.6    4e-15   
ref|XP_009774165.1|  PREDICTED: transcription factor UNE12-like i...  80.5    1e-14   
ref|XP_009774164.1|  PREDICTED: transcription factor UNE12-like i...  80.1    1e-14   
gb|KJB44521.1|  hypothetical protein B456_007G257400                  76.3    5e-14   
ref|XP_008810758.1|  PREDICTED: transcription factor bHLH82-like      79.7    1e-13   
ref|XP_007050662.1|  Transcription factor bHLH69, putative            79.7    2e-13   
ref|XP_011625690.1|  PREDICTED: transcription factor bHLH66           79.0    2e-13   
ref|XP_006355866.1|  PREDICTED: uncharacterized protein LOC102578...  78.6    4e-13   
ref|XP_006355867.1|  PREDICTED: uncharacterized protein LOC102578...  78.2    4e-13   
ref|XP_009782719.1|  PREDICTED: transcription factor bHLH7-like       74.3    5e-13   
gb|KJB42082.1|  hypothetical protein B456_007G135600                  78.2    6e-13   
gb|KJB42081.1|  hypothetical protein B456_007G135600                  77.8    7e-13   
ref|XP_009417961.1|  PREDICTED: uncharacterized protein LOC103998264  76.3    3e-12   
gb|KDO59408.1|  hypothetical protein CISIN_1g012156mg                 75.9    3e-12   
emb|CDP03607.1|  unnamed protein product                              75.1    4e-12   
ref|XP_009594402.1|  PREDICTED: transcription factor bHLH69           75.1    4e-12   
ref|XP_010278373.1|  PREDICTED: transcription factor bHLH66-like ...  75.1    7e-12   
emb|CDY20289.1|  BnaC04g36670D                                        73.2    7e-12   
ref|XP_008361196.1|  PREDICTED: transcription factor bHLH78-like      75.1    1e-11   
ref|XP_004247151.1|  PREDICTED: transcription factor UNE12-like i...  73.6    1e-11   
ref|XP_003520214.1|  PREDICTED: transcription factor bHLH7-like i...  72.8    4e-11   
gb|KHN18892.1|  Transcription factor bHLH69                           72.4    4e-11   
ref|XP_006575082.1|  PREDICTED: transcription factor bHLH7-like i...  72.4    5e-11   
ref|XP_006575079.1|  PREDICTED: transcription factor bHLH7-like i...  72.4    5e-11   
ref|XP_007144615.1|  hypothetical protein PHAVU_007G170200g           70.9    2e-10   
ref|XP_010470831.1|  PREDICTED: transcription factor bHLH49-like      68.9    2e-10   
ref|XP_004495294.1|  PREDICTED: transcription factor bHLH83-like      69.7    5e-10   
gb|AFK38088.1|  unknown                                               69.3    7e-10   
ref|XP_002520769.1|  DNA binding protein, putative                    68.9    1e-09   
ref|XP_003590676.1|  Transcription factor bHLH66                      68.2    2e-09   
ref|XP_004290671.1|  PREDICTED: transcription factor bHLH69           67.0    4e-09   
ref|XP_009413453.1|  PREDICTED: transcription factor UNE10-like       64.7    5e-09   
ref|NP_001147052.1|  protein SPATULA                                  65.1    5e-09   
gb|KJB48603.1|  hypothetical protein B456_008G077300                  65.1    6e-09   
ref|NP_001140849.1|  putative HLH DNA-binding domain superfamily ...  64.7    7e-09   
gb|KHG02827.1|  Transcription factor SPATULA -like protein            65.1    7e-09   
ref|XP_003592482.1|  Transcription factor bHLH84                      63.2    1e-08   



>gb|EYU46514.1| hypothetical protein MIMGU_mgv1a010915mg [Erythranthe guttata]
Length=297

 Score =   262 bits (669),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 141/160 (88%), Gaps = 2/160 (1%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER+RALQ+LVPSVNKTDR  M+DEIVDYVKFLRLQVKVLS
Sbjct  140  GQATDPHSIAERLRR-ERIAERVRALQELVPSVNKTDRATMVDEIVDYVKFLRLQVKVLS  198

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVAPLVTD+PIS +EEEG +E GR QPAWEKWSNDGTERQVAKLMEENVGAA
Sbjct  199  MSRLGGAGAVAPLVTDVPISTIEEEG-NEGGRAQPAWEKWSNDGTERQVAKLMEENVGAA  257

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            MQFLQSKALCIMPISLASAIYH+Q PDT  L+KPE+NPPS
Sbjct  258  MQFLQSKALCIMPISLASAIYHTQPPDTPTLMKPESNPPS  297



>ref|XP_002281626.1| PREDICTED: transcription factor UNE12 [Vitis vinifera]
 emb|CBI17928.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 127/135 (94%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP++ VEEE
Sbjct  156  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLASVEEE  215

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
              SE GR +PAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ 
Sbjct  216  A-SEGGRNEPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQQ  274

Query  475  PDTTPLVKPETNPPS  431
            PDTTPL+KP+TNPPS
Sbjct  275  PDTTPLIKPQTNPPS  289



>ref|XP_002520976.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF41393.1| DNA binding protein, putative [Ricinus communis]
Length=299

 Score =   246 bits (629),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 127/135 (94%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VE+E
Sbjct  166  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEDE  225

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
             G E GR QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLA+AIYH+QA
Sbjct  226  TG-EGGRNQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLATAIYHTQA  284

Query  475  PDTTPLVKPETNPPS  431
            PDT+ +VKPETNPPS
Sbjct  285  PDTSTIVKPETNPPS  299



>gb|KHN02539.1| Transcription factor UNE12 [Glycine soja]
Length=210

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  77   LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  136

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            GG E  R +PAW+KWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIY SQ 
Sbjct  137  GG-EGARNRPAWDKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYQSQP  195

Query  475  PDTTPLVKPETNPPS  431
            PDT+ +VKPETNPPS
Sbjct  196  PDTSSIVKPETNPPS  210



>ref|XP_006383684.1| hypothetical protein POPTR_0005s23930g [Populus trichocarpa]
 gb|ERP61481.1| hypothetical protein POPTR_0005s23930g [Populus trichocarpa]
Length=300

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 126/135 (93%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VE+E
Sbjct  167  LQELVPSVNKTDRATMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEDE  226

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
             G E GR QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLA+AIYH+Q 
Sbjct  227  TG-EGGRNQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLATAIYHTQP  285

Query  475  PDTTPLVKPETNPPS  431
            PDTT +VKPETNPPS
Sbjct  286  PDTTTIVKPETNPPS  300



>ref|XP_008451266.1| PREDICTED: transcription factor UNE12 [Cucumis melo]
Length=313

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 127/135 (94%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  180  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  239

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            G SE GR QPAW+KWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYH+Q 
Sbjct  240  G-SEGGRNQPAWDKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHTQP  298

Query  475  PDTTPLVKPETNPPS  431
            PD++ +VKPE+NPP+
Sbjct  299  PDSSSIVKPESNPPA  313



>ref|XP_007050429.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
 gb|EOX94586.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
Length=303

 Score =   244 bits (624),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 126/135 (93%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VE+E
Sbjct  170  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEDE  229

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
             G E GR QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLA+AIYH+Q 
Sbjct  230  SG-EGGRNQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLATAIYHTQP  288

Query  475  PDTTPLVKPETNPPS  431
            PDT+P+VKPE NPP+
Sbjct  289  PDTSPIVKPEANPPA  303



>ref|XP_004146956.1| PREDICTED: transcription factor UNE12 [Cucumis sativus]
 gb|KGN44766.1| hypothetical protein Csa_7G378550 [Cucumis sativus]
Length=316

 Score =   244 bits (623),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 126/134 (94%), Gaps = 1/134 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  183  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  242

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            G SE GR QPAW+KWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYH+Q 
Sbjct  243  G-SEGGRNQPAWDKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHTQP  301

Query  475  PDTTPLVKPETNPP  434
            PD++ +VKPE+NPP
Sbjct  302  PDSSSVVKPESNPP  315



>ref|XP_003554277.1| PREDICTED: transcription factor UNE12-like isoform X1 [Glycine 
max]
Length=292

 Score =   243 bits (621),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  159  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  218

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            GG E  R +PAW+KWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIY SQ 
Sbjct  219  GG-EGARNRPAWDKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYQSQP  277

Query  475  PDTTPLVKPETNPPS  431
            PDT+ +VKPETNPPS
Sbjct  278  PDTSSIVKPETNPPS  292



>ref|XP_012092122.1| PREDICTED: transcription factor UNE12-like [Jatropha curcas]
 ref|XP_012092123.1| PREDICTED: transcription factor UNE12-like [Jatropha curcas]
 ref|XP_012092124.1| PREDICTED: transcription factor UNE12-like [Jatropha curcas]
 gb|KDP21374.1| hypothetical protein JCGZ_21845 [Jatropha curcas]
Length=301

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 126/135 (93%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VE+E
Sbjct  168  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEDE  227

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
             G E GR QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLA+AIYH+Q 
Sbjct  228  TG-EDGRNQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLATAIYHTQP  286

Query  475  PDTTPLVKPETNPPS  431
            PDT+ +VKPETNPPS
Sbjct  287  PDTSTIVKPETNPPS  301



>ref|XP_010087126.1| hypothetical protein L484_012559 [Morus notabilis]
 gb|EXB26566.1| hypothetical protein L484_012559 [Morus notabilis]
Length=305

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 127/142 (89%), Gaps = 8/142 (6%)
 Frame = -1

Query  835  LQDLVPSVNK-------TDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP  677
            LQ+LVPSVNK       TDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP
Sbjct  165  LQELVPSVNKANDFPFYTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP  224

Query  676  ISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLAS  497
            +S VEEEG SE GR QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLAS
Sbjct  225  LSSVEEEG-SEGGRNQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLAS  283

Query  496  AIYHSQAPDTTPLVKPETNPPS  431
            AIYHSQ PDT+ +VKPETNPPS
Sbjct  284  AIYHSQPPDTSSVVKPETNPPS  305



>ref|XP_011042433.1| PREDICTED: transcription factor UNE12 [Populus euphratica]
Length=300

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSV KTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VE+E
Sbjct  167  LQELVPSVTKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEDE  226

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
             G E GR QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLA+AIYH+Q 
Sbjct  227  TG-EGGRNQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLATAIYHTQP  285

Query  475  PDTTPLVKPETNPPS  431
            PDTT +VKPETNPPS
Sbjct  286  PDTTTIVKPETNPPS  300



>emb|CDP03688.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 124/134 (93%), Gaps = 1/134 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPIS VEEE
Sbjct  180  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISSVEEE  239

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
             G E GR QPAW+KWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYH+Q 
Sbjct  240  SG-EGGRPQPAWDKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHTQP  298

Query  475  PDTTPLVKPETNPP  434
            PD + L+KPETNPP
Sbjct  299  PDASNLIKPETNPP  312



>gb|KHF99712.1| Transcription factor UNE12 -like protein [Gossypium arboreum]
Length=305

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 127/134 (95%), Gaps = 1/134 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR VMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VE+E
Sbjct  172  LQELVPSVNKTDRAVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEDE  231

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
             G ++GR QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLA+AIYHSQ 
Sbjct  232  SG-DSGRNQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLATAIYHSQP  290

Query  475  PDTTPLVKPETNPP  434
            PDT+ ++KPET+PP
Sbjct  291  PDTSSIIKPETDPP  304



>ref|XP_011082599.1| PREDICTED: transcription factor UNE12-like [Sesamum indicum]
Length=320

 Score =   242 bits (617),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 126/134 (94%), Gaps = 1/134 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPIS +EEE
Sbjct  187  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISSIEEE  246

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            G S++GR QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYH+Q 
Sbjct  247  G-SDSGRAQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHTQP  305

Query  475  PDTTPLVKPETNPP  434
            P+TT  VKPE++PP
Sbjct  306  PETTTTVKPESDPP  319



>ref|XP_011026052.1| PREDICTED: transcription factor UNE12-like [Populus euphratica]
Length=300

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VE+E
Sbjct  167  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSPVEDE  226

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
             G E GR Q AWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLA+AIYH+Q 
Sbjct  227  TG-EGGRNQLAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLATAIYHTQP  285

Query  475  PDTTPLVKPETNPPS  431
            PDTT +VKPETNPPS
Sbjct  286  PDTTTIVKPETNPPS  300



>gb|KJB42176.1| hypothetical protein B456_007G141800 [Gossypium raimondii]
Length=303

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 127/135 (94%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLG AGAVAPLVTD+P+S VE+E
Sbjct  170  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGAAGAVAPLVTDLPLSSVEDE  229

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
             G E GR+QPAWEKWSNDGTERQVAKLMEE+VGAAMQFLQSKALC+MPISLA+AIYH+Q+
Sbjct  230  SG-EGGRSQPAWEKWSNDGTERQVAKLMEEDVGAAMQFLQSKALCVMPISLATAIYHTQS  288

Query  475  PDTTPLVKPETNPPS  431
            PDT+ +VKPETNPPS
Sbjct  289  PDTSSVVKPETNPPS  303



>gb|KJB42177.1| hypothetical protein B456_007G141800 [Gossypium raimondii]
Length=304

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLG AGAVAPLVTD+P+S VE++
Sbjct  170  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGAAGAVAPLVTDLPLSSVEQD  229

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
               E GR+QPAWEKWSNDGTERQVAKLMEE+VGAAMQFLQSKALC+MPISLA+AIYH+Q+
Sbjct  230  ESGEGGRSQPAWEKWSNDGTERQVAKLMEEDVGAAMQFLQSKALCVMPISLATAIYHTQS  289

Query  475  PDTTPLVKPETNPPS  431
            PDT+ +VKPETNPPS
Sbjct  290  PDTSSVVKPETNPPS  304



>ref|XP_009354865.1| PREDICTED: transcription factor UNE12 [Pyrus x bretschneideri]
 ref|XP_009354866.1| PREDICTED: transcription factor UNE12 [Pyrus x bretschneideri]
Length=301

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 126/135 (93%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  168  LQELVPSVNKTDRAAMLDEIMDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  227

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            G SE GR QPAW+KWSNDGTERQVAKLME+NVGAAMQFLQSKALCIMPISLASAIY++Q 
Sbjct  228  G-SEGGRNQPAWDKWSNDGTERQVAKLMEDNVGAAMQFLQSKALCIMPISLASAIYNTQP  286

Query  475  PDTTPLVKPETNPPS  431
            PDT+ +VKPE NPPS
Sbjct  287  PDTSTVVKPEMNPPS  301



>ref|XP_002302077.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE81350.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=300

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVK+LSMSRLGGAGAVAPLVTDIP+S VE+E
Sbjct  167  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKILSMSRLGGAGAVAPLVTDIPLSPVEDE  226

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
             G E GR Q AWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI+LA+AIYH+Q 
Sbjct  227  TG-EGGRNQLAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPITLATAIYHTQP  285

Query  475  PDTTPLVKPETNPPS  431
            PDTT +VKPETNPPS
Sbjct  286  PDTTTIVKPETNPPS  300



>gb|KHG09586.1| Transcription factor UNE12 -like protein [Gossypium arboreum]
Length=304

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 133/151 (88%), Gaps = 10/151 (7%)
 Frame = -1

Query  856  IAERIR---------ALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGA  704
            IAER+R         ALQ+LVPSVNKTDR VMLDEIVDYVKFLRLQVKVLSMSRLGGAGA
Sbjct  155  IAERLRRERITERIRALQELVPSVNKTDRAVMLDEIVDYVKFLRLQVKVLSMSRLGGAGA  214

Query  703  VAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKAL  524
            VAPLVTDIP+S VE E G E GR+ PAWEKWSNDGTE+QVAKLMEENVGAAMQFLQSK+L
Sbjct  215  VAPLVTDIPLSSVEYESG-EGGRSHPAWEKWSNDGTEQQVAKLMEENVGAAMQFLQSKSL  273

Query  523  CIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            CIMPISLA+AIYH+Q PD++ +VKPETNPP+
Sbjct  274  CIMPISLATAIYHTQVPDSSCVVKPETNPPA  304



>gb|KHN10703.1| Transcription factor UNE12 [Glycine soja]
Length=210

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 124/135 (92%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  77   LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  136

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            GG E  R +PAW+KWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIY SQ 
Sbjct  137  GG-EGARNRPAWDKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYQSQP  195

Query  475  PDTTPLVKPETNPPS  431
            PDT+ +VK ET+PPS
Sbjct  196  PDTSSIVKHETSPPS  210



>gb|KJB22947.1| hypothetical protein B456_004G075200 [Gossypium raimondii]
 gb|KJB22948.1| hypothetical protein B456_004G075200 [Gossypium raimondii]
Length=304

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 133/151 (88%), Gaps = 10/151 (7%)
 Frame = -1

Query  856  IAERIR---------ALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGA  704
            IAER+R         ALQ+LVPSVNKTDR VMLDEIVDYVKFLRLQVKVLSMSRLGGAGA
Sbjct  155  IAERLRRERITERIRALQELVPSVNKTDRAVMLDEIVDYVKFLRLQVKVLSMSRLGGAGA  214

Query  703  VAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKAL  524
            VAPLVTDIP+S VE E G E GR+QPAWEKWSNDGTE+QVAKLMEENVGAAMQFLQSK+L
Sbjct  215  VAPLVTDIPLSSVEYESG-EGGRSQPAWEKWSNDGTEQQVAKLMEENVGAAMQFLQSKSL  273

Query  523  CIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            CIMPISLA+AIYH+Q PDT+ +VKPET PP+
Sbjct  274  CIMPISLATAIYHTQVPDTSSVVKPETIPPA  304



>gb|ACN21630.1| putative basic helix-loop-helix protein BHLH3 [Lotus japonicus]
Length=297

 Score =   239 bits (611),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  164  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  223

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            GG E  R +PAW+KWSNDGTE+QVAKLMEENVGAAMQFLQSKALCIMPISLASAIY SQ 
Sbjct  224  GG-EGARNRPAWDKWSNDGTEKQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYQSQP  282

Query  475  PDTTPLVKPETNPPS  431
            PD++ +VKPETNPPS
Sbjct  283  PDSSSMVKPETNPPS  297



>ref|XP_007144689.1| hypothetical protein PHAVU_007G176900g [Phaseolus vulgaris]
 gb|ESW16683.1| hypothetical protein PHAVU_007G176900g [Phaseolus vulgaris]
Length=280

 Score =   239 bits (609),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 123/135 (91%), Gaps = 2/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  148  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  207

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            G    GR QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIY SQ 
Sbjct  208  GSE--GRNQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYQSQP  265

Query  475  PDTTPLVKPETNPPS  431
             DT+ +VKPETNPPS
Sbjct  266  SDTSSIVKPETNPPS  280



>ref|XP_003536810.1| PREDICTED: transcription factor UNE12 [Glycine max]
Length=283

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 123/135 (91%), Gaps = 2/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  151  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  210

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            GG   GR QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMP+SLASAIY SQ 
Sbjct  211  GGE--GRNQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPVSLASAIYQSQP  268

Query  475  PDTTPLVKPETNPPS  431
              T+ +VKPETNPPS
Sbjct  269  SGTSSIVKPETNPPS  283



>gb|KHN03837.1| Transcription factor UNE12 [Glycine soja]
Length=278

 Score =   238 bits (608),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 123/135 (91%), Gaps = 2/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  146  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  205

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            GG   GR QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMP+SLASAIY SQ 
Sbjct  206  GGE--GRNQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPVSLASAIYQSQP  263

Query  475  PDTTPLVKPETNPPS  431
              T+ +VKPETNPPS
Sbjct  264  SGTSSIVKPETNPPS  278



>ref|XP_008372300.1| PREDICTED: transcription factor UNE12-like [Malus domestica]
 ref|XP_008372301.1| PREDICTED: transcription factor UNE12-like [Malus domestica]
 ref|XP_008356199.1| PREDICTED: transcription factor UNE12-like [Malus domestica]
 ref|XP_008356200.1| PREDICTED: transcription factor UNE12-like [Malus domestica]
Length=300

 Score =   239 bits (609),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  167  LQELVPSVNKTDRAAMLDEIMDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  226

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            G SE GR QPAW+KWSNDGTERQVAKLME+NVGAAMQFLQ KALCIMPISLASAIY++Q 
Sbjct  227  G-SEGGRNQPAWDKWSNDGTERQVAKLMEDNVGAAMQFLQXKALCIMPISLASAIYNTQP  285

Query  475  PDTTPLVKPETNPPS  431
            PDT+ +VKPE NPPS
Sbjct  286  PDTSSVVKPEMNPPS  300



>ref|XP_008372294.1| PREDICTED: transcription factor UNE12-like [Malus domestica]
 ref|XP_008372295.1| PREDICTED: transcription factor UNE12-like [Malus domestica]
Length=300

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  167  LQELVPSVNKTDRAAMLDEIMDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  226

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            G SE GR QPAW+KWSNDGTERQVAKLME+NVGAAMQFLQ KALCIMPISLASAIY++Q 
Sbjct  227  G-SEGGRNQPAWDKWSNDGTERQVAKLMEDNVGAAMQFLQYKALCIMPISLASAIYNTQP  285

Query  475  PDTTPLVKPETNPPS  431
            PDT+ +VKPE NPPS
Sbjct  286  PDTSSVVKPEMNPPS  300



>gb|KJB25973.1| hypothetical protein B456_004G218900 [Gossypium raimondii]
Length=305

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 125/134 (93%), Gaps = 1/134 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR VMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VE+E
Sbjct  172  LQELVPSVNKTDRAVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEDE  231

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
             G + GR QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLA+AIYHSQ 
Sbjct  232  SG-DGGRNQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLATAIYHSQP  290

Query  475  PDTTPLVKPETNPP  434
             DT+ +VKPET+PP
Sbjct  291  LDTSSIVKPETDPP  304



>gb|KHG12939.1| Transcription factor UNE12 -like protein [Gossypium arboreum]
Length=302

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 126/134 (94%), Gaps = 1/134 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLG AGAVAPLVTD+P+S VE+E
Sbjct  170  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGAAGAVAPLVTDLPLSSVEDE  229

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
             G E GR+QPAWEKWSNDGTERQVAKLMEE+VGAAMQFLQSKALC+MPISLA+AIYH+Q+
Sbjct  230  SG-EGGRSQPAWEKWSNDGTERQVAKLMEEDVGAAMQFLQSKALCVMPISLATAIYHTQS  288

Query  475  PDTTPLVKPETNPP  434
            PDT+ +VKPETNPP
Sbjct  289  PDTSSVVKPETNPP  302



>ref|XP_007162488.1| hypothetical protein PHAVU_001G156400g [Phaseolus vulgaris]
 gb|ESW34482.1| hypothetical protein PHAVU_001G156400g [Phaseolus vulgaris]
Length=292

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 124/135 (92%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  159  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  218

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            GG E  R +PAW+K SNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIY SQ 
Sbjct  219  GG-EGARNRPAWDKCSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYQSQP  277

Query  475  PDTTPLVKPETNPPS  431
            PD++ +VKPETNPPS
Sbjct  278  PDSSSIVKPETNPPS  292



>ref|XP_003521266.1| PREDICTED: transcription factor UNE12-like [Glycine max]
Length=292

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 124/135 (92%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  159  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  218

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            GG E  R +PAW+KWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIY SQ 
Sbjct  219  GG-EGARNRPAWDKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYQSQP  277

Query  475  PDTTPLVKPETNPPS  431
            PDT+ +VK ET+PPS
Sbjct  278  PDTSSIVKHETSPPS  292



>ref|XP_004495148.1| PREDICTED: transcription factor UNE12-like isoform X1 [Cicer 
arietinum]
Length=285

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 124/134 (93%), Gaps = 1/134 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  153  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  212

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            G S++GR QPAWEKWSNDGTE+QVAKLMEENVGAAMQFLQSKALCIMPISLASAIY SQ 
Sbjct  213  G-SDSGRNQPAWEKWSNDGTEKQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYQSQP  271

Query  475  PDTTPLVKPETNPP  434
             D++ +VKPET PP
Sbjct  272  SDSSSIVKPETTPP  285



>ref|XP_011079946.1| PREDICTED: transcription factor UNE12 [Sesamum indicum]
Length=324

 Score =   237 bits (605),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 122/135 (90%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPIS +EEE
Sbjct  191  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISSIEEE  250

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
             G + GR QPAWEKWSNDGTERQVAKLMEENVGAAMQ LQSKALCIMPISLASAIYH+Q 
Sbjct  251  SG-DGGRAQPAWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCIMPISLASAIYHTQP  309

Query  475  PDTTPLVKPETNPPS  431
             DT  L KPE++PPS
Sbjct  310  RDTVTLAKPESSPPS  324



>ref|XP_003590536.1| Transcription factor UNE12 [Medicago truncatula]
 gb|AES60787.1| basic helix loop helix protein BHLH4 [Medicago truncatula]
Length=282

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 123/134 (92%), Gaps = 1/134 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  149  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  208

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            G S++GR QPAWEKWSNDGTE+QVAKLMEENVGAAMQFLQSKALCIMPISLASAIY SQ 
Sbjct  209  G-SDSGRNQPAWEKWSNDGTEKQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYQSQP  267

Query  475  PDTTPLVKPETNPP  434
             D + +VKPET PP
Sbjct  268  SDNSSIVKPETIPP  281



>ref|XP_003590537.1| Transcription factor UNE12 [Medicago truncatula]
 gb|AES60788.1| basic helix loop helix protein BHLH4 [Medicago truncatula]
Length=285

 Score =   234 bits (596),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 123/134 (92%), Gaps = 1/134 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  152  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  211

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            G S++GR QPAWEKWSNDGTE+QVAKLMEENVGAAMQFLQSKALCIMPISLASAIY SQ 
Sbjct  212  G-SDSGRNQPAWEKWSNDGTEKQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYQSQP  270

Query  475  PDTTPLVKPETNPP  434
             D + +VKPET PP
Sbjct  271  SDNSSIVKPETIPP  284



>ref|XP_006349737.1| PREDICTED: transcription factor UNE12-like [Solanum tuberosum]
Length=302

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR VMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPIS VEEE
Sbjct  168  LQELVPSVNKTDRAVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISSVEEE  227

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
                    QPAWEKWS+DGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ 
Sbjct  228  SSEGGNNNQPAWEKWSSDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQP  287

Query  475  PDTTPLVKPETNPPS  431
            PDT+ LVKPETNPPS
Sbjct  288  PDTSSLVKPETNPPS  302



>ref|XP_004247209.1| PREDICTED: transcription factor UNE12 [Solanum lycopersicum]
Length=302

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR VMLDEIVDY+KFLRLQVKVLSMSRLGGAGAVAPLVTDIPIS VEEE
Sbjct  168  LQELVPSVNKTDRAVMLDEIVDYIKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISSVEEE  227

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
                    QPAWEKWS+DGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ 
Sbjct  228  SSEGGNNNQPAWEKWSSDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQP  287

Query  475  PDTTPLVKPETNPPS  431
            PDT+ LVKPETNPPS
Sbjct  288  PDTSSLVKPETNPPS  302



>gb|KDO48911.1| hypothetical protein CISIN_1g040019mg [Citrus sinensis]
Length=166

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = -1

Query  913  CGQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVL  734
            C  ++   L  +V  R ERIA+R+RALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVL
Sbjct  6    CCHQQMFSLFFVVQLRRERIADRMRALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVL  65

Query  733  SMSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGA  554
            SMSRLG AGAVA LV D+P+S   E    + G +QP WEKWSNDGTE+QVAKLMEE++GA
Sbjct  66   SMSRLGAAGAVAQLVADVPLSSALEGESIDGGSSQPEWEKWSNDGTEQQVAKLMEEDIGA  125

Query  553  AMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            AMQFLQSKALCIMPISLASAIY ++ PD    VKPE++ PS
Sbjct  126  AMQFLQSKALCIMPISLASAIYRTRQPDAPAFVKPESSTPS  166



>gb|KHN18841.1| Transcription factor UNE12 [Glycine soja]
Length=274

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 121/135 (90%), Gaps = 2/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSR+GGA AVAPLVTDIP+S VEEE
Sbjct  142  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRIGGADAVAPLVTDIPLSSVEEE  201

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            GG   GR QPAWEK SNDGTERQVAKLMEENVGAAMQFLQSKALCIMP+SLASAIY SQ 
Sbjct  202  GGE--GRNQPAWEKCSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPVSLASAIYQSQP  259

Query  475  PDTTPLVKPETNPPS  431
             DT+ +VKPE NPPS
Sbjct  260  SDTSSIVKPEINPPS  274



>ref|XP_010274210.1| PREDICTED: transcription factor UNE12 isoform X3 [Nelumbo nucifera]
Length=293

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 135/162 (83%), Gaps = 4/162 (2%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLS
Sbjct  134  GQATDPHSIAERLRR-ERIAERMKALQELVPSSNKTDRAAMLDEIVDYVKFLRLQVKVLS  192

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP++ VE E GSE   +Q AWEKWSNDGTERQVAKLMEE+VGAA
Sbjct  193  MSRLGGAGAVAQLVADIPLTSVEGE-GSEGRSSQRAWEKWSNDGTERQVAKLMEEDVGAA  251

Query  550  MQFLQSKALCIMPISLASAIYHSQAPD--TTPLVKPETNPPS  431
            MQFLQSKALCIMP+SLA+AIYH+  P+  TTP+VKPE++ PS
Sbjct  252  MQFLQSKALCIMPMSLAAAIYHTHPPEAPTTPIVKPESSAPS  293



>ref|XP_008382959.1| PREDICTED: transcription factor UNE12-like [Malus domestica]
 ref|XP_009367753.1| PREDICTED: transcription factor UNE12-like [Pyrus x bretschneideri]
Length=298

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  165  LQELVPSVNKTDRAAMLDEIMDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  224

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            GG    R QPAW+KWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYH+Q+
Sbjct  225  GGEGG-RNQPAWDKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHTQS  283

Query  475  PDTTPLVKPETNPPS  431
            PDT+ +VKPE NPPS
Sbjct  284  PDTSSVVKPEMNPPS  298



>emb|CDY18011.1| BnaC03g30830D [Brassica napus]
Length=304

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 128/151 (85%), Gaps = 10/151 (7%)
 Frame = -1

Query  856  IAERIRA---------LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGA  704
            IAER+R          LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGA
Sbjct  152  IAERLRRERIAERIRALQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGA  211

Query  703  VAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKA  527
            VAPLVTD+P+S   E+  SE GRT QPAWEKWSNDGTERQVAKLMEENVGAAMQ LQSKA
Sbjct  212  VAPLVTDMPLSSSVEDETSEGGRTPQPAWEKWSNDGTERQVAKLMEENVGAAMQLLQSKA  271

Query  526  LCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LC+MPISLA AIYHSQ PDT+ +VKPETNPP
Sbjct  272  LCMMPISLAMAIYHSQPPDTSSVVKPETNPP  302



>ref|XP_010274208.1| PREDICTED: transcription factor UNE12 isoform X1 [Nelumbo nucifera]
Length=324

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 135/162 (83%), Gaps = 4/162 (2%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLS
Sbjct  165  GQATDPHSIAERLRR-ERIAERMKALQELVPSSNKTDRAAMLDEIVDYVKFLRLQVKVLS  223

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP++ VE E GSE   +Q AWEKWSNDGTERQVAKLMEE+VGAA
Sbjct  224  MSRLGGAGAVAQLVADIPLTSVEGE-GSEGRSSQRAWEKWSNDGTERQVAKLMEEDVGAA  282

Query  550  MQFLQSKALCIMPISLASAIYHSQAPD--TTPLVKPETNPPS  431
            MQFLQSKALCIMP+SLA+AIYH+  P+  TTP+VKPE++ PS
Sbjct  283  MQFLQSKALCIMPMSLAAAIYHTHPPEAPTTPIVKPESSAPS  324



>ref|XP_009607290.1| PREDICTED: transcription factor UNE12-like [Nicotiana tomentosiformis]
Length=302

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/134 (90%), Positives = 125/134 (93%), Gaps = 1/134 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR VMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPIS VEEE
Sbjct  169  LQELVPSVNKTDRAVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISSVEEE  228

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
              SE G  QPAWEKWS+DGTERQVAKLMEENVG+AMQFLQSKALCIMPISLASAIYHSQ 
Sbjct  229  S-SEVGNNQPAWEKWSSDGTERQVAKLMEENVGSAMQFLQSKALCIMPISLASAIYHSQP  287

Query  475  PDTTPLVKPETNPP  434
            PDT+ LVKPETNPP
Sbjct  288  PDTSSLVKPETNPP  301



>ref|XP_009776898.1| PREDICTED: transcription factor UNE12-like [Nicotiana sylvestris]
Length=302

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 125/134 (93%), Gaps = 1/134 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR VMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPIS VEEE
Sbjct  170  LQELVPSVNKTDRAVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISSVEEE  229

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
              SE G  QPAWEKWS+DGTERQVAKLMEENVG+AMQFLQSKALCIMPISLASAIYHSQ 
Sbjct  230  S-SEGGNNQPAWEKWSSDGTERQVAKLMEENVGSAMQFLQSKALCIMPISLASAIYHSQP  288

Query  475  PDTTPLVKPETNPP  434
            PDT+ L+KPETNPP
Sbjct  289  PDTSSLIKPETNPP  302



>ref|XP_009134422.1| PREDICTED: transcription factor UNE12-like [Brassica rapa]
Length=309

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 128/151 (85%), Gaps = 10/151 (7%)
 Frame = -1

Query  856  IAERIRA---------LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGA  704
            IAER+R          LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGA
Sbjct  157  IAERLRRERIAERIRALQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGA  216

Query  703  VAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKA  527
            VAPLVTD+P+S   E+  S+ GRT QPAWEKWSNDGTERQVAKLMEENVGAAMQ LQSKA
Sbjct  217  VAPLVTDMPLSSSVEDETSDGGRTPQPAWEKWSNDGTERQVAKLMEENVGAAMQLLQSKA  276

Query  526  LCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LC+MPISLA AIYHSQ PDT+ +VKPETNPP
Sbjct  277  LCMMPISLAMAIYHSQPPDTSSVVKPETNPP  307



>ref|XP_007201836.1| hypothetical protein PRUPE_ppa009299mg [Prunus persica]
 gb|EMJ03035.1| hypothetical protein PRUPE_ppa009299mg [Prunus persica]
Length=298

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 124/135 (92%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  165  LQELVPSVNKTDRAAMLDEIMDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  224

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            GG    R QPAW+KWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYH+Q 
Sbjct  225  GGEGG-RNQPAWDKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHTQP  283

Query  475  PDTTPLVKPETNPPS  431
            PDT+ +VKPE NPPS
Sbjct  284  PDTSSVVKPEMNPPS  298



>ref|XP_008235331.1| PREDICTED: transcription factor UNE12 [Prunus mume]
Length=298

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 124/135 (92%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  165  LQELVPSVNKTDRAAMLDEIMDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  224

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            GG    R QPAW+KWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYH+Q 
Sbjct  225  GGEGG-RNQPAWDKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHTQP  283

Query  475  PDTTPLVKPETNPPS  431
            PDT+ +VKPE NPPS
Sbjct  284  PDTSSVVKPEMNPPS  298



>ref|XP_006396471.1| hypothetical protein EUTSA_v10028824mg [Eutrema salsugineum]
 ref|XP_006396472.1| hypothetical protein EUTSA_v10028824mg [Eutrema salsugineum]
 gb|ESQ37924.1| hypothetical protein EUTSA_v10028824mg [Eutrema salsugineum]
 gb|ESQ37925.1| hypothetical protein EUTSA_v10028824mg [Eutrema salsugineum]
Length=310

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 128/151 (85%), Gaps = 10/151 (7%)
 Frame = -1

Query  856  IAERIRA---------LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGA  704
            IAER+R          LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGA
Sbjct  159  IAERLRRERIAERIRALQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGA  218

Query  703  VAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKA  527
            VAPLVTD+P+S   E+  S+ GRT QPAWEKWSNDGTERQVAKLMEENVGAAMQ LQSKA
Sbjct  219  VAPLVTDMPLSSSVEDETSDGGRTPQPAWEKWSNDGTERQVAKLMEENVGAAMQLLQSKA  278

Query  526  LCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LC+MPISLA AIYHSQ PDT+ +VKPETNPP
Sbjct  279  LCMMPISLAMAIYHSQPPDTSSVVKPETNPP  309



>ref|XP_004289895.1| PREDICTED: transcription factor UNE12 [Fragaria vesca subsp. 
vesca]
Length=292

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 124/135 (92%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S VEEE
Sbjct  159  LQELVPSVNKTDRAAMLDEIMDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSVEEE  218

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            GG    R QPAW+KWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMP+SLASAIYH+Q 
Sbjct  219  GGEGG-RNQPAWDKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPVSLASAIYHTQP  277

Query  475  PDTTPLVKPETNPPS  431
            PDT+ +VKPE NPPS
Sbjct  278  PDTSSVVKPEMNPPS  292



>ref|NP_001118919.1| transcription factor UNE12 [Arabidopsis thaliana]
 gb|AEE82201.1| transcription factor UNE12 [Arabidopsis thaliana]
Length=247

 Score =   225 bits (574),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 120/135 (89%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTD+P+S   E+
Sbjct  112  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDMPLSSSVED  171

Query  655  GGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
               E GRT QPAWEKWSNDGTERQVAKLMEENVGAAMQ LQSKALC+MPISLA AIYHSQ
Sbjct  172  ETGEGGRTPQPAWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCMMPISLAMAIYHSQ  231

Query  478  APDTTPLVKPETNPP  434
             PDT+ +VKPE NPP
Sbjct  232  PPDTSSVVKPENNPP  246



>emb|CDY22062.1| BnaA09g00910D [Brassica napus]
Length=304

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 120/135 (89%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTD+P+S   E+
Sbjct  168  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDMPLSSTVED  227

Query  655  GGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
               E GR  QPAWEKWSNDGTERQVAKLMEENVGAAMQ LQSKALC+MPISLA AIYHSQ
Sbjct  228  ESGEGGRAPQPAWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCMMPISLAMAIYHSQ  287

Query  478  APDTTPLVKPETNPP  434
             PDT+ +VKPETNPP
Sbjct  288  PPDTSSVVKPETNPP  302



>ref|XP_010422571.1| PREDICTED: transcription factor UNE12-like [Camelina sativa]
Length=262

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 120/135 (89%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTD+P+S   E+
Sbjct  127  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDMPLSSSVED  186

Query  655  GGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
               E GR  QPAWEKWSNDGTERQVAKLMEENVGAAMQ LQSKALC+MPISLA AIYHSQ
Sbjct  187  ETGEGGRAPQPAWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCMMPISLAMAIYHSQ  246

Query  478  APDTTPLVKPETNPP  434
             PDT+ +VKPETNPP
Sbjct  247  PPDTSSVVKPETNPP  261



>ref|XP_009111272.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor UNE12 [Brassica 
rapa]
Length=304

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 120/135 (89%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTD+P+S   E+
Sbjct  168  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDMPLSSSVED  227

Query  655  GGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
               E GR  QPAWEKWSNDGTERQVAKLMEENVGAAMQ LQSKALC+MPISLA AIYHSQ
Sbjct  228  ESGEGGRAPQPAWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCMMPISLAMAIYHSQ  287

Query  478  APDTTPLVKPETNPP  434
             PDT+ +VKPETNPP
Sbjct  288  PPDTSSVVKPETNPP  302



>ref|XP_002872829.1| hypothetical protein ARALYDRAFT_490301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49088.1| hypothetical protein ARALYDRAFT_490301 [Arabidopsis lyrata subsp. 
lyrata]
Length=310

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 121/135 (90%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTD+P+S   E+
Sbjct  175  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDMPLSSSVED  234

Query  655  GGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
               + GRT QPAWEKWSNDGTERQVAKLMEENVGAAMQ LQSKALC+MPISLA AIYHSQ
Sbjct  235  ETGDGGRTPQPAWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCMMPISLAMAIYHSQ  294

Query  478  APDTTPLVKPETNPP  434
             PDT+ +VKPETNPP
Sbjct  295  PPDTSSVVKPETNPP  309



>emb|CDY21898.1| BnaC09g00040D [Brassica napus]
Length=301

 Score =   226 bits (576),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 120/135 (89%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTD+P+S   E+
Sbjct  165  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDMPLSSSVED  224

Query  655  GGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
               E GR  QPAWEKWSNDGTERQVAKLMEENVGAAMQ LQSKALC+MPISLA AIYHSQ
Sbjct  225  ESGEGGRAPQPAWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCMMPISLAMAIYHSQ  284

Query  478  APDTTPLVKPETNPP  434
             PDTT +VKPE+NPP
Sbjct  285  PPDTTSVVKPESNPP  299



>ref|XP_006443926.1| hypothetical protein CICLE_v10021443mg [Citrus clementina]
 ref|XP_006479602.1| PREDICTED: transcription factor UNE12-like [Citrus sinensis]
 gb|ESR57166.1| hypothetical protein CICLE_v10021443mg [Citrus clementina]
 gb|KDO68565.1| hypothetical protein CISIN_1g022649mg [Citrus sinensis]
Length=294

 Score =   226 bits (575),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 121/135 (90%), Gaps = 2/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVT-DIPISLVEE  659
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSR+G  GAVAPLVT D+P+S VE+
Sbjct  160  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRVGAPGAVAPLVTTDLPLSSVED  219

Query  658  EGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
            E G E  R QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLA+AIYHSQ
Sbjct  220  ESG-EGVRNQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLATAIYHSQ  278

Query  478  APDTTPLVKPETNPP  434
             P++  LVKPETNPP
Sbjct  279  PPESPNLVKPETNPP  293



>emb|CDX90930.1| BnaA03g26100D [Brassica napus]
Length=310

 Score =   226 bits (576),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 121/135 (90%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTD+P+S   E+
Sbjct  174  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDMPLSSSVED  233

Query  655  GGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
              SE GRT QPAWEKWSNDGTERQVAKLMEENVGAAMQ LQSKALC+MPISLA AIYHSQ
Sbjct  234  ETSEGGRTPQPAWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCMMPISLAMAIYHSQ  293

Query  478  APDTTPLVKPETNPP  434
             PDT+ +VK ETNPP
Sbjct  294  PPDTSSVVKAETNPP  308



>ref|NP_567245.1| transcription factor UNE12 [Arabidopsis thaliana]
 ref|NP_001031577.1| transcription factor UNE12 [Arabidopsis thaliana]
 sp|O22768.2|UNE12_ARATH RecName: Full=Transcription factor UNE12; AltName: Full=Basic 
helix-loop-helix protein 59; Short=AtbHLH59; Short=bHLH 59; 
AltName: Full=Protein UNFERTILIZED EMBRYO SAC 12; AltName: 
Full=Transcription factor EN 93; AltName: Full=bHLH transcription 
factor bHLH059 [Arabidopsis thaliana]
 gb|AAK32915.1|AF367328_1 AT4g02590/T10P11_13 [Arabidopsis thaliana]
 gb|AAC78259.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB80752.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAN28890.1| At4g02590/T10P11_13 [Arabidopsis thaliana]
 dbj|BAH19471.1| AT4G02590 [Arabidopsis thaliana]
 gb|AEE82199.1| transcription factor UNE12 [Arabidopsis thaliana]
 gb|AEE82200.1| transcription factor UNE12 [Arabidopsis thaliana]
Length=310

 Score =   226 bits (576),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 120/135 (89%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTD+P+S   E+
Sbjct  175  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDMPLSSSVED  234

Query  655  GGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
               E GRT QPAWEKWSNDGTERQVAKLMEENVGAAMQ LQSKALC+MPISLA AIYHSQ
Sbjct  235  ETGEGGRTPQPAWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCMMPISLAMAIYHSQ  294

Query  478  APDTTPLVKPETNPP  434
             PDT+ +VKPE NPP
Sbjct  295  PPDTSSVVKPENNPP  309



>gb|KJB11136.1| hypothetical protein B456_001G242500 [Gossypium raimondii]
Length=299

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 122/137 (89%), Gaps = 2/137 (1%)
 Frame = -1

Query  838  ALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEE  659
             LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVL+MSRLGGA AVAP V DIP+S +E+
Sbjct  164  GLQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLTMSRLGGAAAVAPFVIDIPLSSIED  223

Query  658  EGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
            E G E+GR+QPAWEKWSNDGTER VAKLMEENVGAAMQFLQSKALCIMP+SLA AIYH+Q
Sbjct  224  ERG-ESGRSQPAWEKWSNDGTERHVAKLMEENVGAAMQFLQSKALCIMPVSLAKAIYHTQ  282

Query  478  APDT-TPLVKPETNPPS  431
             PDT + +VKPET+P S
Sbjct  283  PPDTSSSIVKPETDPTS  299



>gb|AIL24119.1| basic helix-loop-helix leucine-zipper transcription factor [Tamarix 
hispida]
Length=307

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 127/158 (80%), Gaps = 14/158 (9%)
 Frame = -1

Query  862  ERIAERIRA---------LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGA  710
              IAER+R          LQDLVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGA
Sbjct  150  HSIAERLRRERIAERIRALQDLVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGA  209

Query  709  GAVAPLVTDIPISLVEE-EGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQS  533
            GAVAPLVTD+P+S VE+  G    GR QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQS
Sbjct  210  GAVAPLVTDVPVSSVEDEGGEGGGGRNQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQS  269

Query  532  KALCIMPISLASAIYHSQAPDTT----PLVKPETNPPS  431
            KALCIMPISLASAIYH+Q P  T     LVKPETNP S
Sbjct  270  KALCIMPISLASAIYHTQQPSDTSNASSLVKPETNPLS  307



>ref|XP_010429869.1| PREDICTED: transcription factor UNE12-like [Camelina sativa]
Length=314

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 120/135 (89%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTD+P+S   E+
Sbjct  179  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDMPLSSSVED  238

Query  655  GGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
               E GR  QPAWEKWSNDGTERQVAKLMEENVGAAMQ LQSKALC+MPISLA AIYHSQ
Sbjct  239  ETGEGGRAPQPAWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCMMPISLAMAIYHSQ  298

Query  478  APDTTPLVKPETNPP  434
             PDT+ +VKPETNPP
Sbjct  299  PPDTSSVVKPETNPP  313



>ref|XP_009364494.1| PREDICTED: transcription factor UNE12 isoform X2 [Pyrus x bretschneideri]
Length=336

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  192  RRERIAERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  251

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE E G E G  Q AWEKWSNDGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  252  ADVPLSAVEGE-GMEGGTNQQAWEKWSNDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  310

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA AI+ +  PD T +VKPE+N  S
Sbjct  311  SLAPAIFRTHQPDATTMVKPESNSSS  336



>ref|XP_008366876.1| PREDICTED: transcription factor UNE12-like isoform X1 [Malus 
domestica]
Length=336

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  192  RRERIAERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  251

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE E G E G  Q AWEKWSNDGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  252  ADVPLSAVEGE-GMEGGTNQQAWEKWSNDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  310

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA AI+ +  PD T +VKPE+N  S
Sbjct  311  SLAPAIFRTHQPDATTMVKPESNSSS  336



>emb|CDX91293.1| BnaC02g27040D [Brassica napus]
Length=298

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 122/136 (90%), Gaps = 2/136 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTD+P+S   E+
Sbjct  161  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDMPLSSSVED  220

Query  655  GGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
             GSE GRT Q AWEKWSNDGTERQVAKLMEENVGAAMQ LQSKALC+MPISLA AIYHSQ
Sbjct  221  EGSEGGRTPQAAWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCMMPISLAMAIYHSQ  280

Query  478  APDT-TPLVKPETNPP  434
             PDT + +VKPETNPP
Sbjct  281  PPDTSSSVVKPETNPP  296



>ref|XP_009364493.1| PREDICTED: transcription factor UNE12 isoform X1 [Pyrus x bretschneideri]
Length=337

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  193  RRERIAERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  252

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE E G E G  Q AWEKWSNDGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  253  ADVPLSAVEGE-GMEGGTNQQAWEKWSNDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  311

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA AI+ +  PD T +VKPE+N  S
Sbjct  312  SLAPAIFRTHQPDATTMVKPESNSSS  337



>ref|XP_008218266.1| PREDICTED: transcription factor UNE12-like isoform X2 [Prunus 
mume]
Length=341

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  197  RRERIAERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  256

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE EG  E G  Q AWEKWSNDGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  257  ADVPLSAVEGEG-IEGGTNQQAWEKWSNDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  315

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA AI+ +  PD T LVKPE+N  S
Sbjct  316  SLAPAIFRTHQPDATTLVKPESNSSS  341



>ref|XP_006288280.1| hypothetical protein CARUB_v10001523mg [Capsella rubella]
 gb|EOA21178.1| hypothetical protein CARUB_v10001523mg [Capsella rubella]
Length=310

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 120/135 (89%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISL-VEE  659
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTD+P+S  VE+
Sbjct  175  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDMPLSSSVED  234

Query  658  EGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
            E G      QPAWEKWSNDGTERQVAKLMEENVGAAMQ LQSKALC+MPISLA AIYHSQ
Sbjct  235  ETGDGGRAPQPAWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCMMPISLAMAIYHSQ  294

Query  478  APDTTPLVKPETNPP  434
             PDT+ +VKPETNPP
Sbjct  295  PPDTSSVVKPETNPP  309



>ref|XP_004493736.1| PREDICTED: transcription factor UNE12-like isoform X1 [Cicer 
arietinum]
Length=300

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 122/142 (86%), Gaps = 7/142 (5%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVE--  662
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S +E  
Sbjct  159  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSIESY  218

Query  661  EEGGSEAG-----RTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLAS  497
            +  G +       R  PAW+KWSNDGTE+QVAKLMEENVGAAMQFLQSKALCIMPISLAS
Sbjct  219  KSNGDQEEGGEGGRNGPAWDKWSNDGTEKQVAKLMEENVGAAMQFLQSKALCIMPISLAS  278

Query  496  AIYHSQAPDTTPLVKPETNPPS  431
            AIY SQ PD++ +VKPETNPPS
Sbjct  279  AIYQSQPPDSSSIVKPETNPPS  300



>ref|XP_008218265.1| PREDICTED: transcription factor UNE12-like isoform X1 [Prunus 
mume]
Length=346

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  202  RRERIAERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  261

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE EG  E G  Q AWEKWSNDGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  262  ADVPLSAVEGEG-IEGGTNQQAWEKWSNDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  320

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA AI+ +  PD T LVKPE+N  S
Sbjct  321  SLAPAIFRTHQPDATTLVKPESNSSS  346



>ref|XP_010456011.1| PREDICTED: transcription factor UNE12 [Camelina sativa]
Length=312

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 120/135 (89%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISL-VEE  659
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTD+P+S  VE+
Sbjct  177  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDMPLSSSVED  236

Query  658  EGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
            E G      QPAWEKWSNDGTERQVAKLMEENVGAAMQ LQSKALC+MPISLA AIYHSQ
Sbjct  237  ETGDGGRAPQPAWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCMMPISLAMAIYHSQ  296

Query  478  APDTTPLVKPETNPP  434
             PDT+ +VKPETNPP
Sbjct  297  PPDTSSVVKPETNPP  311



>ref|XP_010679161.1| PREDICTED: transcription factor UNE12 [Beta vulgaris subsp. vulgaris]
Length=301

 Score =   224 bits (571),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 128/151 (85%), Gaps = 10/151 (7%)
 Frame = -1

Query  856  IAERIRA---------LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGA  704
            IAER+R          LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGA
Sbjct  152  IAERLRRERIAERIRALQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGA  211

Query  703  VAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKAL  524
            V PLVTD+PIS VEEEGG    R QP WEKWSNDGTERQVAKLMEENVGAAMQFLQSKAL
Sbjct  212  VVPLVTDMPISSVEEEGGEGG-RGQPVWEKWSNDGTERQVAKLMEENVGAAMQFLQSKAL  270

Query  523  CIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            CIMP+SLASAIYH+Q PD + LVKPE+NPPS
Sbjct  271  CIMPVSLASAIYHTQPPDASSLVKPESNPPS  301



>ref|XP_007205486.1| hypothetical protein PRUPE_ppa008172mg [Prunus persica]
 gb|EMJ06685.1| hypothetical protein PRUPE_ppa008172mg [Prunus persica]
Length=342

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  198  RRERIAERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  257

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE E G E G  Q AWEKWSNDGTE+QVAKLMEE+VGAAMQFLQ+KALCIMPI
Sbjct  258  ADVPLSAVEGE-GIEGGTNQQAWEKWSNDGTEQQVAKLMEEDVGAAMQFLQAKALCIMPI  316

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA AI+ +  PD T LVKPE+N  S
Sbjct  317  SLAPAIFRTHQPDATTLVKPESNSSS  342



>dbj|BAJ33851.1| unnamed protein product [Thellungiella halophila]
Length=310

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 127/151 (84%), Gaps = 10/151 (7%)
 Frame = -1

Query  856  IAERIRA---------LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGA  704
            IAER+R          LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGA
Sbjct  159  IAERLRRERIAERIRALQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGA  218

Query  703  VAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKA  527
            VAPLVTD+P+S   E+  S+ GRT QPAWEKWSNDGTERQVAKLMEENVGAAMQ LQSKA
Sbjct  219  VAPLVTDMPLSSSVEDETSDGGRTPQPAWEKWSNDGTERQVAKLMEENVGAAMQLLQSKA  278

Query  526  LCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LC+MPISLA AI HSQ PDT+ +VKPETNPP
Sbjct  279  LCMMPISLAMAICHSQPPDTSSVVKPETNPP  309



>gb|AAM65759.1| putative bHLH transcription factor [Arabidopsis thaliana]
Length=310

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 119/135 (88%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGG GAVAPLVTD+P+S   E+
Sbjct  175  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGVGAVAPLVTDMPLSSSVED  234

Query  655  GGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
               E GRT QPAWEKWSNDGTERQVAKLMEENVGAAMQ LQSKALC+MPISLA AIYHSQ
Sbjct  235  ETGEGGRTPQPAWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCMMPISLAMAIYHSQ  294

Query  478  APDTTPLVKPETNPP  434
             PDT+ +VKPE NPP
Sbjct  295  PPDTSSVVKPENNPP  309



>ref|XP_004493737.1| PREDICTED: transcription factor UNE12-like isoform X2 [Cicer 
arietinum]
Length=292

 Score =   223 bits (569),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 123/135 (91%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIP+S +EEE
Sbjct  159  LQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPLSSIEEE  218

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            GG    R  PAW+KWSNDGTE+QVAKLMEENVGAAMQFLQSKALCIMPISLASAIY SQ 
Sbjct  219  GGEGG-RNGPAWDKWSNDGTEKQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYQSQP  277

Query  475  PDTTPLVKPETNPPS  431
            PD++ +VKPETNPPS
Sbjct  278  PDSSSIVKPETNPPS  292



>gb|AAM10948.1|AF488592_1 putative bHLH transcription factor [Arabidopsis thaliana]
Length=310

 Score =   224 bits (570),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 119/135 (88%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTD+P+S    +
Sbjct  175  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDMPLSSSVXD  234

Query  655  GGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
               E GRT QPAWEKWSNDGTERQVAKLMEENVGAAMQ LQSKALC+MPISLA AIYHSQ
Sbjct  235  ETGEGGRTPQPAWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCMMPISLAMAIYHSQ  294

Query  478  APDTTPLVKPETNPP  434
             PDT+ +VKPE NPP
Sbjct  295  PPDTSSVVKPENNPP  309



>ref|XP_010038816.1| PREDICTED: transcription factor UNE12 isoform X2 [Eucalyptus 
grandis]
 gb|KCW84665.1| hypothetical protein EUGRSUZ_B01487 [Eucalyptus grandis]
Length=323

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 122/135 (90%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQDLVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLG AGAVAPLVTDIP+S VEEE
Sbjct  190  LQDLVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGAAGAVAPLVTDIPLSSVEEE  249

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            GG    R QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLA+AIY +Q 
Sbjct  250  GGEGG-RNQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLATAIYQTQP  308

Query  475  PDTTPLVKPETNPPS  431
            PDT+ LVK E+NPPS
Sbjct  309  PDTSSLVKSESNPPS  323



>ref|XP_010038809.1| PREDICTED: transcription factor UNE12 isoform X1 [Eucalyptus 
grandis]
 gb|KCW84664.1| hypothetical protein EUGRSUZ_B01487 [Eucalyptus grandis]
Length=344

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 122/135 (90%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQDLVPSVNKTDR  MLDEIVDYVKFLRLQVKVLSMSRLG AGAVAPLVTDIP+S VEEE
Sbjct  211  LQDLVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGAAGAVAPLVTDIPLSSVEEE  270

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            GG    R QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLA+AIY +Q 
Sbjct  271  GGEGG-RNQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLATAIYQTQP  329

Query  475  PDTTPLVKPETNPPS  431
            PDT+ LVK E+NPPS
Sbjct  330  PDTSSLVKSESNPPS  344



>emb|CBI34158.3| unnamed protein product [Vitis vinifera]
Length=261

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  117  RRERIAERMKALQELVPSANKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  176

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+  +E +G +E G  Q AWEKWS DGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  177  ADVPLLSIEGDG-TEGGSNQQAWEKWSTDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  235

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLASAI+ +  P+ + LVKPE++ PS
Sbjct  236  SLASAIFRTHQPEPSTLVKPESDAPS  261



>gb|EYU17893.1| hypothetical protein MIMGU_mgv1a010769mg [Erythranthe guttata]
Length=302

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 134/159 (84%), Gaps = 2/159 (1%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R E+IAERIRALQ+LVP+VNKTDR  MLDEIVDYVKFL+LQ+KVLS
Sbjct  143  GQATDPHSIAERLRR-EKIAERIRALQELVPNVNKTDRAAMLDEIVDYVKFLKLQLKVLS  201

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVAPLVTDI    +EEEGG+  GR QPAWEKWS+DGTERQVAKLMEENVGAA
Sbjct  202  MSRLGGAGAVAPLVTDISTLSMEEEGGNGGGRAQPAWEKWSSDGTERQVAKLMEENVGAA  261

Query  550  MQFLQSKALCIMPISLASAIYHSQ-APDTTPLVKPETNP  437
            MQFLQSKALC+MPISLASAIYH+Q   D T  VKPE++P
Sbjct  262  MQFLQSKALCMMPISLASAIYHTQPVTDATSHVKPESDP  300



>ref|XP_002284047.1| PREDICTED: transcription factor UNE12 [Vitis vinifera]
 emb|CBI26351.3| unnamed protein product [Vitis vinifera]
Length=313

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLS
Sbjct  156  GQATDPHSIAERL-RRERIAERMKALQELVPSSNKTDRAAMLDEIVDYVKFLRLQVKVLS  214

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP+  VE E G E G  Q AW+KWSNDGTER+VAKLMEE+VGAA
Sbjct  215  MSRLGGAGAVAQLVADIPLPAVEGETG-EGGSNQQAWDKWSNDGTEREVAKLMEEDVGAA  273

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            MQFLQSKALCIMPISLA+AIY +   DT  L+KPE N PS
Sbjct  274  MQFLQSKALCIMPISLAAAIYPAHQTDTPTLIKPEPNAPS  313



>ref|XP_007030571.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
 gb|EOY11073.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
Length=345

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLG AGAVA LV
Sbjct  202  RRERIAERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGAAGAVAQLV  261

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE +G    G TQPAWEKWSNDGTE+QVAKLMEE++GAAMQFLQSKALCIMPI
Sbjct  262  ADVPLSSVEGDGIE--GGTQPAWEKWSNDGTEQQVAKLMEEDIGAAMQFLQSKALCIMPI  319

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLASAI+ +  PD   +VKPE++ PS
Sbjct  320  SLASAIFRTHQPDAPTIVKPESSTPS  345



>ref|XP_003520191.1| PREDICTED: transcription factor UNE12-like [Glycine max]
Length=274

 Score =   220 bits (561),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 123/151 (81%), Gaps = 11/151 (7%)
 Frame = -1

Query  856  IAERIRA---------LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGA  704
            IAER+R          LQ+LVPSVNKTDR  MLDEIVDYVKFLRLQVKV ++   GGA A
Sbjct  126  IAERLRRERIAERIRALQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVNALXXXGGADA  185

Query  703  VAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKAL  524
            VAPLVTDIP+S VEEEGG   GR QPAWEK SNDGTERQVAKLMEENVGAAMQFLQSKAL
Sbjct  186  VAPLVTDIPLSSVEEEGGE--GRNQPAWEKCSNDGTERQVAKLMEENVGAAMQFLQSKAL  243

Query  523  CIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            CIMP+SLASAIY SQ  DT+ +VKPE NPPS
Sbjct  244  CIMPVSLASAIYQSQPSDTSSIVKPEINPPS  274



>gb|KJB44876.1| hypothetical protein B456_007G277200 [Gossypium raimondii]
Length=323

 Score =   222 bits (565),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLG AGAVA LV
Sbjct  180  RRERIAERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGAAGAVAQLV  239

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+  VE +G    G TQPAWEKWSNDGTE+QVAKLMEE++GAAMQFLQSKALCI+PI
Sbjct  240  ADVPLLSVEGDGA--GGGTQPAWEKWSNDGTEQQVAKLMEEDIGAAMQFLQSKALCIVPI  297

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLASAI+ +  PD   +VKPE+N PS
Sbjct  298  SLASAIFPAHQPDAPTIVKPESNTPS  323



>ref|XP_011465955.1| PREDICTED: transcription factor UNE12 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=338

 Score =   222 bits (565),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  193  RRERIAERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  252

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE EG       Q AWEKWSNDGTE+QVAKLMEE+VGAAMQ+LQSKALCIMPI
Sbjct  253  ADVPLSAVEGEGIEGGTNNQQAWEKWSNDGTEQQVAKLMEEDVGAAMQYLQSKALCIMPI  312

Query  508  SLASAIYHSQAPDTTPLVKPETN  440
            SLA AI+ +  PDTT +VKPE++
Sbjct  313  SLAPAIFRTHQPDTTTMVKPESH  335



>ref|XP_004302053.1| PREDICTED: transcription factor UNE12 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=339

 Score =   222 bits (565),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  194  RRERIAERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  253

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE EG       Q AWEKWSNDGTE+QVAKLMEE+VGAAMQ+LQSKALCIMPI
Sbjct  254  ADVPLSAVEGEGIEGGTNNQQAWEKWSNDGTEQQVAKLMEEDVGAAMQYLQSKALCIMPI  313

Query  508  SLASAIYHSQAPDTTPLVKPETN  440
            SLA AI+ +  PDTT +VKPE++
Sbjct  314  SLAPAIFRTHQPDTTTMVKPESH  336



>ref|XP_009364496.1| PREDICTED: transcription factor UNE12 isoform X3 [Pyrus x bretschneideri]
Length=335

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 122/146 (84%), Gaps = 3/146 (2%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  193  RRERIAERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  252

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S  E   G E G  Q AWEKWSNDGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  253  ADVPLSAGE---GMEGGTNQQAWEKWSNDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  309

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA AI+ +  PD T +VKPE+N  S
Sbjct  310  SLAPAIFRTHQPDATTMVKPESNSSS  335



>ref|XP_008366877.1| PREDICTED: transcription factor UNE12-like isoform X2 [Malus 
domestica]
Length=334

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 122/146 (84%), Gaps = 3/146 (2%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  192  RRERIAERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  251

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S  E   G E G  Q AWEKWSNDGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  252  ADVPLSAGE---GMEGGTNQQAWEKWSNDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  308

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA AI+ +  PD T +VKPE+N  S
Sbjct  309  SLAPAIFRTHQPDATTMVKPESNSSS  334



>ref|XP_006432927.1| hypothetical protein CICLE_v10001768mg [Citrus clementina]
 ref|XP_006471682.1| PREDICTED: transcription factor UNE12-like isoform X1 [Citrus 
sinensis]
 gb|ESR46167.1| hypothetical protein CICLE_v10001768mg [Citrus clementina]
Length=336

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIA+R+RALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLG AGAVA LV
Sbjct  191  RRERIADRMRALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGAAGAVAQLV  250

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S   E    + G +QP WEKWSNDGTE+QVAKLMEE++GAAMQFLQSKALCIMPI
Sbjct  251  ADVPLSSALEGESIDGGSSQPEWEKWSNDGTEQQVAKLMEEDIGAAMQFLQSKALCIMPI  310

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLASAIY ++ PD    VKPE++ PS
Sbjct  311  SLASAIYRTRQPDAPAFVKPESSTPS  336



>ref|XP_008450747.1| PREDICTED: transcription factor UNE12-like isoform X1 [Cucumis 
melo]
Length=318

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 123/145 (85%), Gaps = 1/145 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  175  RRERIAERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  234

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE E G E+G  Q AWEKWS+DGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  235  ADVPLSSVEGE-GIESGNNQQAWEKWSSDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  293

Query  508  SLASAIYHSQAPDTTPLVKPETNPP  434
            SLASAI+ +   D   LVKPE N P
Sbjct  294  SLASAIFRTHQADPQILVKPEMNTP  318



>ref|XP_004135655.1| PREDICTED: transcription factor UNE12-like isoform X1 [Cucumis 
sativus]
 gb|KGN66149.1| hypothetical protein Csa_1G573680 [Cucumis sativus]
Length=318

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 123/145 (85%), Gaps = 1/145 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  175  RRERIAERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  234

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE E G E+G  Q AWEKWS+DGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  235  ADVPLSSVEGE-GIESGNNQQAWEKWSSDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  293

Query  508  SLASAIYHSQAPDTTPLVKPETNPP  434
            SLASAI+ +   D   LVKPE N P
Sbjct  294  SLASAIFRTHQADPQILVKPEMNTP  318



>emb|CAN66761.1| hypothetical protein VITISV_032727 [Vitis vinifera]
Length=337

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLS
Sbjct  180  GQATDPHSIAERLRR-ERIAERMKALQELVPSSNKTDRAAMLDEIVDYVKFLRLQVKVLS  238

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP+  VE E G E G  Q AW+KWSNDGTER+VAKLMEE+VGAA
Sbjct  239  MSRLGGAGAVAQLVADIPLPAVEGETG-EGGSNQQAWDKWSNDGTEREVAKLMEEDVGAA  297

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            MQFLQSKALCIMPISLA+AIY +   DT  L+KPE N PS
Sbjct  298  MQFLQSKALCIMPISLAAAIYPAHQTDTPTLIKPEPNAPS  337



>emb|CDX97278.1| BnaA02g20690D [Brassica napus]
Length=299

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 130/161 (81%), Gaps = 3/161 (2%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAE IRALQ+LVP+VNKTDR  M+DEIVDYVKFL LQVKV S
Sbjct  138  GQATDPHSIAERL-RRERIAEWIRALQELVPTVNKTDRAAMIDEIVDYVKFLMLQVKVWS  196

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGA  554
            MSRLGGAGAVAPLVTD+P+    E+ GSE GRT Q AWEK SNDGTERQVAKLME+NV A
Sbjct  197  MSRLGGAGAVAPLVTDMPLPSSVEDEGSEGGRTPQAAWEKGSNDGTERQVAKLMEKNVWA  256

Query  553  AMQFLQSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPP  434
            AMQ LQSK LC+MPISLA AIYHSQ PDT + +VKPETNPP
Sbjct  257  AMQLLQSKTLCMMPISLAMAIYHSQPPDTSSSVVKPETNPP  297



>ref|XP_010659880.1| PREDICTED: transcription factor UNE12-like [Vitis vinifera]
Length=331

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  187  RRERIAERMKALQELVPSANKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  246

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+  +E +G +E G  Q AWEKWS DGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  247  ADVPLLSIEGDG-TEGGSNQQAWEKWSTDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  305

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLASAI+ +  P+ + LVKPE++ PS
Sbjct  306  SLASAIFRTHQPEPSTLVKPESDAPS  331



>ref|XP_011659936.1| PREDICTED: transcription factor UNE12-like isoform X2 [Cucumis 
sativus]
Length=313

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 123/145 (85%), Gaps = 1/145 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  170  RRERIAERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  229

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE E G E+G  Q AWEKWS+DGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  230  ADVPLSSVEGE-GIESGNNQQAWEKWSSDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  288

Query  508  SLASAIYHSQAPDTTPLVKPETNPP  434
            SLASAI+ +   D   LVKPE N P
Sbjct  289  SLASAIFRTHQADPQILVKPEMNTP  313



>ref|XP_008450748.1| PREDICTED: transcription factor UNE12-like isoform X2 [Cucumis 
melo]
Length=313

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 123/145 (85%), Gaps = 1/145 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  170  RRERIAERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  229

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE E G E+G  Q AWEKWS+DGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  230  ADVPLSSVEGE-GIESGNNQQAWEKWSSDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  288

Query  508  SLASAIYHSQAPDTTPLVKPETNPP  434
            SLASAI+ +   D   LVKPE N P
Sbjct  289  SLASAIFRTHQADPQILVKPEMNTP  313



>gb|ACN21631.1| putative basic helix-loop-helix protein BHLH4 [Lotus japonicus]
Length=275

 Score =   215 bits (548),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 116/135 (86%), Gaps = 11/135 (8%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVPSVNKTDR VMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPL          EE
Sbjct  152  LQELVPSVNKTDRAVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPL----------EE  201

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            GG E GR QPAWEKWSNDGTE+QVAKLMEEN+GAAMQFLQSKALCIMPISLASAIY SQ 
Sbjct  202  GG-EGGRNQPAWEKWSNDGTEKQVAKLMEENIGAAMQFLQSKALCIMPISLASAIYQSQP  260

Query  475  PDTTPLVKPETNPPS  431
             + + +VKPET+PPS
Sbjct  261  SENSSIVKPETSPPS  275



>ref|XP_008370704.1| PREDICTED: transcription factor UNE12-like isoform X2 [Malus 
domestica]
Length=331

 Score =   217 bits (552),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 122/146 (84%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  187  RRERIAERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  246

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE E G E G  Q A EKWSNDGTE++VAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  247  ADVPLSAVEGE-GMEGGTNQQACEKWSNDGTEQEVAKLMEEDVGAAMQFLQSKALCIMPI  305

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA AI+ +  PD   +VKPE+N  S
Sbjct  306  SLAPAIFXTHQPDAPTIVKPESNSSS  331



>ref|XP_008370703.1| PREDICTED: transcription factor UNE12-like isoform X1 [Malus 
domestica]
Length=332

 Score =   217 bits (552),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 122/146 (84%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  188  RRERIAERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  247

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE E G E G  Q A EKWSNDGTE++VAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  248  ADVPLSAVEGE-GMEGGTNQQACEKWSNDGTEQEVAKLMEEDVGAAMQFLQSKALCIMPI  306

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA AI+ +  PD   +VKPE+N  S
Sbjct  307  SLAPAIFXTHQPDAPTIVKPESNSSS  332



>ref|XP_010522761.1| PREDICTED: transcription factor UNE12 [Tarenaya hassleriana]
Length=310

 Score =   216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 122/135 (90%), Gaps = 1/135 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVP+VNKTDR  M+DE+VDYVKFLRLQVKVLSMSRLGGAGAVAPLVTD+P+S   EE
Sbjct  175  LQELVPTVNKTDRAAMIDEVVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDMPLSSSVEE  234

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ-  479
             GSE GRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLA AIYHSQ 
Sbjct  235  EGSEGGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLAMAIYHSQP  294

Query  478  APDTTPLVKPETNPP  434
            A D+   +KPETNPP
Sbjct  295  ASDSPSGIKPETNPP  309



>ref|XP_012089261.1| PREDICTED: transcription factor UNE12-like isoform X4 [Jatropha 
curcas]
 gb|KDP23663.1| hypothetical protein JCGZ_23496 [Jatropha curcas]
Length=332

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVP+ NKTDR VMLDEIVDYVKFLRLQVKVLSMSRLG AGAVA LV
Sbjct  187  RRERIAERMKALQELVPTANKTDRAVMLDEIVDYVKFLRLQVKVLSMSRLGAAGAVAQLV  246

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DI  S VE     E G  Q  WEKWSNDGTE+QVAKLMEE++GAAMQFLQSKALCIMPI
Sbjct  247  ADIQPSSVEAGESIEGGANQQPWEKWSNDGTEQQVAKLMEEDIGAAMQFLQSKALCIMPI  306

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLASAI+ +  PD   +VKPE+N PS
Sbjct  307  SLASAIFRTHPPDAPSIVKPESNTPS  332



>ref|XP_010025019.1| PREDICTED: transcription factor UNE12-like isoform X3 [Eucalyptus 
grandis]
Length=253

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 119/146 (82%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERI ER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  109  RRERINERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  168

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S  E E   E G  QPAWEKW  DGTE+QVAKLMEE+VGAAMQFLQSK LCIMPI
Sbjct  169  ADVPLSSAEGE-IIEGGNNQPAWEKWLTDGTEQQVAKLMEEDVGAAMQFLQSKTLCIMPI  227

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLASAI+ +  PD    +KPE++ PS
Sbjct  228  SLASAIFRTSQPDMPRSIKPESSAPS  253



>ref|XP_007144828.1| hypothetical protein PHAVU_007G187500g [Phaseolus vulgaris]
 gb|ESW16822.1| hypothetical protein PHAVU_007G187500g [Phaseolus vulgaris]
Length=357

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 128/157 (82%), Gaps = 1/157 (1%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVPS+NKTDR  MLDEIVDYVKFLRLQVKVLS
Sbjct  200  GQATDPHSIAERL-RRERIAERMKALQELVPSINKTDRAAMLDEIVDYVKFLRLQVKVLS  258

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV D+P+S VE+    E G  + AW+KWSNDGTE+QVAKLMEE+VGAA
Sbjct  259  MSRLGGAGAVAQLVADVPLSAVEQGEDIEGGANEQAWDKWSNDGTEQQVAKLMEEDVGAA  318

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            MQFLQSKALCIMPISLASAI+     +++ ++KPE+N
Sbjct  319  MQFLQSKALCIMPISLASAIFRMPQSESSTVIKPESN  355



>ref|XP_012089258.1| PREDICTED: transcription factor UNE12-like isoform X1 [Jatropha 
curcas]
Length=344

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVP+ NKTDR VMLDEIVDYVKFLRLQVKVLSMSRLG AGAVA LV
Sbjct  199  RRERIAERMKALQELVPTANKTDRAVMLDEIVDYVKFLRLQVKVLSMSRLGAAGAVAQLV  258

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DI  S VE     E G  Q  WEKWSNDGTE+QVAKLMEE++GAAMQFLQSKALCIMPI
Sbjct  259  ADIQPSSVEAGESIEGGANQQPWEKWSNDGTEQQVAKLMEEDIGAAMQFLQSKALCIMPI  318

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLASAI+ +  PD   +VKPE+N PS
Sbjct  319  SLASAIFRTHPPDAPSIVKPESNTPS  344



>gb|KHN04930.1| Transcription factor UNE12 [Glycine soja]
Length=332

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS+NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  188  RRERIAERMKALQELVPSINKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  247

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE +   E G  + AW+KWSNDGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  248  ADVPLSAVEGDQDIEGGANEQAWDKWSNDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  307

Query  508  SLASAIYHSQAPDTTPLVKPETN  440
            SLASAI+     + +  +KPE+N
Sbjct  308  SLASAIFRMPQSEASTGIKPESN  330



>ref|XP_012089262.1| PREDICTED: transcription factor UNE12-like isoform X5 [Jatropha 
curcas]
Length=331

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVP+ NKTDR VMLDEIVDYVKFLRLQVKVLSMSRLG AGAVA LV
Sbjct  187  RRERIAERMKALQELVPTANKTDRAVMLDEIVDYVKFLRLQVKVLSMSRLGAAGAVAQLV  246

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DI  S VE E   E G  Q  WEKWSNDGTE+QVAKLMEE++GAAMQFLQSKALCIMPI
Sbjct  247  ADIQPSSVEGES-IEGGANQQPWEKWSNDGTEQQVAKLMEEDIGAAMQFLQSKALCIMPI  305

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLASAI+ +  PD   +VKPE+N PS
Sbjct  306  SLASAIFRTHPPDAPSIVKPESNTPS  331



>ref|XP_002531293.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31106.1| conserved hypothetical protein [Ricinus communis]
Length=326

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVP+ NKTDR  M+DEIVDYVKFLRLQVKVLSMSRLG AGAVA LV
Sbjct  181  RRERIAERMKALQELVPTANKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGAAGAVAQLV  240

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P++ VE E    A   Q  WEKWSNDGTE+QVAKLMEE++GAAMQFLQSKALCIMPI
Sbjct  241  ADVPLASVEGESIDGAAANQQTWEKWSNDGTEQQVAKLMEEDIGAAMQFLQSKALCIMPI  300

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLASAI  +  PD   ++KPE+N PS
Sbjct  301  SLASAILRTHPPDAPSIIKPESNTPS  326



>ref|XP_002306441.2| hypothetical protein POPTR_0005s05500g [Populus trichocarpa]
 gb|EEE93437.2| hypothetical protein POPTR_0005s05500g [Populus trichocarpa]
Length=331

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 127/160 (79%), Gaps = 2/160 (1%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R  RI ER++ALQ+LVP+ NKTDR  MLDEIVDYVKFLRLQVKVLS
Sbjct  174  GQATDPHSIAERL-RRVRITERVKALQELVPTCNKTDRAAMLDEIVDYVKFLRLQVKVLS  232

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLG AGAVA LV D+P+S V+ EG  E G  Q AWE WSNDGTE++VAKLMEE+VGAA
Sbjct  233  MSRLGAAGAVAQLVADVPLSSVQGEG-IEGGANQQAWENWSNDGTEQEVAKLMEEDVGAA  291

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            MQ LQSKALCIMP+SLASAI+ ++ P+   LVKPE+NPPS
Sbjct  292  MQLLQSKALCIMPVSLASAIFRARPPNAPTLVKPESNPPS  331



>ref|XP_012089259.1| PREDICTED: transcription factor UNE12-like isoform X2 [Jatropha 
curcas]
Length=343

 Score =   214 bits (546),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVP+ NKTDR VMLDEIVDYVKFLRLQVKVLSMSRLG AGAVA LV
Sbjct  199  RRERIAERMKALQELVPTANKTDRAVMLDEIVDYVKFLRLQVKVLSMSRLGAAGAVAQLV  258

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DI  S VE E   E G  Q  WEKWSNDGTE+QVAKLMEE++GAAMQFLQSKALCIMPI
Sbjct  259  ADIQPSSVEGES-IEGGANQQPWEKWSNDGTEQQVAKLMEEDIGAAMQFLQSKALCIMPI  317

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLASAI+ +  PD   +VKPE+N PS
Sbjct  318  SLASAIFRTHPPDAPSIVKPESNTPS  343



>ref|XP_011032406.1| PREDICTED: transcription factor UNE12-like isoform X2 [Populus 
euphratica]
Length=331

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 120/143 (84%), Gaps = 1/143 (1%)
 Frame = -1

Query  859  RIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDI  680
            RI ER++ALQ+LVP+ NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLG AGAVA LV D+
Sbjct  190  RITERVKALQELVPTCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGAAGAVAQLVADV  249

Query  679  PISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLA  500
            P+S V+ EG  E G  Q AWE WSNDGTE++VAKLMEE+VGAAMQ LQSKALCIMPISLA
Sbjct  250  PLSSVQGEG-IEGGANQQAWENWSNDGTEQEVAKLMEEDVGAAMQLLQSKALCIMPISLA  308

Query  499  SAIYHSQAPDTTPLVKPETNPPS  431
            SAI+ ++ P+   LVKPE NPPS
Sbjct  309  SAIFRARPPNAPTLVKPELNPPS  331



>ref|XP_011032404.1| PREDICTED: transcription factor UNE12-like isoform X1 [Populus 
euphratica]
Length=332

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 120/143 (84%), Gaps = 1/143 (1%)
 Frame = -1

Query  859  RIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDI  680
            RI ER++ALQ+LVP+ NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLG AGAVA LV D+
Sbjct  191  RITERVKALQELVPTCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGAAGAVAQLVADV  250

Query  679  PISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLA  500
            P+S V+ EG  E G  Q AWE WSNDGTE++VAKLMEE+VGAAMQ LQSKALCIMPISLA
Sbjct  251  PLSSVQGEG-IEGGANQQAWENWSNDGTEQEVAKLMEEDVGAAMQLLQSKALCIMPISLA  309

Query  499  SAIYHSQAPDTTPLVKPETNPPS  431
            SAI+ ++ P+   LVKPE NPPS
Sbjct  310  SAIFRARPPNAPTLVKPELNPPS  332



>gb|EAZ02995.1| hypothetical protein OsI_25136 [Oryza sativa Indica Group]
Length=293

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 119/146 (82%), Gaps = 2/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER+RALQDLVP+ NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  150  RRERIAERMRALQDLVPNTNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGAGAVAQLV  209

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DIPIS+  E   S++G  Q  WEKWS DGTE+QVAKLMEE++GAAMQFLQSKALC+MPI
Sbjct  210  ADIPISVKGE--ASDSGSKQQIWEKWSTDGTEKQVAKLMEEDIGAAMQFLQSKALCMMPI  267

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA AIY +Q       VKPE N PS
Sbjct  268  SLAMAIYDTQHSQDGHSVKPEPNTPS  293



>ref|XP_010025017.1| PREDICTED: transcription factor UNE12-like isoform X2 [Eucalyptus 
grandis]
Length=315

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 119/146 (82%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERI ER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  171  RRERINERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  230

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S  E E   E G  QPAWEKW  DGTE+QVAKLMEE+VGAAMQFLQSK LCIMPI
Sbjct  231  ADVPLSSAEGE-IIEGGNNQPAWEKWLTDGTEQQVAKLMEEDVGAAMQFLQSKTLCIMPI  289

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLASAI+ +  PD    +KPE++ PS
Sbjct  290  SLASAIFRTSQPDMPRSIKPESSAPS  315



>ref|XP_006606461.1| PREDICTED: transcription factor UNE12-like isoform X2 [Glycine 
max]
Length=332

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS+NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  188  RRERIAERMKALQELVPSINKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  247

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE +   E G  + AW+KWSNDGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  248  ADVPLSAVEGDQDIEGGANEQAWDKWSNDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  307

Query  508  SLASAIYHSQAPDTTPLVKPETN  440
             LASAI+     + +  +KPE+N
Sbjct  308  PLASAIFRMPQSEASTGIKPESN  330



>ref|XP_003556469.1| PREDICTED: transcription factor UNE12-like isoform X1 [Glycine 
max]
Length=331

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS+NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  187  RRERIAERMKALQELVPSINKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  246

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE +   E G  + AW+KWSNDGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  247  ADVPLSAVEGDQDIEGGANEQAWDKWSNDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  306

Query  508  SLASAIYHSQAPDTTPLVKPETN  440
             LASAI+     + +  +KPE+N
Sbjct  307  PLASAIFRMPQSEASTGIKPESN  329



>ref|XP_006305432.1| hypothetical protein CARUB_v10009831mg [Capsella rubella]
 gb|EOA38330.1| hypothetical protein CARUB_v10009831mg [Capsella rubella]
Length=308

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 117/135 (87%), Gaps = 8/135 (6%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISL-VEE  659
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVT++P+S  +E+
Sbjct  180  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTEMPLSSSIED  239

Query  658  EGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
            E       TQ  WEKWSNDGTERQVAKLMEENVGAAMQ LQSKALCIMPISLA AIYHSQ
Sbjct  240  E-------TQAVWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCIMPISLAMAIYHSQ  292

Query  478  APDTTPLVKPETNPP  434
             PDT+ +VKPE NPP
Sbjct  293  PPDTSSVVKPEMNPP  307



>ref|XP_010246322.1| PREDICTED: transcription factor UNE12-like isoform X4 [Nelumbo 
nucifera]
 ref|XP_010246323.1| PREDICTED: transcription factor UNE12-like isoform X4 [Nelumbo 
nucifera]
Length=432

 Score =   216 bits (549),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLS
Sbjct  275  GQATDPHSIAERLRR-ERIAERMKALQELVPSSNKTDRAAMLDEIVDYVKFLRLQVKVLS  333

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP++ VE EG      +Q AWEKWS DGTERQVAKLMEE+VGAA
Sbjct  334  MSRLGGAGAVAQLVADIPLTSVEGEGSEGG-SSQRAWEKWSTDGTERQVAKLMEEDVGAA  392

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            MQFLQSKALCIMPISLA+AIYH+  P+    VKPE+N PS
Sbjct  393  MQFLQSKALCIMPISLATAIYHAHPPEAPTAVKPESNTPS  432



>ref|XP_010025016.1| PREDICTED: transcription factor UNE12-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW61601.1| hypothetical protein EUGRSUZ_H04337 [Eucalyptus grandis]
Length=320

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 119/146 (82%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERI ER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  176  RRERINERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  235

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S  E E   E G  QPAWEKW  DGTE+QVAKLMEE+VGAAMQFLQSK LCIMPI
Sbjct  236  ADVPLSSAEGE-IIEGGNNQPAWEKWLTDGTEQQVAKLMEEDVGAAMQFLQSKTLCIMPI  294

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLASAI+ +  PD    +KPE++ PS
Sbjct  295  SLASAIFRTSQPDMPRSIKPESSAPS  320



>gb|KCW61602.1| hypothetical protein EUGRSUZ_H04337 [Eucalyptus grandis]
Length=347

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 119/146 (82%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERI ER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  203  RRERINERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  262

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S  E E   E G  QPAWEKW  DGTE+QVAKLMEE+VGAAMQFLQSK LCIMPI
Sbjct  263  ADVPLSSAEGE-IIEGGNNQPAWEKWLTDGTEQQVAKLMEEDVGAAMQFLQSKTLCIMPI  321

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLASAI+ +  PD    +KPE++ PS
Sbjct  322  SLASAIFRTSQPDMPRSIKPESSAPS  347



>ref|XP_010246321.1| PREDICTED: transcription factor UNE12-like isoform X3 [Nelumbo 
nucifera]
Length=486

 Score =   216 bits (550),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLS
Sbjct  329  GQATDPHSIAERLRR-ERIAERMKALQELVPSSNKTDRAAMLDEIVDYVKFLRLQVKVLS  387

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP++ VE EG      +Q AWEKWS DGTERQVAKLMEE+VGAA
Sbjct  388  MSRLGGAGAVAQLVADIPLTSVEGEGSEGG-SSQRAWEKWSTDGTERQVAKLMEEDVGAA  446

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            MQFLQSKALCIMPISLA+AIYH+  P+    VKPE+N PS
Sbjct  447  MQFLQSKALCIMPISLATAIYHAHPPEAPTAVKPESNTPS  486



>gb|KEH43018.1| transcription factor UNE12-like protein [Medicago truncatula]
Length=355

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS+NKTD+  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  211  RRERIAERMKALQELVPSINKTDKAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  270

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE E   E G  Q AW KWSNDGTE+QVAKLMEE+VGAAMQ LQSKALCIMPI
Sbjct  271  ADVPVSAVEGE-DIEGGTNQQAWAKWSNDGTEQQVAKLMEEDVGAAMQLLQSKALCIMPI  329

Query  508  SLASAIYHSQAPDTTPLVKPETN  440
            SLASAI+     D++ ++KPE+N
Sbjct  330  SLASAIFRMPQSDSSTIIKPESN  352



>ref|XP_010674832.1| PREDICTED: transcription factor UNE12-like [Beta vulgaris subsp. 
vulgaris]
Length=328

 Score =   211 bits (537),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 126/161 (78%), Gaps = 6/161 (4%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLS
Sbjct  171  GQATDPHSIAERLRR-ERIAERMKALQELVPSCNKTDRAAMLDEIVDYVKFLRLQVKVLS  229

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV D+P S  E EG   A   Q AWEKWSNDGTE+QVAKLME+++GAA
Sbjct  230  MSRLGGAGAVAQLVADVPPSSAEGEGVDGA---QAAWEKWSNDGTEQQVAKLMEQDIGAA  286

Query  550  MQFLQSKALCIMPISLASAIY--HSQAPDTTPLVKPETNPP  434
            MQFLQSKALCIMP+SLASAI+  H   PD   +VKPE NPP
Sbjct  287  MQFLQSKALCIMPVSLASAIFRSHPPPPDPPGIVKPEANPP  327



>ref|XP_002466294.1| hypothetical protein SORBIDRAFT_01g005130 [Sorghum bicolor]
 gb|EER93292.1| hypothetical protein SORBIDRAFT_01g005130 [Sorghum bicolor]
Length=283

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 125/160 (78%), Gaps = 3/160 (2%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER+RALQ+LVP+ NKTDR VMLDEI+DYVKFLRLQVKVLS
Sbjct  127  GQATDPHSIAERL-RRERIAERMRALQELVPNTNKTDRAVMLDEILDYVKFLRLQVKVLS  185

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP+S+  E   S++G  Q  WEKWS DGTERQVAKLMEE++GAA
Sbjct  186  MSRLGGAGAVAQLVADIPLSVKGE--ASDSGSKQQIWEKWSTDGTERQVAKLMEEDIGAA  243

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            MQFLQSKALC+MPISLA AIY +Q       VKPE N PS
Sbjct  244  MQFLQSKALCMMPISLAMAIYDTQHSQDGQPVKPEPNTPS  283



>ref|XP_008788138.1| PREDICTED: transcription factor UNE12-like isoform X2 [Phoenix 
dactylifera]
Length=263

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 118/146 (81%), Gaps = 2/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER+RALQ+LVPS NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  120  RRERIAERMRALQELVPSTNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGAGAVAQLV  179

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DIP+ +  E   SE+GR Q  WEKWS DGTERQVAKLMEE++GAAMQFLQSKALC+MPI
Sbjct  180  ADIPLPVEGE--ASESGRKQQVWEKWSTDGTERQVAKLMEEDIGAAMQFLQSKALCMMPI  237

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA AIY + +      VKPE N  S
Sbjct  238  SLAMAIYDTHSQPEGHTVKPEPNTSS  263



>gb|EEE66685.1| hypothetical protein OsJ_23336 [Oryza sativa Japonica Group]
Length=342

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 124/160 (78%), Gaps = 3/160 (2%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER+RALQDLVP+ NKTDR  MLDEI+DYVKFLRLQVKVLS
Sbjct  186  GQATDPHSIAERL-RRERIAERMRALQDLVPNTNKTDRAAMLDEILDYVKFLRLQVKVLS  244

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIPIS+  E   S++G  Q  WEKWS DGTE+QVAKLMEE++GAA
Sbjct  245  MSRLGGAGAVAQLVADIPISVKGE--ASDSGSKQQIWEKWSTDGTEKQVAKLMEEDIGAA  302

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            MQFLQSKALC+MPISLA AIY +Q       VKPE N PS
Sbjct  303  MQFLQSKALCMMPISLAMAIYDTQHSQDGHSVKPEPNTPS  342



>ref|XP_008788137.1| PREDICTED: transcription factor UNE12-like isoform X1 [Phoenix 
dactylifera]
Length=264

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 118/146 (81%), Gaps = 2/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER+RALQ+LVPS NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  121  RRERIAERMRALQELVPSTNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGAGAVAQLV  180

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DIP+ +  E   SE+GR Q  WEKWS DGTERQVAKLMEE++GAAMQFLQSKALC+MPI
Sbjct  181  ADIPLPVEGE--ASESGRKQQVWEKWSTDGTERQVAKLMEEDIGAAMQFLQSKALCMMPI  238

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA AIY + +      VKPE N  S
Sbjct  239  SLAMAIYDTHSQPEGHTVKPEPNTSS  264



>ref|XP_010246320.1| PREDICTED: transcription factor UNE12-like isoform X2 [Nelumbo 
nucifera]
Length=503

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLS
Sbjct  346  GQATDPHSIAERLRR-ERIAERMKALQELVPSSNKTDRAAMLDEIVDYVKFLRLQVKVLS  404

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP++ VE EG      +Q AWEKWS DGTERQVAKLMEE+VGAA
Sbjct  405  MSRLGGAGAVAQLVADIPLTSVEGEGSEGG-SSQRAWEKWSTDGTERQVAKLMEEDVGAA  463

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            MQFLQSKALCIMPISLA+AIYH+  P+    VKPE+N PS
Sbjct  464  MQFLQSKALCIMPISLATAIYHAHPPEAPTAVKPESNTPS  503



>ref|XP_006589182.1| PREDICTED: transcription factor UNE12-like isoform X4 [Glycine 
max]
Length=327

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS+NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  183  RRERIAERMKALQELVPSINKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  242

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE +   E    + AW+KWSNDGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  243  ADVPLSAVEGDQDIEGVSNEQAWDKWSNDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  302

Query  508  SLASAIYHSQAPDTTPLVKPETN  440
            SLAS+I+     + +  +KPE+N
Sbjct  303  SLASSIFRMPQSEASTGIKPESN  325



>ref|XP_006589180.1| PREDICTED: transcription factor UNE12-like isoform X2 [Glycine 
max]
Length=329

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS+NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  185  RRERIAERMKALQELVPSINKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  244

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE +   E    + AW+KWSNDGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  245  ADVPLSAVEGDQDIEGVSNEQAWDKWSNDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  304

Query  508  SLASAIYHSQAPDTTPLVKPETN  440
            SLAS+I+     + +  +KPE+N
Sbjct  305  SLASSIFRMPQSEASTGIKPESN  327



>ref|XP_010246319.1| PREDICTED: transcription factor UNE12-like isoform X1 [Nelumbo 
nucifera]
Length=517

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVKVLS
Sbjct  360  GQATDPHSIAERLRR-ERIAERMKALQELVPSSNKTDRAAMLDEIVDYVKFLRLQVKVLS  418

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP++ VE EG      +Q AWEKWS DGTERQVAKLMEE+VGAA
Sbjct  419  MSRLGGAGAVAQLVADIPLTSVEGEGSEGG-SSQRAWEKWSTDGTERQVAKLMEEDVGAA  477

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            MQFLQSKALCIMPISLA+AIYH+  P+    VKPE+N PS
Sbjct  478  MQFLQSKALCIMPISLATAIYHAHPPEAPTAVKPESNTPS  517



>ref|XP_006589181.1| PREDICTED: transcription factor UNE12-like isoform X3 [Glycine 
max]
Length=328

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS+NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  184  RRERIAERMKALQELVPSINKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  243

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE +   E    + AW+KWSNDGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  244  ADVPLSAVEGDQDIEGVSNEQAWDKWSNDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  303

Query  508  SLASAIYHSQAPDTTPLVKPETN  440
            SLAS+I+     + +  +KPE+N
Sbjct  304  SLASSIFRMPQSEASTGIKPESN  326



>ref|XP_003536121.1| PREDICTED: transcription factor UNE12-like isoform X1 [Glycine 
max]
Length=328

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS+NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  184  RRERIAERMKALQELVPSINKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  243

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE +   E    + AW+KWSNDGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  244  ADVPLSAVEGDQDIEGVSNEQAWDKWSNDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  303

Query  508  SLASAIYHSQAPDTTPLVKPETN  440
            SLAS+I+     + +  +KPE+N
Sbjct  304  SLASSIFRMPQSEASTGIKPESN  326



>ref|XP_004496017.1| PREDICTED: transcription factor UNE12-like [Cicer arietinum]
Length=492

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 122/146 (84%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS+NKTD+  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  348  RRERIAERMKALQELVPSINKTDKAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  407

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE E   E G  Q AW KWSNDGTE+QVAKLMEE+VGAAMQ LQSKALCIMPI
Sbjct  408  ADVPVSAVEGE-DVEGGANQQAWTKWSNDGTEQQVAKLMEEDVGAAMQLLQSKALCIMPI  466

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLASAI+     D++ ++KPE+N  S
Sbjct  467  SLASAIFRMPQSDSSTIIKPESNNHS  492



>ref|XP_010228372.1| PREDICTED: transcription factor UNE12-like isoform X1 [Brachypodium 
distachyon]
Length=186

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 117/143 (82%), Gaps = 2/143 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER+RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  43   RRERIAERMRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGAGAVAQLV  102

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DIP+S+  E   S++G  Q  WEKWS DGTERQVAKLM+E++GAAMQFLQSKALC+MPI
Sbjct  103  ADIPLSVKGE--ASDSGSNQQIWEKWSTDGTERQVAKLMDEDIGAAMQFLQSKALCMMPI  160

Query  508  SLASAIYHSQAPDTTPLVKPETN  440
            SLA AIY +Q       VKPE N
Sbjct  161  SLAMAIYDTQHSQDGQPVKPEPN  183



>ref|NP_001184895.1| transcription factor bHLH7 [Arabidopsis thaliana]
 gb|AAD25805.1|AC006550_13 Contains PF|00010 helix-loop-helix DNA-binding domain. ESTs gb|T45640 
and gb|T22783 come from this gene [Arabidopsis thaliana]
 gb|AEE27519.1| transcription factor bHLH7 [Arabidopsis thaliana]
Length=297

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 124/152 (82%), Gaps = 18/152 (12%)
 Frame = -1

Query  856  IAERIR---------ALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGA  704
            IAER+R         +LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGA
Sbjct  152  IAERLRRERIAERIRSLQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGA  211

Query  703  VAPLVTDIPI-SLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKA  527
            VAPLVT++P+ S VE+E       TQ  WEKWSNDGTERQVAKLMEENVGAAMQ LQSKA
Sbjct  212  VAPLVTEMPLSSSVEDE-------TQAVWEKWSNDGTERQVAKLMEENVGAAMQLLQSKA  264

Query  526  LCIMPISLASAIYHSQAPDT-TPLVKPETNPP  434
            LCIMPISLA AIYHSQ PDT + +VKPE NPP
Sbjct  265  LCIMPISLAMAIYHSQPPDTSSSIVKPEMNPP  296



>ref|NP_563672.1| transcription factor bHLH7 [Arabidopsis thaliana]
 sp|Q93Y00.1|BH007_ARATH RecName: Full=Transcription factor bHLH7; AltName: Full=Basic 
helix-loop-helix protein 7; Short=AtbHLH7; Short=bHLH 7; AltName: 
Full=Transcription factor EN 92; AltName: Full=bHLH transcription 
factor bHLH007 [Arabidopsis thaliana]
 gb|AAL55714.2|AF251692_1 putative transcription factor BHLH7 [Arabidopsis thaliana]
 gb|AAK96661.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM47952.1| unknown protein [Arabidopsis thaliana]
 gb|AEE27518.1| transcription factor bHLH7 [Arabidopsis thaliana]
Length=302

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 124/152 (82%), Gaps = 18/152 (12%)
 Frame = -1

Query  856  IAERIR---------ALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGA  704
            IAER+R         +LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGA
Sbjct  157  IAERLRRERIAERIRSLQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGA  216

Query  703  VAPLVTDIPI-SLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKA  527
            VAPLVT++P+ S VE+E       TQ  WEKWSNDGTERQVAKLMEENVGAAMQ LQSKA
Sbjct  217  VAPLVTEMPLSSSVEDE-------TQAVWEKWSNDGTERQVAKLMEENVGAAMQLLQSKA  269

Query  526  LCIMPISLASAIYHSQAPDT-TPLVKPETNPP  434
            LCIMPISLA AIYHSQ PDT + +VKPE NPP
Sbjct  270  LCIMPISLAMAIYHSQPPDTSSSIVKPEMNPP  301



>ref|XP_002892144.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68403.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 115/135 (85%), Gaps = 7/135 (5%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVT++P+S   E+
Sbjct  177  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTEMPLSSSTED  236

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
                   TQ  WEKWSNDGTERQVAKLMEENVGAAMQ LQSKALCIMPISLA AIYHSQ 
Sbjct  237  ------ETQAVWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCIMPISLAMAIYHSQP  290

Query  475  PDT-TPLVKPETNPP  434
            PDT + +VKPE NPP
Sbjct  291  PDTSSSIVKPEMNPP  305



>gb|ACN21629.1| putative basic helix-loop-helix protein BHLH2 [Lotus japonicus]
 gb|AFK41432.1| unknown [Lotus japonicus]
Length=342

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER+RALQ+LVPS+NK+DR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  198  RRERIAERMRALQELVPSINKSDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  257

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE E   E G ++ AW KWSNDGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  258  ADVPLSAVEGE-DIEGGASEQAWSKWSNDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  316

Query  508  SLASAIYHSQAPDTTPLVKPETN  440
            SLASAI+     + +  +KPE++
Sbjct  317  SLASAIFRMPQSEASTTIKPESD  339



>ref|NP_001152044.1| LOC100285681 [Zea mays]
 gb|ACG45529.1| BHLH transcription factor [Zea mays]
 gb|AFW67349.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04749.1| bHLH transcription factor, partial [synthetic construct]
Length=285

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 124/160 (78%), Gaps = 3/160 (2%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER+RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLS
Sbjct  129  GQATDPHSIAERL-RRERIAERMRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLS  187

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP+S+  E   S++G  Q  WEKWS DGTERQVAKLMEE++GAA
Sbjct  188  MSRLGGAGAVAQLVADIPLSVKGE--ASDSGSKQQIWEKWSTDGTERQVAKLMEEDIGAA  245

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            MQFLQSKALC+MPISLA AIY +Q       VKPE N PS
Sbjct  246  MQFLQSKALCMMPISLAMAIYDTQHSQDGQPVKPEPNTPS  285



>ref|XP_012089260.1| PREDICTED: transcription factor UNE12-like isoform X3 [Jatropha 
curcas]
Length=341

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 119/146 (82%), Gaps = 3/146 (2%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVP+ NKTDR VMLDEIVDYVKFLRLQVKVLSMSRLG AGAVA LV
Sbjct  199  RRERIAERMKALQELVPTANKTDRAVMLDEIVDYVKFLRLQVKVLSMSRLGAAGAVAQLV  258

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DI  S  E     E G  Q  WEKWSNDGTE+QVAKLMEE++GAAMQFLQSKALCIMPI
Sbjct  259  ADIQPSSGES---IEGGANQQPWEKWSNDGTEQQVAKLMEEDIGAAMQFLQSKALCIMPI  315

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLASAI+ +  PD   +VKPE+N PS
Sbjct  316  SLASAIFRTHPPDAPSIVKPESNTPS  341



>gb|KHN22077.1| Transcription factor UNE12 [Glycine soja]
Length=327

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVPS+NKTDR  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  183  RRERIAERMKALQELVPSINKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAQLV  242

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             D+P+S VE +   E    + AW+KWSNDGTE+QVAKLMEE+VGAAMQFLQSKALCIMPI
Sbjct  243  ADVPLSAVEGDQDIEGVSNEQAWDKWSNDGTEQQVAKLMEEDVGAAMQFLQSKALCIMPI  302

Query  508  SLASAIYHSQAPDTTPLVKPETN  440
            SLAS+I+     + +  +KPE+N
Sbjct  303  SLASSIFCMPQSEASTGIKPESN  325



>ref|XP_004955662.1| PREDICTED: transcription factor UNE12-like [Setaria italica]
Length=289

 Score =   208 bits (530),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 124/157 (79%), Gaps = 3/157 (2%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER+RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLS
Sbjct  133  GQATDPHSIAERL-RRERIAERMRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLS  191

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP+S+  E   S++G TQ  WEKWS DGTE+QVAKLMEE++GAA
Sbjct  192  MSRLGGAGAVAQLVADIPLSVKGE--ASDSGSTQHIWEKWSTDGTEKQVAKLMEEDIGAA  249

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            MQFLQSKALC+MPISLA AIY +Q P     +KPE N
Sbjct  250  MQFLQSKALCMMPISLAMAIYDTQNPQDGHSLKPEPN  286



>gb|KFK42664.1| hypothetical protein AALP_AA1G023700 [Arabis alpina]
Length=305

 Score =   208 bits (530),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 117/136 (86%), Gaps = 9/136 (7%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPI-SLVEE  659
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTD+P+ S +E+
Sbjct  176  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDMPLSSSIED  235

Query  658  EGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
            E       +Q  WEKWSNDGTERQVAKLMEENVGAAMQ LQSKALCIMPISLA AIYHSQ
Sbjct  236  E-------SQAVWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCIMPISLAMAIYHSQ  288

Query  478  APDT-TPLVKPETNPP  434
             PDT + ++KPE NPP
Sbjct  289  PPDTSSSIIKPEMNPP  304



>ref|XP_009144630.1| PREDICTED: transcription factor UNE12-like, partial [Brassica 
rapa]
Length=290

 Score =   207 bits (528),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 117/136 (86%), Gaps = 2/136 (1%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKV SMSRLGGAGAVAPLVTD+P+    E+
Sbjct  153  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVWSMSRLGGAGAVAPLVTDMPLPSSVED  212

Query  655  GGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
             GSE GRT Q AWEK SNDGTERQVAKLME+NV AAMQ LQSK LC+MPISLA AIYHSQ
Sbjct  213  EGSEGGRTPQAAWEKGSNDGTERQVAKLMEKNVWAAMQLLQSKTLCMMPISLAMAIYHSQ  272

Query  478  APDT-TPLVKPETNPP  434
             PDT + +VKPETNPP
Sbjct  273  PPDTSSSVVKPETNPP  288



>ref|XP_009418926.1| PREDICTED: transcription factor UNE12-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=299

 Score =   208 bits (529),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 118/146 (81%), Gaps = 2/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER+RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  156  RRERIAERLRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGAGAVAQLV  215

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DIP+S+  E   SE G TQ  WEKWS DGTERQVAKLMEE++GAAMQFLQSK+LC+MPI
Sbjct  216  ADIPVSVEGET--SEGGSTQHIWEKWSTDGTERQVAKLMEEDIGAAMQFLQSKSLCMMPI  273

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA AI  +     +  VKPE N PS
Sbjct  274  SLAMAILDTHHQSESKTVKPEPNTPS  299



>ref|XP_009418925.1| PREDICTED: transcription factor UNE12-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=318

 Score =   208 bits (530),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 118/146 (81%), Gaps = 2/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER+RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  175  RRERIAERLRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGAGAVAQLV  234

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DIP+S+  E   SE G TQ  WEKWS DGTERQVAKLMEE++GAAMQFLQSK+LC+MPI
Sbjct  235  ADIPVSVEGET--SEGGSTQHIWEKWSTDGTERQVAKLMEEDIGAAMQFLQSKSLCMMPI  292

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA AI  +     +  VKPE N PS
Sbjct  293  SLAMAILDTHHQSESKTVKPEPNTPS  318



>ref|XP_010457313.1| PREDICTED: transcription factor bHLH7-like [Camelina sativa]
Length=310

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 117/136 (86%), Gaps = 9/136 (7%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPI-SLVEE  659
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVT++P+ S +E+
Sbjct  181  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTEMPLSSSIED  240

Query  658  EGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
            E       TQ  WEKWSNDGTERQVAKLMEENVGAAMQ LQSKALCIMPISLA AIYHSQ
Sbjct  241  E-------TQAVWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCIMPISLAMAIYHSQ  293

Query  478  APDT-TPLVKPETNPP  434
             PDT + +VKPE NPP
Sbjct  294  PPDTSSSIVKPEMNPP  309



>ref|XP_004981425.1| PREDICTED: transcription factor UNE12-like [Setaria italica]
Length=283

 Score =   207 bits (527),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 124/160 (78%), Gaps = 3/160 (2%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER+RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLS
Sbjct  127  GQATDPHSIAERL-RRERIAERMRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLS  185

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP+S+  E   S++G  Q  WEKWS DGTE+QVAKLMEE++GAA
Sbjct  186  MSRLGGAGAVAQLVADIPLSVKGE--ASDSGSKQQIWEKWSTDGTEKQVAKLMEEDIGAA  243

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            MQFLQSKALC+MPISLA AIY +Q       VKPE N PS
Sbjct  244  MQFLQSKALCMMPISLAMAIYDTQHSQDGQPVKPEPNTPS  283



>ref|XP_002461549.1| hypothetical protein SORBIDRAFT_02g004570 [Sorghum bicolor]
 gb|EER98070.1| hypothetical protein SORBIDRAFT_02g004570 [Sorghum bicolor]
Length=277

 Score =   207 bits (526),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 126/160 (79%), Gaps = 8/160 (5%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER+RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLS
Sbjct  120  GQATDPHSIAERL-RRERIAERMRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLS  178

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP+S+  E   S++G TQ  WEKWS DGTE+QVAKLMEE++GAA
Sbjct  179  MSRLGGAGAVAQLVADIPLSVKGE--ASDSGSTQHIWEKWSTDGTEKQVAKLMEEDIGAA  236

Query  550  MQFLQSKALCIMPISLASAIY---HSQAPDTTPLVKPETN  440
            MQFLQSKALC+MPISLA AIY   HSQ  D   L+KPE N
Sbjct  237  MQFLQSKALCMMPISLAMAIYDTQHSQ--DGHSLMKPEPN  274



>ref|XP_010474907.1| PREDICTED: transcription factor bHLH7-like [Camelina sativa]
Length=313

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 117/136 (86%), Gaps = 9/136 (7%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPI-SLVEE  659
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVT++P+ S +E+
Sbjct  184  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTEMPLSSSIED  243

Query  658  EGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
            E       TQ  WEKWSNDGTERQVAKLMEENVGAAMQ LQSKALCIMPISLA AIYHSQ
Sbjct  244  E-------TQAVWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCIMPISLAMAIYHSQ  296

Query  478  APDT-TPLVKPETNPP  434
             PDT + +VKPE NPP
Sbjct  297  PPDTSSSIVKPEMNPP  312



>ref|NP_001059050.1| Os07g0182200 [Oryza sativa Japonica Group]
 ref|XP_006657507.1| PREDICTED: transcription factor UNE12-like [Oryza brachyantha]
 dbj|BAF20964.1| Os07g0182200 [Oryza sativa Japonica Group]
 dbj|BAG90055.1| unnamed protein product [Oryza sativa Japonica Group]
Length=136

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 112/138 (81%), Gaps = 2/138 (1%)
 Frame = -1

Query  844  IRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLV  665
            +RALQDLVP+ NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVA LV DIPIS+ 
Sbjct  1    MRALQDLVPNTNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGAGAVAQLVADIPISVK  60

Query  664  EEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYH  485
             E   S++G  Q  WEKWS DGTE+QVAKLMEE++GAAMQFLQSKALC+MPISLA AIY 
Sbjct  61   GE--ASDSGSKQQIWEKWSTDGTEKQVAKLMEEDIGAAMQFLQSKALCMMPISLAMAIYD  118

Query  484  SQAPDTTPLVKPETNPPS  431
            +Q       VKPE N PS
Sbjct  119  TQHSQDGHSVKPEPNTPS  136



>gb|EPS57409.1| hypothetical protein M569_17409, partial [Genlisea aurea]
Length=286

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 125/169 (74%), Gaps = 19/169 (11%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAE+IRALQ+LVP+VNKTDR  MLDEIVDYVKFLRLQVKVLS
Sbjct  126  GQATDPHSIAERLRR-ERIAEKIRALQELVPTVNKTDRAAMLDEIVDYVKFLRLQVKVLS  184

Query  730  MSRLGGAGAVAPLVTDIPISLVEE--EGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVG  557
            MSRLGGAGAVAPLVTDIPIS      EGG        AWEKWS+DGTERQVAKLMEENVG
Sbjct  185  MSRLGGAGAVAPLVTDIPISSSSSSIEGG--------AWEKWSSDGTERQVAKLMEENVG  236

Query  556  AAMQFLQSKALCIMPISLASAIYHSQAP--------DTTPLVKPETNPP  434
            AAMQ LQSKALCIMP+SLASAIYH             ++ +  PE NPP
Sbjct  237  AAMQLLQSKALCIMPVSLASAIYHHHHHAHPPPPPESSSSITNPEFNPP  285



>ref|XP_009119583.1| PREDICTED: transcription factor bHLH7 [Brassica rapa]
 emb|CDX89919.1| BnaA10g01630D [Brassica napus]
Length=311

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 115/135 (85%), Gaps = 7/135 (5%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVT++P+S   E+
Sbjct  182  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTEMPLSSSTED  241

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
                   TQ  WEKWS+DGTERQVAKLMEENVGAAMQ LQSKALCIMP+SLA AIYHSQ 
Sbjct  242  ------ETQAVWEKWSDDGTERQVAKLMEENVGAAMQLLQSKALCIMPVSLAMAIYHSQP  295

Query  475  PDT-TPLVKPETNPP  434
            PDT + +VKPE NPP
Sbjct  296  PDTSSSVVKPEMNPP  310



>gb|EMT27472.1| Transcription factor UNE12 [Aegilops tauschii]
Length=219

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER+RALQ+LVP+ NKTDR VMLDEI+DYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  76   RRERIAERMRALQELVPNTNKTDRAVMLDEILDYVKFLRLQVKVLSMSRLGGAGAVAQLV  135

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
            +DIP+S+  E   S+ G  Q  WEKWS DGTE+QVAKLM+E++GAAMQFLQSKALC+MP+
Sbjct  136  SDIPLSVKGE--ASDGGSKQQIWEKWSTDGTEKQVAKLMDEDIGAAMQFLQSKALCMMPV  193

Query  508  SLASAIYHSQAPDTTPLVKPETN  440
            SLA AIY +Q       VKPE N
Sbjct  194  SLAMAIYDTQHSQDGQPVKPEPN  216



>ref|XP_009418924.1| PREDICTED: transcription factor UNE12-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=328

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 118/146 (81%), Gaps = 2/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER+RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  185  RRERIAERLRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGAGAVAQLV  244

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DIP+S+  E   SE G TQ  WEKWS DGTERQVAKLMEE++GAAMQFLQSK+LC+MPI
Sbjct  245  ADIPVSVEGET--SEGGSTQHIWEKWSTDGTERQVAKLMEEDIGAAMQFLQSKSLCMMPI  302

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA AI  +     +  VKPE N PS
Sbjct  303  SLAMAILDTHHQSESKTVKPEPNTPS  328



>ref|XP_010936103.1| PREDICTED: transcription factor UNE12 isoform X2 [Elaeis guineensis]
Length=276

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 121/157 (77%), Gaps = 3/157 (2%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER+RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLS
Sbjct  120  GQATDPHSIAERL-RRERIAERMRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLS  178

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP+ +  E   SE+GR Q  WEKWS DGTERQVAKLMEE++GAA
Sbjct  179  MSRLGGAGAVAQLVADIPLPVEGE--ASESGRKQQVWEKWSTDGTERQVAKLMEEDIGAA  236

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            MQFLQSKALC+MPISLA AIY +        VKPE N
Sbjct  237  MQFLQSKALCMMPISLAMAIYDTHNQPEGHTVKPEPN  273



>emb|CDY18143.1| BnaC05g01660D [Brassica napus]
Length=306

 Score =   206 bits (524),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 115/135 (85%), Gaps = 7/135 (5%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVT++P+S   E+
Sbjct  177  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTEMPLSSSTED  236

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
                   TQ  WEKWS+DGTERQVAKLMEENVGAAMQ LQSKALCIMP+SLA AIYHSQ 
Sbjct  237  ------ETQAVWEKWSDDGTERQVAKLMEENVGAAMQLLQSKALCIMPVSLAMAIYHSQP  290

Query  475  PDT-TPLVKPETNPP  434
            PDT + +VKPE NPP
Sbjct  291  PDTSSSVVKPEMNPP  305



>ref|XP_010481495.1| PREDICTED: transcription factor bHLH7-like [Camelina sativa]
Length=311

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 117/136 (86%), Gaps = 9/136 (7%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPI-SLVEE  659
            LQ+LVP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVT++P+ S +E+
Sbjct  182  LQELVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTEMPLSSSIED  241

Query  658  EGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
            E       TQ  WEKWSNDGTERQVAKLMEENVGAAMQ LQSKALCI+PISLA AIYHSQ
Sbjct  242  E-------TQAVWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCIIPISLAMAIYHSQ  294

Query  478  APDT-TPLVKPETNPP  434
             PDT + +VKPE NPP
Sbjct  295  PPDTSSSIVKPEMNPP  310



>ref|XP_011038575.1| PREDICTED: transcription factor UNE12-like [Populus euphratica]
Length=332

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 1/143 (1%)
 Frame = -1

Query  859  RIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDI  680
            RI ER++ALQ+LVP+ NKTDR  MLDEIVDYVKFLRLQ+KVLSMSRLG AGAVA LV D+
Sbjct  191  RITERVKALQELVPTCNKTDRAAMLDEIVDYVKFLRLQIKVLSMSRLGAAGAVAQLVADV  250

Query  679  PISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLA  500
            P+S V+ E G+E G  Q +WE WSND TE++VAKLMEE+VGAAMQFLQSKALCIMPISLA
Sbjct  251  PLSSVQGE-GNEGGANQQSWENWSNDDTEQEVAKLMEEDVGAAMQFLQSKALCIMPISLA  309

Query  499  SAIYHSQAPDTTPLVKPETNPPS  431
            SAI+ ++ P+ + L+  E+N PS
Sbjct  310  SAIFRARPPNASTLINTESNTPS  332



>gb|EEE60096.1| hypothetical protein OsJ_12958 [Oryza sativa Japonica Group]
Length=294

 Score =   205 bits (522),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 123/160 (77%), Gaps = 3/160 (2%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER+RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLS
Sbjct  138  GQATDPHSIAERLRR-ERIAERMRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLS  196

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP+S+  E   S++G  Q  WEKWS DGTERQVAKLMEE++GAA
Sbjct  197  MSRLGGAGAVAQLVADIPLSVKGE--ASDSGGNQQIWEKWSTDGTERQVAKLMEEDIGAA  254

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            MQFLQSKALC+MPISLA AIY +Q       VK E N PS
Sbjct  255  MQFLQSKALCMMPISLAMAIYDTQQTQDGQPVKHEPNTPS  294



>ref|XP_011076653.1| PREDICTED: transcription factor UNE12-like [Sesamum indicum]
Length=304

 Score =   206 bits (523),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 124/160 (78%), Gaps = 3/160 (2%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERI+ERI+ALQ+LVPS NKTDR  MLDEI+DYVKFLRLQVKVLS
Sbjct  148  GQATDPHSIAERL-RRERISERIKALQELVPSCNKTDRAAMLDEILDYVKFLRLQVKVLS  206

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP+  VE+E G  +   Q  WEKWSN+ TER+VAKLMEE+VGAA
Sbjct  207  MSRLGGAGAVAQLVADIPLQAVEDETGEIS--NQHVWEKWSNEETEREVAKLMEEDVGAA  264

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            MQ+LQSK+LCIMPISLAS IY S   D + LVKPE   PS
Sbjct  265  MQYLQSKSLCIMPISLASLIYPSNQSDDSTLVKPEPPAPS  304



>ref|NP_001051563.1| Os03g0797600 [Oryza sativa Japonica Group]
 gb|AAP44685.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99356.1| Lipoamide dehydrogenase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13477.1| Os03g0797600 [Oryza sativa Japonica Group]
 dbj|BAG96659.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76334.1| hypothetical protein OsI_13903 [Oryza sativa Indica Group]
Length=294

 Score =   205 bits (522),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 123/160 (77%), Gaps = 3/160 (2%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER+RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLS
Sbjct  138  GQATDPHSIAERL-RRERIAERMRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLS  196

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP+S+  E   S++G  Q  WEKWS DGTERQVAKLMEE++GAA
Sbjct  197  MSRLGGAGAVAQLVADIPLSVKGE--ASDSGGNQQIWEKWSTDGTERQVAKLMEEDIGAA  254

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            MQFLQSKALC+MPISLA AIY +Q       VK E N PS
Sbjct  255  MQFLQSKALCMMPISLAMAIYDTQQTQDGQPVKHEPNTPS  294



>gb|KHG28438.1| Transcription factor UNE12 -like protein [Gossypium arboreum]
Length=353

 Score =   207 bits (526),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 124/173 (72%), Gaps = 29/173 (17%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNK---------------------------TDRTVMLDEIVD  770
            R ERIAER++ALQ+LVPS NK                           TDR  MLDEIVD
Sbjct  183  RRERIAERMKALQELVPSCNKVPPFSSSAWYMKSETDLLADALLNILQTDRAAMLDEIVD  242

Query  769  YVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTER  590
            YVKFLRLQVKVLSMSRLG AGAVA LV D+P+  VE +G    G TQPAWEKWSNDGTE+
Sbjct  243  YVKFLRLQVKVLSMSRLGAAGAVAQLVADVPLLSVEGDGA--GGGTQPAWEKWSNDGTEQ  300

Query  589  QVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QVAKLMEE++GAAMQFLQSKALCI+PISLASAI+ +  PD   +VKPE+N PS
Sbjct  301  QVAKLMEEDIGAAMQFLQSKALCIVPISLASAIFPAHQPDAPTIVKPESNTPS  353



>ref|XP_010228376.1| PREDICTED: transcription factor UNE12-like isoform X2 [Brachypodium 
distachyon]
Length=282

 Score =   204 bits (520),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 122/157 (78%), Gaps = 3/157 (2%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER+RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLS
Sbjct  126  GQATDPHSIAERL-RRERIAERMRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLS  184

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP+S+  E   S++G  Q  WEKWS DGTERQVAKLM+E++GAA
Sbjct  185  MSRLGGAGAVAQLVADIPLSVKGE--ASDSGSNQQIWEKWSTDGTERQVAKLMDEDIGAA  242

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            MQFLQSKALC+MPISLA AIY +Q       VKPE N
Sbjct  243  MQFLQSKALCMMPISLAMAIYDTQHSQDGQPVKPEPN  279



>ref|XP_010936096.1| PREDICTED: transcription factor UNE12 isoform X1 [Elaeis guineensis]
Length=310

 Score =   205 bits (522),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 116/143 (81%), Gaps = 2/143 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER+RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  167  RRERIAERMRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGAGAVAQLV  226

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DIP+ +  E   SE+GR Q  WEKWS DGTERQVAKLMEE++GAAMQFLQSKALC+MPI
Sbjct  227  ADIPLPVEGE--ASESGRKQQVWEKWSTDGTERQVAKLMEEDIGAAMQFLQSKALCMMPI  284

Query  508  SLASAIYHSQAPDTTPLVKPETN  440
            SLA AIY +        VKPE N
Sbjct  285  SLAMAIYDTHNQPEGHTVKPEPN  307



>gb|ACG44301.1| BHLH transcription factor [Zea mays]
Length=136

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 113/138 (82%), Gaps = 2/138 (1%)
 Frame = -1

Query  844  IRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLV  665
            +RALQ+LVP+ NKTDR VMLDEI+DYVKFLRLQVKVLSMSRLGGAGAVA LV DIP+S+ 
Sbjct  1    MRALQELVPNTNKTDRAVMLDEILDYVKFLRLQVKVLSMSRLGGAGAVAQLVADIPLSVK  60

Query  664  EEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYH  485
             E   S++G  Q  WEKWS DGTERQ+AKLMEE++GAAMQFLQSKALC+MPISLA AIY 
Sbjct  61   GE--ASDSGSKQQIWEKWSTDGTERQIAKLMEEDIGAAMQFLQSKALCMMPISLAMAIYD  118

Query  484  SQAPDTTPLVKPETNPPS  431
            +Q       VKPE N PS
Sbjct  119  TQHSQDGQPVKPEPNTPS  136



>ref|XP_010923486.1| PREDICTED: transcription factor UNE12-like isoform X2 [Elaeis 
guineensis]
Length=311

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 121/157 (77%), Gaps = 3/157 (2%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER+RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLS
Sbjct  155  GQATDPHSIAERL-RRERIAERMRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLS  213

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP+S+  E   SE+G  Q  WEKWS DGTERQVAKLMEE++GAA
Sbjct  214  MSRLGGAGAVAQLVADIPLSVEGE--ASESGSKQQVWEKWSTDGTERQVAKLMEEDIGAA  271

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            MQFLQSKALC+MPISLA AIY +        VKPE N
Sbjct  272  MQFLQSKALCMMPISLAMAIYDTHHQPEGHTVKPEPN  308



>ref|XP_010923485.1| PREDICTED: transcription factor UNE12-like isoform X1 [Elaeis 
guineensis]
Length=322

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 116/143 (81%), Gaps = 2/143 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER+RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  179  RRERIAERMRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGAGAVAQLV  238

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DIP+S+  E   SE+G  Q  WEKWS DGTERQVAKLMEE++GAAMQFLQSKALC+MPI
Sbjct  239  ADIPLSVEGE--ASESGSKQQVWEKWSTDGTERQVAKLMEEDIGAAMQFLQSKALCMMPI  296

Query  508  SLASAIYHSQAPDTTPLVKPETN  440
            SLA AIY +        VKPE N
Sbjct  297  SLAMAIYDTHHQPEGHTVKPEPN  319



>gb|ABB16991.1| unknown [Solanum tuberosum]
Length=304

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 118/146 (81%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERI+ERI+ALQ+LVPS NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGA AVA LV
Sbjct  160  RRERISERIKALQELVPSCNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGASAVAQLV  219

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DIP+  VE + G E+   Q  W+KWSN  TER+VAKLMEE+VGAAMQ+LQSK+LCIMPI
Sbjct  220  ADIPLQSVEGDSG-ESRSNQHIWDKWSNVDTEREVAKLMEEDVGAAMQYLQSKSLCIMPI  278

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA+ IY +Q PD   LVKPE   PS
Sbjct  279  SLAALIYPTQLPDDQSLVKPEAAAPS  304



>ref|XP_003561348.1| PREDICTED: transcription factor UNE12-like isoform X1 [Brachypodium 
distachyon]
Length=288

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 116/143 (81%), Gaps = 1/143 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER+RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVA L+
Sbjct  144  RRERIAERMRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGAGAVAQLI  203

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DIP+S+  EE     G+ Q  WEKWS DGTE+QVAKLMEE++GAAMQFLQSKALC+MPI
Sbjct  204  ADIPLSVKGEEASDSGGKQQ-IWEKWSTDGTEKQVAKLMEEDIGAAMQFLQSKALCMMPI  262

Query  508  SLASAIYHSQAPDTTPLVKPETN  440
            SLA AIY +Q       +KPE N
Sbjct  263  SLAMAIYDTQHLQDGHSMKPEPN  285



>ref|XP_010556765.1| PREDICTED: transcription factor UNE12 [Tarenaya hassleriana]
Length=313

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 118/139 (85%), Gaps = 6/139 (4%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISL---V  665
            L ++VP+VNKTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTD+P+ L   V
Sbjct  175  LHEIVPTVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDMPLPLSSSV  234

Query  664  EEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYH  485
            E+E G E GRT+PAWEK S DGTE QVAKLMEENVGAAMQFLQSK+LCIMPISLA A+ H
Sbjct  235  EDE-GIEGGRTEPAWEKLSKDGTEGQVAKLMEENVGAAMQFLQSKSLCIMPISLAMAVCH  293

Query  484  SQA--PDTTPLVKPETNPP  434
            SQ+   DT+  VKPE NPP
Sbjct  294  SQSQPSDTSSGVKPEMNPP  312



>gb|ADX60279.1| bHLH transcription factor [Oryza sativa Japonica Group]
Length=294

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 123/160 (77%), Gaps = 3/160 (2%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER+RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLS
Sbjct  138  GQATDPHSIAERL-RRERIAERMRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLS  196

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            +SRLGGAGAVA LV DIP+S+  E   S++G  Q  WEKWS DGTERQVAKLMEE++GAA
Sbjct  197  ISRLGGAGAVAQLVADIPLSVKGE--ASDSGGNQQIWEKWSTDGTERQVAKLMEEDIGAA  254

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            MQFLQSKALC+MPISLA AIY +Q       VK E N PS
Sbjct  255  MQFLQSKALCMMPISLAMAIYDTQQTQDGQPVKHEPNTPS  294



>ref|XP_004247636.1| PREDICTED: transcription factor UNE12-like [Solanum lycopersicum]
Length=304

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 118/146 (81%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERI+ERI+ALQ+LVPS NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGA AVA LV
Sbjct  160  RRERISERIKALQELVPSCNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGASAVAQLV  219

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DIP+  VE + G E+   Q  W+KWSN  TER+VAKLMEE+VGAAMQ+LQSK+LCIMPI
Sbjct  220  ADIPLQSVEGDSG-ESRSNQHIWDKWSNVDTEREVAKLMEEDVGAAMQYLQSKSLCIMPI  278

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA+ IY +Q PD   LVKPE   PS
Sbjct  279  SLAALIYPTQQPDDQSLVKPEAAAPS  304



>ref|XP_008786085.1| PREDICTED: transcription factor UNE12-like isoform X2 [Phoenix 
dactylifera]
Length=310

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 121/160 (76%), Gaps = 3/160 (2%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER+R LQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLS
Sbjct  154  GQATDPHSIAERL-RRERIAERMRTLQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLS  212

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP+S+  E   SE+G  Q  WEKWS DGTERQVAKLMEE++GAA
Sbjct  213  MSRLGGAGAVAQLVADIPLSVEGE--ASESGSNQQVWEKWSTDGTERQVAKLMEEDIGAA  270

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            MQ LQSKALC+MPISLA AIY +        VKPE N PS
Sbjct  271  MQLLQSKALCMMPISLAMAIYDTHDQPEGHAVKPEPNTPS  310



>ref|XP_010553329.1| PREDICTED: transcription factor bHLH7-like [Tarenaya hassleriana]
Length=332

 Score =   204 bits (518),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 127/163 (78%), Gaps = 8/163 (5%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTDR  MLD+IVDYVKFLRLQVKVLS
Sbjct  173  GQATDPHSIAERL-RRERIAERMKALQELVPTCNKTDRAAMLDDIVDYVKFLRLQVKVLS  231

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLG  GAVA LV D+P+  VE   G + G ++PAWE+WSNDGTE QVAKLMEE+VGAA
Sbjct  232  MSRLGATGAVAQLVADVPLPSVE---GDDGGTSEPAWERWSNDGTEEQVAKLMEEDVGAA  288

Query  550  MQFLQSKALCIMPISLASAIY--HSQ-APDTTPLV-KPETNPP  434
            MQFLQSKALCIMP+SLASAI+  H Q + D  P++ KPE N P
Sbjct  289  MQFLQSKALCIMPVSLASAIFSTHPQPSSDQPPMIPKPEMNNP  331



>ref|XP_008786084.1| PREDICTED: transcription factor UNE12-like isoform X1 [Phoenix 
dactylifera]
Length=321

 Score =   203 bits (517),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 121/160 (76%), Gaps = 3/160 (2%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER+R LQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLS
Sbjct  165  GQATDPHSIAERL-RRERIAERMRTLQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLS  223

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVA LV DIP+S+  E   SE+G  Q  WEKWS DGTERQVAKLMEE++GAA
Sbjct  224  MSRLGGAGAVAQLVADIPLSVEGE--ASESGSNQQVWEKWSTDGTERQVAKLMEEDIGAA  281

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            MQ LQSKALC+MPISLA AIY +        VKPE N PS
Sbjct  282  MQLLQSKALCMMPISLAMAIYDTHDQPEGHAVKPEPNTPS  321



>ref|NP_001274947.1| uncharacterized LOC102577469 [Solanum tuberosum]
 gb|AFW90609.1| basic helix-loop-helix protein BHLH3 [Solanum tuberosum]
Length=303

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 118/146 (81%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERI+ERI+ALQ+LVPS NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGA AVA LV
Sbjct  159  RRERISERIKALQELVPSCNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGASAVAQLV  218

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DIP+  VE + G E+   Q  W+KWSN  TE++VAKLMEE+VGAAMQ+LQSK+LCIMPI
Sbjct  219  ADIPLQSVEGDSG-ESRSNQRIWDKWSNVDTEQEVAKLMEEDVGAAMQYLQSKSLCIMPI  277

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA+ IY +Q PD   LVKPE   PS
Sbjct  278  SLAALIYPTQQPDDQLLVKPEAAAPS  303



>ref|XP_010228286.1| PREDICTED: transcription factor UNE12-like isoform X2 [Brachypodium 
distachyon]
Length=286

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER+RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVA L+
Sbjct  144  RRERIAERMRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGAGAVAQLI  203

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DIP+S    E  S++G  Q  WEKWS DGTE+QVAKLMEE++GAAMQFLQSKALC+MPI
Sbjct  204  ADIPLS---GEEASDSGGKQQIWEKWSTDGTEKQVAKLMEEDIGAAMQFLQSKALCMMPI  260

Query  508  SLASAIYHSQAPDTTPLVKPETN  440
            SLA AIY +Q       +KPE N
Sbjct  261  SLAMAIYDTQHLQDGHSMKPEPN  283



>ref|XP_006650733.1| PREDICTED: transcription factor UNE12-like [Oryza brachyantha]
Length=136

 Score =   194 bits (494),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 111/138 (80%), Gaps = 2/138 (1%)
 Frame = -1

Query  844  IRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLV  665
            +RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVA LV DIP+S+ 
Sbjct  1    MRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGAGAVAQLVADIPLSVK  60

Query  664  EEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYH  485
             E   S++G  Q  WEKWS DGTERQVAKLMEE++GAAMQFLQSKALC+MPISLA AIY 
Sbjct  61   GE--ASDSGGDQQIWEKWSTDGTERQVAKLMEEDIGAAMQFLQSKALCMMPISLAMAIYD  118

Query  484  SQAPDTTPLVKPETNPPS  431
            +Q       VK E N PS
Sbjct  119  TQHTQDGQPVKHEPNTPS  136



>ref|XP_010457311.1| PREDICTED: transcription factor bHLH7 [Camelina sativa]
Length=122

 Score =   194 bits (492),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 108/127 (85%), Gaps = 9/127 (7%)
 Frame = -1

Query  808  KTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISL-VEEEGGSEAGRT  632
            +TDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVT++P+S  +E+E       T
Sbjct  2    QTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTEMPLSSSIEDE-------T  54

Query  631  QPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDT-TPLV  455
            Q  WEKWSNDGTERQVAKLMEENVGAAMQ LQSKALCIMPISLA AIYHSQ PDT + +V
Sbjct  55   QAVWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCIMPISLAMAIYHSQPPDTSSSIV  114

Query  454  KPETNPP  434
            KPE NPP
Sbjct  115  KPEMNPP  121



>ref|XP_006418274.1| hypothetical protein EUTSA_v10008279mg [Eutrema salsugineum]
 dbj|BAJ34239.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36627.1| hypothetical protein EUTSA_v10008279mg [Eutrema salsugineum]
Length=308

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 121/152 (80%), Gaps = 18/152 (12%)
 Frame = -1

Query  856  IAERIRA---------LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGA  704
            IAER+R          LQ+LVP+V+KTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGA
Sbjct  163  IAERLRRERIAERIRALQELVPTVSKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGA  222

Query  703  VAPLVTDIPI-SLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKA  527
            VAPLVT++P+ S +E+E       TQ  WEKWSNDGTE QVAKLMEENVGAAMQ LQSKA
Sbjct  223  VAPLVTEMPLSSSIEDE-------TQGVWEKWSNDGTELQVAKLMEENVGAAMQLLQSKA  275

Query  526  LCIMPISLASAIYHSQAPDT-TPLVKPETNPP  434
            LCIMPISLA AIYHSQ  DT + ++KPE NPP
Sbjct  276  LCIMPISLAMAIYHSQPQDTSSSIIKPEMNPP  307



>ref|XP_006418273.1| hypothetical protein EUTSA_v10008279mg [Eutrema salsugineum]
 gb|ESQ36626.1| hypothetical protein EUTSA_v10008279mg [Eutrema salsugineum]
Length=303

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 115/136 (85%), Gaps = 9/136 (7%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPI-SLVEE  659
            LQ+LVP+V+KTDR  M+DEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVT++P+ S +E+
Sbjct  174  LQELVPTVSKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTEMPLSSSIED  233

Query  658  EGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQ  479
            E       TQ  WEKWSNDGTE QVAKLMEENVGAAMQ LQSKALCIMPISLA AIYHSQ
Sbjct  234  E-------TQGVWEKWSNDGTELQVAKLMEENVGAAMQLLQSKALCIMPISLAMAIYHSQ  286

Query  478  APDT-TPLVKPETNPP  434
              DT + ++KPE NPP
Sbjct  287  PQDTSSSIIKPEMNPP  302



>gb|ACF82186.1| unknown [Zea mays]
 tpg|DAA59786.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=193

 Score =   194 bits (494),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 119/153 (78%), Gaps = 8/153 (5%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER+RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  42   RRERIAERMRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGAGAVAQLV  101

Query  688  TDIPISLVEEEGGSEAG-----RTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKAL  524
             DIP+S V+ E G   G     + Q  WEKWS DGTE+QVAKLMEE++GAAMQFLQSKAL
Sbjct  102  ADIPLS-VKGEAGDGGGAPQQQQQQHVWEKWSTDGTEKQVAKLMEEDIGAAMQFLQSKAL  160

Query  523  CIMPISLASAIYHSQAP--DTTPLVKPETNPPS  431
            C+MP+SLA AIY +Q P       +KPE N  S
Sbjct  161  CMMPVSLAMAIYDTQHPLDGHGHSLKPEPNASS  193



>ref|XP_009762993.1| PREDICTED: transcription factor UNE12-like [Nicotiana sylvestris]
Length=339

 Score =   199 bits (506),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 118/146 (81%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERI+ERI+ALQ+LVPS NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGA AVA LV
Sbjct  195  RRERISERIKALQELVPSCNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGASAVAQLV  254

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DIP+  VE +  +E+   Q  WEKWSN  TE++VAKLMEE+VGAAMQ+LQSK+LCIMPI
Sbjct  255  ADIPLQSVEGD-SAESRSNQHIWEKWSNVDTEQEVAKLMEEDVGAAMQYLQSKSLCIMPI  313

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA+ IY +Q PD   +VKPE   PS
Sbjct  314  SLAALIYPTQQPDDLSMVKPEPAAPS  339



>emb|CDP20692.1| unnamed protein product [Coffea canephora]
Length=304

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 117/146 (80%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERI+ERI+ALQ+LVPS NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVA LV
Sbjct  160  RRERISERIKALQELVPSCNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGAGAVAQLV  219

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DIP+  VE + G E    Q  WEKWSN+ TER+VAKLMEE+VGAAMQ+LQSK+LCIMPI
Sbjct  220  ADIPLQTVEGDTG-ENITNQQVWEKWSNEETEREVAKLMEEDVGAAMQYLQSKSLCIMPI  278

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA+ IY +   +   LVKPE   PS
Sbjct  279  SLAALIYPTLQSEEPALVKPEPPAPS  304



>ref|NP_001140213.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|ACF83346.1| unknown [Zea mays]
 gb|ACG37964.1| BHLH transcription factor [Zea mays]
 tpg|DAA59787.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05977.1| bHLH transcription factor, partial [synthetic construct]
Length=285

 Score =   195 bits (495),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 122/164 (74%), Gaps = 9/164 (5%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER+RALQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLS
Sbjct  121  GQATDPHSIAERL-RRERIAERMRALQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLS  179

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPA-----WEKWSNDGTERQVAKLMEE  566
            MSRLGGAGAVA LV DIP+S V+ E G   G  Q       WEKWS DGTE+QVAKLMEE
Sbjct  180  MSRLGGAGAVAQLVADIPLS-VKGEAGDGGGAPQQQQQQHVWEKWSTDGTEKQVAKLMEE  238

Query  565  NVGAAMQFLQSKALCIMPISLASAIYHSQAP--DTTPLVKPETN  440
            ++GAAMQFLQSKALC+MP+SLA AIY +Q P       +KPE N
Sbjct  239  DIGAAMQFLQSKALCMMPVSLAMAIYDTQHPLDGHGHSLKPEPN  282



>ref|XP_009398564.1| PREDICTED: transcription factor UNE12-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=300

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 111/135 (82%), Gaps = 6/135 (4%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVA L+ DIP+S+   E
Sbjct  172  LQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGAGAVAQLIADIPLSV---E  228

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
            G  EAG  Q  WEKWS DGTERQVAKLMEE++GAAMQFLQSKALC+MPISLA AIY +  
Sbjct  229  G--EAGSKQQVWEKWSTDGTERQVAKLMEEDIGAAMQFLQSKALCMMPISLAMAIYDTHQ  286

Query  475  PDTTPLVKPETNPPS  431
            P+  P VKPE N PS
Sbjct  287  PEAQP-VKPEPNTPS  300



>ref|XP_009612697.1| PREDICTED: transcription factor UNE12-like [Nicotiana tomentosiformis]
Length=339

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 117/146 (80%), Gaps = 1/146 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERI+ERI+ALQ+LVPS NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGA AVA LV
Sbjct  195  RRERISERIKALQELVPSCNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGASAVAQLV  254

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DIP+  VE +  +E+   Q  WEKWSN  TE++VAKLMEE+VGAAMQ+LQSK+LCIMPI
Sbjct  255  ADIPLQSVEGD-SAESRSNQHIWEKWSNVDTEQEVAKLMEEDVGAAMQYLQSKSLCIMPI  313

Query  508  SLASAIYHSQAPDTTPLVKPETNPPS  431
            SLA+ IY +Q  D   +VKPE   PS
Sbjct  314  SLAALIYPTQQLDDPSMVKPEPAAPS  339



>ref|XP_009399361.1| PREDICTED: transcription factor UNE12-like [Musa acuminata subsp. 
malaccensis]
Length=302

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 111/135 (82%), Gaps = 3/135 (2%)
 Frame = -1

Query  835  LQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEE  656
            LQ+LVP+ NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGGAGAVA L+ DIP++ VE E
Sbjct  171  LQELVPNTNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGAGAVAQLIADIPLA-VEGE  229

Query  655  GGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQA  476
             G + G  Q  WEKWS DGTERQVAKLMEE++GAAMQFLQSKALC+MPISLA AIY +  
Sbjct  230  AG-KGGTNQQVWEKWSTDGTERQVAKLMEEDIGAAMQFLQSKALCMMPISLAMAIYDAHQ  288

Query  475  PDTTPLVKPETNPPS  431
            PD  P VKPE + PS
Sbjct  289  PDAQP-VKPEPDTPS  302



>ref|XP_010553760.1| PREDICTED: transcription factor bHLH7-like isoform X2 [Tarenaya 
hassleriana]
Length=310

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 114/146 (78%), Gaps = 6/146 (4%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVP+ NKTDR  MLD+IVDYVKFLRLQVKVLS SRLG  GAVA LV
Sbjct  165  RRERIAERMKALQELVPTCNKTDRAAMLDDIVDYVKFLRLQVKVLSTSRLGATGAVAQLV  224

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
              +P+S V+   G + G ++P WEKW+ DGTE QVAKLMEE VGAAMQFLQSK LCIMPI
Sbjct  225  AGVPLSSVK---GDDGGASEPMWEKWTGDGTEEQVAKLMEEEVGAAMQFLQSKELCIMPI  281

Query  508  SLASAIY--HSQAPDTTPLV-KPETN  440
            SLAS I+  H +  D  P++ KPE N
Sbjct  282  SLASTIFNTHLRPSDQQPMIPKPEMN  307



>ref|XP_010553759.1| PREDICTED: transcription factor bHLH7-like isoform X1 [Tarenaya 
hassleriana]
Length=311

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 114/146 (78%), Gaps = 6/146 (4%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVP+ NKTDR  MLD+IVDYVKFLRLQVKVLS SRLG  GAVA LV
Sbjct  166  RRERIAERMKALQELVPTCNKTDRAAMLDDIVDYVKFLRLQVKVLSTSRLGATGAVAQLV  225

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
              +P+S V+   G + G ++P WEKW+ DGTE QVAKLMEE VGAAMQFLQSK LCIMPI
Sbjct  226  AGVPLSSVK---GDDGGASEPMWEKWTGDGTEEQVAKLMEEEVGAAMQFLQSKELCIMPI  282

Query  508  SLASAIY--HSQAPDTTPLV-KPETN  440
            SLAS I+  H +  D  P++ KPE N
Sbjct  283  SLASTIFNTHLRPSDQQPMIPKPEMN  308



>ref|XP_004234028.1| PREDICTED: transcription factor UNE12-like [Solanum lycopersicum]
 ref|XP_010317400.1| PREDICTED: transcription factor UNE12-like [Solanum lycopersicum]
Length=296

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERI+ERI+ALQ+L PS NKTDR  MLDEI+DYVKFLRLQVKVLSMSRLGG  A A +V
Sbjct  152  RRERISERIKALQELAPSCNKTDRAAMLDEILDYVKFLRLQVKVLSMSRLGGTSAAAQVV  211

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPI  509
             DIP+  VE +   E+   Q  WEKWS+  TE++VAKLMEE+VG AMQ+LQSK+LCIMPI
Sbjct  212  ADIPLQSVEGD-TCESHSNQRVWEKWSDSETEQEVAKLMEEDVGTAMQYLQSKSLCIMPI  270

Query  508  SLASAIYHSQAPDTTPLVKPETNPP  434
            SLA+ IY +Q  D   +VKPE   P
Sbjct  271  SLAALIYPTQQSDNQSMVKPEQAAP  295



>gb|AFW90608.1| beta-fructofuranosidase protein [Solanum tuberosum]
Length=298

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 121/167 (72%), Gaps = 2/167 (1%)
 Frame = -1

Query  937  IHLQFDQECGQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKF  758
            IH +     GQ  D   I   L R ERI+ERI+ALQ+LVP+ NKTDR  ++DEI+DYVKF
Sbjct  130  IHPRVRARRGQATDPHSIAERL-RRERISERIKALQELVPNCNKTDRAALVDEILDYVKF  188

Query  757  LRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAK  578
            LRLQVKVLSMSRLGG  AVA LVTDIP+  VE +   E+   Q  WEKWS+  TE++VAK
Sbjct  189  LRLQVKVLSMSRLGGTSAVAQLVTDIPLQSVEGD-SCESRSNQHVWEKWSDSETEQEVAK  247

Query  577  LMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNP  437
            LM E+VG AMQ+LQSK+LCIMP+SLA+ IY +Q  D   +VKP+  P
Sbjct  248  LMGEDVGTAMQYLQSKSLCIMPVSLAALIYPTQQTDDQSMVKPDYGP  294



>ref|XP_012092119.1| PREDICTED: transcription factor UNE12-like [Jatropha curcas]
 ref|XP_012092120.1| PREDICTED: transcription factor UNE12-like [Jatropha curcas]
Length=99

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 1/100 (1%)
 Frame = -1

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGAGAVAPLVTDIP+S VE+E G E GR QPAWEKWSNDGTERQVAKLMEENVGAA
Sbjct  1    MSRLGGAGAVAPLVTDIPLSSVEDETG-EDGRNQPAWEKWSNDGTERQVAKLMEENVGAA  59

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            MQFLQSKALCIMPISLA+AIYH+Q PDT+ +VKPETNPPS
Sbjct  60   MQFLQSKALCIMPISLATAIYHTQPPDTSTIVKPETNPPS  99



>ref|XP_002319074.2| hypothetical protein POPTR_0013s03830g [Populus trichocarpa]
 gb|EEE94997.2| hypothetical protein POPTR_0013s03830g [Populus trichocarpa]
Length=119

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  790  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKW  611
            MLDEIVDYVKFLRLQ+KVLSMSRLG AGAVA LV D+P+S ++ EG +E G  Q +WE W
Sbjct  1    MLDEIVDYVKFLRLQIKVLSMSRLGAAGAVAQLVADVPLSSIKGEG-NEGGANQQSWENW  59

Query  610  SNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            SND TE++VAKLMEE+VGAAMQFLQSKALCIMPISLASAI+ ++ P+ + L+  E+N PS
Sbjct  60   SNDDTEQEVAKLMEEDVGAAMQFLQSKALCIMPISLASAIFRARPPNASTLINTESNTPS  119



>ref|XP_009398565.1| PREDICTED: transcription factor UNE12-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=278

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 114/162 (70%), Gaps = 8/162 (5%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPS--VNKTDRTVMLDEIVDYVKFLRLQVKV  737
            GQ +   +  +  P   R   R R  Q   P     +TDR  MLDEI+DYVKFLRLQVKV
Sbjct  123  GQAKQGGVASMPQPPAPRPKVRARRGQATDPHSIAERTDRAAMLDEILDYVKFLRLQVKV  182

Query  736  LSMSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVG  557
            LSMSRLGGAGAVA L+ DIP+S+   EG  EAG  Q  WEKWS DGTERQVAKLMEE++G
Sbjct  183  LSMSRLGGAGAVAQLIADIPLSV---EG--EAGSKQQVWEKWSTDGTERQVAKLMEEDIG  237

Query  556  AAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            AAMQFLQSKALC+MPISLA AIY +  P+  P VKPE N PS
Sbjct  238  AAMQFLQSKALCMMPISLAMAIYDTHQPEAQP-VKPEPNTPS  278



>ref|XP_010274209.1| PREDICTED: transcription factor UNE12 isoform X2 [Nelumbo nucifera]
Length=298

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 111/162 (69%), Gaps = 30/162 (19%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVPS NKTDR  MLDEIVDYVKFLRLQVK   
Sbjct  165  GQATDPHSIAERL-RRERIAERMKALQELVPSSNKTDRAAMLDEIVDYVKFLRLQVKGE-  222

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
                                      GSE   +Q AWEKWSNDGTERQVAKLMEE+VGAA
Sbjct  223  --------------------------GSEGRSSQRAWEKWSNDGTERQVAKLMEEDVGAA  256

Query  550  MQFLQSKALCIMPISLASAIYHSQAPD--TTPLVKPETNPPS  431
            MQFLQSKALCIMP+SLA+AIYH+  P+  TTP+VKPE++ PS
Sbjct  257  MQFLQSKALCIMPMSLAAAIYHTHPPEAPTTPIVKPESSAPS  298



>gb|EMS63234.1| Transcription factor UNE12 [Triticum urartu]
Length=189

 Score =   173 bits (438),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 99/122 (81%), Gaps = 2/122 (2%)
 Frame = -1

Query  805  TDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQP  626
            TDR VMLDEI+DYVKFLRLQVKVLSMSRLGGAGAVA LV+DIP+S+  E   S+ G  Q 
Sbjct  67   TDRAVMLDEILDYVKFLRLQVKVLSMSRLGGAGAVAQLVSDIPLSVKGE--ASDGGSKQQ  124

Query  625  AWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPE  446
             WEKWS DGTE+QVAKLM+E++GAAMQFLQSKALC+MP+SLA AIY +Q       VKPE
Sbjct  125  IWEKWSTDGTEKQVAKLMDEDIGAAMQFLQSKALCMMPVSLAMAIYDTQHSQDGQPVKPE  184

Query  445  TN  440
             N
Sbjct  185  PN  186



>gb|KHG26252.1| Transcription factor UNE12 -like protein [Gossypium arboreum]
Length=131

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 2/105 (2%)
 Frame = -1

Query  742  KVLSMSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEEN  563
            +VL+MSRLGGA AVAP V DIP+S +E+E G E+GR+QPAWEKWSNDGT+R VAKLMEEN
Sbjct  28   QVLTMSRLGGAAAVAPFVIDIPLSSIEDERG-ESGRSQPAWEKWSNDGTDRHVAKLMEEN  86

Query  562  VGAAMQFLQSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPPS  431
            VGAAMQFLQSKALCIMPISLA AIY +Q PDT + +VKPET+P S
Sbjct  87   VGAAMQFLQSKALCIMPISLAKAIYDTQPPDTSSSIVKPETDPTS  131



>ref|XP_010041192.1| PREDICTED: transcription factor UNE12-like [Eucalyptus grandis]
 gb|KCW44559.1| hypothetical protein EUGRSUZ_L01929 [Eucalyptus grandis]
Length=99

 Score =   159 bits (402),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 89/100 (89%), Gaps = 1/100 (1%)
 Frame = -1

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLG AGAVAPLVTDIP+S VEEEGG    R QPAWEKWSNDGTERQVAKLMEENVGAA
Sbjct  1    MSRLGAAGAVAPLVTDIPLSSVEEEGGEGG-RNQPAWEKWSNDGTERQVAKLMEENVGAA  59

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            MQFLQSKALCIMPISLA+AIY +Q PDT+ LVK E+NPPS
Sbjct  60   MQFLQSKALCIMPISLATAIYQTQPPDTSSLVKSESNPPS  99



>gb|KHG20614.1| Transcription factor UNE12 -like protein [Gossypium arboreum]
Length=100

 Score =   158 bits (399),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 88/101 (87%), Gaps = 2/101 (2%)
 Frame = -1

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGA AVAP V DIP+S +E+E G E+GR+QPAWEKWSNDGT+R VAKLMEENVGAA
Sbjct  1    MSRLGGAAAVAPFVIDIPLSSIEDERG-ESGRSQPAWEKWSNDGTDRHVAKLMEENVGAA  59

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPPS  431
            MQFLQSKALCIMPISLA AIY +Q PDT + +VKPET+P S
Sbjct  60   MQFLQSKALCIMPISLAKAIYDTQPPDTSSSIVKPETDPTS  100



>ref|XP_006356051.1| PREDICTED: transcription factor UNE12-like [Solanum tuberosum]
Length=119

 Score =   157 bits (398),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 93/120 (78%), Gaps = 1/120 (1%)
 Frame = -1

Query  790  MLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKW  611
            MLDEI+DYVKFLRLQVKVLSMSRLGGA AVA LV DIP+  VE +   E+   Q  WEKW
Sbjct  1    MLDEILDYVKFLRLQVKVLSMSRLGGASAVAQLVADIPLQSVEGDS-CESRSNQHVWEKW  59

Query  610  SNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            S+  TE++VAKLMEE+VG AMQ+LQSK+LCIMP+SLA+ IY +Q  D   +VKPE   PS
Sbjct  60   SDSETEQEVAKLMEEDVGTAMQYLQSKSLCIMPVSLAALIYPTQQTDNQSMVKPEPTAPS  119



>gb|ERN01450.1| hypothetical protein AMTR_s00002p00267570 [Amborella trichopoda]
Length=307

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 99/131 (76%), Gaps = 8/131 (6%)
 Frame = -1

Query  814  VNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEEGGSEAGR  635
              +TDR  MLDEI++YVKFLRLQVKVLSMSR+GGAGAVA LV DIP  L  +EG     +
Sbjct  177  AERTDRAAMLDEILEYVKFLRLQVKVLSMSRMGGAGAVAQLVADIP--LPADEGDGSGCK  234

Query  634  TQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDT----  467
             + AWE+WS +GTER+VAKLMEE+VGAAMQFLQSKALC+MPI+LAS +YH++   T    
Sbjct  235  EEQAWERWSTEGTEREVAKLMEEDVGAAMQFLQSKALCLMPIALASTLYHTRQGSTSSSD  294

Query  466  --TPLVKPETN  440
              T   KPE N
Sbjct  295  GPTSRAKPEPN  305



>ref|XP_011621734.1| PREDICTED: transcription factor UNE12 [Amborella trichopoda]
Length=343

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 99/129 (77%), Gaps = 8/129 (6%)
 Frame = -1

Query  808  KTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQ  629
            +TDR  MLDEI++YVKFLRLQVKVLSMSR+GGAGAVA LV DIP  L  +EG     + +
Sbjct  215  RTDRAAMLDEILEYVKFLRLQVKVLSMSRMGGAGAVAQLVADIP--LPADEGDGSGCKEE  272

Query  628  PAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDT------  467
             AWE+WS +GTER+VAKLMEE+VGAAMQFLQSKALC+MPI+LAS +YH++   T      
Sbjct  273  QAWERWSTEGTEREVAKLMEEDVGAAMQFLQSKALCLMPIALASTLYHTRQGSTSSSDGP  332

Query  466  TPLVKPETN  440
            T   KPE N
Sbjct  333  TSRAKPEPN  341



>ref|XP_010265624.1| PREDICTED: transcription factor bHLH66-like [Nelumbo nucifera]
Length=505

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 110/156 (71%), Gaps = 11/156 (7%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLSMSRLGGA AVAPLV
Sbjct  317  RRERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLSMSRLGGAAAVAPLV  376

Query  688  TDIPI----SLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALC  521
             DI        V+  GG  A   Q A    S   TE+QVAKLMEE++G+AMQ+LQ K LC
Sbjct  377  ADISSDGGGDCVQASGGRSANGAQTASSNDSLTATEQQVAKLMEEDMGSAMQYLQGKGLC  436

Query  520  IMPISLASAIY-----HSQAPDTTP--LVKPETNPP  434
            +MPISLA+AI      HS+ P+ T   LV P  + P
Sbjct  437  LMPISLATAISTATTCHSRNPNHTHHRLVSPNVDVP  472



>ref|XP_011084002.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH69-like 
[Sesamum indicum]
Length=388

 Score =   163 bits (412),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 115/173 (66%), Gaps = 17/173 (10%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  202  GQATDPHSIAERL-RRERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  260

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDG-----TERQVAKLMEE  566
            MSRLGGA AVAPLV D+       EG S  G  Q A    + DG     TE QVAKLMEE
Sbjct  261  MSRLGGAAAVAPLVADM-----SSEGRSGNGTAQTASTSNTKDGGGMTVTEHQVAKLMEE  315

Query  565  NVGAAMQFLQSKALCIMPISLASAI----YHSQAPDTTPLVKPETNPPS*ILT  419
            ++G+AMQ+LQ K LC+MPISLA+AI     HS+ P       P T+P   +LT
Sbjct  316  DMGSAMQYLQGKGLCLMPISLATAISTATSHSRKPPAA--SNPPTSPSMSVLT  366



>ref|XP_009358465.1| PREDICTED: transcription factor bHLH66-like [Pyrus x bretschneideri]
Length=469

 Score =   162 bits (409),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 113/175 (65%), Gaps = 22/175 (13%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  258  GQATDPHSIAERLRR-ERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  316

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEA----------GRTQPAWE--KWSNDG----  599
            MSRLGGA AVAPLV D+       EGG +           GR+    +    SND     
Sbjct  317  MSRLGGAAAVAPLVADM-----SSEGGGDCIQASANGGTRGRSSNGNQTASSSNDNSMTV  371

Query  598  TERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            TE QVAKLMEE++G+AMQ+LQ K LC+MPISLA+AI  +      PL++   N P
Sbjct  372  TEHQVAKLMEEDMGSAMQYLQGKGLCLMPISLATAISTATCHSRNPLLQNSNNNP  426



>ref|XP_009800017.1| PREDICTED: transcription factor UNE12-like, partial [Nicotiana 
sylvestris]
Length=231

 Score =   156 bits (394),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 103/145 (71%), Gaps = 4/145 (3%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVA--P  695
            R ERI+ERI+ALQ+LVPS NKTDR  MLD+I  YVKFLRLQVKV+  S +  +  V    
Sbjct  86   RRERISERIKALQELVPSCNKTDRAAMLDDI--YVKFLRLQVKVIRRSTISDSSTVRLFH  143

Query  694  LVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIM  515
            L+ D+ IS +      E+   Q  WEKWSN  TE +VAKLMEE+VGAAMQ+LQSK+LCIM
Sbjct  144  LLQDLFISSISMGDSGESRSNQHVWEKWSNVETEEEVAKLMEEDVGAAMQYLQSKSLCIM  203

Query  514  PISLASAIYHSQAPDTTPLVKPETN  440
            PISLA  IY +Q  D   +VKPE++
Sbjct  204  PISLAILIYPTQQTDNQSVVKPESS  228



>ref|XP_008367760.1| PREDICTED: transcription factor bHLH66-like [Malus domestica]
Length=472

 Score =   162 bits (409),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 113/175 (65%), Gaps = 22/175 (13%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  261  GQATDPHSIAERLRR-ERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  319

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEA----------GRTQPAWE--KWSNDG----  599
            MSRLGGA AVAPLV D+       EGG +           GR+    +    SND     
Sbjct  320  MSRLGGAAAVAPLVADM-----SSEGGGDCIQASANGGTRGRSSNGNQTASSSNDNSMTV  374

Query  598  TERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            TE QVAKLMEE++G+AMQ+LQ K LC+MPISLA+AI  +      PL++   N P
Sbjct  375  TEHQVAKLMEEDMGSAMQYLQGKGLCLMPISLATAISTATCHSRNPLLQNSNNNP  429



>ref|XP_004507723.1| PREDICTED: transcription factor bHLH66-like [Cicer arietinum]
Length=400

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 108/156 (69%), Gaps = 5/156 (3%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL++QVKVLS
Sbjct  206  GQATDPHSIAERL-RRERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQVQVKVLS  264

Query  730  MSRLGGAGAVAPLVTDIPISLVEE----EGGSEAGRTQPAWEKWSNDGTERQVAKLMEEN  563
            MSRLGGAGAVAPLV D+   +V +     G        P     S   TE+QVAKLMEE+
Sbjct  265  MSRLGGAGAVAPLVADMSSEVVSDCVQANGNPRNSTGNPKTANESLTMTEQQVAKLMEED  324

Query  562  VGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLV  455
            +G+AMQ+LQ K LC+MPISLA+AI  +   +  PL+
Sbjct  325  MGSAMQYLQGKGLCLMPISLATAISTATCHNRNPLM  360



>ref|XP_009366166.1| PREDICTED: transcription factor bHLH66-like [Pyrus x bretschneideri]
Length=468

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 113/173 (65%), Gaps = 22/173 (13%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  256  GQATDPHSIAERLRR-ERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  314

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEA----------GRTQPAWE--KWSNDG----  599
            MSRLGGAGAVAPLV D+       EGG +           GR+    +    SND     
Sbjct  315  MSRLGGAGAVAPLVADM-----SSEGGGDCIQASANGGTRGRSSNGNQTASSSNDNSMTV  369

Query  598  TERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            TE QVAKLM+E++G+AMQ+LQ K LC+MPISLA+AI  +      PL+   +N
Sbjct  370  TEHQVAKLMKEDMGSAMQYLQGKGLCLMPISLATAISSATCHSRNPLLHNNSN  422



>ref|XP_010275766.1| PREDICTED: transcription factor bHLH66 [Nelumbo nucifera]
Length=507

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 111/170 (65%), Gaps = 11/170 (6%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  307  GQATDPHSIAERLRR-ERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  365

Query  730  MSRLGGAGAVAPLVTDIPI----SLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEEN  563
            MSRLGGA AVAPLV DI        ++  GG      Q A    S   TE QVAKLMEE+
Sbjct  366  MSRLGGAAAVAPLVADISSDGGGDCIQASGGRSGNGNQTASSNDSLTMTEHQVAKLMEED  425

Query  562  VGAAMQFLQSKALCIMPISLASAIY----HSQAP--DTTPLVKPETNPPS  431
            +G+AMQ+LQ K LC+MPISLA+AI     H++ P     PL+      PS
Sbjct  426  MGSAMQYLQGKGLCLMPISLATAISTATCHTRNPTNGNNPLLSSNAEGPS  475



>ref|XP_007154897.1| hypothetical protein PHAVU_003G157100g [Phaseolus vulgaris]
 gb|ESW26891.1| hypothetical protein PHAVU_003G157100g [Phaseolus vulgaris]
Length=396

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 108/159 (68%), Gaps = 14/159 (9%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  213  GQATDPHSIAERL-RRERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  271

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKW---SND---GTERQVAKLME  569
            MSRLGGA AVAPLV DI       EGG +    QP        SND    TE+QVAKLME
Sbjct  272  MSRLGGAAAVAPLVADI-----SSEGGGDC--VQPKSNNANGNSNDTLATTEQQVAKLME  324

Query  568  ENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVK  452
            E++G+AMQ+LQ K LC+MPISLA+AI  +      P + 
Sbjct  325  EDMGSAMQYLQGKGLCLMPISLATAISKATCHARNPFIN  363



>ref|XP_009394940.1| PREDICTED: transcription factor bHLH82-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=440

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 108/168 (64%), Gaps = 9/168 (5%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  243  GQATDPHSIAERLRR-ERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  301

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            MSRLGGA AVAPLV D+   + +   G +      A    S   TE QVAK+MEE++G+A
Sbjct  302  MSRLGGAAAVAPLVADMASEVGQSGAGRDGANGGAAGSSDSLTVTEHQVAKMMEEDMGSA  361

Query  550  MQFLQSKALCIMPISLASAIY--------HSQAPDTTPLVKPETNPPS  431
            MQ+LQ K LC+MPISLASAI         H   P   P   P  + PS
Sbjct  362  MQYLQGKGLCLMPISLASAISSATAGHLGHGLVPGVLPPPNPSGDAPS  409



>gb|KJB54936.1| hypothetical protein B456_009G055200 [Gossypium raimondii]
Length=450

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 109/159 (69%), Gaps = 14/159 (9%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  240  GQATDPHSIAERL-RRERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  298

Query  730  MSRLGGAGAVAPLVTDIP------ISLVEEEGGS---EAGRTQPAWEKWSNDGTERQVAK  578
            MSRLGGA AVAPLV D+P      +      GGS    +   QP+    S   TE QVAK
Sbjct  299  MSRLGGAAAVAPLVADMPPEGGDCVQTTAGGGGSLQRNSNGNQPSANNDSLTVTEHQVAK  358

Query  577  LMEENVGAAMQFLQSKALCIMPISLASAIY----HSQAP  473
            LMEE++G+AMQ+LQ K LC+MPISLA+AI     HS+ P
Sbjct  359  LMEEDMGSAMQYLQGKGLCLMPISLATAISTATCHSRNP  397



>ref|XP_007154896.1| hypothetical protein PHAVU_003G157100g [Phaseolus vulgaris]
 gb|ESW26890.1| hypothetical protein PHAVU_003G157100g [Phaseolus vulgaris]
Length=388

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 108/159 (68%), Gaps = 14/159 (9%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  205  GQATDPHSIAERL-RRERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  263

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKW---SND---GTERQVAKLME  569
            MSRLGGA AVAPLV DI       EGG +    QP        SND    TE+QVAKLME
Sbjct  264  MSRLGGAAAVAPLVADI-----SSEGGGDC--VQPKSNNANGNSNDTLATTEQQVAKLME  316

Query  568  ENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVK  452
            E++G+AMQ+LQ K LC+MPISLA+AI  +      P + 
Sbjct  317  EDMGSAMQYLQGKGLCLMPISLATAISKATCHARNPFIN  355



>gb|KHG24512.1| Transcription factor bHLH66 -like protein [Gossypium arboreum]
Length=485

 Score =   160 bits (405),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 109/162 (67%), Gaps = 10/162 (6%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  275  GQATDPHSIAERL-RRERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  333

Query  730  MSRLGGAGAVAPLVTDIP------ISLVEEEGGS---EAGRTQPAWEKWSNDGTERQVAK  578
            MSRLGGA AVAPLV D+P      +      GGS    +   QP+    S   TE QVAK
Sbjct  334  MSRLGGAAAVAPLVADMPSEGGDCVQTTAGGGGSLQRNSNGNQPSANNDSLTETEHQVAK  393

Query  577  LMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVK  452
            LMEE++G+AMQ+LQ K LC+MPISLA+AI  +      P++ 
Sbjct  394  LMEEDMGSAMQYLQGKGLCLMPISLATAISTATCHSRNPMIN  435



>ref|XP_004287121.1| PREDICTED: transcription factor bHLH66-like [Fragaria vesca subsp. 
vesca]
Length=459

 Score =   159 bits (403),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 105/157 (67%), Gaps = 7/157 (4%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  248  GQATDPHSIAERLRR-ERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  306

Query  730  MSRLGGAGAVAPLVTDIPIS------LVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLME  569
            MSRLGGAGAVAPLV D+              GG+     Q A    S   TE QVAKLME
Sbjct  307  MSRLGGAGAVAPLVADMSSEGGGDCIQTSGNGGTRGRSNQTASSNDSMTVTEHQVAKLME  366

Query  568  ENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPL  458
            E++G+AMQ+LQ K LC+MPISLA+AI  +      PL
Sbjct  367  EDMGSAMQYLQGKGLCLMPISLATAISTATCHTRNPL  403



>ref|XP_007011960.1| LJRHL1-like 1 [Theobroma cacao]
 gb|EOY29579.1| LJRHL1-like 1 [Theobroma cacao]
Length=469

 Score =   159 bits (403),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 108/161 (67%), Gaps = 10/161 (6%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  256  GQATDPHSIAERLRR-ERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  314

Query  730  MSRLGGAGAVAPLVTDIPIS------LVEEEGGSEAGRTQPAWEKWSNDG---TERQVAK  578
            MSRLGGA AVAPLV D+P             GGS    +       SND    TE+QVAK
Sbjct  315  MSRLGGAAAVAPLVADMPSEGGGDCIQTSANGGSLPRNSNGNQTSSSNDSLTVTEQQVAK  374

Query  577  LMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLV  455
            LMEE++G+AMQ+LQ K LC+MPISLA+AI  +      P++
Sbjct  375  LMEEDMGSAMQYLQGKGLCLMPISLATAISTATCHSRNPMI  415



>ref|XP_006343666.1| PREDICTED: transcription factor bHLH66-like [Solanum tuberosum]
Length=444

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 110/165 (67%), Gaps = 12/165 (7%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  262  GQATDPHSIAERLRR-ERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  320

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDG-----TERQVAKLMEE  566
            MSRLGGA AVAPLV D+     E  G    GR        S++      TE QVAKLMEE
Sbjct  321  MSRLGGAAAVAPLVADMS---SEGRGEGNVGRGGNGTAASSSNSETMTVTEHQVAKLMEE  377

Query  565  NVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            ++G+AMQ+LQ K LC+MPISLA+AI  S      PL+ PE   P+
Sbjct  378  DMGSAMQYLQGKGLCLMPISLATAISTST---RIPLLSPEATSPT  419



>ref|XP_008242964.1| PREDICTED: transcription factor bHLH66-like [Prunus mume]
Length=485

 Score =   159 bits (403),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 111/173 (64%), Gaps = 22/173 (13%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  272  GQATDPHSIAERLRR-ERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  330

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEA----------GRTQPAWE--KWSNDG----  599
            MSRLGGA AVAPLV D     V  EGG +           GR+    +    SND     
Sbjct  331  MSRLGGAAAVAPLVAD-----VSSEGGGDCIQASANGGTRGRSSNGNQTASSSNDNSMTV  385

Query  598  TERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            TE QVAKLMEE++G+AMQ+LQ K LC+MPISLA+AI  +      PL+    N
Sbjct  386  TEHQVAKLMEEDMGSAMQYLQGKGLCLMPISLATAISTATCHTRNPLIHNNHN  438



>ref|XP_009394942.1| PREDICTED: transcription factor bHLH82-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=439

 Score =   159 bits (401),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 111/172 (65%), Gaps = 18/172 (10%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  243  GQATDPHSIAERLRR-ERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  301

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQP-AWEKWSNDG---TERQVAKLMEEN  563
            MSRLGGA AVAPLV D+       EG S AGR         S+D    TE QVAK+MEE+
Sbjct  302  MSRLGGAAAVAPLVADM-----ASEGQSGAGRDGANGGAAGSSDSLTVTEHQVAKMMEED  356

Query  562  VGAAMQFLQSKALCIMPISLASAIY--------HSQAPDTTPLVKPETNPPS  431
            +G+AMQ+LQ K LC+MPISLASAI         H   P   P   P  + PS
Sbjct  357  MGSAMQYLQGKGLCLMPISLASAISSATAGHLGHGLVPGVLPPPNPSGDAPS  408



>ref|XP_007204332.1| hypothetical protein PRUPE_ppa005254mg [Prunus persica]
 gb|EMJ05531.1| hypothetical protein PRUPE_ppa005254mg [Prunus persica]
Length=470

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 110/169 (65%), Gaps = 22/169 (13%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  253  GQATDPHSIAERLRR-ERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  311

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEA----------GRTQPAWE--KWSNDG----  599
            MSRLGGA AVAPLV D     V  EGG +           GR+    +    SND     
Sbjct  312  MSRLGGAAAVAPLVAD-----VSSEGGGDCIQASANGGTRGRSSNGNQTASSSNDNSMTV  366

Query  598  TERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVK  452
            TE QVAKLMEE++G+AMQ+LQ K LC+MPISLA+AI  +      PL+ 
Sbjct  367  TEHQVAKLMEEDMGSAMQYLQGKGLCLMPISLATAISTATCHTRNPLIH  415



>ref|NP_001141950.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|ACN26773.1| unknown [Zea mays]
 tpg|DAA40065.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05429.1| bHLH transcription factor, partial [Zea mays]
Length=470

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 103/143 (72%), Gaps = 14/143 (10%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEIVDYVKFL+LQVKVLS
Sbjct  244  GQATDPHSIAERLRR-ERIAERMKALQELVPNANKTDKASMLDEIVDYVKFLQLQVKVLS  302

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDG---TERQVAKLMEENV  560
            MSRLGGA AVAPLV D+          S  GR   A    S+DG   TE+QVAKLMEE++
Sbjct  303  MSRLGGAAAVAPLVADM----------SSEGRGGVAVAAGSDDGLAVTEQQVAKLMEEDM  352

Query  559  GAAMQFLQSKALCIMPISLASAI  491
            G AMQ+LQ K LC+MP+SLASAI
Sbjct  353  GTAMQYLQGKGLCLMPVSLASAI  375



>ref|XP_008667581.1| PREDICTED: putative HLH DNA-binding domain superfamily protein 
isoform X1 [Zea mays]
 tpg|DAA40064.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=471

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 103/143 (72%), Gaps = 14/143 (10%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEIVDYVKFL+LQVKVLS
Sbjct  245  GQATDPHSIAERLRR-ERIAERMKALQELVPNANKTDKASMLDEIVDYVKFLQLQVKVLS  303

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDG---TERQVAKLMEENV  560
            MSRLGGA AVAPLV D+          S  GR   A    S+DG   TE+QVAKLMEE++
Sbjct  304  MSRLGGAAAVAPLVADM----------SSEGRGGVAVAAGSDDGLAVTEQQVAKLMEEDM  353

Query  559  GAAMQFLQSKALCIMPISLASAI  491
            G AMQ+LQ K LC+MP+SLASAI
Sbjct  354  GTAMQYLQGKGLCLMPVSLASAI  376



>ref|XP_003610348.1| Transcription factor bHLH66 [Medicago truncatula]
 gb|AES92545.1| BHLH transcription factor [Medicago truncatula]
Length=400

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 106/158 (67%), Gaps = 8/158 (5%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL++QVKVLS
Sbjct  201  GQATDPHSIAERL-RRERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQVQVKVLS  259

Query  730  MSRLGGAGAVAPLVTDIP----ISLVEEEGGSEAGRTQPAWEKWSNDG---TERQVAKLM  572
            MSRLGGAGAVAPLV D+        V+  G        P     SN+    TE QVAKLM
Sbjct  260  MSRLGGAGAVAPLVADMSSEGVSDCVQTNGNGGVHPRNPKTASSSNESLTMTEHQVAKLM  319

Query  571  EENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPL  458
            EE++G+AMQ+LQ K LC+MPISLA+AI  +      PL
Sbjct  320  EEDMGSAMQYLQGKGLCLMPISLATAISTATCHTRNPL  357



>ref|XP_003610347.1| Transcription factor bHLH66 [Medicago truncatula]
 gb|AES92544.1| BHLH transcription factor [Medicago truncatula]
Length=403

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 106/158 (67%), Gaps = 8/158 (5%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL++QVKVLS
Sbjct  204  GQATDPHSIAERL-RRERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQVQVKVLS  262

Query  730  MSRLGGAGAVAPLVTDIP----ISLVEEEGGSEAGRTQPAWEKWSNDG---TERQVAKLM  572
            MSRLGGAGAVAPLV D+        V+  G        P     SN+    TE QVAKLM
Sbjct  263  MSRLGGAGAVAPLVADMSSEGVSDCVQTNGNGGVHPRNPKTASSSNESLTMTEHQVAKLM  322

Query  571  EENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPL  458
            EE++G+AMQ+LQ K LC+MPISLA+AI  +      PL
Sbjct  323  EEDMGSAMQYLQGKGLCLMPISLATAISTATCHTRNPL  360



>gb|KDP38664.1| hypothetical protein JCGZ_04017 [Jatropha curcas]
Length=461

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 105/153 (69%), Gaps = 19/153 (12%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  239  GQATDPHSIAERL-RRERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  297

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEA----------GRTQPAWEKWSND---GTER  590
            MSRLGGA AVAPLV DI       EGG +            R+  A  +  ND   G E 
Sbjct  298  MSRLGGAAAVAPLVADI-----SSEGGGDCIQATANGGSLPRSSNAGSQTPNDSLTGAEH  352

Query  589  QVAKLMEENVGAAMQFLQSKALCIMPISLASAI  491
            QVAKLMEE++G+AMQ+LQ K LC+MPISLA+AI
Sbjct  353  QVAKLMEEDMGSAMQYLQGKGLCLMPISLATAI  385



>ref|XP_004251756.1| PREDICTED: transcription factor bHLH66-like [Solanum lycopersicum]
Length=387

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 110/167 (66%), Gaps = 22/167 (13%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER+++LQ+LVP+ NKTD+  MLDEI+DYV+FL+LQVKVLS
Sbjct  191  GQATDPHSIAERLRR-ERIAERMKSLQELVPNANKTDKASMLDEIIDYVRFLQLQVKVLS  249

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEA-------GRTQPAWEKWSNDG----TERQV  584
            MSRLGGA AVAPLV D        EGG +        G +       +ND     TE QV
Sbjct  250  MSRLGGAAAVAPLVAD-----RSSEGGGDCVQGNVGRGGSNGTTSSANNDSSMTMTEHQV  304

Query  583  AKLMEENVGAAMQFLQSKALCIMPISLASAIY----HSQAPDTTPLV  455
            AKLMEE++G+AMQ+LQ K LC+MPISLA+AI     HS  P+  PL+
Sbjct  305  AKLMEEDMGSAMQYLQGKGLCLMPISLATAISTSTCHSMKPN-NPLL  350



>ref|XP_011033445.1| PREDICTED: transcription factor bHLH66-like [Populus euphratica]
Length=453

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 104/150 (69%), Gaps = 11/150 (7%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L RG RIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  245  GQATDPHSIAERLRRG-RIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  303

Query  730  MSRLGGAGAVAPLVTDIPISL------VEEEGGSEAGRTQPAWEKWSNDG----TERQVA  581
            MSRLGGA AVAPLV D+              GGS A  T  +    +ND     TE QVA
Sbjct  304  MSRLGGAAAVAPLVADMSSEAGGDCIQANANGGSIARTTNGSQTASTNDSSLTVTEHQVA  363

Query  580  KLMEENVGAAMQFLQSKALCIMPISLASAI  491
            KLMEE++G+AMQ+LQ K LC+MPISLA+AI
Sbjct  364  KLMEEDMGSAMQYLQGKGLCLMPISLATAI  393



>ref|XP_012071482.1| PREDICTED: transcription factor bHLH66-like [Jatropha curcas]
Length=468

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 105/153 (69%), Gaps = 19/153 (12%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  246  GQATDPHSIAERL-RRERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  304

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEA----------GRTQPAWEKWSND---GTER  590
            MSRLGGA AVAPLV DI       EGG +            R+  A  +  ND   G E 
Sbjct  305  MSRLGGAAAVAPLVADI-----SSEGGGDCIQATANGGSLPRSSNAGSQTPNDSLTGAEH  359

Query  589  QVAKLMEENVGAAMQFLQSKALCIMPISLASAI  491
            QVAKLMEE++G+AMQ+LQ K LC+MPISLA+AI
Sbjct  360  QVAKLMEEDMGSAMQYLQGKGLCLMPISLATAI  392



>ref|XP_006473971.1| PREDICTED: transcription factor bHLH66-like [Citrus sinensis]
Length=469

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 109/160 (68%), Gaps = 13/160 (8%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  257  GQATDPHSIAERLRR-ERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  315

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEA----GRT-QPAWEKWSNDG---TERQVAKL  575
            MSRLGGA AVAPLV D    +  E GG +     GR    A    +ND    TE QVAKL
Sbjct  316  MSRLGGAAAVAPLVAD----MSSEGGGGDCIQANGRNPNGAQTTSANDSLTVTEHQVAKL  371

Query  574  MEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLV  455
            MEE++G+AMQ+LQ K LC+MPISLA+AI  +      P++
Sbjct  372  MEEDMGSAMQYLQGKGLCLMPISLATAISTATCHSRNPII  411



>ref|XP_002325140.2| hypothetical protein POPTR_0018s11800g [Populus trichocarpa]
 gb|EEF03705.2| hypothetical protein POPTR_0018s11800g [Populus trichocarpa]
Length=455

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 116/182 (64%), Gaps = 13/182 (7%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  246  GQATDPHSIAERLRR-ERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  304

Query  730  MSRLGGAGAVAPLVTDIPISL------VEEEGGSEAGRTQPAWEKWSNDG----TERQVA  581
            MSRLGGA AVAPLV D+             +GGS +  +       +ND     TE QVA
Sbjct  305  MSRLGGAAAVAPLVADMSSEAGGDCIQASADGGSLSRTSNGNQTARTNDSSLTVTEHQVA  364

Query  580  KLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS*ILTNKRCPG  401
            KLMEE++G+AMQ+LQ K LC+MPISLA+AI  +   + +P +    N  + + +N   P 
Sbjct  365  KLMEEDMGSAMQYLQGKGLCLMPISLATAISTATCHNRSPAIN--NNHHALLQSNGEGPA  422

Query  400  CP  395
             P
Sbjct  423  SP  424



>ref|XP_011078667.1| PREDICTED: transcription factor bHLH66-like [Sesamum indicum]
Length=418

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 113/172 (66%), Gaps = 23/172 (13%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  224  GQATDPHSIAERLRR-ERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  282

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWE--KWSNDG---TERQVAKLMEE  566
            MSRLGGA AVAPLV D           S  GR+    +    SN+G    E+QVAKLMEE
Sbjct  283  MSRLGGAAAVAPLVADK----------STEGRSGNGMQTASSSNEGMTVAEQQVAKLMEE  332

Query  565  NVGAAMQFLQSKALCIMPISLASAI----YHSQAP---DTTPLVKPETNPPS  431
            ++G+AMQ+LQ K LC+MPISLA+AI     HS+ P      PL+  E   PS
Sbjct  333  DMGSAMQYLQGKGLCLMPISLATAISTATSHSRNPLASSNNPLLNGEPGGPS  384



>gb|KHN18326.1| Transcription factor bHLH66 [Glycine soja]
Length=320

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 102/143 (71%), Gaps = 16/143 (11%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  153  GQATDPHSIAERL-RRERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  211

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDG---TERQVAKLMEENV  560
            MSRLGGA AVAPLV          EGG   G    A    SND    TE+QVAKLMEE++
Sbjct  212  MSRLGGAAAVAPLVA---------EGG---GDCIQAKRSNSNDSLAMTEQQVAKLMEEDM  259

Query  559  GAAMQFLQSKALCIMPISLASAI  491
            G+AMQ+LQ K LC+MPISLASAI
Sbjct  260  GSAMQYLQGKGLCLMPISLASAI  282



>ref|XP_003570296.1| PREDICTED: transcription factor bHLH82-like [Brachypodium distachyon]
Length=351

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 112/163 (69%), Gaps = 18/163 (11%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVPS NKTD+  MLDEI+DYVKFL++QVKVLS
Sbjct  149  GQATDPHSIAERLRR-ERIAERMKALQELVPSANKTDKASMLDEIIDYVKFLQVQVKVLS  207

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSND-----------GTERQV  584
            MSRLGGAGAVAPLV +    +  E+ G+  G +   W+  + +            TE QV
Sbjct  208  MSRLGGAGAVAPLVAN----MSPEDNGNGDGTSSSGWDGNAGNSDDNGGGSTLRATEEQV  263

Query  583  AKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLV  455
            ++LMEE++G+AMQ+LQ K LC+MPISLAS I  + +P  +PL+
Sbjct  264  SRLMEEDMGSAMQYLQGKGLCLMPISLASLISSATSP--SPLL  304



>gb|ERN18653.1| hypothetical protein AMTR_s00065p00184910 [Amborella trichopoda]
Length=473

 Score =   157 bits (396),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 109/161 (68%), Gaps = 19/161 (12%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI++YVKFL+LQVKVLS
Sbjct  276  GQATDPHSIAERLRR-ERIAERMKALQELVPNANKTDKASMLDEIIEYVKFLQLQVKVLS  334

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEA------GRTQPAWEKWSNDG---TERQVAK  578
            MSRLGGA AVAPLV DI       EGG +       GR     +  + D    TE QVAK
Sbjct  335  MSRLGGAAAVAPLVADI-----SSEGGGDCIQANGIGRNASGGQTPTQDSLTVTEHQVAK  389

Query  577  LMEENVGAAMQFLQSKALCIMPISLASAI----YHSQAPDT  467
            LMEE++G+AMQ+LQ K LC+MPISLASAI     H++ P +
Sbjct  390  LMEEDMGSAMQYLQGKGLCLMPISLASAISSATCHTRNPSS  430



>ref|XP_009795099.1| PREDICTED: transcription factor bHLH66-like [Nicotiana sylvestris]
Length=387

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 108/162 (67%), Gaps = 12/162 (7%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER+++LQ+LVP+ NKTD+  MLDEI+DYV+FL+LQVKVLS
Sbjct  190  GQATDPHSIAERLRR-ERIAERMKSLQELVPNANKTDKASMLDEIIDYVRFLQLQVKVLS  248

Query  730  MSRLGGAGAVAPLVTDIPI------SLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLME  569
            MSRLGGA AVAPLV D         S     GG  + RT       S   TE QVAKLME
Sbjct  249  MSRLGGAAAVAPLVADRSSEGGGGDSAQANGGGRGSNRTTSLANNDSMTMTEHQVAKLME  308

Query  568  ENVGAAMQFLQSKALCIMPISLASAIY----HSQAPDTTPLV  455
            E++G+AMQ+LQ K LC+MPISLA+AI     HS  P+  PL+
Sbjct  309  EDMGSAMQYLQGKGLCLMPISLATAISTATCHSMKPN-NPLL  349



>ref|XP_011628047.1| PREDICTED: transcription factor bHLH66 [Amborella trichopoda]
 ref|XP_006857186.2| PREDICTED: transcription factor bHLH66 [Amborella trichopoda]
Length=482

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 109/161 (68%), Gaps = 19/161 (12%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI++YVKFL+LQVKVLS
Sbjct  285  GQATDPHSIAERLRR-ERIAERMKALQELVPNANKTDKASMLDEIIEYVKFLQLQVKVLS  343

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEA------GRTQPAWEKWSNDG---TERQVAK  578
            MSRLGGA AVAPLV DI       EGG +       GR     +  + D    TE QVAK
Sbjct  344  MSRLGGAAAVAPLVADI-----SSEGGGDCIQANGIGRNASGGQTPTQDSLTVTEHQVAK  398

Query  577  LMEENVGAAMQFLQSKALCIMPISLASAI----YHSQAPDT  467
            LMEE++G+AMQ+LQ K LC+MPISLASAI     H++ P +
Sbjct  399  LMEEDMGSAMQYLQGKGLCLMPISLASAISSATCHTRNPSS  439



>ref|XP_006600554.1| PREDICTED: transcription factor bHLH66-like isoform X4 [Glycine 
max]
Length=363

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 103/143 (72%), Gaps = 16/143 (11%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  196  GQATDPHSIAERL-RRERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  254

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDG---TERQVAKLMEENV  560
            MSRLGGA AVAPLV          EGG +  +   A    SND    TE+QVAKLMEE++
Sbjct  255  MSRLGGAAAVAPLVA---------EGGGDCIQ---AKRSNSNDSLAMTEQQVAKLMEEDM  302

Query  559  GAAMQFLQSKALCIMPISLASAI  491
            G+AMQ+LQ K LC+MPISLASAI
Sbjct  303  GSAMQYLQGKGLCLMPISLASAI  325



>ref|XP_006600553.1| PREDICTED: transcription factor bHLH66-like isoform X3 [Glycine 
max]
Length=365

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 103/143 (72%), Gaps = 16/143 (11%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  198  GQATDPHSIAERL-RRERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  256

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDG---TERQVAKLMEENV  560
            MSRLGGA AVAPLV          EGG +  +   A    SND    TE+QVAKLMEE++
Sbjct  257  MSRLGGAAAVAPLVA---------EGGGDCIQ---AKRSNSNDSLAMTEQQVAKLMEEDM  304

Query  559  GAAMQFLQSKALCIMPISLASAI  491
            G+AMQ+LQ K LC+MPISLASAI
Sbjct  305  GSAMQYLQGKGLCLMPISLASAI  327



>ref|XP_002965459.1| hypothetical protein SELMODRAFT_24892, partial [Selaginella moellendorffii]
 ref|XP_002994179.1| hypothetical protein SELMODRAFT_24890, partial [Selaginella moellendorffii]
 gb|EFJ04769.1| hypothetical protein SELMODRAFT_24890, partial [Selaginella moellendorffii]
 gb|EFJ32879.1| hypothetical protein SELMODRAFT_24892, partial [Selaginella moellendorffii]
Length=143

 Score =   148 bits (374),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 93/126 (74%), Gaps = 7/126 (6%)
 Frame = -1

Query  868  RGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLV  689
            R ERIAER++ALQDLVP+ NKTD+  MLDEIVDYVKFL+LQVKVLSMSRLG A AV  LV
Sbjct  22   RRERIAERMKALQDLVPNANKTDKASMLDEIVDYVKFLQLQVKVLSMSRLGSAAAVPSLV  81

Query  688  TDIPISLVEEEGGSEAGRTQPAWEKWSNDG---TERQVAKLMEENVGAAMQFLQSKALCI  518
             D+P     E   S    T       S+DG    ERQVA+LM+E++G+AMQ+LQSK LC+
Sbjct  82   ADLP----SEGANSLLASTLSRSTGISHDGLASAERQVARLMDEDMGSAMQYLQSKGLCL  137

Query  517  MPISLA  500
            MPISLA
Sbjct  138  MPISLA  143



>ref|XP_010656597.1| PREDICTED: transcription factor UNE12-like isoform X2 [Vitis 
vinifera]
Length=506

 Score =   157 bits (396),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 111/165 (67%), Gaps = 25/165 (15%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  285  GQATDPHSIAERLRR-ERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  343

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSE----AGRTQPAWEK--------WSNDG---T  596
            MSRLGGA AVAPLV D+       EGG +    +G + P   +         SND    T
Sbjct  344  MSRLGGAAAVAPLVADM-----SSEGGGDCIQASGTSGPTGGRATNGTQTTTSNDSLTVT  398

Query  595  ERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIY----HSQAP  473
            E QVAKLMEE++G+AMQ+LQ K LC+MPISLA+AI     HS+ P
Sbjct  399  EHQVAKLMEEDMGSAMQYLQGKGLCLMPISLATAISTTTCHSRNP  443



>ref|XP_010929149.1| PREDICTED: uncharacterized protein LOC105050721 isoform X1 [Elaeis 
guineensis]
Length=514

 Score =   157 bits (396),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 107/143 (75%), Gaps = 7/143 (5%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  290  GQATDPHSIAERL-RRERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  348

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDG---TERQVAKLMEENV  560
            MSRLGGA AVAP+V+D+P   +  +G  ++GR+        ND    TE QVAKLMEE++
Sbjct  349  MSRLGGAAAVAPVVSDMPSERLAVQG--QSGRSG-INGAAGNDSLTVTEHQVAKLMEEDM  405

Query  559  GAAMQFLQSKALCIMPISLASAI  491
            G+AMQ+LQ K LC+MPISLASAI
Sbjct  406  GSAMQYLQGKGLCLMPISLASAI  428



>ref|XP_010656596.1| PREDICTED: uncharacterized protein LOC100243222 isoform X1 [Vitis 
vinifera]
Length=511

 Score =   157 bits (396),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 111/165 (67%), Gaps = 25/165 (15%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  290  GQATDPHSIAERLRR-ERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  348

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSE----AGRTQPAWEK--------WSNDG---T  596
            MSRLGGA AVAPLV D+       EGG +    +G + P   +         SND    T
Sbjct  349  MSRLGGAAAVAPLVADM-----SSEGGGDCIQASGTSGPTGGRATNGTQTTTSNDSLTVT  403

Query  595  ERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIY----HSQAP  473
            E QVAKLMEE++G+AMQ+LQ K LC+MPISLA+AI     HS+ P
Sbjct  404  EHQVAKLMEEDMGSAMQYLQGKGLCLMPISLATAISTTTCHSRNP  448



>ref|XP_006600552.1| PREDICTED: transcription factor bHLH66-like isoform X2 [Glycine 
max]
Length=365

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 103/143 (72%), Gaps = 16/143 (11%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  198  GQATDPHSIAERL-RRERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  256

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDG---TERQVAKLMEENV  560
            MSRLGGA AVAPLV          EGG +  +   A    SND    TE+QVAKLMEE++
Sbjct  257  MSRLGGAAAVAPLVA---------EGGGDCIQ---AKRSNSNDSLAMTEQQVAKLMEEDM  304

Query  559  GAAMQFLQSKALCIMPISLASAI  491
            G+AMQ+LQ K LC+MPISLASAI
Sbjct  305  GSAMQYLQGKGLCLMPISLASAI  327



>ref|XP_006600551.1| PREDICTED: transcription factor bHLH66-like isoform X1 [Glycine 
max]
Length=367

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 103/143 (72%), Gaps = 16/143 (11%)
 Frame = -1

Query  910  GQEEDRQLIHIVLPRGERIAERIRALQDLVPSVNKTDRTVMLDEIVDYVKFLRLQVKVLS  731
            GQ  D   I   L R ERIAER++ALQ+LVP+ NKTD+  MLDEI+DYVKFL+LQVKVLS
Sbjct  200  GQATDPHSIAERL-RRERIAERMKALQELVPNANKTDKASMLDEIIDYVKFLQLQVKVLS  258

Query  730  MSRLGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDG---TERQVAKLMEENV  560
            MSRLGGA AVAPLV          EGG +  +   A    SND    TE+QVAKLMEE++
Sbjct  259  MSRLGGAAAVAPLVA---------EGGGDCIQ---AKRSNSNDSLAMTEQQVAKLMEEDM  306

Query  559  GAAMQFLQSKALCIMPISLASAI  491
            G+AMQ+LQ K LC+MPISLASAI
Sbjct  307  GSAMQYLQGKGLCLMPISLASAI  329



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2377925492388