BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9826

Length=872
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU42442.1|  hypothetical protein MIMGU_mgv1a0056111mg               424   1e-146   Erythranthe guttata [common monkey flower]
ref|XP_002532409.1|  Xylose isomerase, putative                         430   2e-145   Ricinus communis
ref|XP_006343543.1|  PREDICTED: xylose isomerase-like                   430   2e-145   Solanum tuberosum [potatoes]
ref|XP_009801815.1|  PREDICTED: xylose isomerase                        428   7e-145   Nicotiana sylvestris
emb|CDP02939.1|  unnamed protein product                                428   9e-145   Coffea canephora [robusta coffee]
ref|XP_004242672.1|  PREDICTED: xylose isomerase                        427   2e-144   Solanum lycopersicum
ref|XP_011079316.1|  PREDICTED: xylose isomerase                        426   8e-144   Sesamum indicum [beniseed]
ref|XP_009606829.1|  PREDICTED: xylose isomerase                        426   8e-144   Nicotiana tomentosiformis
gb|EYU34279.1|  hypothetical protein MIMGU_mgv1a005575mg                425   8e-144   Erythranthe guttata [common monkey flower]
gb|KDP43806.1|  hypothetical protein JCGZ_23014                         421   3e-142   Jatropha curcas
ref|XP_010688511.1|  PREDICTED: xylose isomerase isoform X3             421   3e-142   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010688509.1|  PREDICTED: xylose isomerase isoform X2             421   3e-142   
ref|XP_012065287.1|  PREDICTED: xylose isomerase                        422   7e-142   Jatropha curcas
ref|XP_010688508.1|  PREDICTED: xylose isomerase isoform X1             421   1e-141   
ref|XP_002277520.2|  PREDICTED: xylose isomerase                        418   6e-141   Vitis vinifera
ref|XP_011648918.1|  PREDICTED: xylose isomerase                        417   2e-140   Cucumis sativus [cucumbers]
emb|CBI17768.3|  unnamed protein product                                418   2e-140   Vitis vinifera
emb|CAN65150.1|  hypothetical protein VITISV_037086                     415   5e-140   Vitis vinifera
ref|XP_008452100.1|  PREDICTED: xylose isomerase                        416   5e-140   Cucumis melo [Oriental melon]
ref|XP_011018165.1|  PREDICTED: xylose isomerase                        414   2e-139   Populus euphratica
dbj|BAD95103.1|  xylose isomerase                                       405   2e-139   Arabidopsis thaliana [mouse-ear cress]
gb|KHN17567.1|  Xylose isomerase                                        414   3e-139   Glycine soja [wild soybean]
ref|XP_003549495.1|  PREDICTED: xylose isomerase                        414   3e-139   Glycine max [soybeans]
ref|XP_008223675.1|  PREDICTED: xylose isomerase                        413   5e-139   Prunus mume [ume]
ref|XP_007222807.1|  hypothetical protein PRUPE_ppa005065mg             413   5e-139   Prunus persica
ref|XP_010102992.1|  Xylose isomerase                                   413   6e-139   
ref|XP_002324488.1|  hypothetical protein POPTR_0018s10460g             413   7e-139   Populus trichocarpa [western balsam poplar]
ref|XP_011069881.1|  PREDICTED: xylose isomerase-like                   412   7e-139   Sesamum indicum [beniseed]
ref|XP_007011128.1|  Xylose isomerase family protein isoform 2          412   9e-139   
ref|XP_010102993.1|  Xylose isomerase                                   414   1e-138   
gb|ACJ84879.1|  unknown                                                 405   5e-138   Medicago truncatula
ref|XP_006453438.1|  hypothetical protein CICLE_v10008154mg             410   1e-137   Citrus clementina [clementine]
ref|XP_007011127.1|  Xylose isomerase family protein isoform 1          412   1e-137   
ref|XP_009348411.1|  PREDICTED: xylose isomerase-like                   409   1e-137   Pyrus x bretschneideri [bai li]
gb|KDO62435.1|  hypothetical protein CISIN_1g0373932mg                  409   2e-137   Citrus sinensis [apfelsine]
ref|XP_007154797.1|  hypothetical protein PHAVU_003G148700g             409   3e-137   Phaseolus vulgaris [French bean]
gb|KHG02217.1|  Xylose isomerase -like protein                          408   6e-137   Gossypium arboreum [tree cotton]
ref|XP_004507817.1|  PREDICTED: xylose isomerase-like isoform X3        408   6e-137   Cicer arietinum [garbanzo]
gb|KJB60238.1|  hypothetical protein B456_009G296100                    407   7e-137   Gossypium raimondii
gb|KJB60240.1|  hypothetical protein B456_009G296100                    407   8e-137   Gossypium raimondii
ref|XP_009336656.1|  PREDICTED: xylose isomerase-like                   407   8e-137   Pyrus x bretschneideri [bai li]
ref|XP_008365436.1|  PREDICTED: xylose isomerase-like                   407   1e-136   Malus domestica [apple tree]
ref|XP_010259769.1|  PREDICTED: xylose isomerase isoform X2             407   2e-136   Nelumbo nucifera [Indian lotus]
gb|EPS67638.1|  xylose isomerase                                        406   3e-136   Genlisea aurea
ref|XP_010259768.1|  PREDICTED: xylose isomerase isoform X1             406   8e-136   Nelumbo nucifera [Indian lotus]
ref|XP_004297371.1|  PREDICTED: xylose isomerase                        404   1e-135   Fragaria vesca subsp. vesca
gb|AES92376.2|  xylose isomerase                                        404   2e-135   Medicago truncatula
ref|XP_003610179.1|  Xylose isomerase                                   404   2e-135   
ref|XP_010938719.1|  PREDICTED: xylose isomerase                        404   3e-135   Elaeis guineensis
gb|KJB60239.1|  hypothetical protein B456_009G296100                    404   3e-135   Gossypium raimondii
ref|XP_008796228.1|  PREDICTED: xylose isomerase isoform X2             401   3e-134   Phoenix dactylifera
ref|NP_568861.3|  xylose isomerase                                      401   3e-134   Arabidopsis thaliana [mouse-ear cress]
gb|AFK39166.1|  unknown                                                 401   3e-134   Medicago truncatula
dbj|BAE98492.1|  xylose isomerase                                       401   3e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010065878.1|  PREDICTED: xylose isomerase-like isoform X3        401   4e-134   Eucalyptus grandis [rose gum]
ref|XP_010443465.1|  PREDICTED: xylose isomerase                        400   5e-134   Camelina sativa [gold-of-pleasure]
ref|XP_006280396.1|  hypothetical protein CARUB_v10026323mg             400   6e-134   Capsella rubella
ref|XP_002864523.1|  xylose isomerase family protein                    400   1e-133   Arabidopsis lyrata subsp. lyrata
ref|XP_008796227.1|  PREDICTED: xylose isomerase isoform X1             401   1e-133   Phoenix dactylifera
ref|XP_009391575.1|  PREDICTED: xylose isomerase-like                   399   2e-133   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006401183.1|  hypothetical protein EUTSA_v10013406mg             399   2e-133   Eutrema salsugineum [saltwater cress]
ref|XP_009120281.1|  PREDICTED: xylose isomerase                        398   3e-133   Brassica rapa
ref|XP_010539451.1|  PREDICTED: xylose isomerase                        398   5e-133   Tarenaya hassleriana [spider flower]
ref|XP_010483295.1|  PREDICTED: xylose isomerase-like                   398   6e-133   Camelina sativa [gold-of-pleasure]
emb|CDY25894.1|  BnaC09g32660D                                          398   7e-133   Brassica napus [oilseed rape]
emb|CDY49729.1|  BnaA10g11590D                                          397   7e-133   Brassica napus [oilseed rape]
dbj|BAJ34093.1|  unnamed protein product                                397   7e-133   Eutrema halophilum
gb|AAM61519.1|  xylose isomerase                                        397   1e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452612.1|  PREDICTED: xylose isomerase-like                   397   1e-132   Camelina sativa [gold-of-pleasure]
ref|XP_004958079.1|  PREDICTED: xylose isomerase-like                   397   1e-132   Setaria italica
ref|XP_004958625.1|  PREDICTED: xylose isomerase-like                   397   2e-132   Setaria italica
ref|XP_009417936.1|  PREDICTED: xylose isomerase-like                   397   2e-132   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGV54617.1|  xylose isomerase                                        394   1e-131   Phaseolus vulgaris [French bean]
ref|XP_006658089.1|  PREDICTED: xylose isomerase-like                   392   8e-131   Oryza brachyantha
gb|EEC82655.1|  hypothetical protein OsI_27268                          391   2e-130   Oryza sativa Indica Group [Indian rice]
ref|NP_001060585.1|  Os07g0669100                                       391   2e-130   
ref|NP_001132889.1|  putative xylose isomerase family protein pre...    390   4e-130   Zea mays [maize]
ref|XP_003562496.1|  PREDICTED: xylose isomerase                        390   5e-130   Brachypodium distachyon [annual false brome]
ref|XP_006845583.1|  PREDICTED: xylose isomerase                        389   1e-129   Amborella trichopoda
ref|XP_004507815.1|  PREDICTED: xylose isomerase-like isoform X1        390   1e-129   
gb|EMS46439.1|  Xylose isomerase                                        388   1e-129   Triticum urartu
gb|ACG42142.1|  xylose isomerase                                        389   2e-129   Zea mays [maize]
gb|KCW63564.1|  hypothetical protein EUGRSUZ_G01193                     389   2e-129   Eucalyptus grandis [rose gum]
gb|KJB60241.1|  hypothetical protein B456_009G296100                    388   3e-129   Gossypium raimondii
ref|NP_001132653.1|  uncharacterized protein LOC100194128 precursor     388   5e-129   Zea mays [maize]
gb|ACG35698.1|  xylose isomerase                                        388   6e-129   Zea mays [maize]
ref|XP_008650947.1|  PREDICTED: uncharacterized protein LOC100194...    389   1e-128   Zea mays [maize]
dbj|BAJ96683.1|  predicted protein                                      386   2e-128   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA64057.1|  TPA: putative xylose isomerase family protein          387   7e-128   
dbj|BAB08802.1|  xylose isomerase                                       383   3e-127   Arabidopsis thaliana [mouse-ear cress]
gb|EMT06905.1|  Xylose isomerase                                        382   3e-127   
sp|Q40082.1|XYLA_HORVU  RecName: Full=Xylose isomerase                  380   3e-126   Hordeum vulgare [barley]
gb|ABR16225.1|  unknown                                                 350   3e-115   Picea sitchensis
ref|XP_001774702.1|  predicted protein                                  340   2e-110   
ref|XP_002991242.1|  hypothetical protein SELMODRAFT_229601             337   2e-109   
ref|XP_002991182.1|  hypothetical protein SELMODRAFT_161472             337   3e-109   
emb|CAA64544.1|  xylose isomerase                                       329   3e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010065874.1|  PREDICTED: xylose isomerase-like isoform X1        298   4e-94    
ref|XP_005646804.1|  xylose isomerase                                   296   2e-93    Coccomyxa subellipsoidea C-169
gb|KIZ04907.1|  xylose isomerase                                        285   6e-89    Monoraphidium neglectum
ref|WP_034568836.1|  xylose isomerase                                   275   9e-86    Clostridiales bacterium oral taxon 876
gb|ERI94441.1|  xylose isomerase                                        275   1e-85    Clostridiales bacterium oral taxon 876 str. F0540
ref|XP_001633389.1|  predicted protein                                  272   6e-85    Nematostella vectensis
ref|WP_039037140.1|  xylose isomerase                                   273   1e-84    Pseudoalteromonas
ref|WP_016710605.1|  xylose isomerase                                   271   3e-84    Pseudoalteromonas
ref|WP_008131330.1|  xylose isomerase                                   271   4e-84    Pseudoalteromonas sp. BSi20480
ref|WP_010556356.1|  xylose isomerase                                   271   4e-84    Pseudoalteromonas marina
gb|EGI71574.1|  xylose isomerase                                        266   9e-84    Pseudoalteromonas distincta
ref|WP_024599023.1|  xylose isomerase                                   268   6e-83    Pseudoalteromonas
ref|WP_007585153.1|  xylose isomerase                                   268   6e-83    Pseudoalteromonas sp. BSi20429
ref|WP_007375167.1|  MULTISPECIES: xylose isomerase                     268   7e-83    Pseudoalteromonas
ref|WP_024594232.1|  xylose isomerase                                   268   7e-83    Pseudoalteromonas sp. TB13
ref|WP_019027960.1|  xylose isomerase                                   267   2e-82    Colwellia piezophila
ref|WP_017895180.1|  xylose isomerase                                   267   2e-82    Clostridium tyrobutyricum
ref|WP_010588344.1|  xylose isomerase                                   266   3e-82    Schlesneria paludicola
ref|XP_004356776.1|  xylose isomerase                                   266   3e-82    Acanthamoeba castellanii str. Neff
gb|ETK93389.1|  xylose isomerase                                        260   4e-82    Phytophthora parasitica
ref|XP_002506620.1|  predicted protein                                  265   4e-82    Micromonas commoda
gb|ETK93384.1|  xylose isomerase                                        261   5e-82    Phytophthora parasitica
ref|XP_010738383.1|  PREDICTED: xylose isomerase-like isoform X2        263   6e-82    
gb|EQF74127.1|  xylose isomerase                                        260   6e-82    Clostridioides difficile CD212
ref|WP_016205623.1|  xylose isomerase                                   265   7e-82    Clostridium
gb|ETL46794.1|  xylose isomerase                                        260   1e-81    Phytophthora parasitica
ref|WP_007061694.1|  xylose isomerase                                   264   3e-81    Clostridium carboxidivorans
gb|AKA69666.1|  xylose isomerase                                        264   3e-81    Clostridium scatologenes
gb|ETI53522.1|  xylose isomerase                                        261   3e-81    Phytophthora parasitica P1569
emb|CAF93733.1|  unnamed protein product                                263   3e-81    Tetraodon nigroviridis
gb|EFX66553.1|  hypothetical protein DAPPUDRAFT_218978                  262   4e-81    Daphnia pulex
ref|XP_011603566.1|  PREDICTED: xylose isomerase-like isoform X3        262   5e-81    
gb|ERM41646.1|  xylose isomerase                                        259   6e-81    Clostridioides difficile P68
ref|WP_009959507.1|  xylose isomerase                                   263   7e-81    Verrucomicrobium spinosum
ref|XP_010738382.1|  PREDICTED: xylose isomerase-like isoform X1        262   9e-81    
gb|ELU13203.1|  hypothetical protein CAPTEDRAFT_149382                  263   1e-80    Capitella teleta
ref|XP_011603565.1|  PREDICTED: xylose isomerase-like isoform X2        262   1e-80    
ref|WP_032079132.1|  xylose isomerase                                   262   1e-80    Clostridium drakei
ref|WP_038164239.1|  xylose isomerase                                   262   1e-80    Verrucomicrobium sp. BvORR106
ref|XP_003387079.1|  PREDICTED: xylose isomerase-like                   263   2e-80    
gb|AAR09155.1|  xylose isomerase                                        255   2e-80    Mannheimia granulomatis
ref|WP_016601082.1|  xylose isomerase                                   258   2e-80    Yersinia pestis
ref|WP_009959227.1|  xylose isomerase                                   261   2e-80    Verrucomicrobium spinosum
ref|WP_013238479.1|  MULTISPECIES: xylose isomerase                     261   3e-80    Clostridium
ref|WP_035688493.1|  xylose isomerase                                   261   3e-80    Avibacterium paragallinarum
ref|XP_005090167.1|  PREDICTED: xylose isomerase-like                   258   3e-80    
ref|XP_008321922.1|  PREDICTED: xylose isomerase-like isoform X2        260   3e-80    
ref|XP_008290598.1|  PREDICTED: xylose isomerase-like                   261   4e-80    Stegastes partitus
gb|EOS54587.1|  xylose isomerase                                        261   4e-80    Paenibacillus barengoltzii G22
ref|XP_008900733.1|  xylose isomerase                                   261   4e-80    Phytophthora parasitica INRA-310
ref|XP_003965907.2|  PREDICTED: xylose isomerase-like isoform X1        262   4e-80    
gb|EES74125.1|  xylose isomerase                                        261   5e-80    Paenibacillus sp. oral taxon 786 str. D14
ref|WP_028537509.1|  MULTISPECIES: xylose isomerase                     261   5e-80    Paenibacillus
ref|WP_026462632.1|  xylose isomerase                                   260   6e-80    Adhaeribacter aquaticus
ref|WP_036644393.1|  xylose isomerase                                   260   6e-80    Paenibacillus sp. oral taxon 786
ref|WP_008302073.1|  xylose isomerase                                   260   6e-80    Paraglaciecola agarilytica
ref|WP_007985011.1|  MULTISPECIES: xylose isomerase                     260   7e-80    Alteromonadaceae
emb|CDQ80418.1|  unnamed protein product                                260   8e-80    Oncorhynchus mykiss
ref|WP_010074860.1|  xylose isomerase                                   260   8e-80    Clostridium cellulovorans
ref|WP_026658263.1|  Xylose isomerase                                   260   9e-80    
gb|ETL77578.1|  xylose isomerase                                        260   9e-80    Phytophthora parasitica
ref|WP_045959980.1|  xylose isomerase                                   259   1e-79    Acholeplasma palmae
ref|WP_012341741.1|  xylose isomerase                                   259   1e-79    Histophilus somni
ref|XP_008321921.1|  PREDICTED: xylose isomerase-like isoform X1        259   1e-79    Cynoglossus semilaevis [half-smooth tongue sole]
ref|WP_020532079.1|  hypothetical protein                               259   1e-79    Flexithrix dorotheae
ref|WP_007106886.1|  xylose isomerase                                   259   1e-79    Paraglaciecola polaris
ref|WP_006990989.1|  MULTISPECIES: xylose isomerase                     259   2e-79    Alteromonadales
ref|WP_023563217.1|  xylose isomerase                                   253   2e-79    
ref|WP_032233807.1|  xylose isomerase                                   253   2e-79    Escherichia coli [E. coli]
ref|WP_007414259.1|  xylose isomerase                                   259   2e-79    Pedosphaera parvula
emb|CBK25455.2|  unnamed protein product                                259   2e-79    Blastocystis hominis
ref|WP_021376347.1|  xylose isomerase                                   259   2e-79    Clostridioides difficile
ref|WP_038172460.1|  xylose isomerase                                   259   2e-79    Verrucomicrobium sp. BvORR106
gb|ABI24864.1|  D-xylose isomerase                                      259   2e-79    Histophilus somni 129PT
gb|ETP51333.1|  xylose isomerase                                        259   2e-79    Phytophthora parasitica P10297
ref|WP_044704476.1|  xylose isomerase                                   252   3e-79    
ref|WP_011576446.1|  xylose isomerase                                   259   3e-79    Pseudoalteromonas atlantica
ref|WP_041604097.1|  xylose isomerase                                   259   3e-79    Histophilus somni
gb|KHI92157.1|  xylose isomerase                                        253   3e-79    Escherichia coli [E. coli]
gb|ETO82214.1|  xylose isomerase                                        259   3e-79    Phytophthora parasitica P1976
ref|WP_021369126.1|  xylose isomerase                                   258   3e-79    Clostridioides difficile
ref|WP_014625278.1|  xylose isomerase                                   258   3e-79    Spirochaeta thermophila
ref|WP_036097976.1|  xylose isomerase                                   258   3e-79    Listeria floridensis
ref|WP_009898127.1|  xylose isomerase                                   258   4e-79    Clostridiales
ref|WP_039463449.1|  xylose isomerase                                   258   4e-79    Pectobacterium carotovorum
ref|WP_039279877.1|  xylose isomerase                                   258   4e-79    Pectobacterium carotovorum
ref|WP_009891378.1|  xylose isomerase                                   258   4e-79    Clostridiales
gb|EFP62823.1|  putative xylose isomerase                               254   4e-79    Erysipelotrichaceae bacterium 3_1_53
gb|ADD61976.1|  putative protein                                        253   5e-79    uncultured organism
ref|WP_036626617.1|  xylose isomerase                                   258   5e-79    Paenibacillus
ref|WP_021421788.1|  xylose isomerase                                   258   5e-79    Clostridioides difficile
ref|WP_015923669.1|  xylose isomerase                                   258   5e-79    Halothermothrix orenii
ref|WP_021423576.1|  xylose isomerase                                   258   5e-79    Clostridioides difficile
gb|EHJ36230.1|  xylose isomerase                                        258   5e-79    Clostridioides difficile 70-100-2010
ref|YP_003219374.1|  xylose isomerase                                   258   5e-79    
ref|WP_028514448.1|  xylose isomerase                                   258   5e-79    Ruminococcus flavefaciens
ref|WP_009906213.1|  xylose isomerase                                   258   6e-79    Clostridioides difficile
ref|WP_016679053.1|  xylose isomerase                                   256   6e-79    Yersinia pestis
ref|XP_010883508.1|  PREDICTED: xylose isomerase-like                   259   7e-79    
ref|XP_006636149.1|  PREDICTED: xylose isomerase-like                   256   7e-79    
ref|WP_021393548.1|  xylose isomerase                                   258   7e-79    Clostridioides difficile
ref|WP_021361041.1|  xylose isomerase                                   258   7e-79    Clostridioides difficile
ref|WP_021388228.1|  xylose isomerase                                   258   7e-79    Clostridioides difficile
ref|WP_037562869.1|  xylose isomerase                                   258   7e-79    Alkalispirochaeta odontotermitis
ref|WP_014757233.1|  MULTISPECIES: xylose isomerase                     258   8e-79    Thermoanaerobacterium aotearoense
gb|EFH05881.1|  xylose isomerase                                        258   8e-79    Clostridioides difficile NAP08
gb|EHJ32437.1|  xylose isomerase                                        258   8e-79    Clostridioides difficile 002-P50-2011
ref|WP_039882234.1|  xylose isomerase                                   257   9e-79    Mesotoga
ref|WP_018751681.1|  xylose isomerase                                   257   9e-79    Paenibacillus sanguinis
ref|WP_021013961.1|  Xylose isomerase                                   257   1e-78    Serratia sp. ATCC 39006
ref|WP_021412148.1|  xylose isomerase                                   257   1e-78    Clostridioides difficile
ref|WP_014731027.1|  xylose isomerase                                   257   1e-78    Mesotoga prima
ref|WP_022618581.1|  Xylose isomerase                                   257   1e-78    Clostridioides difficile
emb|CCU83726.1|  Xylose isomerase                                       257   1e-78    Mesotoga infera
ref|WP_002209593.1|  MULTISPECIES: xylose isomerase                     257   1e-78    Yersinia pseudotuberculosis complex
ref|WP_014913698.1|  xylose isomerase                                   257   1e-78    Pectobacterium carotovorum
ref|WP_032466856.1|  xylose isomerase                                   257   1e-78    Yersinia pseudotuberculosis
ref|WP_033847877.1|  MULTISPECIES: xylose isomerase                     257   1e-78    Yersinia pseudotuberculosis complex
ref|WP_012230197.1|  xylose isomerase                                   257   2e-78    Yersinia pestis
ref|XP_010792168.1|  PREDICTED: xylose isomerase-like                   253   2e-78    Notothenia coriiceps [yellowbelly rockcod]
gb|EHJ34457.1|  xylose isomerase                                        257   2e-78    Clostridioides difficile 050-P50-2011
ref|WP_025235120.1|  xylose isomerase                                   256   2e-78    Mannheimia sp. USDA-ARS-USMARC-1261
ref|WP_027072689.1|  xylose isomerase                                   257   2e-78    Luteimonas sp. J29
ref|WP_015842241.1|  xylose isomerase                                   256   2e-78    Pectobacterium carotovorum
ref|WP_040043960.1|  xylose isomerase                                   256   2e-78    Pectobacterium
ref|WP_024063558.1|  xylose isomerase                                   256   2e-78    Yersinia pseudotuberculosis
ref|WP_007415126.1|  xylose isomerase                                   256   2e-78    Pedosphaera parvula
gb|AHM63135.1|  xylose isomerase                                        256   2e-78    Flammeovirgaceae bacterium 311
ref|XP_009537176.1|  hypothetical protein PHYSODRAFT_565503             255   2e-78    Phytophthora sojae
ref|WP_039521824.1|  xylose isomerase                                   256   2e-78    Pectobacterium carotovorum
ref|WP_025381905.1|  xylose isomerase                                   256   2e-78    Yersinia similis
ref|WP_039284980.1|  xylose isomerase                                   256   2e-78    Pectobacterium
ref|WP_013298905.1|  xylose isomerase                                   256   3e-78    Thermoanaerobacterium thermosaccharolyticum
ref|WP_039490220.1|  xylose isomerase                                   256   3e-78    Pectobacterium carotovorum
ref|WP_010284187.1|  xylose isomerase                                   256   3e-78    Pectobacterium carotovorum
ref|WP_013788885.1|  xylose isomerase                                   256   3e-78    Thermoanaerobacterium xylanolyticum
ref|WP_012570371.1|  xylose isomerase                                   256   3e-78    Coxiella burnetii
ref|WP_013314408.1|  xylose isomerase                                   256   3e-78    Spirochaeta thermophila
ref|XP_002904118.1|  xylose isomerase 1                                 257   3e-78    Phytophthora infestans T30-4
ref|WP_039316685.1|  xylose isomerase                                   256   3e-78    Pectobacterium carotovorum
ref|WP_039510331.1|  xylose isomerase                                   256   3e-78    Pectobacterium carotovorum
ref|WP_013411463.1|  xylose isomerase                                   256   3e-78    Caldicellulosiruptor owensensis
ref|WP_013289876.1|  xylose isomerase                                   256   3e-78    Caldicellulosiruptor obsidiansis
ref|WP_011091740.1|  xylose isomerase                                   256   4e-78    Pectobacterium atrosepticum
gb|ETI53536.1|  xylose isomerase                                        256   4e-78    Phytophthora parasitica P1569
ref|WP_015358602.1|  MULTISPECIES: xylose isomerase XylA                256   4e-78    Thermoclostridium stercorarium
ref|WP_009110894.1|  xylose isomerase                                   256   4e-78    Brenneria sp. EniD312
ref|WP_025423857.1|  xylose isomerase                                   256   4e-78    Sodalis praecaptivus
ref|WP_035601129.1|  xylose isomerase                                   255   4e-78    Haloferula sp. BvORR071
ref|WP_039483227.1|  xylose isomerase                                   255   5e-78    Pectobacterium
ref|WP_005769174.1|  xylose isomerase                                   255   5e-78    Coxiella burnetii
emb|CDK78581.1|  Xylose isomerase                                       251   5e-78    Klebsiella pneumoniae IS22
ref|WP_029450677.1|  xylose isomerase                                   255   6e-78    Clostridium algidicarnis
ref|WP_006978554.1|  xylose isomerase                                   255   6e-78    Chthoniobacter flavus
ref|WP_015312541.1|  xylose isomerase                                   255   6e-78    Thermoanaerobacterium thermosaccharolyticum
ref|WP_015392438.1|  xylose isomerase XylA                              255   6e-78    Clostridium saccharoperbutylacetonicum
ref|WP_034864662.1|  xylose isomerase                                   255   8e-78    Enterobacteriaceae bacterium B14
sp|P30435.1|XYLA_THESA  RecName: Full=Xylose isomerase                  255   8e-78    Thermoanaerobacterium saccharolyticum
ref|WP_022064579.1|  xylose isomerase 1                                 251   8e-78    
ref|WP_013626379.1|  xylose isomerase                                   254   8e-78    Rubinisphaera brasiliensis
emb|CDL08095.1|  Xylose isomerase                                       251   9e-78    Klebsiella pneumoniae IS43
ref|WP_039508364.1|  xylose isomerase                                   254   9e-78    Pectobacterium carotovorum
ref|WP_039501790.1|  xylose isomerase                                   254   9e-78    Pectobacterium carotovorum
ref|WP_013043164.1|  xylose isomerase                                   254   1e-77    Coraliomargarita akajimensis
ref|WP_025216446.1|  xylose isomerase                                   254   1e-77    Mannheimia varigena
emb|CDK84469.1|  Xylose isomerase                                       251   1e-77    Escherichia coli IS25
emb|CFQ53579.1|  xylose isomerase                                       254   1e-77    Yersinia aleksiciae
ref|WP_022428254.1|  xylose isomerase                                   248   1e-77    
ref|WP_044480420.1|  xylose isomerase                                   254   1e-77    Paenibacillus antibioticophila
ref|WP_039474499.1|  xylose isomerase                                   254   1e-77    Pectobacterium carotovorum
ref|WP_039546353.1|  xylose isomerase                                   254   1e-77    Pectobacterium carotovorum
ref|WP_040032255.1|  xylose isomerase                                   254   1e-77    Pectobacterium carotovorum
ref|WP_010296596.1|  xylose isomerase                                   254   1e-77    Pectobacterium carotovorum
ref|WP_039533067.1|  xylose isomerase                                   254   1e-77    Pectobacterium
ref|WP_022587522.1|  xylose isomerase                                   254   1e-77    Caldanaerobacter subterraneus
ref|WP_029228039.1|  xylose isomerase                                   254   1e-77    Caldicellulosiruptor acetigenus
ref|WP_012058599.1|  xylose isomerase                                   254   1e-77    Clostridium beijerinckii
ref|WP_014041981.1|  xylose isomerase                                   254   2e-77    Caldicellulosiruptor lactoaceticus
ref|WP_013433194.1|  xylose isomerase                                   254   2e-77    Caldicellulosiruptor kristjanssonii
ref|WP_012896352.1|  xylose isomerase                                   254   2e-77    Thermotoga naphthophila
ref|WP_039550240.1|  xylose isomerase                                   254   2e-77    Pectobacterium carotovorum
gb|EGT69025.1|  xylA                                                    251   2e-77    Escherichia coli O104:H4 str. C227-11
ref|WP_038033066.1|  MULTISPECIES: xylose isomerase                     254   2e-77    
ref|WP_010040427.1|  xylose isomerase                                   254   2e-77    
ref|WP_019678379.1|  xylose isomerase                                   254   2e-77    
ref|WP_002997116.1|  xylose isomerase                                   254   2e-77    
ref|WP_044593090.1|  xylose isomerase                                   247   2e-77    
gb|KHC94878.1|  xylose isomerase                                        254   2e-77    
ref|WP_013430944.1|  xylose isomerase                                   254   2e-77    
ref|WP_029093373.1|  xylose isomerase                                   254   2e-77    
ref|WP_028518112.1|  xylose isomerase                                   254   2e-77    
ref|WP_024860181.1|  xylose isomerase                                   253   2e-77    
ref|WP_019212709.1|  xylose isomerase                                   253   2e-77    
ref|WP_004957122.1|  xylose isomerase                                   253   3e-77    
ref|WP_006450750.1|  hypothetical protein                               247   3e-77    
ref|WP_045761622.1|  xylose isomerase                                   248   3e-77    
ref|WP_026313111.1|  xylose isomerase                                   253   3e-77    
ref|WP_036676605.1|  xylose isomerase                                   253   3e-77    
ref|WP_008907517.1|  xylose isomerase                                   253   3e-77    
ref|WP_041897212.1|  xylose isomerase                                   253   3e-77    
ref|WP_027073399.1|  xylose isomerase                                   253   3e-77    
ref|WP_013203314.1|  xylose isomerase                                   253   3e-77    
ref|WP_009089925.1|  xylose isomerase                                   253   3e-77    
ref|WP_039516200.1|  xylose isomerase                                   253   3e-77    
ref|WP_011997245.1|  xylose isomerase                                   253   3e-77    
gb|ABX77269.1|  xylose isomerase                                        252   3e-77    
ref|WP_017209278.1|  xylose isomerase                                   253   4e-77    
gb|KEQ26959.1|  xylose isomerase                                        253   4e-77    
gb|AHS50841.1|  xylose isomerase                                        247   5e-77    
ref|WP_037401133.1|  MULTISPECIES: xylose isomerase                     253   5e-77    
ref|WP_035132135.1|  xylose isomerase                                   253   5e-77    
gb|EMD05062.1|  xylose isomerase                                        250   5e-77    
ref|WP_022971245.1|  xylose isomerase                                   253   6e-77    
ref|WP_025247077.1|  xylose isomerase                                   253   6e-77    
ref|WP_025845578.1|  xylose isomerase                                   253   6e-77    
ref|WP_015919215.1|  MULTISPECIES: xylose isomerase                     253   6e-77    
emb|CFR13025.1|  xylose isomerase                                       253   6e-77    
ref|WP_039031149.1|  xylose isomerase                                   253   6e-77    
ref|WP_014702033.1|  MULTISPECIES: xylose isomerase                     253   6e-77    
ref|WP_006569355.1|  xylose isomerase                                   252   7e-77    
ref|WP_022495570.1|  xylose isomerase                                   253   7e-77    
ref|WP_044448229.1|  xylose isomerase                                   252   7e-77    
ref|WP_025608026.1|  xylose isomerase                                   253   7e-77    
ref|WP_034646410.1|  xylose isomerase                                   252   7e-77    
ref|WP_026292827.1|  xylose isomerase                                   252   7e-77    
pdb|1A0E|A  Chain A, Xylose Isomerase From Thermotoga Neapolitana       253   7e-77    
ref|WP_023976124.1|  MULTISPECIES: xylose isomerase                     252   7e-77    
ref|YP_001244714.1|  xylose isomerase                                   253   7e-77    
ref|WP_038506942.1|  xylose isomerase                                   252   8e-77    
ref|WP_036908018.1|  xylose isomerase                                   252   8e-77    
ref|WP_005968070.1|  xylose isomerase                                   252   8e-77    
ref|WP_012367934.1|  xylose isomerase                                   252   8e-77    
ref|WP_004082185.1|  MULTISPECIES: xylose isomerase                     252   8e-77    
ref|WP_037440177.1|  xylose isomerase                                   252   8e-77    
ref|WP_001149593.1|  xylose isomerase                                   252   8e-77    
ref|WP_005273438.1|  xylose isomerase                                   252   8e-77    
ref|WP_038670249.1|  xylose isomerase                                   252   9e-77    
ref|WP_035145587.1|  xylose isomerase                                   252   9e-77    
ref|WP_001508052.1|  xylose isomerase                                   252   9e-77    
ref|WP_002435366.1|  xylose isomerase                                   252   9e-77    
ref|WP_029683770.1|  xylose isomerase                                   252   9e-77    
gb|EID68467.1|  xylose isomerase                                        250   9e-77    
emb|CDL24850.1|  Xylose isomerase                                       250   9e-77    
ref|WP_026887251.1|  xylose isomerase                                   252   9e-77    
ref|WP_012310984.1|  xylose isomerase                                   252   9e-77    
ref|WP_043866305.1|  xylose isomerase                                   252   9e-77    
gb|KFC92410.1|  xylose isomerase                                        252   1e-76    
ref|WP_001465681.1|  xylose isomerase                                   252   1e-76    
ref|WP_021807303.1|  Xylose isomerase                                   252   1e-76    
ref|WP_022287212.1|  xylose isomerase                                   252   1e-76    
ref|WP_015907182.1|  xylose isomerase                                   252   1e-76    
gb|EEI49246.1|  xylose isomerase                                        252   1e-76    
ref|WP_042348229.1|  xylose isomerase                                   252   1e-76    
emb|CDL50435.1|  Xylose isomerase                                       250   1e-76    
ref|WP_039020900.1|  xylose isomerase                                   252   1e-76    
ref|WP_006808250.1|  xylose isomerase                                   252   1e-76    
ref|WP_005883317.1|  xylose isomerase                                   252   1e-76    
sp|A4W566.1|XYLA_ENT38  RecName: Full=Xylose isomerase                  252   1e-76    
ref|XP_009537174.1|  hypothetical protein PHYSODRAFT_306712             256   1e-76    
ref|WP_029764725.1|  xylose isomerase                                   248   1e-76    
ref|WP_019081423.1|  xylose isomerase                                   252   1e-76    
ref|WP_019084159.1|  xylose isomerase                                   252   1e-76    
gb|EIM35652.1|  xylose isomerase                                        251   1e-76    
ref|WP_019705053.1|  xylose isomerase                                   252   1e-76    
ref|WP_032304021.1|  xylose isomerase                                   252   1e-76    
ref|WP_028668460.1|  xylose isomerase                                   252   1e-76    
ref|WP_044725149.1|  xylose isomerase                                   247   1e-76    
ref|WP_041689201.1|  xylose isomerase                                   252   1e-76    
ref|WP_032615804.1|  xylose isomerase                                   252   1e-76    
gb|KGB05862.1|  xylose isomerase                                        251   1e-76    
ref|WP_012374578.1|  xylose isomerase                                   252   1e-76    
ref|WP_020945662.1|  xylose isomerase                                   251   1e-76    
pdb|1A0C|A  Chain A, Xylose Isomerase From Thermoanaerobacterium ...    251   1e-76    
emb|CDL35690.1|  Xylose isomerase                                       251   1e-76    
ref|WP_015068489.1|  xylose isomerase                                   251   1e-76    
ref|WP_042568812.1|  xylose isomerase                                   251   2e-76    
sp|P19148.1|XYLA_THETU  RecName: Full=Xylose isomerase                  251   2e-76    
ref|WP_013622653.1|  xylose isomerase                                   251   2e-76    
ref|WP_040077895.1|  xylose isomerase                                   251   2e-76    
ref|WP_012967070.1|  MULTISPECIES: xylose isomerase                     251   2e-76    
ref|WP_028520139.1|  xylose isomerase                                   251   2e-76    
ref|WP_039417914.1|  xylose isomerase                                   245   2e-76    
ref|WP_044003575.1|  xylose isomerase                                   251   2e-76    
ref|WP_040373941.1|  xylose isomerase                                   251   2e-76    
ref|WP_005186907.1|  xylose isomerase                                   251   2e-76    
ref|WP_014951354.1|  xylose isomerase                                   251   2e-76    
ref|WP_024140823.1|  xylose isomerase                                   245   2e-76    
ref|WP_039899478.1|  xylose isomerase                                   251   2e-76    
ref|WP_001149554.1|  xylose isomerase                                   251   2e-76    
ref|WP_028525170.1|  xylose isomerase                                   251   2e-76    
sp|Q9KGU2.1|XYLA_THEYO  RecName: Full=Xylose isomerase                  251   2e-76    
ref|WP_044878597.1|  xylose isomerase                                   251   2e-76    
ref|WP_012072255.1|  xylose isomerase                                   251   2e-76    
ref|WP_009186695.1|  xylose isomerase                                   251   2e-76    
ref|WP_038052482.1|  xylose isomerase                                   251   2e-76    
ref|WP_016807721.1|  xylose isomerase                                   251   2e-76    
ref|WP_025119080.1|  MULTISPECIES: xylose isomerase                     251   2e-76    
ref|WP_001149598.1|  MULTISPECIES: xylose isomerase                     251   2e-76    
ref|WP_029828866.1|  xylose isomerase                                   244   2e-76    
ref|WP_004205019.1|  MULTISPECIES: xylose isomerase                     251   2e-76    
ref|WP_010519961.1|  xylose isomerase                                   251   2e-76    
ref|WP_024274807.1|  xylose isomerase                                   251   2e-76    
ref|WP_017145250.1|  xylose isomerase                                   251   2e-76    
ref|WP_013403911.1|  xylose isomerase                                   251   2e-76    
ref|WP_042834224.1|  xylose isomerase                                   251   3e-76    
ref|WP_018479480.1|  xylose isomerase                                   251   3e-76    
ref|XP_011445523.1|  PREDICTED: xylose isomerase-like                   251   3e-76    
ref|WP_029501331.1|  xylose isomerase                                   251   3e-76    
ref|WP_044427763.1|  xylose isomerase                                   251   3e-76    
ref|WP_045770804.1|  xylose isomerase                                   248   3e-76    
ref|WP_032666682.1|  xylose isomerase                                   251   3e-76    
ref|WP_004713833.1|  xylose isomerase                                   251   3e-76    
ref|WP_042718634.1|  xylose isomerase                                   251   3e-76    
emb|CDL23208.1|  Xylose isomerase                                       245   3e-76    
ref|WP_045334711.1|  xylose isomerase                                   251   3e-76    
gb|EPF13009.1|  xylose isomerase                                        251   3e-76    
emb|CDL52587.1|  Xylose isomerase                                       246   3e-76    
ref|WP_045622160.1|  xylose isomerase                                   251   3e-76    
gb|ESD79223.1|  xylose isomerase                                        250   3e-76    
ref|WP_045350937.1|  xylose isomerase                                   251   3e-76    
ref|WP_026080557.1|  MULTISPECIES: xylose isomerase                     251   3e-76    
ref|WP_032623446.1|  MULTISPECIES: xylose isomerase                     251   3e-76    
ref|WP_004248083.1|  xylose isomerase                                   251   3e-76    
ref|WP_003869013.1|  MULTISPECIES: xylose isomerase                     251   3e-76    
gb|ERP05160.1|  xylose isomerase                                        251   3e-76    
ref|WP_044651610.1|  xylose isomerase                                   244   3e-76    
ref|WP_040118329.1|  xylose isomerase                                   251   4e-76    
emb|CDK61521.1|  Xylose isomerase                                       245   4e-76    
ref|WP_004251168.1|  xylose isomerase                                   250   4e-76    
emb|CBK87787.1|  D-xylose isomerase                                     251   4e-76    
ref|WP_033568106.1|  xylose isomerase                                   250   4e-76    
emb|CEL79606.1|  xylose isomerase                                       251   4e-76    
ref|WP_035146022.1|  xylose isomerase                                   250   4e-76    
gb|EGK63892.1|  xylose isomerase                                        251   4e-76    
ref|WP_006250828.1|  xylose isomerase                                   250   4e-76    
ref|WP_019637313.1|  xylose isomerase                                   250   4e-76    
ref|WP_032643805.1|  xylose isomerase                                   251   4e-76    
ref|WP_011146524.1|  xylose isomerase                                   250   4e-76    
gb|ESN15465.1|  xylose isomerase                                        251   4e-76    
ref|WP_045085057.1|  xylose isomerase [                                 250   4e-76    
ref|WP_034838066.1|  xylose isomerase [                                 250   4e-76    
ref|WP_039307010.1|  xylose isomerase                                   250   4e-76    
ref|WP_041883538.1|  xylose isomerase                                   250   4e-76    
ref|WP_012994345.1|  MULTISPECIES: xylose isomerase                     250   4e-76    
ref|WP_042611687.1|  xylose isomerase                                   250   4e-76    
ref|WP_032740356.1|  xylose isomerase                                   244   5e-76    
ref|WP_024483256.1|  xylose isomerase                                   250   5e-76    
ref|WP_045174058.1|  xylose isomerase                                   250   5e-76    
ref|WP_032480072.1|  xylose isomerase                                   250   5e-76    
ref|WP_043088301.1|  xylose isomerase                                   244   5e-76    
ref|WP_006249615.1|  xylose isomerase                                   250   5e-76    
ref|WP_023291332.1|  MULTISPECIES: xylose isomerase                     250   5e-76    
gb|KFH83687.1|  xylose isomerase                                        250   5e-76    
gb|KFA82152.1|  xylose isomerase                                        251   5e-76    
ref|WP_033559853.1|  xylose isomerase                                   250   5e-76    
ref|WP_001149574.1|  xylose isomerase                                   250   5e-76    
ref|WP_043091886.1|  xylose isomerase                                   250   5e-76    
ref|WP_029487833.1|  xylose isomerase                                   250   5e-76    
ref|WP_014227204.1|  xylose isomerase                                   250   5e-76    
ref|WP_021181325.1|  Xylose isomerase                                   250   5e-76    
ref|WP_016235849.1|  xylose isomerase                                   250   5e-76    
ref|WP_044311133.1|  xylose isomerase                                   250   6e-76    
ref|WP_033559014.1|  xylose isomerase                                   250   6e-76    
ref|WP_001149573.1|  MULTISPECIES: xylose isomerase                     250   6e-76    
ref|WP_001149597.1|  xylose isomerase                                   250   6e-76    
ref|WP_025863290.1|  xylose isomerase                                   250   6e-76    
ref|WP_001647704.1|  xylose isomerase                                   250   6e-76    
ref|WP_005763758.1|  xylose isomerase                                   250   6e-76    
ref|WP_045784421.1|  xylose isomerase                                   250   6e-76    
ref|WP_001149575.1|  xylose isomerase                                   250   6e-76    
ref|WP_025106783.1|  MULTISPECIES: xylose isomerase                     250   6e-76    
ref|WP_045176406.1|  xylose isomerase                                   250   6e-76    
ref|WP_044862205.1|  xylose isomerase                                   250   6e-76    
ref|WP_032240107.1|  xylose isomerase                                   250   6e-76    
ref|WP_001149592.1|  MULTISPECIES: xylose isomerase                     250   6e-76    
ref|WP_044643138.1|  xylose isomerase                                   249   6e-76    
gb|KFH98176.1|  xylose isomerase                                        250   6e-76    
ref|WP_001149572.1|  xylose isomerase                                   250   6e-76    
ref|WP_001720742.1|  xylose isomerase                                   250   6e-76    
ref|WP_001149581.1|  MULTISPECIES: xylose isomerase                     250   6e-76    
ref|WP_001149579.1|  xylose isomerase                                   250   6e-76    
ref|WP_043106581.1|  xylose isomerase                                   244   6e-76    
ref|WP_042075061.1|  xylose isomerase                                   250   6e-76    
gb|EUB41621.1|  xylose isomerase                                        250   6e-76    
ref|WP_022296268.1|  MULTISPECIES: xylose isomerase                     250   6e-76    
ref|WP_001149584.1|  xylose isomerase                                   250   6e-76    
ref|WP_005599638.1|  xylose isomerase                                   250   6e-76    
ref|WP_012064875.1|  xylose isomerase                                   250   6e-76    
ref|WP_041252697.1|  xylose isomerase                                   250   6e-76    
ref|WP_032454343.1|  xylose isomerase                                   250   6e-76    
ref|WP_001149601.1|  xylose isomerase                                   250   6e-76    
ref|WP_038159154.1|  xylose isomerase                                   250   6e-76    
ref|WP_001461724.1|  xylose isomerase                                   250   6e-76    
ref|WP_001149599.1|  xylose isomerase                                   250   6e-76    
ref|WP_034536238.1|  xylose isomerase                                   250   6e-76    
ref|WP_005654109.1|  xylose isomerase                                   250   6e-76    
ref|WP_044070232.1|  xylose isomerase                                   250   7e-76    
ref|WP_039102633.1|  xylose isomerase                                   250   7e-76    
gb|KFH95583.1|  xylose isomerase                                        250   7e-76    
ref|WP_001149583.1|  xylose isomerase                                   250   7e-76    
ref|WP_023486221.1|  Xylose isomerase                                   250   7e-76    
ref|WP_001604442.1|  xylose isomerase                                   250   7e-76    
ref|WP_024722974.1|  xylose isomerase                                   250   7e-76    



>gb|EYU42442.1| hypothetical protein MIMGU_mgv1a0056111mg, partial [Erythranthe 
guttata]
 gb|EYU42443.1| hypothetical protein MIMGU_mgv1a0056111mg, partial [Erythranthe 
guttata]
Length=261

 Score =   424 bits (1091),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVA+KKKIGF GTL IEPKPQEPTKHQYDWDAAT+ANFLRK GLIDEFKLNIE
Sbjct  34   MARFFEAAVAHKKKIGFNGTLLIEPKPQEPTKHQYDWDAATSANFLRKYGLIDEFKLNIE  93

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF MDV EATLVMLSVIKN
Sbjct  94   CNHATLSGHSCHHEIETARINGLLGNIDANTGDPQIGWDTDQFMMDVGEATLVMLSVIKN  153

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRKRYQ
Sbjct  154  GGLAPGGFNFDAKLRRESTDVEDLFIAHIAGMDTLARGLRNAAKLIEDGSLDELVRKRYQ  213

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+ELGA IE GK DF++LEKKA+EWGEPKV SAKQELAEMI QSAL
Sbjct  214  SFDTELGAQIEAGKTDFDVLEKKAIEWGEPKVASAKQELAEMIFQSAL  261



>ref|XP_002532409.1| Xylose isomerase, putative [Ricinus communis]
 gb|EEF29973.1| Xylose isomerase, putative [Ricinus communis]
Length=477

 Score =   430 bits (1105),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARFMEAAVAYKKKIGF GTL IEPKPQEPTKHQYDWDAAT ANFLRK GLIDEFKLNIE
Sbjct  250  MARFMEAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGLIDEFKLNIE  309

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEATLVM+SVI+N
Sbjct  310  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFMTDIAEATLVMMSVIRN  369

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLR+AAKLIEDGSL ELVRKRY+
Sbjct  370  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRNAAKLIEDGSLAELVRKRYE  429

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADFE+LEKKA+EWGEPKVPSAKQELAEMI QSAL
Sbjct  430  SFDTEIGAQIEAGKADFEMLEKKAIEWGEPKVPSAKQELAEMIFQSAL  477



>ref|XP_006343543.1| PREDICTED: xylose isomerase-like [Solanum tuberosum]
Length=481

 Score =   430 bits (1105),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 208/228 (91%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARFMEAAVAYKKKIGF GTL IEPKPQEPTKHQYDWDAAT+ANFLRK GLI EFKLNIE
Sbjct  254  MARFMEAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATSANFLRKYGLIGEFKLNIE  313

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATL+GHSCHHE+ETARINGLLGNIDANSGDPQ GWDTDQF MDVAEATLVM +VIKN
Sbjct  314  CNHATLAGHSCHHELETARINGLLGNIDANSGDPQIGWDTDQFLMDVAEATLVMQTVIKN  373

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLIEDGSL +LVRKRYQ
Sbjct  374  GGLAPGGFNFDAKLRRESTDVEDLFIAHIAGMDTLARGLRNAAKLIEDGSLSDLVRKRYQ  433

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFDSELGAAIE GKADFELLEKKALEWGEPKVPS KQELAEMI QSAL
Sbjct  434  SFDSELGAAIESGKADFELLEKKALEWGEPKVPSGKQELAEMIFQSAL  481



>ref|XP_009801815.1| PREDICTED: xylose isomerase [Nicotiana sylvestris]
Length=481

 Score =   428 bits (1101),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARFMEAAVAYKKKIGF GTL IEPKPQEPTKHQYDWDAAT+ANFLRK GLI EFKLNIE
Sbjct  254  MARFMEAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATSANFLRKYGLIGEFKLNIE  313

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATL+GHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF MDVAEATLVM +VIKN
Sbjct  314  CNHATLAGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFLMDVAEATLVMQTVIKN  373

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRKRYQ
Sbjct  374  GGLAPGGFNFDAKLRRESTDVEDLFIAHIAGMDTLARGLRNAAKLIEDGSLGELVRKRYQ  433

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+ELGAAIE GKADFELLEKKALEWGEPKVPS KQELAEMI QSAL
Sbjct  434  SFDTELGAAIEAGKADFELLEKKALEWGEPKVPSGKQELAEMIFQSAL  481



>emb|CDP02939.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   428 bits (1100),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF+EAAVAYKKKIGF GT  IEPKPQEPTKHQYDWDAAT+ANFLRK GLIDEFKLNIE
Sbjct  251  LARFLEAAVAYKKKIGFNGTFLIEPKPQEPTKHQYDWDAATSANFLRKYGLIDEFKLNIE  310

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDANSGDPQTGWDTDQF MD+ EATLVMLSVI+N
Sbjct  311  CNHATLSGHSCHHELETARINGLLGNIDANSGDPQTGWDTDQFLMDIQEATLVMLSVIRN  370

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FI HI GMDTLARGLR+AAKLIEDGSL E++RKRYQ
Sbjct  371  GGLAPGGFNFDAKLRRESTDVEDLFIGHIAGMDTLARGLRNAAKLIEDGSLDEIIRKRYQ  430

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFDSELGA IE GKADFELLEKKA EWGEPKVPSAKQELAEMILQ+AL
Sbjct  431  SFDSELGAQIEAGKADFELLEKKAKEWGEPKVPSAKQELAEMILQAAL  478



>ref|XP_004242672.1| PREDICTED: xylose isomerase [Solanum lycopersicum]
Length=481

 Score =   427 bits (1098),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARFMEAAVAYKKKIGF GTL IEPKPQEPTKHQYDWDAAT+ANFLRK GLI EFKLNIE
Sbjct  254  MARFMEAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATSANFLRKYGLIGEFKLNIE  313

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATL+GHSCHHE+ETARINGLLGNIDANSGDPQ GWDTDQF MDVAEATLVM +VIKN
Sbjct  314  CNHATLAGHSCHHELETARINGLLGNIDANSGDPQIGWDTDQFLMDVAEATLVMQTVIKN  373

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTD+EDIFIAHI GMDTLARGLR+AAKLIE+GSL +LVRKRYQ
Sbjct  374  GGLAPGGFNFDAKLRRESTDIEDIFIAHIAGMDTLARGLRNAAKLIEEGSLNDLVRKRYQ  433

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFDSELG+AIE GKADFELLEKKALEWGEPKVPS KQELAEMI QSAL
Sbjct  434  SFDSELGSAIESGKADFELLEKKALEWGEPKVPSGKQELAEMIFQSAL  481



>ref|XP_011079316.1| PREDICTED: xylose isomerase [Sesamum indicum]
 ref|XP_011079317.1| PREDICTED: xylose isomerase [Sesamum indicum]
Length=477

 Score =   426 bits (1094),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 212/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVAYKKKIGF GTL IEPKPQEPTKHQYDWDAAT ANFLRK GLIDEFKLNIE
Sbjct  250  MARFFEAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGLIDEFKLNIE  309

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF MDV EATLVMLSVIKN
Sbjct  310  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFMMDVGEATLVMLSVIKN  369

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRKRYQ
Sbjct  370  GGLAPGGFNFDAKLRRESTDVEDLFIAHIAGMDTLARGLRNAAKLIEDGSLSELVRKRYQ  429

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFDSELGA IE GKADFE+LEKKA+ WGEPKV SAKQELAEMI QSAL
Sbjct  430  SFDSELGAEIEAGKADFEVLEKKAIAWGEPKVASAKQELAEMIFQSAL  477



>ref|XP_009606829.1| PREDICTED: xylose isomerase [Nicotiana tomentosiformis]
Length=481

 Score =   426 bits (1094),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARFME AVAYKKKIGF GTL IEPKPQEPTKHQYDWDAAT+ANFLRK GLI EFKLNIE
Sbjct  254  MARFMETAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATSANFLRKYGLIGEFKLNIE  313

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATL+GHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF MDVAEATLVM +VIKN
Sbjct  314  CNHATLAGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFLMDVAEATLVMQTVIKN  373

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELV+KRYQ
Sbjct  374  GGLAPGGFNFDAKLRRESTDVEDLFIAHIAGMDTLARGLRNAAKLIEDGSLSELVKKRYQ  433

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+ELGAAIE GKADFELLEKKALEWGEPKVPS KQELAEMI QSAL
Sbjct  434  SFDTELGAAIEAGKADFELLEKKALEWGEPKVPSGKQELAEMIFQSAL  481



>gb|EYU34279.1| hypothetical protein MIMGU_mgv1a005575mg [Erythranthe guttata]
Length=478

 Score =   425 bits (1093),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 205/227 (90%), Positives = 212/227 (93%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            ARF EAAVAYKKKIGF GTL IEPKPQEPTKHQYDWDAAT ANFLRK GLIDEFKLNIEC
Sbjct  252  ARFFEAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGLIDEFKLNIEC  311

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF MDV EATLVML+V+KNG
Sbjct  312  NHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFMMDVGEATLVMLTVVKNG  371

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            G+APGGFNFDAKLRRESTDVEDIFIAHI GMDTLARGLR+AAKLIEDGSL ELVRKRYQS
Sbjct  372  GIAPGGFNFDAKLRRESTDVEDIFIAHIAGMDTLARGLRNAAKLIEDGSLNELVRKRYQS  431

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            FDSELGA IE GKADFE+LEKKA EWGEPKV SAKQELAEMI QSAL
Sbjct  432  FDSELGALIEAGKADFEMLEKKAKEWGEPKVASAKQELAEMIFQSAL  478



>gb|KDP43806.1| hypothetical protein JCGZ_23014 [Jatropha curcas]
Length=477

 Score =   421 bits (1083),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 212/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARFMEAAVAYKKKIGF G L IEPKPQEPTKHQYDWDAAT ANFLRK GLI EFKLNIE
Sbjct  250  LARFMEAAVAYKKKIGFNGILLIEPKPQEPTKHQYDWDAATAANFLRKYGLIGEFKLNIE  309

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEAT+VMLSVI+N
Sbjct  310  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDIAEATMVMLSVIRN  369

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHIGGMDTLARGLR+AA+LIEDGSL ELVRKRYQ
Sbjct  370  GGLAPGGFNFDAKLRRESTDVEDLFIAHIGGMDTLARGLRNAARLIEDGSLAELVRKRYQ  429

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADFE LEKKA EWGEPKVPSAKQELAEMI QSAL
Sbjct  430  SFDTEIGAQIEAGKADFETLEKKAFEWGEPKVPSAKQELAEMIFQSAL  477



>ref|XP_010688511.1| PREDICTED: xylose isomerase isoform X3 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   421 bits (1083),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 200/227 (88%), Positives = 213/227 (94%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            ARF+EAA  YKKKIGFKGTL IEPKPQEPTKHQYDWDAATT NFLRK GLIDEFKLNIEC
Sbjct  249  ARFLEAAANYKKKIGFKGTLLIEPKPQEPTKHQYDWDAATTTNFLRKYGLIDEFKLNIEC  308

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATLSGHSCHH++ETARINGLLGNIDANSGDPQTGWDTDQF  D+AEAT+VMLSVIKNG
Sbjct  309  NHATLSGHSCHHDLETARINGLLGNIDANSGDPQTGWDTDQFMTDIAEATMVMLSVIKNG  368

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            G+APGGFNFDAKLRRESTDVED+FIAH+ GMDT+ARGLR+AAKLIEDGSL ELV+KRYQS
Sbjct  369  GMAPGGFNFDAKLRRESTDVEDLFIAHVSGMDTMARGLRNAAKLIEDGSLGELVKKRYQS  428

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            FDSE+GA IE GKADFE LEKKA+EWGEPKVPS KQELAEMI QSAL
Sbjct  429  FDSEIGAKIEAGKADFEYLEKKAIEWGEPKVPSGKQELAEMIFQSAL  475



>ref|XP_010688509.1| PREDICTED: xylose isomerase isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=486

 Score =   421 bits (1083),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 200/227 (88%), Positives = 213/227 (94%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            ARF+EAA  YKKKIGFKGTL IEPKPQEPTKHQYDWDAATT NFLRK GLIDEFKLNIEC
Sbjct  260  ARFLEAAANYKKKIGFKGTLLIEPKPQEPTKHQYDWDAATTTNFLRKYGLIDEFKLNIEC  319

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATLSGHSCHH++ETARINGLLGNIDANSGDPQTGWDTDQF  D+AEAT+VMLSVIKNG
Sbjct  320  NHATLSGHSCHHDLETARINGLLGNIDANSGDPQTGWDTDQFMTDIAEATMVMLSVIKNG  379

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            G+APGGFNFDAKLRRESTDVED+FIAH+ GMDT+ARGLR+AAKLIEDGSL ELV+KRYQS
Sbjct  380  GMAPGGFNFDAKLRRESTDVEDLFIAHVSGMDTMARGLRNAAKLIEDGSLGELVKKRYQS  439

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            FDSE+GA IE GKADFE LEKKA+EWGEPKVPS KQELAEMI QSAL
Sbjct  440  FDSEIGAKIEAGKADFEYLEKKAIEWGEPKVPSGKQELAEMIFQSAL  486



>ref|XP_012065287.1| PREDICTED: xylose isomerase [Jatropha curcas]
Length=526

 Score =   422 bits (1085),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 212/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARFMEAAVAYKKKIGF G L IEPKPQEPTKHQYDWDAAT ANFLRK GLI EFKLNIE
Sbjct  299  LARFMEAAVAYKKKIGFNGILLIEPKPQEPTKHQYDWDAATAANFLRKYGLIGEFKLNIE  358

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEAT+VMLSVI+N
Sbjct  359  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDIAEATMVMLSVIRN  418

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHIGGMDTLARGLR+AA+LIEDGSL ELVRKRYQ
Sbjct  419  GGLAPGGFNFDAKLRRESTDVEDLFIAHIGGMDTLARGLRNAARLIEDGSLAELVRKRYQ  478

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADFE LEKKA EWGEPKVPSAKQELAEMI QSAL
Sbjct  479  SFDTEIGAQIEAGKADFETLEKKAFEWGEPKVPSAKQELAEMIFQSAL  526



>ref|XP_010688508.1| PREDICTED: xylose isomerase isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=517

 Score =   421 bits (1083),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 200/227 (88%), Positives = 213/227 (94%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            ARF+EAA  YKKKIGFKGTL IEPKPQEPTKHQYDWDAATT NFLRK GLIDEFKLNIEC
Sbjct  291  ARFLEAAANYKKKIGFKGTLLIEPKPQEPTKHQYDWDAATTTNFLRKYGLIDEFKLNIEC  350

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATLSGHSCHH++ETARINGLLGNIDANSGDPQTGWDTDQF  D+AEAT+VMLSVIKNG
Sbjct  351  NHATLSGHSCHHDLETARINGLLGNIDANSGDPQTGWDTDQFMTDIAEATMVMLSVIKNG  410

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            G+APGGFNFDAKLRRESTDVED+FIAH+ GMDT+ARGLR+AAKLIEDGSL ELV+KRYQS
Sbjct  411  GMAPGGFNFDAKLRRESTDVEDLFIAHVSGMDTMARGLRNAAKLIEDGSLGELVKKRYQS  470

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            FDSE+GA IE GKADFE LEKKA+EWGEPKVPS KQELAEMI QSAL
Sbjct  471  FDSEIGAKIEAGKADFEYLEKKAIEWGEPKVPSGKQELAEMIFQSAL  517



>ref|XP_002277520.2| PREDICTED: xylose isomerase [Vitis vinifera]
 ref|XP_010656801.1| PREDICTED: xylose isomerase [Vitis vinifera]
Length=478

 Score =   418 bits (1074),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 197/228 (86%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF+EAA AYKKKIGF GTL IEPKPQEPTKHQYDWDAATTANFLRK GLI EFKLNIE
Sbjct  251  LARFLEAAAAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATTANFLRKYGLIGEFKLNIE  310

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETAR+NGLLGNIDAN+GDPQ GWDTDQF  D+AEAT+VMLSV++N
Sbjct  311  CNHATLSGHSCHHELETARLNGLLGNIDANTGDPQIGWDTDQFLTDIAEATMVMLSVVRN  370

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FI+HI GMDTLARGLR+ AKLIEDGSL+ LVRKRYQ
Sbjct  371  GGLAPGGFNFDAKLRRESTDVEDLFISHISGMDTLARGLRNVAKLIEDGSLENLVRKRYQ  430

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADFE+LEKKA+EWGEPKVPSAKQELAEMI QSAL
Sbjct  431  SFDTEIGAQIEAGKADFEMLEKKAMEWGEPKVPSAKQELAEMIFQSAL  478



>ref|XP_011648918.1| PREDICTED: xylose isomerase [Cucumis sativus]
 ref|XP_011648919.1| PREDICTED: xylose isomerase [Cucumis sativus]
 gb|KGN61107.1| hypothetical protein Csa_2G049960 [Cucumis sativus]
Length=476

 Score =   417 bits (1071),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 194/227 (85%), Positives = 213/227 (94%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            ARF +AAVAYKKKIGF GTL IEPKPQEPTKHQYDWDAAT+ANFLRK GLIDEF+LNIEC
Sbjct  250  ARFFQAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATSANFLRKYGLIDEFQLNIEC  309

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TLSGHSCHH++ETAR+NG+LG+IDAN+GDPQ GWDTDQF  D+AEAT+VMLSV++NG
Sbjct  310  NHVTLSGHSCHHDLETARLNGILGSIDANTGDPQVGWDTDQFMTDIAEATMVMLSVVRNG  369

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GLAPGGFNFDAKLRRESTDVED+FIAHIGGMDTLARGLR+ AKL+EDGSL ELVRKRY+S
Sbjct  370  GLAPGGFNFDAKLRRESTDVEDLFIAHIGGMDTLARGLRNVAKLLEDGSLTELVRKRYES  429

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            FD+E+GA IE GKADFE LEKKALEWGEPKVPSAKQELAEMI QSAL
Sbjct  430  FDTEIGAQIEAGKADFEFLEKKALEWGEPKVPSAKQELAEMIFQSAL  476



>emb|CBI17768.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   418 bits (1075),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 197/228 (86%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF+EAA AYKKKIGF GTL IEPKPQEPTKHQYDWDAATTANFLRK GLI EFKLNIE
Sbjct  299  LARFLEAAAAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATTANFLRKYGLIGEFKLNIE  358

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETAR+NGLLGNIDAN+GDPQ GWDTDQF  D+AEAT+VMLSV++N
Sbjct  359  CNHATLSGHSCHHELETARLNGLLGNIDANTGDPQIGWDTDQFLTDIAEATMVMLSVVRN  418

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FI+HI GMDTLARGLR+ AKLIEDGSL+ LVRKRYQ
Sbjct  419  GGLAPGGFNFDAKLRRESTDVEDLFISHISGMDTLARGLRNVAKLIEDGSLENLVRKRYQ  478

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADFE+LEKKA+EWGEPKVPSAKQELAEMI QSAL
Sbjct  479  SFDTEIGAQIEAGKADFEMLEKKAMEWGEPKVPSAKQELAEMIFQSAL  526



>emb|CAN65150.1| hypothetical protein VITISV_037086 [Vitis vinifera]
Length=462

 Score =   415 bits (1067),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 196/228 (86%), Positives = 212/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF+EAA AYKKKIGF GTL IEPKPQEPTKHQYDWDAATTANFLRK GLI EFKLNIE
Sbjct  235  LARFLEAAAAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATTANFLRKYGLIGEFKLNIE  294

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETAR+NGLLGNIDAN+GDPQ GWDTDQF  D+AEAT+VMLSV++N
Sbjct  295  CNHATLSGHSCHHELETARLNGLLGNIDANTGDPQIGWDTDQFLTDIAEATMVMLSVVRN  354

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FI+HI GMDTLARGLR+ AKLIED SL+ LVRKRYQ
Sbjct  355  GGLAPGGFNFDAKLRRESTDVEDLFISHISGMDTLARGLRNVAKLIEDXSLENLVRKRYQ  414

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADFE+LEKKA+EWGEPKVPSAKQELAEMI QSAL
Sbjct  415  SFDTEIGAQIEAGKADFEMLEKKAMEWGEPKVPSAKQELAEMIFQSAL  462



>ref|XP_008452100.1| PREDICTED: xylose isomerase [Cucumis melo]
 ref|XP_008452108.1| PREDICTED: xylose isomerase [Cucumis melo]
Length=476

 Score =   416 bits (1068),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 193/227 (85%), Positives = 214/227 (94%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            ARF +AAVAYKKKIGF GTL IEPKPQEPTKHQYDWDAAT+ANFLRK GLID+F+LNIEC
Sbjct  250  ARFFQAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATSANFLRKYGLIDDFQLNIEC  309

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TLSGHSCHH++ETAR+NG+LG+IDAN+GDPQ GWDTDQF MD++EAT+VMLSV++NG
Sbjct  310  NHVTLSGHSCHHDLETARLNGILGSIDANTGDPQVGWDTDQFMMDLSEATMVMLSVVRNG  369

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GLAPGGFNFDAKLRRESTDVED+FIAHIGGMDTLARGLR+ AKL+EDGSL ELVRKRY+S
Sbjct  370  GLAPGGFNFDAKLRRESTDVEDLFIAHIGGMDTLARGLRNVAKLLEDGSLTELVRKRYES  429

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            FD+E+GA IE GKADFE LEKKALEWGEPKVPSAKQELAEMI QSAL
Sbjct  430  FDTEIGAQIEAGKADFEFLEKKALEWGEPKVPSAKQELAEMIFQSAL  476



>ref|XP_011018165.1| PREDICTED: xylose isomerase [Populus euphratica]
 ref|XP_011018166.1| PREDICTED: xylose isomerase [Populus euphratica]
Length=477

 Score =   414 bits (1065),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 197/228 (86%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVAYKKKIGF GTL IEPKPQEPTKHQYDWDAATTANFLRK GLI EFKLNIE
Sbjct  250  LARFCEAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATTANFLRKYGLIGEFKLNIE  309

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D++EAT+VMLSVI+N
Sbjct  310  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFMTDISEATMVMLSVIRN  369

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRREST+VEDIF+AHI GMDTLARGLRSAAKLI+DGSL ELVRKRYQ
Sbjct  370  GGLAPGGFNFDAKLRRESTEVEDIFLAHISGMDTLARGLRSAAKLIQDGSLAELVRKRYQ  429

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA +E GK DFE LEK A++WGEPKVPSAKQELAEMI QSAL
Sbjct  430  SFDTEIGAQVEAGKGDFETLEKLAMKWGEPKVPSAKQELAEMIFQSAL  477



>dbj|BAD95103.1| xylose isomerase [Arabidopsis thaliana]
Length=233

 Score =   405 bits (1041),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVAYKKKIGFKGTL IEPKPQEPTKHQYDWDAAT ANFLRK GLIDEFKLNIE
Sbjct  6    LARFFEAAVAYKKKIGFKGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGLIDEFKLNIE  65

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGH+CHHE+ETARINGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SVIKN
Sbjct  66   CNHATLSGHTCHHELETARINGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSVIKN  125

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+GSL ELVRKRY 
Sbjct  126  GGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAVKILEEGSLSELVRKRYA  185

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            ++DSELG  IE GKADFE LEKKA E+GEPKV SAKQELAEMI QSA+
Sbjct  186  TWDSELGKQIEEGKADFEYLEKKAKEFGEPKVSSAKQELAEMIFQSAM  233



>gb|KHN17567.1| Xylose isomerase [Glycine soja]
Length=480

 Score =   414 bits (1064),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 198/228 (87%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVAYKKKIGF GT  IEPKPQEPTKHQYDWDAAT+ANFLRK GL  EFKLNIE
Sbjct  253  LARFFEAAVAYKKKIGFNGTFLIEPKPQEPTKHQYDWDAATSANFLRKYGLTGEFKLNIE  312

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF +D+ EATL+MLSVI+N
Sbjct  313  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFLVDIQEATLIMLSVIRN  372

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRKRYQ
Sbjct  373  GGLAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTLARGLRNAAKLIEDGSLAELVRKRYQ  432

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADFELLEKK  EWGEPKV SAKQELAEMILQS L
Sbjct  433  SFDTEIGAQIEAGKADFELLEKKVKEWGEPKVASAKQELAEMILQSVL  480



>ref|XP_003549495.1| PREDICTED: xylose isomerase [Glycine max]
Length=480

 Score =   414 bits (1064),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 198/228 (87%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVAYKKKIGF GT  IEPKPQEPTKHQYDWDAAT+ANFLRK GL  EFKLNIE
Sbjct  253  LARFFEAAVAYKKKIGFNGTFLIEPKPQEPTKHQYDWDAATSANFLRKYGLTGEFKLNIE  312

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF +D+ EATL+MLSVI+N
Sbjct  313  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFLVDIQEATLIMLSVIRN  372

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRKRYQ
Sbjct  373  GGLAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTLARGLRNAAKLIEDGSLAELVRKRYQ  432

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADFELLEKK  EWGEPKV SAKQELAEMILQS L
Sbjct  433  SFDTEIGAQIEAGKADFELLEKKVKEWGEPKVASAKQELAEMILQSVL  480



>ref|XP_008223675.1| PREDICTED: xylose isomerase [Prunus mume]
Length=479

 Score =   413 bits (1062),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF+EAAVAYKKKIG+ GTL IEPKPQEPTKHQYDWDAAT+ANFLRK GLI EFKLNIE
Sbjct  252  LARFLEAAVAYKKKIGYNGTLLIEPKPQEPTKHQYDWDAATSANFLRKYGLIGEFKLNIE  311

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETAR+NGLLGNIDAN+GDPQTGWDTDQF  D+AEATLVML+V+KN
Sbjct  312  CNHATLSGHSCHHELETARLNGLLGNIDANTGDPQTGWDTDQFLTDIAEATLVMLTVVKN  371

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+  KLIEDGSL ELVRKRY+
Sbjct  372  GGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTLARGLRNVVKLIEDGSLDELVRKRYE  431

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GK DFE LEKKA+EWGEPKVPSAKQELAEM+ QS L
Sbjct  432  SFDTEIGAHIEAGKGDFEYLEKKAIEWGEPKVPSAKQELAEMLFQSVL  479



>ref|XP_007222807.1| hypothetical protein PRUPE_ppa005065mg [Prunus persica]
 gb|EMJ24006.1| hypothetical protein PRUPE_ppa005065mg [Prunus persica]
Length=479

 Score =   413 bits (1062),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF+EAAVAYKKKIGF GTL IEPKPQEPTKHQYDWDAAT+ANFLRK GLI EFKLNIE
Sbjct  252  LARFLEAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATSANFLRKYGLIGEFKLNIE  311

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETAR+NGLLGNIDAN+GDPQTGWDTDQF  D+AEATLVML+V+KN
Sbjct  312  CNHATLSGHSCHHELETARLNGLLGNIDANTGDPQTGWDTDQFLTDIAEATLVMLTVVKN  371

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+  KLIEDGSL ELVRKRY+
Sbjct  372  GGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTLARGLRNVVKLIEDGSLDELVRKRYE  431

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GK DFE LEKKA+EWGEP+VPSAKQELAEM+ QS L
Sbjct  432  SFDTEIGAHIEAGKGDFEYLEKKAIEWGEPRVPSAKQELAEMLFQSVL  479



>ref|XP_010102992.1| Xylose isomerase [Morus notabilis]
 gb|EXB94559.1| Xylose isomerase [Morus notabilis]
Length=482

 Score =   413 bits (1062),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 199/227 (88%), Positives = 212/227 (93%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            ARF+EAAVAYKKKIGFKGTL IEPKPQEPTKHQYDWDAATTANFLRK GLI EFKLNIEC
Sbjct  256  ARFLEAAVAYKKKIGFKGTLLIEPKPQEPTKHQYDWDAATTANFLRKYGLIGEFKLNIEC  315

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATL+GHSCHHE+ETAR+N LLGNIDAN+GDPQ GWDTDQF  D+AEAT+VM SV+KNG
Sbjct  316  NHATLAGHSCHHELETARLNDLLGNIDANTGDPQIGWDTDQFLTDIAEATMVMQSVVKNG  375

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGL +AAK+IEDGSL ELVRKRY S
Sbjct  376  GLAPGGFNFDAKLRRESTDVEDLFIAHISGMDTLARGLCNAAKIIEDGSLAELVRKRYAS  435

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            FD+ELGA IE GKADFELLEKKAL+WGEPKVPSAKQELAEMI QSAL
Sbjct  436  FDTELGALIETGKADFELLEKKALQWGEPKVPSAKQELAEMIFQSAL  482



>ref|XP_002324488.1| hypothetical protein POPTR_0018s10460g [Populus trichocarpa]
 gb|EEF03053.1| hypothetical protein POPTR_0018s10460g [Populus trichocarpa]
Length=477

 Score =   413 bits (1061),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 197/228 (86%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVAYKKKIGF GTL IEPKPQEPTKHQYDWDAATTANFLRK GLI EFKLNIE
Sbjct  250  LARFCEAAVAYKKKIGFIGTLLIEPKPQEPTKHQYDWDAATTANFLRKYGLIGEFKLNIE  309

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D++EAT+VM+SVI+N
Sbjct  310  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFMTDISEATMVMISVIRN  369

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRREST+VEDIF+AHI GMDTLARGLRSAAKLI+DGSL ELVRKRYQ
Sbjct  370  GGLAPGGFNFDAKLRRESTEVEDIFLAHISGMDTLARGLRSAAKLIQDGSLAELVRKRYQ  429

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GK DFE LEK A++WGEPKVPSAKQELAEMI QSAL
Sbjct  430  SFDTEIGAQIEAGKGDFETLEKLAMKWGEPKVPSAKQELAEMIFQSAL  477



>ref|XP_011069881.1| PREDICTED: xylose isomerase-like [Sesamum indicum]
Length=475

 Score =   412 bits (1060),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 198/228 (87%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A F+EAA AYKKKIGF GTL IEPKPQEPTKHQYDWDAAT ANFLRK GLIDEFKLNIE
Sbjct  248  MASFLEAAAAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGLIDEFKLNIE  307

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF MDV+EATLVMLSVIKN
Sbjct  308  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFMMDVSEATLVMLSVIKN  367

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVEDIFIAHI GMDT+ARGLR+AAKL+ DG L ELVR+RYQ
Sbjct  368  GGLAPGGFNFDAKLRRESTDVEDIFIAHIAGMDTVARGLRNAAKLLADGLLSELVRQRYQ  427

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+ELGA IE GK DF+LLEKKA+EWGEP V SAKQELAEMI QSAL
Sbjct  428  SFDTELGAQIEAGKGDFDLLEKKAIEWGEPTVASAKQELAEMIFQSAL  475



>ref|XP_007011128.1| Xylose isomerase family protein isoform 2 [Theobroma cacao]
 gb|EOY19938.1| Xylose isomerase family protein isoform 2 [Theobroma cacao]
Length=471

 Score =   412 bits (1059),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 197/228 (86%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF+EAAVAYKKKIGF GTL IEPKPQEPTKHQYDWDAATTANFLRK GL+ EFKLNIE
Sbjct  244  LARFLEAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATTANFLRKYGLLGEFKLNIE  303

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHH++ETARINGLLGNIDAN+GDPQ GWDTDQF  D+ EAT+VMLSVI+N
Sbjct  304  CNHATLSGHSCHHDLETARINGLLGNIDANTGDPQIGWDTDQFMTDIGEATMVMLSVIRN  363

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRKRY 
Sbjct  364  GGLAPGGFNFDAKLRRESTDVEDLFIAHISGMDTLARGLRNAAKLIEDGSLVELVRKRYS  423

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADFE+LEK A EWGEPKV SAKQELAEMI QSAL
Sbjct  424  SFDTEIGAEIEAGKADFEMLEKLAKEWGEPKVASAKQELAEMIFQSAL  471



>ref|XP_010102993.1| Xylose isomerase [Morus notabilis]
 gb|EXB94560.1| Xylose isomerase [Morus notabilis]
Length=523

 Score =   414 bits (1063),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 212/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF+EAAVAYKKKIGFKGTL IEPKPQEPTKHQYDWDAATTANFLRK GLI EFKLNIE
Sbjct  296  MARFLEAAVAYKKKIGFKGTLLIEPKPQEPTKHQYDWDAATTANFLRKYGLIGEFKLNIE  355

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATL+GHSCHHE+ETAR+N LLGNIDAN+GDPQ GWDTDQF  D+AEAT+VM SV+KN
Sbjct  356  CNHATLAGHSCHHELETARLNDLLGNIDANTGDPQIGWDTDQFLTDIAEATMVMQSVVKN  415

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGL +AAK+IEDGSL ELVRKRY 
Sbjct  416  GGLAPGGFNFDAKLRRESTDVEDLFIAHISGMDTLARGLCNAAKIIEDGSLAELVRKRYA  475

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+ELGA IE GKADFELLEKKAL+WGEPKVPSAKQELAEMI QSAL
Sbjct  476  SFDTELGALIETGKADFELLEKKALQWGEPKVPSAKQELAEMIFQSAL  523



>gb|ACJ84879.1| unknown [Medicago truncatula]
Length=329

 Score =   405 bits (1041),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVA+KKKIGF GT  IEPKPQEPTKHQYDWDAAT ANFLRK GLI EFKLNIE
Sbjct  102  LARFFEAAVAHKKKIGFNGTFLIEPKPQEPTKHQYDWDAATAANFLRKYGLIGEFKLNIE  161

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDT+QF +D+ EAT++MLSVI+N
Sbjct  162  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTNQFLVDIQEATMIMLSVIRN  221

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD KLRRESTDVED+FIAHI GMDT+ARGLR+AAKL+EDGSL ELVRKRYQ
Sbjct  222  GGIAPGGFNFDVKLRRESTDVEDLFIAHIVGMDTMARGLRNAAKLVEDGSLAELVRKRYQ  281

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADF+ LEKK  EWGEPKV SAKQELAEMI Q+A+
Sbjct  282  SFDTEIGAQIEAGKADFDFLEKKVKEWGEPKVASAKQELAEMIFQNAM  329



>ref|XP_006453438.1| hypothetical protein CICLE_v10008154mg [Citrus clementina]
 ref|XP_006474142.1| PREDICTED: xylose isomerase-like [Citrus sinensis]
 gb|ESR66678.1| hypothetical protein CICLE_v10008154mg [Citrus clementina]
Length=478

 Score =   410 bits (1053),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 193/228 (85%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A F E+A AYKKKIGFKG L IEPKPQEPTKHQYDWDAAT ANFLRK GLI++FKLNIE
Sbjct  251  MANFFESAAAYKKKIGFKGNLLIEPKPQEPTKHQYDWDAATAANFLRKYGLINDFKLNIE  310

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHH++ETAR+NGLLGNIDAN+GDPQ GWDTDQF  D+ EAT +MLSVIKN
Sbjct  311  CNHATLSGHSCHHDIETARLNGLLGNIDANTGDPQVGWDTDQFLTDIGEATSIMLSVIKN  370

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+AAKLIEDGSL ELVRKRYQ
Sbjct  371  GGLAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTVARGLRTAAKLIEDGSLPELVRKRYQ  430

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFDSE+G  IE GKADFE+LEKKA+EWGEPKVPSAKQELAEMI QSA+
Sbjct  431  SFDSEIGQKIEAGKADFEMLEKKAMEWGEPKVPSAKQELAEMIFQSAI  478



>ref|XP_007011127.1| Xylose isomerase family protein isoform 1 [Theobroma cacao]
 gb|EOY19937.1| Xylose isomerase family protein isoform 1 [Theobroma cacao]
Length=538

 Score =   412 bits (1058),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 197/228 (86%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF+EAAVAYKKKIGF GTL IEPKPQEPTKHQYDWDAATTANFLRK GL+ EFKLNIE
Sbjct  311  LARFLEAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATTANFLRKYGLLGEFKLNIE  370

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHH++ETARINGLLGNIDAN+GDPQ GWDTDQF  D+ EAT+VMLSVI+N
Sbjct  371  CNHATLSGHSCHHDLETARINGLLGNIDANTGDPQIGWDTDQFMTDIGEATMVMLSVIRN  430

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRKRY 
Sbjct  431  GGLAPGGFNFDAKLRRESTDVEDLFIAHISGMDTLARGLRNAAKLIEDGSLVELVRKRYS  490

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADFE+LEK A EWGEPKV SAKQELAEMI QSAL
Sbjct  491  SFDTEIGAEIEAGKADFEMLEKLAKEWGEPKVASAKQELAEMIFQSAL  538



>ref|XP_009348411.1| PREDICTED: xylose isomerase-like [Pyrus x bretschneideri]
Length=477

 Score =   409 bits (1052),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 212/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF+EAAVAYKKKIG+ GTL IEPKPQEPTKHQYDWDAAT+ANFLRK GLI EFKLNIE
Sbjct  250  LARFLEAAVAYKKKIGYNGTLLIEPKPQEPTKHQYDWDAATSANFLRKYGLIGEFKLNIE  309

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSC+HE+ETAR+NGLLGN+DAN+GDPQTGWDTDQF  D+AEATLVM SV+KN
Sbjct  310  CNHATLSGHSCYHELETARLNGLLGNVDANTGDPQTGWDTDQFLTDIAEATLVMQSVVKN  369

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFDAKLRRESTDVED+FIAHIGGMDTLARGLR+ AKL+EDGSL +LVRKRY+
Sbjct  370  GGIAPGGFNFDAKLRRESTDVEDLFIAHIGGMDTLARGLRNVAKLVEDGSLPDLVRKRYK  429

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADFE LEKKA+EWGEP VPSAKQELAEM+ QS L
Sbjct  430  SFDTEVGALIEAGKADFEYLEKKAIEWGEPTVPSAKQELAEMLFQSVL  477



>gb|KDO62435.1| hypothetical protein CISIN_1g0373932mg, partial [Citrus sinensis]
Length=487

 Score =   409 bits (1052),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 193/227 (85%), Positives = 209/227 (92%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F E+A AYKKKIGFKG L IEPKPQEPTKHQYDWDAAT ANFLRK GLI++FKLNIEC
Sbjct  261  ANFFESAAAYKKKIGFKGNLLIEPKPQEPTKHQYDWDAATAANFLRKYGLINDFKLNIEC  320

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATLSGHSCHH++ETAR+NGLLGNIDAN+GDPQ GWDTDQF  D+ EAT +MLSVIKNG
Sbjct  321  NHATLSGHSCHHDIETARLNGLLGNIDANTGDPQVGWDTDQFLTDIGEATSIMLSVIKNG  380

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GLAPGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+AAKLIEDGSL ELVRKRYQS
Sbjct  381  GLAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTVARGLRTAAKLIEDGSLPELVRKRYQS  440

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            FDSE+G  IE GKADFE+LEKKA+EWGEPKVPSAKQELAEMI QSA+
Sbjct  441  FDSEIGQKIEAGKADFEMLEKKAMEWGEPKVPSAKQELAEMIFQSAI  487



>ref|XP_007154797.1| hypothetical protein PHAVU_003G148700g [Phaseolus vulgaris]
 gb|ESW26791.1| hypothetical protein PHAVU_003G148700g [Phaseolus vulgaris]
Length=479

 Score =   409 bits (1050),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 196/227 (86%), Positives = 208/227 (92%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            ARF EAAVAYKKKIGF GTL IEPKPQEPTKHQYDWDAAT+ANFLRK GL  EFKLNIEC
Sbjct  253  ARFFEAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATSANFLRKYGLAGEFKLNIEC  312

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATLSGHSC HE+ETARINGLLGNIDAN+GDPQ GWDTDQF +D+ EATL+MLSVI+NG
Sbjct  313  NHATLSGHSCQHELETARINGLLGNIDANTGDPQVGWDTDQFLVDIQEATLIMLSVIRNG  372

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLI+DGSL ELVRKRYQS
Sbjct  373  GLAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTLARGLRNAAKLIKDGSLSELVRKRYQS  432

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            FD+E+GA IE GKADFELLEKK  EWGEP V SAKQELAEMI QSAL
Sbjct  433  FDTEIGAQIEAGKADFELLEKKVKEWGEPTVASAKQELAEMIFQSAL  479



>gb|KHG02217.1| Xylose isomerase -like protein [Gossypium arboreum]
Length=475

 Score =   408 bits (1048),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 193/227 (85%), Positives = 209/227 (92%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A+F+EAA AYKK+IGF GTL IEPKPQEPTKHQYDWDAATT NFLRK GL+ EFKLNIEC
Sbjct  249  AKFLEAAAAYKKRIGFNGTLLIEPKPQEPTKHQYDWDAATTLNFLRKYGLLAEFKLNIEC  308

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATLSGHSCHH++ETARING+LGNIDAN+GDPQ GWDTDQF  DV EAT+VM+SVI+NG
Sbjct  309  NHATLSGHSCHHDLETARINGMLGNIDANTGDPQVGWDTDQFLTDVGEATMVMISVIRNG  368

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELV KRY S
Sbjct  369  GLAPGGFNFDAKLRRESTDVEDLFIAHISGMDTLARGLRNAAKLIEDGSLAELVSKRYSS  428

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            FD+ELGA IE GKADFE+LEKKA+EWGEPKV SAKQELAEMI QSAL
Sbjct  429  FDTELGAQIEAGKADFEMLEKKAMEWGEPKVASAKQELAEMIFQSAL  475



>ref|XP_004507817.1| PREDICTED: xylose isomerase-like isoform X3 [Cicer arietinum]
Length=479

 Score =   408 bits (1048),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVA+KKKIGF GTL IEPKPQEPTKHQYDWDAATTANFLRK GL  EFKLNIE
Sbjct  252  LARFFEAAVAHKKKIGFNGTLLIEPKPQEPTKHQYDWDAATTANFLRKYGLEGEFKLNIE  311

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF +D+ EAT++MLSVI+N
Sbjct  312  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFLVDIQEATMIMLSVIRN  371

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
             G+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+AAKLIEDGSL ELVRKRYQ
Sbjct  372  DGIAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTMARGLRTAAKLIEDGSLAELVRKRYQ  431

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADF+LLEKKA EWGEPKV SAKQELAEMI QSA+
Sbjct  432  SFDTEIGAQIEAGKADFDLLEKKAKEWGEPKVASAKQELAEMIFQSAI  479



>gb|KJB60238.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
 gb|KJB60242.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
Length=475

 Score =   407 bits (1047),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A+F+EAA AYKKKIGF GTL IEPKPQEPTKHQYDWDAATT NFL K GL+ EFKLNIE
Sbjct  248  MAKFLEAAAAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATTLNFLHKYGLLGEFKLNIE  307

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHH++ETARING+LGNIDAN+GDPQ GWDTDQF  DV EAT+VMLSVI+N
Sbjct  308  CNHATLSGHSCHHDLETARINGMLGNIDANTGDPQVGWDTDQFLTDVGEATMVMLSVIRN  367

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRES DVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRKRY 
Sbjct  368  GGLAPGGFNFDAKLRRESKDVEDLFIAHISGMDTLARGLRNAAKLIEDGSLAELVRKRYS  427

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+ELGA IE GKADFE+LEKKA+EWGEPKV SAKQELAEMI QSAL
Sbjct  428  SFDTELGAQIEAGKADFEMLEKKAMEWGEPKVASAKQELAEMIFQSAL  475



>gb|KJB60240.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
Length=474

 Score =   407 bits (1047),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A+F+EAA AYKKKIGF GTL IEPKPQEPTKHQYDWDAATT NFL K GL+ EFKLNIE
Sbjct  247  MAKFLEAAAAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATTLNFLHKYGLLGEFKLNIE  306

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHH++ETARING+LGNIDAN+GDPQ GWDTDQF  DV EAT+VMLSVI+N
Sbjct  307  CNHATLSGHSCHHDLETARINGMLGNIDANTGDPQVGWDTDQFLTDVGEATMVMLSVIRN  366

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRES DVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRKRY 
Sbjct  367  GGLAPGGFNFDAKLRRESKDVEDLFIAHISGMDTLARGLRNAAKLIEDGSLAELVRKRYS  426

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+ELGA IE GKADFE+LEKKA+EWGEPKV SAKQELAEMI QSAL
Sbjct  427  SFDTELGAQIEAGKADFEMLEKKAMEWGEPKVASAKQELAEMIFQSAL  474



>ref|XP_009336656.1| PREDICTED: xylose isomerase-like [Pyrus x bretschneideri]
Length=477

 Score =   407 bits (1047),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF+EAAVAYKKKIG+ GTL IEPKPQEPTKHQYDWDAAT+ANFLRK GLI EFKLNIE
Sbjct  250  LARFLEAAVAYKKKIGYNGTLLIEPKPQEPTKHQYDWDAATSANFLRKYGLIGEFKLNIE  309

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSC+HE+ETAR+NGLLGN+DAN+GDPQTGWDTDQF  D+AEATLVM SV+KN
Sbjct  310  CNHATLSGHSCYHELETARLNGLLGNVDANTGDPQTGWDTDQFLTDIAEATLVMQSVVKN  369

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFDAKLRRESTDVED+FIAHIGGMDTLARGLR+ AKL+EDGSL +LVRKRY+
Sbjct  370  GGIAPGGFNFDAKLRRESTDVEDLFIAHIGGMDTLARGLRNVAKLVEDGSLPDLVRKRYK  429

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADFE LEKKA+EWGEP VPSAKQELAEM  QS L
Sbjct  430  SFDTEVGALIEAGKADFEYLEKKAIEWGEPTVPSAKQELAEMHFQSVL  477



>ref|XP_008365436.1| PREDICTED: xylose isomerase-like [Malus domestica]
 ref|XP_008365437.1| PREDICTED: xylose isomerase-like [Malus domestica]
Length=477

 Score =   407 bits (1047),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 191/228 (84%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF+EAAVAYKKKIG+ GTL IEPKPQEPTKHQYDWDAAT+ANFLRK GLI EFKLNIE
Sbjct  250  LARFLEAAVAYKKKIGYNGTLLIEPKPQEPTKHQYDWDAATSANFLRKYGLIGEFKLNIE  309

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSC+HE+ETAR+NGLLGN+DAN+GDPQTGWDTDQF  D+AEATLVM SV+KN
Sbjct  310  CNHATLSGHSCYHELETARLNGLLGNVDANTGDPQTGWDTDQFLTDIAEATLVMQSVVKN  369

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+ AKL+EDGSL +LVRKRY+
Sbjct  370  GGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTLARGLRNVAKLVEDGSLPDLVRKRYK  429

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADFE LEKKA+EWGEP VPSAKQELAEM+ QS L
Sbjct  430  SFDTEVGALIEAGKADFEYLEKKAIEWGEPTVPSAKQELAEMLFQSVL  477



>ref|XP_010259769.1| PREDICTED: xylose isomerase isoform X2 [Nelumbo nucifera]
Length=479

 Score =   407 bits (1045),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 193/228 (85%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF+EAAVAYKKKIGF G L IEPKPQEPTKHQYDWDAATTA FLRK  L  EFKLNIE
Sbjct  252  LARFLEAAVAYKKKIGFNGILLIEPKPQEPTKHQYDWDAATTAGFLRKYNLSGEFKLNIE  311

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+ EAT+VMLSV++N
Sbjct  312  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDIGEATMVMLSVVRN  371

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+ AKLIEDGSL ELVRKRY+
Sbjct  372  GGLAPGGFNFDAKLRRESTDVEDLFIAHITGMDTLARGLRNVAKLIEDGSLAELVRKRYE  431

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADFE LE KA+EWGEPKVPSAKQELAEM+ QSAL
Sbjct  432  SFDTEIGAQIEAGKADFEFLETKAMEWGEPKVPSAKQELAEMVFQSAL  479



>gb|EPS67638.1| xylose isomerase [Genlisea aurea]
Length=472

 Score =   406 bits (1043),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 195/227 (86%), Positives = 206/227 (91%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            ARF EAAVAYKKKIGF GT  IEPKPQEPTKHQYDWDAAT+ANFLRK GLI+EFKLNIEC
Sbjct  246  ARFFEAAVAYKKKIGFNGTFLIEPKPQEPTKHQYDWDAATSANFLRKYGLINEFKLNIEC  305

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATLSGHSCHHEVETARINGLLGNIDANSGDPQ GWDTDQF MDVAEAT+VMLSVIKNG
Sbjct  306  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQVGWDTDQFMMDVAEATMVMLSVIKNG  365

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GLAPGGFNFDAKLRRESTDVED+FI HI GMDTLARGLR+A KLIE+G L E+V+KRY+S
Sbjct  366  GLAPGGFNFDAKLRRESTDVEDMFIGHIAGMDTLARGLRNARKLIEEGQLSEIVKKRYKS  425

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            FDSELG  IE G  DFELLEKKA+E GEP+V S KQELAEMI QSAL
Sbjct  426  FDSELGGEIEAGNGDFELLEKKAVELGEPQVASGKQELAEMIFQSAL  472



>ref|XP_010259768.1| PREDICTED: xylose isomerase isoform X1 [Nelumbo nucifera]
Length=515

 Score =   406 bits (1044),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 193/228 (85%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF+EAAVAYKKKIGF G L IEPKPQEPTKHQYDWDAATTA FLRK  L  EFKLNIE
Sbjct  288  LARFLEAAVAYKKKIGFNGILLIEPKPQEPTKHQYDWDAATTAGFLRKYNLSGEFKLNIE  347

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+ EAT+VMLSV++N
Sbjct  348  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDIGEATMVMLSVVRN  407

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+ AKLIEDGSL ELVRKRY+
Sbjct  408  GGLAPGGFNFDAKLRRESTDVEDLFIAHITGMDTLARGLRNVAKLIEDGSLAELVRKRYE  467

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADFE LE KA+EWGEPKVPSAKQELAEM+ QSAL
Sbjct  468  SFDTEIGAQIEAGKADFEFLETKAMEWGEPKVPSAKQELAEMVFQSAL  515



>ref|XP_004297371.1| PREDICTED: xylose isomerase [Fragaria vesca subsp. vesca]
 ref|XP_011463128.1| PREDICTED: xylose isomerase [Fragaria vesca subsp. vesca]
Length=478

 Score =   404 bits (1039),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 191/228 (84%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF+EAAVAYKKKIGF GTL IEPKPQEPTKHQYDWDAATTANFLRK GL+ EFKLNIE
Sbjct  251  LARFLEAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATTANFLRKYGLLGEFKLNIE  310

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETAR+NGLLGNIDAN+GDPQ GWDTD+F  D+AEAT VML+V+KN
Sbjct  311  CNHATLSGHSCHHELETARLNGLLGNIDANTGDPQIGWDTDEFLTDIAEATRVMLTVVKN  370

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+F+AHI GMDTLARGL + AKLIEDGSL ELVRKRY+
Sbjct  371  GGLAPGGFNFDAKLRRESTDVEDLFVAHISGMDTLARGLHNVAKLIEDGSLAELVRKRYE  430

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GK DFE LEKKA+EWGEPKVPSAKQELAE + Q AL
Sbjct  431  SFDTEVGAQIEAGKGDFEYLEKKAMEWGEPKVPSAKQELAERLFQFAL  478



>gb|AES92376.2| xylose isomerase [Medicago truncatula]
Length=480

 Score =   404 bits (1039),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 190/228 (83%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVA+KKKIGF GT  IEPKPQEPTKHQYDWDAAT ANFLRK GLI EFKLNIE
Sbjct  253  LARFFEAAVAHKKKIGFNGTFLIEPKPQEPTKHQYDWDAATAANFLRKYGLIGEFKLNIE  312

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF +D+ EAT++MLSVI+N
Sbjct  313  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFLVDIQEATMIMLSVIRN  372

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+AAKL+EDGSL ELVRKRYQ
Sbjct  373  GGIAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTMARGLRNAAKLVEDGSLAELVRKRYQ  432

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADF+ LEKK  EWGEPKV SAKQELAEMI Q+A+
Sbjct  433  SFDTEIGAQIEAGKADFDFLEKKVKEWGEPKVASAKQELAEMIFQNAM  480



>ref|XP_003610179.1| Xylose isomerase [Medicago truncatula]
Length=478

 Score =   404 bits (1039),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 190/228 (83%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVA+KKKIGF GT  IEPKPQEPTKHQYDWDAAT ANFLRK GLI EFKLNIE
Sbjct  251  LARFFEAAVAHKKKIGFNGTFLIEPKPQEPTKHQYDWDAATAANFLRKYGLIGEFKLNIE  310

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF +D+ EAT++MLSVI+N
Sbjct  311  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFLVDIQEATMIMLSVIRN  370

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+AAKL+EDGSL ELVRKRYQ
Sbjct  371  GGIAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTMARGLRNAAKLVEDGSLAELVRKRYQ  430

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADF+ LEKK  EWGEPKV SAKQELAEMI Q+A+
Sbjct  431  SFDTEIGAQIEAGKADFDFLEKKVKEWGEPKVASAKQELAEMIFQNAM  478



>ref|XP_010938719.1| PREDICTED: xylose isomerase [Elaeis guineensis]
Length=479

 Score =   404 bits (1037),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF++AAV YKKKIGF GTL IEPKPQEPTKHQYDWDAAT   FL+K GL+ EFKLNIE
Sbjct  252  LARFLQAAVNYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATAFAFLQKYGLVGEFKLNIE  311

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEATLVMLSV++N
Sbjct  312  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDIAEATLVMLSVVRN  371

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+ AKLIEDGSL ELVRKRY 
Sbjct  372  GGLAPGGFNFDAKLRRESTDVEDLFIAHISGMDTLARGLRNVAKLIEDGSLDELVRKRYS  431

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFDSE+GA IE GKADFE LEKKA+EWGEP V S KQELAEMI QSAL
Sbjct  432  SFDSEIGALIEAGKADFETLEKKAMEWGEPSVASGKQELAEMIFQSAL  479



>gb|KJB60239.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
Length=474

 Score =   404 bits (1037),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 208/228 (91%), Gaps = 1/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A+F+EAA AYKKKIGF GTL IEPKPQEPTKHQYDWDAATT NFL K GL+ EFKLNIE
Sbjct  248  MAKFLEAAAAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATTLNFLHKYGLL-EFKLNIE  306

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHH++ETARING+LGNIDAN+GDPQ GWDTDQF  DV EAT+VMLSVI+N
Sbjct  307  CNHATLSGHSCHHDLETARINGMLGNIDANTGDPQVGWDTDQFLTDVGEATMVMLSVIRN  366

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRES DVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRKRY 
Sbjct  367  GGLAPGGFNFDAKLRRESKDVEDLFIAHISGMDTLARGLRNAAKLIEDGSLAELVRKRYS  426

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+ELGA IE GKADFE+LEKKA+EWGEPKV SAKQELAEMI QSAL
Sbjct  427  SFDTELGAQIEAGKADFEMLEKKAMEWGEPKVASAKQELAEMIFQSAL  474



>ref|XP_008796228.1| PREDICTED: xylose isomerase isoform X2 [Phoenix dactylifera]
 ref|XP_008796229.1| PREDICTED: xylose isomerase isoform X2 [Phoenix dactylifera]
 ref|XP_008796230.1| PREDICTED: xylose isomerase isoform X2 [Phoenix dactylifera]
Length=483

 Score =   401 bits (1031),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 189/228 (83%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF++AAV YKKKIGF GTL IEPKPQEPTKHQYDWDAAT   FL+K GL+ EFKLNIE
Sbjct  256  LARFLQAAVNYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATAFAFLQKYGLLGEFKLNIE  315

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGN+DAN+GDPQ GWDTDQF  D+AEATLVMLSV++N
Sbjct  316  CNHATLSGHSCHHELETARINGLLGNVDANTGDPQIGWDTDQFLTDIAEATLVMLSVVRN  375

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGL + AKLIEDGSL ELVRKRY 
Sbjct  376  GGLAPGGFNFDAKLRRESTDVEDMFIAHISGMDTLARGLHNVAKLIEDGSLDELVRKRYS  435

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA +E GKADFE LEKKA+EWGEP VPS KQELAEMI QSAL
Sbjct  436  SFDTEIGALVEAGKADFETLEKKAMEWGEPSVPSGKQELAEMIFQSAL  483



>ref|NP_568861.3| xylose isomerase [Arabidopsis thaliana]
 sp|Q9FKK7.2|XYLA_ARATH RecName: Full=Xylose isomerase [Arabidopsis thaliana]
 gb|AAM97134.1| expressed protein; supported by full length cDNA: Ceres: 122798 
[Arabidopsis thaliana]
 gb|AAP31951.1| At5g57655 [Arabidopsis thaliana]
 gb|AED96932.1| xylose isomerase [Arabidopsis thaliana]
Length=477

 Score =   401 bits (1030),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVAYKKKIGFKGTL IEPKPQEPTKHQYDWDAAT ANFLRK GLIDEFKLNIE
Sbjct  250  LARFFEAAVAYKKKIGFKGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGLIDEFKLNIE  309

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGH+CHHE+ETARINGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SVIKN
Sbjct  310  CNHATLSGHTCHHELETARINGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSVIKN  369

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+GSL ELVRKRY 
Sbjct  370  GGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAVKILEEGSLSELVRKRYA  429

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            ++DSELG  IE GKADFE LEKKA E+GEPKV SAKQELAEMI QSA+
Sbjct  430  TWDSELGKQIEEGKADFEYLEKKAKEFGEPKVSSAKQELAEMIFQSAM  477



>gb|AFK39166.1| unknown [Medicago truncatula]
Length=480

 Score =   401 bits (1030),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVA+KKKIGF GT  IEPKPQEPTKHQYDWDAAT ANFLRK GLI EFKLNIE
Sbjct  253  LARFFEAAVAHKKKIGFNGTFLIEPKPQEPTKHQYDWDAATAANFLRKYGLIGEFKLNIE  312

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDT+QF +D+ EAT++MLSVI+N
Sbjct  313  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTNQFLVDIQEATMIMLSVIRN  372

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD KLRRESTDVED+FIAHI GMDT+ARGLR+AAKL+EDGSL ELVRKRYQ
Sbjct  373  GGIAPGGFNFDVKLRRESTDVEDLFIAHIVGMDTMARGLRNAAKLVEDGSLAELVRKRYQ  432

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADF+ LEKK  EWGEPKV SAKQELAEMI Q+A+
Sbjct  433  SFDTEIGAQIEAGKADFDFLEKKVKEWGEPKVASAKQELAEMIFQNAM  480



>dbj|BAE98492.1| xylose isomerase [Arabidopsis thaliana]
Length=477

 Score =   401 bits (1030),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVAYKKKIGFKGTL IEPKPQEPTKHQYDWDAAT ANFLRK GLIDEFKLNIE
Sbjct  250  LARFFEAAVAYKKKIGFKGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGLIDEFKLNIE  309

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGH+CHHE+ETARINGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SVIKN
Sbjct  310  CNHATLSGHTCHHELETARINGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSVIKN  369

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+GSL ELVRKRY 
Sbjct  370  GGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAVKILEEGSLSELVRKRYA  429

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            ++DSELG  IE GKADFE LEKKA E+GEPKV SAKQELAEMI QSA+
Sbjct  430  TWDSELGKQIEEGKADFEYLEKKAKEFGEPKVSSAKQELAEMIFQSAM  477



>ref|XP_010065878.1| PREDICTED: xylose isomerase-like isoform X3 [Eucalyptus grandis]
Length=480

 Score =   401 bits (1030),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 189/228 (83%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF+EAAVAYKKKIGF GTL +EPKPQEPTKHQYD D ATTA+FLRK GL+ EFK+N+E
Sbjct  253  MARFLEAAVAYKKKIGFNGTLLLEPKPQEPTKHQYDSDVATTASFLRKYGLLGEFKINVE  312

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETAR+NGL GN+DAN+GDPQ GWDTDQF  D+ EATLVMLSV++N
Sbjct  313  CNHATLSGHSCHHELETARLNGLFGNLDANTGDPQIGWDTDQFLTDIGEATLVMLSVVRN  372

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGG NFDAKLRRESTDVED+FIAHIGGMDTLARGLR+ AKLIEDGSL ELVRKRY+
Sbjct  373  GGLAPGGINFDAKLRRESTDVEDLFIAHIGGMDTLARGLRNVAKLIEDGSLDELVRKRYE  432

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E GA IE GK DFE LEKKA+EWGEPKVPSAKQELAEMI QSAL
Sbjct  433  SFDTEFGAQIEAGKVDFETLEKKAMEWGEPKVPSAKQELAEMIFQSAL  480



>ref|XP_010443465.1| PREDICTED: xylose isomerase [Camelina sativa]
Length=477

 Score =   400 bits (1028),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVAYKKKIGFKGTL IEPKPQEPTKHQYDWDAAT ANFLRK GLIDEFKLNIE
Sbjct  250  LARFFEAAVAYKKKIGFKGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGLIDEFKLNIE  309

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGH+CHHE+ETAR+NGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SVIKN
Sbjct  310  CNHATLSGHTCHHELETARLNGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSVIKN  369

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+GSL ELVRKRY 
Sbjct  370  GGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAVKILEEGSLNELVRKRYA  429

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            S+DSELG  IE GKADFE LEKKA E+GEPKV SAKQELAEMI QSA+
Sbjct  430  SWDSELGKQIEEGKADFEYLEKKAKEFGEPKVSSAKQELAEMIFQSAM  477



>ref|XP_006280396.1| hypothetical protein CARUB_v10026323mg [Capsella rubella]
 gb|EOA13294.1| hypothetical protein CARUB_v10026323mg [Capsella rubella]
Length=477

 Score =   400 bits (1028),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 191/228 (84%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVAYKKKIGFKGTL IEPKPQEPTKHQYDWDAAT ANFLRK GLIDEFKLNIE
Sbjct  250  LARFFEAAVAYKKKIGFKGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGLIDEFKLNIE  309

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGH+CHHE+ETAR+NGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SVI+N
Sbjct  310  CNHATLSGHTCHHELETARLNGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSVIRN  369

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ RGLR+AAK++E+GSL ELVRKRY 
Sbjct  370  GGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMGRGLRNAAKILEEGSLNELVRKRYA  429

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            S+DSE+G  IE GKADFE LEKKA E GEPKVPSAKQELAEMI QSA+
Sbjct  430  SWDSEIGKQIEEGKADFEYLEKKAKEIGEPKVPSAKQELAEMIFQSAM  477



>ref|XP_002864523.1| xylose isomerase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40782.1| xylose isomerase family protein [Arabidopsis lyrata subsp. lyrata]
Length=477

 Score =   400 bits (1027),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 191/228 (84%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVAYKKKIGFKGTL IEPKPQEPTKHQYDWDAAT ANFLRK GLIDEFKLNIE
Sbjct  250  LARFFEAAVAYKKKIGFKGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGLIDEFKLNIE  309

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGH+CHHE+ETAR+NGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SVIKN
Sbjct  310  CNHATLSGHTCHHELETARLNGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSVIKN  369

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+GSL ELVRKRY 
Sbjct  370  GGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAVKILEEGSLNELVRKRYA  429

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            ++DSELG  IE GKADFE LEKKA E+GEPKV SAKQELAEMI QSA+
Sbjct  430  TWDSELGKQIEEGKADFEYLEKKAKEFGEPKVSSAKQELAEMIFQSAM  477



>ref|XP_008796227.1| PREDICTED: xylose isomerase isoform X1 [Phoenix dactylifera]
Length=529

 Score =   401 bits (1031),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 189/228 (83%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF++AAV YKKKIGF GTL IEPKPQEPTKHQYDWDAAT   FL+K GL+ EFKLNIE
Sbjct  302  LARFLQAAVNYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATAFAFLQKYGLLGEFKLNIE  361

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGN+DAN+GDPQ GWDTDQF  D+AEATLVMLSV++N
Sbjct  362  CNHATLSGHSCHHELETARINGLLGNVDANTGDPQIGWDTDQFLTDIAEATLVMLSVVRN  421

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGL + AKLIEDGSL ELVRKRY 
Sbjct  422  GGLAPGGFNFDAKLRRESTDVEDMFIAHISGMDTLARGLHNVAKLIEDGSLDELVRKRYS  481

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA +E GKADFE LEKKA+EWGEP VPS KQELAEMI QSAL
Sbjct  482  SFDTEIGALVEAGKADFETLEKKAMEWGEPSVPSGKQELAEMIFQSAL  529



>ref|XP_009391575.1| PREDICTED: xylose isomerase-like [Musa acuminata subsp. malaccensis]
Length=479

 Score =   399 bits (1025),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 203/228 (89%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF++AA  YKKKIGF GTL IEPKPQEPTKHQYDWDAAT   FL+K GL+ EFKLNIE
Sbjct  252  LARFLKAAADYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATAYAFLQKYGLLGEFKLNIE  311

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+ EATLVMLSV++N
Sbjct  312  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDIGEATLVMLSVVRN  371

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+ AKL EDGSL ELVRKRYQ
Sbjct  372  GGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTLARGLRNVAKLTEDGSLAELVRKRYQ  431

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+GA IE GKADFE LEKK +EWGEP VPS KQELAEMI QSAL
Sbjct  432  SFDTEIGALIEAGKADFETLEKKVMEWGEPSVPSGKQELAEMIFQSAL  479



>ref|XP_006401183.1| hypothetical protein EUTSA_v10013406mg [Eutrema salsugineum]
 gb|ESQ42636.1| hypothetical protein EUTSA_v10013406mg [Eutrema salsugineum]
Length=482

 Score =   399 bits (1024),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 189/227 (83%), Positives = 207/227 (91%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            ARF EAAVAYKKKIGF GTL IEPKPQEPTKHQYDWDAAT ANFLRK GLIDEFKLNIEC
Sbjct  256  ARFFEAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGLIDEFKLNIEC  315

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATLSGH+CHHE+ETAR+NGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SVI+NG
Sbjct  316  NHATLSGHTCHHELETARLNGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSVIRNG  375

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            G+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+G L ELVRKRY S
Sbjct  376  GIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTIARGLRNAVKILEEGRLSELVRKRYSS  435

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            +DSE+G  IE GKADFE LEKKA E+GEPKVPSAKQELAEMI QSA+
Sbjct  436  WDSEIGKQIEEGKADFEYLEKKAKEFGEPKVPSAKQELAEMIFQSAM  482



>ref|XP_009120281.1| PREDICTED: xylose isomerase [Brassica rapa]
 ref|XP_009120282.1| PREDICTED: xylose isomerase [Brassica rapa]
Length=477

 Score =   398 bits (1023),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 191/227 (84%), Positives = 207/227 (91%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            ARF EAAVAYKKKIGF GTL IEPKPQEPTKHQYDWDAAT ANFLRK GLI+EFKLNIEC
Sbjct  251  ARFFEAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGLINEFKLNIEC  310

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATLSGH+CHHE+ETARINGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SVIKNG
Sbjct  311  NHATLSGHTCHHELETARINGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSVIKNG  370

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            G+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+AAK++E+G L ELV KRY S
Sbjct  371  GIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTVARGLRNAAKILEEGRLSELVGKRYSS  430

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            +DSELG  IE GKADFE LEKKA E+GEPKVPSAKQELAEMI QSA+
Sbjct  431  WDSELGKQIEEGKADFEYLEKKAKEFGEPKVPSAKQELAEMIFQSAM  477



>ref|XP_010539451.1| PREDICTED: xylose isomerase [Tarenaya hassleriana]
Length=477

 Score =   398 bits (1022),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVAYKKKIGF GT  IEPKPQEPTKHQYDWDAAT+ANFLRK GLI EFKLNIE
Sbjct  250  LARFFEAAVAYKKKIGFNGTFLIEPKPQEPTKHQYDWDAATSANFLRKYGLIGEFKLNIE  309

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGH+CHHE+ETAR+NGLLGNIDANSGD QTGWDTDQF  DVAEAT++M SVIKN
Sbjct  310  CNHATLSGHTCHHELETARLNGLLGNIDANSGDAQTGWDTDQFLTDVAEATMIMFSVIKN  369

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+AAKLIE+G+L E+V KRY 
Sbjct  370  GGLAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAAKLIEEGTLGEVVSKRYS  429

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            S+DSELG  IE GKADFE LEKKA EWGE KV SAKQELAEMI QSAL
Sbjct  430  SWDSELGKQIEEGKADFEYLEKKAKEWGEMKVASAKQELAEMIFQSAL  477



>ref|XP_010483295.1| PREDICTED: xylose isomerase-like [Camelina sativa]
Length=477

 Score =   398 bits (1022),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 190/228 (83%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVAYKKKIGFKGTL IEPKPQEPTKHQYDWDAAT ANFLRK GLI+EFKLNIE
Sbjct  250  LARFFEAAVAYKKKIGFKGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGLINEFKLNIE  309

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGH+CHHE+ETAR+NGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SVI+N
Sbjct  310  CNHATLSGHTCHHELETARLNGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSVIRN  369

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+GSL ELVRKRY 
Sbjct  370  GGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAVKILEEGSLNELVRKRYA  429

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            S+DSELG  IE GKADFE LEKKA E+GEPKV SAKQELAEMI QSA+
Sbjct  430  SWDSELGKQIEEGKADFEYLEKKAKEFGEPKVSSAKQELAEMIFQSAM  477



>emb|CDY25894.1| BnaC09g32660D [Brassica napus]
Length=491

 Score =   398 bits (1022),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 190/227 (84%), Positives = 207/227 (91%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            ARF E+AVAYKKKIGF GTL IEPKPQEPTKHQYDWDAAT ANFLRK GLI+EFKLNIEC
Sbjct  265  ARFFESAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGLINEFKLNIEC  324

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATLSGH+CHHE+ETARINGLLGNIDAN+GD QTGWDTDQF  D+ EAT+VM+SVIKNG
Sbjct  325  NHATLSGHTCHHELETARINGLLGNIDANTGDAQTGWDTDQFLTDLGEATMVMMSVIKNG  384

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            G+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+AAK++EDG L ELV KRY S
Sbjct  385  GIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTVARGLRNAAKILEDGRLSELVGKRYSS  444

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            +DSELG  IE GKADFE LEKKA E+GEPKVPSAKQELAEMI QSA+
Sbjct  445  WDSELGKQIEEGKADFEYLEKKAKEFGEPKVPSAKQELAEMIFQSAM  491



>emb|CDY49729.1| BnaA10g11590D [Brassica napus]
Length=477

 Score =   397 bits (1021),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 190/227 (84%), Positives = 207/227 (91%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            ARF E+AVAYKKKIGF GTL IEPKPQEPTKHQYDWDAAT ANFLRK GLI+EFKLNIEC
Sbjct  251  ARFFESAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGLINEFKLNIEC  310

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATLSGH+CHHE+ETARINGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SVIKNG
Sbjct  311  NHATLSGHTCHHELETARINGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSVIKNG  370

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            G+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+AAK++E+G L ELV KRY S
Sbjct  371  GIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTVARGLRNAAKILEEGRLSELVGKRYSS  430

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            +DSELG  IE GKADFE LEKKA E+GEPKVPSAKQELAEMI QSA+
Sbjct  431  WDSELGKQIEEGKADFEYLEKKAKEFGEPKVPSAKQELAEMIFQSAM  477



>dbj|BAJ34093.1| unnamed protein product [Thellungiella halophila]
Length=482

 Score =   397 bits (1021),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 188/227 (83%), Positives = 207/227 (91%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            ARF EAAVAYKKKIGF GTL IEPKPQEPTKHQYDWDAAT ANFLRK GLIDEFKLNIEC
Sbjct  256  ARFFEAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGLIDEFKLNIEC  315

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATLSGH+CHHE+ETAR+NGLLGN+DAN+GD QTGWDTDQF  DV EAT+VM+SVI+NG
Sbjct  316  NHATLSGHTCHHELETARLNGLLGNMDANTGDAQTGWDTDQFLTDVGEATMVMMSVIRNG  375

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            G+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+G L ELVRKRY S
Sbjct  376  GIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTIARGLRNAVKILEEGRLSELVRKRYSS  435

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            +DSE+G  IE GKADFE LEKKA E+GEPKVPSAKQELAEMI QSA+
Sbjct  436  WDSEIGKQIEEGKADFEYLEKKAKEFGEPKVPSAKQELAEMIFQSAM  482



>gb|AAM61519.1| xylose isomerase [Arabidopsis thaliana]
Length=477

 Score =   397 bits (1020),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 190/228 (83%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVAYKKKIGFKGTL IEPKPQEPTKHQYDWDAAT ANFLRK GLIDEFKLNIE
Sbjct  250  LARFFEAAVAYKKKIGFKGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGLIDEFKLNIE  309

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGH+CHHE+ETARINGLLGNIDAN+GD  TGWDTDQF  DV EAT+VM+SVIKN
Sbjct  310  CNHATLSGHTCHHELETARINGLLGNIDANTGDAXTGWDTDQFLTDVGEATMVMMSVIKN  369

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+GSL ELVRKRY 
Sbjct  370  GGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAVKILEEGSLSELVRKRYA  429

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            ++DSELG  IE G+ADFE LEKKA E+GEPKV SAKQELAEMI QSA+
Sbjct  430  TWDSELGKQIEEGEADFEYLEKKAKEFGEPKVSSAKQELAEMIFQSAM  477



>ref|XP_010452612.1| PREDICTED: xylose isomerase-like [Camelina sativa]
Length=477

 Score =   397 bits (1020),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 189/228 (83%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVAYKKKIGFKGTL IEPKPQEPTKHQYDWDAAT ANFLRK GL++EFKLNIE
Sbjct  250  LARFFEAAVAYKKKIGFKGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGLVNEFKLNIE  309

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGH+CHHE+ETAR+NGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SVIKN
Sbjct  310  CNHATLSGHTCHHELETARLNGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSVIKN  369

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+GSL ELVRKRY 
Sbjct  370  GGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAVKILEEGSLNELVRKRYA  429

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            S+DSELG  IE GKADFE LEKKA E+GEPKV SAKQELAEMI +SA+
Sbjct  430  SWDSELGKQIEEGKADFEYLEKKAKEFGEPKVSSAKQELAEMIFKSAM  477



>ref|XP_004958079.1| PREDICTED: xylose isomerase-like [Setaria italica]
Length=480

 Score =   397 bits (1019),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 202/228 (89%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A F++AAV YKKKIGF GTL IEPKPQEPTKHQYDWD AT   FL+K GLI EFK+N+E
Sbjct  253  LANFLQAAVDYKKKIGFNGTLLIEPKPQEPTKHQYDWDVATAFAFLQKYGLIGEFKINVE  312

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEATLVM +V+KN
Sbjct  313  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFMTDIAEATLVMSTVVKN  372

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+ AKLIEDGSL ELVRKRYQ
Sbjct  373  GGLAPGGFNFDAKLRRESTDVEDMFIAHISGMDTLARGLRNVAKLIEDGSLDELVRKRYQ  432

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFDSE+GA IE GK DFE LEKK LEWGEP VPS KQELAEM+ QSAL
Sbjct  433  SFDSEIGALIEAGKGDFETLEKKVLEWGEPTVPSGKQELAEMLFQSAL  480



>ref|XP_004958625.1| PREDICTED: xylose isomerase-like [Setaria italica]
Length=480

 Score =   397 bits (1019),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 189/228 (83%), Positives = 201/228 (88%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A F++AAV YKKKIGF GTL IEPKPQEPTKHQYDWD AT   FL+K GL  EFK+N+E
Sbjct  253  LATFLQAAVDYKKKIGFNGTLLIEPKPQEPTKHQYDWDVATAFAFLQKYGLTGEFKINVE  312

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEATLVM SV+KN
Sbjct  313  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFMTDIAEATLVMSSVVKN  372

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVEDIFIAHI GMDTLARGLR+ AKLIEDGSL ELVRKRYQ
Sbjct  373  GGLAPGGFNFDAKLRRESTDVEDIFIAHISGMDTLARGLRNVAKLIEDGSLDELVRKRYQ  432

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFDSE+GA IE GK DFE LEKK LEWGEP VPS KQELAEM+ QSAL
Sbjct  433  SFDSEIGALIEAGKGDFETLEKKVLEWGEPTVPSGKQELAEMLFQSAL  480



>ref|XP_009417936.1| PREDICTED: xylose isomerase-like [Musa acuminata subsp. malaccensis]
Length=479

 Score =   397 bits (1019),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 203/228 (89%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF++AAV YKKKIGF GTL IEPKPQEPTKHQYDWDAAT   FL+K GLI EFKLNIE
Sbjct  252  LARFLQAAVDYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATAFAFLQKYGLIGEFKLNIE  311

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+ EATLVMLSV++N
Sbjct  312  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDIGEATLVMLSVVRN  371

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+  KL EDGSL ELVRKRYQ
Sbjct  372  GGLAPGGFNFDAKLRRESTDVEDMFIAHISGMDTLARGLRNVQKLTEDGSLAELVRKRYQ  431

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFD+E+G+ IE GKADFE LEK+A+EW EP VPS KQELAEMI QSAL
Sbjct  432  SFDTEIGSLIEAGKADFETLEKQAMEWDEPSVPSGKQELAEMIFQSAL  479



>gb|AGV54617.1| xylose isomerase [Phaseolus vulgaris]
Length=480

 Score =   394 bits (1013),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 191/227 (84%), Positives = 204/227 (90%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            ARF EAAVAYKKKIGF GTL IEPKPQEP+K QYDWDAAT+ANFLRK GL  EFKLNIEC
Sbjct  254  ARFFEAAVAYKKKIGFNGTLLIEPKPQEPSKPQYDWDAATSANFLRKYGLAGEFKLNIEC  313

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHA LSGHSC HE+ETARINGLLGNIDAN+GDPQ GWDTDQF +D+ EATL+MLSVI+NG
Sbjct  314  NHAPLSGHSCQHELETARINGLLGNIDANTGDPQVGWDTDQFLVDIQEATLIMLSVIRNG  373

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLI+DGSL ELVRKRYQS
Sbjct  374  GLAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTLARGLRNAAKLIKDGSLFELVRKRYQS  433

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            FD+E+GA IE GKADFELLEKK  EWGEP V  AKQELAEMI Q AL
Sbjct  434  FDTEIGAQIEAGKADFELLEKKVKEWGEPTVAFAKQELAEMIFQFAL  480



>ref|XP_006658089.1| PREDICTED: xylose isomerase-like [Oryza brachyantha]
Length=480

 Score =   392 bits (1008),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 184/228 (81%), Positives = 202/228 (89%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A F++AAV YKKKIGF GTL IEPKPQEPTKHQYDWD ATT +FL+K GL  EFK+N+E
Sbjct  253  LANFLQAAVDYKKKIGFNGTLLIEPKPQEPTKHQYDWDVATTFSFLQKYGLTGEFKINVE  312

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D++EATLVM SV+KN
Sbjct  313  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDISEATLVMSSVVKN  372

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+F+AHI GMDTLARGLR+  KL+EDGSL +LVRKRYQ
Sbjct  373  GGLAPGGFNFDAKLRRESTDVEDMFLAHISGMDTLARGLRNVVKLMEDGSLDDLVRKRYQ  432

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFDSE+GA IE GK DFE LEKK LEWGEP VPS KQELAEM+ QSAL
Sbjct  433  SFDSEIGAIIEAGKGDFETLEKKVLEWGEPSVPSGKQELAEMLFQSAL  480



>gb|EEC82655.1| hypothetical protein OsI_27268 [Oryza sativa Indica Group]
 gb|EEE67782.1| hypothetical protein OsJ_25511 [Oryza sativa Japonica Group]
Length=478

 Score =   391 bits (1004),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/228 (81%), Positives = 202/228 (89%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A F++AAV YKKKIGF GTL IEPKPQEPTKHQYDWD ATT +FL+K GL  EFK+N+E
Sbjct  251  LASFLQAAVDYKKKIGFNGTLLIEPKPQEPTKHQYDWDVATTFSFLQKYGLTGEFKINVE  310

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D++EATLVM SV+KN
Sbjct  311  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDISEATLVMSSVVKN  370

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+F+AHI GMDTLARGLR+  KLIEDGSL ELVRKRYQ
Sbjct  371  GGLAPGGFNFDAKLRRESTDVEDMFLAHISGMDTLARGLRNVVKLIEDGSLDELVRKRYQ  430

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFDSE+GA IE GK DFE LEKK LEWGEP VPS KQELAE++ Q+AL
Sbjct  431  SFDSEIGALIEAGKGDFETLEKKVLEWGEPIVPSGKQELAEILFQAAL  478



>ref|NP_001060585.1| Os07g0669100 [Oryza sativa Japonica Group]
 dbj|BAC83596.1| putative xylose isomerase [Oryza sativa Japonica Group]
 dbj|BAF22499.1| Os07g0669100 [Oryza sativa Japonica Group]
 dbj|BAG92890.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score =   391 bits (1004),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/228 (81%), Positives = 202/228 (89%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A F++AAV YKKKIGF GTL IEPKPQEPTKHQYDWD ATT +FL+K GL  EFK+N+E
Sbjct  252  LASFLQAAVDYKKKIGFNGTLLIEPKPQEPTKHQYDWDVATTFSFLQKYGLTGEFKINVE  311

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D++EATLVM SV+KN
Sbjct  312  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDISEATLVMSSVVKN  371

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+F+AHI GMDTLARGLR+  KLIEDGSL ELVRKRYQ
Sbjct  372  GGLAPGGFNFDAKLRRESTDVEDMFLAHISGMDTLARGLRNVVKLIEDGSLDELVRKRYQ  431

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFDSE+GA IE GK DFE LEKK LEWGEP VPS KQELAE++ Q+AL
Sbjct  432  SFDSEIGALIEAGKGDFETLEKKVLEWGEPIVPSGKQELAEILFQAAL  479



>ref|NP_001132889.1| putative xylose isomerase family protein precursor [Zea mays]
 gb|ACF81922.1| unknown [Zea mays]
 gb|ACG41148.1| xylose isomerase [Zea mays]
 tpg|DAA41688.1| TPA: putative xylose isomerase family protein [Zea mays]
Length=482

 Score =   390 bits (1003),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 185/228 (81%), Positives = 201/228 (88%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A F++AAV YKKKIGF GTL IEPKPQEPTKHQYDWD ATT  FL+K GL  EFK+N+E
Sbjct  255  LANFLQAAVDYKKKIGFNGTLLIEPKPQEPTKHQYDWDVATTFAFLQKYGLTGEFKINVE  314

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEATLVM +V+KN
Sbjct  315  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFMTDIAEATLVMSTVVKN  374

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+F+AHI GMDTLARGLR+AAKLIEDGSL  LVRKRYQ
Sbjct  375  GGLAPGGFNFDAKLRRESTDVEDLFLAHISGMDTLARGLRNAAKLIEDGSLDALVRKRYQ  434

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFDSE+GA IE GK DFE LEKK LEWGEP VPS KQELAE++  SAL
Sbjct  435  SFDSEIGALIEAGKGDFEALEKKVLEWGEPTVPSGKQELAEILFHSAL  482



>ref|XP_003562496.1| PREDICTED: xylose isomerase [Brachypodium distachyon]
Length=479

 Score =   390 bits (1002),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 184/230 (80%), Positives = 203/230 (88%), Gaps = 0/230 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E  A F++AAV +KKKIGF GTL IEPKPQEPTKHQYDWD ATT +FL+K GL  EFK+N
Sbjct  250  EHLANFLQAAVDHKKKIGFNGTLLIEPKPQEPTKHQYDWDVATTFSFLQKYGLTGEFKIN  309

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +ECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTD+F  D++EATLVM SV+
Sbjct  310  VECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDEFLTDISEATLVMSSVV  369

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            KN GLAPGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+ AKLIEDGSL ELVRKR
Sbjct  370  KNDGLAPGGFNFDAKLRRESTDVEDMFIAHISGMDTMARGLRNVAKLIEDGSLDELVRKR  429

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            YQSFD+E+GA IE GK DFE LEKK LEWGEP VPS KQELAEM+ QSAL
Sbjct  430  YQSFDTEIGAMIEAGKGDFETLEKKVLEWGEPIVPSGKQELAEMLFQSAL  479



>ref|XP_006845583.1| PREDICTED: xylose isomerase [Amborella trichopoda]
 ref|XP_011623820.1| PREDICTED: xylose isomerase [Amborella trichopoda]
 gb|ERN07258.1| hypothetical protein AMTR_s00019p00197750 [Amborella trichopoda]
Length=477

 Score =   389 bits (1000),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/227 (81%), Positives = 201/227 (89%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            ARF +AAV YKKKIGF GTL IEPKPQEPTKHQYDWDAAT+ +FL+K GL  EFKLNIEC
Sbjct  251  ARFFQAAVEYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATSLSFLQKYGLAGEFKLNIEC  310

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATLSGHSCHHE+ETARING LGNIDAN+GDPQ GWDTDQF  D+ EATLVMLSV++NG
Sbjct  311  NHATLSGHSCHHELETARINGALGNIDANTGDPQIGWDTDQFLTDIGEATLVMLSVVRNG  370

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            G+APGGFNFDAKLRRESTDVEDIF+AHI GMDT+ARGLR+ AKL+EDGSL EL+RKRY S
Sbjct  371  GIAPGGFNFDAKLRRESTDVEDIFLAHISGMDTMARGLRNVAKLMEDGSLSELIRKRYAS  430

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            FD+E GA IE GK DFE LEKKA+EWGEP V S KQELAEMI +SAL
Sbjct  431  FDTEFGAEIEAGKVDFETLEKKAMEWGEPAVASGKQELAEMIFRSAL  477



>ref|XP_004507815.1| PREDICTED: xylose isomerase-like isoform X1 [Cicer arietinum]
 ref|XP_004507816.1| PREDICTED: xylose isomerase-like isoform X2 [Cicer arietinum]
Length=491

 Score =   390 bits (1001),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/217 (85%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVA+KKKIGF GTL IEPKPQEPTKHQYDWDAATTANFLRK GL  EFKLNIE
Sbjct  252  LARFFEAAVAHKKKIGFNGTLLIEPKPQEPTKHQYDWDAATTANFLRKYGLEGEFKLNIE  311

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF +D+ EAT++MLSVI+N
Sbjct  312  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFLVDIQEATMIMLSVIRN  371

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
             G+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+AAKLIEDGSL ELVRKRYQ
Sbjct  372  DGIAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTMARGLRTAAKLIEDGSLAELVRKRYQ  431

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQ  213
            SFD+E+GA IE GKADF+LLEKKA EWGEPKV SAKQ
Sbjct  432  SFDTEIGAQIEAGKADFDLLEKKAKEWGEPKVASAKQ  468



>gb|EMS46439.1| Xylose isomerase [Triticum urartu]
Length=445

 Score =   388 bits (996),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/230 (79%), Positives = 202/230 (88%), Gaps = 0/230 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E  A F++AAV +KKKIGF GTL IEPKPQEPTKHQYDWD ATT +FL+K GL  EFK+N
Sbjct  216  EHLANFLQAAVNHKKKIGFNGTLLIEPKPQEPTKHQYDWDVATTFSFLQKFGLTGEFKIN  275

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +ECNHATLSGHSCHHE+ETARIN +LGNIDAN+GDPQ GWDTD+F  D++EATL+M SV+
Sbjct  276  VECNHATLSGHSCHHELETARINDILGNIDANTGDPQVGWDTDEFLTDISEATLIMSSVV  335

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            KN GLAPGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+ AKLIEDGSL ELVRKR
Sbjct  336  KNDGLAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNVAKLIEDGSLDELVRKR  395

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            YQSFD+E+GA IE GK DFE LEKK LEWGEP VPS KQELAEM+ QSAL
Sbjct  396  YQSFDTEIGAMIEAGKGDFETLEKKVLEWGEPTVPSGKQELAEMLFQSAL  445



>gb|ACG42142.1| xylose isomerase [Zea mays]
Length=484

 Score =   389 bits (999),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/228 (81%), Positives = 201/228 (88%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A F++AAV YKKKIGF GTL IEPKPQEPTKHQYDWD ATT  FL+K GL  EFK+N+E
Sbjct  257  LANFLQAAVDYKKKIGFNGTLLIEPKPQEPTKHQYDWDVATTFAFLQKYGLTGEFKINVE  316

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEATLVM +V+KN
Sbjct  317  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFMTDIAEATLVMSTVVKN  376

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+F+AHI GMDTLARGLR+AAKLIEDGSL  LVRKRY+
Sbjct  377  GGLAPGGFNFDAKLRRESTDVEDLFLAHISGMDTLARGLRNAAKLIEDGSLDALVRKRYR  436

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFDSE+GA IE GK DFE LEKK LEWGEP VPS KQELAE++  SAL
Sbjct  437  SFDSEMGALIEAGKGDFEALEKKVLEWGEPTVPSGKQELAEILFHSAL  484



>gb|KCW63564.1| hypothetical protein EUGRSUZ_G01193 [Eucalyptus grandis]
 gb|KCW63565.1| hypothetical protein EUGRSUZ_G01193 [Eucalyptus grandis]
Length=495

 Score =   389 bits (999),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 206/243 (85%), Gaps = 15/243 (6%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYD---------------WDAATTANF  729
             ARF+EAAVAYKKKIGF GTL +EPKPQEPTKHQYD                  ATTA+F
Sbjct  253  MARFLEAAVAYKKKIGFNGTLLLEPKPQEPTKHQYDSASVFHESPLLMGVLLHVATTASF  312

Query  728  LRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPM  549
            LRK GL+ EFK+N+ECNHATLSGHSCHHE+ETAR+NGL GN+DAN+GDPQ GWDTDQF  
Sbjct  313  LRKYGLLGEFKINVECNHATLSGHSCHHELETARLNGLFGNLDANTGDPQIGWDTDQFLT  372

Query  548  DVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKL  369
            D+ EATLVMLSV++NGGLAPGG NFDAKLRRESTDVED+FIAHIGGMDTLARGLR+ AKL
Sbjct  373  DIGEATLVMLSVVRNGGLAPGGINFDAKLRRESTDVEDLFIAHIGGMDTLARGLRNVAKL  432

Query  368  IEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQ  189
            IEDGSL ELVRKRY+SFD+E GA IE GK DFE LEKKA+EWGEPKVPSAKQELAEMI Q
Sbjct  433  IEDGSLDELVRKRYESFDTEFGAQIEAGKVDFETLEKKAMEWGEPKVPSAKQELAEMIFQ  492

Query  188  SAL  180
            SAL
Sbjct  493  SAL  495



>gb|KJB60241.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
Length=465

 Score =   388 bits (996),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 184/217 (85%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A+F+EAA AYKKKIGF GTL IEPKPQEPTKHQYDWDAATT NFL K GL+ EFKLNIE
Sbjct  248  MAKFLEAAAAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATTLNFLHKYGLLGEFKLNIE  307

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHH++ETARING+LGNIDAN+GDPQ GWDTDQF  DV EAT+VMLSVI+N
Sbjct  308  CNHATLSGHSCHHDLETARINGMLGNIDANTGDPQVGWDTDQFLTDVGEATMVMLSVIRN  367

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRES DVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRKRY 
Sbjct  368  GGLAPGGFNFDAKLRRESKDVEDLFIAHISGMDTLARGLRNAAKLIEDGSLAELVRKRYS  427

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQ  213
            SFD+ELGA IE GKADFE+LEKKA+EWGEPKV SAKQ
Sbjct  428  SFDTELGAQIEAGKADFEMLEKKAMEWGEPKVASAKQ  464



>ref|NP_001132653.1| uncharacterized protein LOC100194128 precursor [Zea mays]
 ref|XP_008650948.1| PREDICTED: uncharacterized protein LOC100194128 isoform X1 [Zea 
mays]
 ref|XP_008650949.1| PREDICTED: uncharacterized protein LOC100194128 isoform X1 [Zea 
mays]
 gb|ACF81585.1| unknown [Zea mays]
Length=484

 Score =   388 bits (996),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 184/228 (81%), Positives = 200/228 (88%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A F++AAV YKKKIGF GTL IEPKPQEPTKHQYDWD ATT  FL+K GL  EFK+N+E
Sbjct  257  LANFLQAAVDYKKKIGFNGTLLIEPKPQEPTKHQYDWDVATTFAFLQKYGLTGEFKINVE  316

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEATLVM SV+KN
Sbjct  317  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFMTDIAEATLVMSSVVKN  376

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+F+AHI GMDTLARGLR+ AKLI DGSL +LVRKRYQ
Sbjct  377  GGLAPGGFNFDAKLRRESTDVEDMFLAHISGMDTLARGLRNVAKLIGDGSLDDLVRKRYQ  436

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFDSE+GA IE GK DFE LEKK LEWGEP V S KQELAE++ QSAL
Sbjct  437  SFDSEIGALIEAGKGDFETLEKKVLEWGEPTVASGKQELAEILFQSAL  484



>gb|ACG35698.1| xylose isomerase [Zea mays]
Length=484

 Score =   388 bits (996),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 183/228 (80%), Positives = 200/228 (88%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A F++AAV YKKKIGF GTL IEPKPQEPTKHQYDWD ATT  FL+K GL  EFK+N+E
Sbjct  257  LANFLQAAVDYKKKIGFNGTLLIEPKPQEPTKHQYDWDVATTFAFLQKYGLTGEFKINVE  316

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEATLVM SV+KN
Sbjct  317  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFMTDIAEATLVMSSVVKN  376

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+F+ HI GMDTLARGLR+ AKLIEDGSL +LVRKRYQ
Sbjct  377  GGLAPGGFNFDAKLRRESTDVEDMFLVHISGMDTLARGLRNVAKLIEDGSLDDLVRKRYQ  436

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFDS++GA IE GK DFE LEKK LEWGEP V S KQELAE++ QSAL
Sbjct  437  SFDSDIGALIEAGKGDFETLEKKVLEWGEPTVASGKQELAEILFQSAL  484



>ref|XP_008650947.1| PREDICTED: uncharacterized protein LOC100194128 isoform X2 [Zea 
mays]
Length=533

 Score =   389 bits (998),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/228 (81%), Positives = 200/228 (88%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A F++AAV YKKKIGF GTL IEPKPQEPTKHQYDWD ATT  FL+K GL  EFK+N+E
Sbjct  306  LANFLQAAVDYKKKIGFNGTLLIEPKPQEPTKHQYDWDVATTFAFLQKYGLTGEFKINVE  365

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEATLVM SV+KN
Sbjct  366  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFMTDIAEATLVMSSVVKN  425

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+F+AHI GMDTLARGLR+ AKLI DGSL +LVRKRYQ
Sbjct  426  GGLAPGGFNFDAKLRRESTDVEDMFLAHISGMDTLARGLRNVAKLIGDGSLDDLVRKRYQ  485

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFDSE+GA IE GK DFE LEKK LEWGEP V S KQELAE++ QSAL
Sbjct  486  SFDSEIGALIEAGKGDFETLEKKVLEWGEPTVASGKQELAEILFQSAL  533



>dbj|BAJ96683.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   386 bits (991),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/230 (79%), Positives = 202/230 (88%), Gaps = 0/230 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E  A F++AAV +KKKIGF GTL IEPKPQEPTKHQYDWD ATT +FL+K GL  EFK+N
Sbjct  250  EHLANFLQAAVNHKKKIGFNGTLLIEPKPQEPTKHQYDWDVATTFSFLQKFGLTGEFKIN  309

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +ECNHATLSGHSCHHE+ETARIN +LGNIDAN+GDPQ GWDTD+F  D++EATL+M SV+
Sbjct  310  VECNHATLSGHSCHHELETARINDILGNIDANTGDPQVGWDTDEFLTDISEATLIMSSVV  369

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            KN GLAPGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+ AKLIEDGSL ELVRKR
Sbjct  370  KNDGLAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNVAKLIEDGSLDELVRKR  429

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            YQSFD+E+GA IE GK DFE LEKK LEWGEP VPS KQELAEM+ QSAL
Sbjct  430  YQSFDTEIGAMIETGKGDFETLEKKVLEWGEPTVPSGKQELAEMLFQSAL  479



>tpg|DAA64057.1| TPA: putative xylose isomerase family protein [Zea mays]
Length=559

 Score =   387 bits (995),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 184/228 (81%), Positives = 200/228 (88%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A F++AAV YKKKIGF GTL IEPKPQEPTKHQYDWD ATT  FL+K GL  EFK+N+E
Sbjct  332  LANFLQAAVDYKKKIGFNGTLLIEPKPQEPTKHQYDWDVATTFAFLQKYGLTGEFKINVE  391

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEATLVM SV+KN
Sbjct  392  CNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFMTDIAEATLVMSSVVKN  451

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+F+AHI GMDTLARGLR+ AKLI DGSL +LVRKRYQ
Sbjct  452  GGLAPGGFNFDAKLRRESTDVEDMFLAHISGMDTLARGLRNVAKLIGDGSLDDLVRKRYQ  511

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFDSE+GA IE GK DFE LEKK LEWGEP V S KQELAE++ QSAL
Sbjct  512  SFDSEIGALIEAGKGDFETLEKKVLEWGEPTVASGKQELAEILFQSAL  559



>dbj|BAB08802.1| xylose isomerase [Arabidopsis thaliana]
Length=472

 Score =   383 bits (983),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/217 (84%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF EAAVAYKKKIGFKGTL IEPKPQEPTKHQYDWDAAT ANFLRK GLIDEFKLNIE
Sbjct  250  LARFFEAAVAYKKKIGFKGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGLIDEFKLNIE  309

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGH+CHHE+ETARINGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SVIKN
Sbjct  310  CNHATLSGHTCHHELETARINGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSVIKN  369

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+GSL ELVRKRY 
Sbjct  370  GGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAVKILEEGSLSELVRKRYA  429

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQ  213
            ++DSELG  IE GKADFE LEKKA E+GEPKV SAKQ
Sbjct  430  TWDSELGKQIEEGKADFEYLEKKAKEFGEPKVSSAKQ  466



>gb|EMT06905.1| Xylose isomerase [Aegilops tauschii]
Length=450

 Score =   382 bits (981),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 181/234 (77%), Positives = 202/234 (86%), Gaps = 4/234 (2%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E  A F++AAV +KKKIGF GTL IEPKPQEPTKHQYDWD ATT +FL+K GL  EFK+N
Sbjct  217  EHLANFLQAAVNHKKKIGFNGTLLIEPKPQEPTKHQYDWDVATTFSFLQKFGLTGEFKIN  276

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +ECNHATLSGHSCHHE+ETARIN +LGNIDAN+GDPQ GWDTD+F  D++EATL+M SV+
Sbjct  277  VECNHATLSGHSCHHELETARINDILGNIDANTGDPQVGWDTDEFLTDISEATLIMSSVV  336

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            KN GLAPGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+ AKLIEDGSL ELVRKR
Sbjct  337  KNDGLAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNVAKLIEDGSLDELVRKR  396

Query  329  YQSFDSELGAAIE----GGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            YQSFD+E+GA IE     GK DFE LEKK LEWGEP VPS KQELAEM+ QSAL
Sbjct  397  YQSFDTEIGAMIEVHKLAGKGDFETLEKKVLEWGEPTVPSGKQELAEMLFQSAL  450



>sp|Q40082.1|XYLA_HORVU RecName: Full=Xylose isomerase [Hordeum vulgare]
 emb|CAA64545.1| xylose isomerase [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   380 bits (977),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 200/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E  A F++AAV +KKKIGF GTL IEPKPQEPTKHQYDWD ATT +FL+K GL  EFK+N
Sbjct  250  EHLANFLQAAVNHKKKIGFNGTLLIEPKPQEPTKHQYDWDVATTFSFLQKFGLTGEFKIN  309

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +ECNHATLSGHSCHHE+ETARIN +LGNIDAN+GDPQ GWDTD+F  D++EATL+M SV+
Sbjct  310  VECNHATLSGHSCHHELETARINDILGNIDANTGDPQVGWDTDEFLTDISEATLIMSSVV  369

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            KN GLAPGGFNF AKLRRESTDVED+FIAHI GMDT+ARG R+  KLIEDGSL ELVRKR
Sbjct  370  KNDGLAPGGFNFYAKLRRESTDVEDLFIAHISGMDTMARGRRNVVKLIEDGSLDELVRKR  429

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            YQSFD+E+GA IE GK DFE LEKKALEWGEP VPS KQELAEM+ QSAL
Sbjct  430  YQSFDTEIGAMIEAGKGDFETLEKKALEWGEPTVPSGKQELAEMLFQSAL  479



>gb|ABR16225.1| unknown [Picea sitchensis]
Length=399

 Score =   350 bits (897),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/228 (75%), Positives = 193/228 (85%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A+F++AAV +KK IGF GTL IEPKPQEPTKHQYDWDAATT  FL++ GL  EFKLNIE
Sbjct  172  MAKFLQAAVNWKKTIGFNGTLLIEPKPQEPTKHQYDWDAATTMGFLQRYGLAGEFKLNIE  231

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSCHHE+E +RI G+LGNIDAN+GD QTGWDTDQF  D+ EATLVML+VIKN
Sbjct  232  CNHATLSGHSCHHELEMSRIYGMLGNIDANTGDAQTGWDTDQFLTDIGEATLVMLTVIKN  291

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRES DVED+FI HI GMDTLARGLR+AAKL++DG L ELV KRY+
Sbjct  292  GGLAPGGFNFDAKLRRESVDVEDLFIGHISGMDTLARGLRNAAKLLQDGKLSELVAKRYE  351

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            + +S+LGA IE  +  FE LEKKA EWGEP + S KQELAEMI QS L
Sbjct  352  TLNSKLGALIEEEEVSFEELEKKAHEWGEPPLSSGKQELAEMIFQSYL  399



>ref|XP_001774702.1| predicted protein [Physcomitrella patens]
 gb|EDQ60517.1| predicted protein [Physcomitrella patens]
Length=479

 Score =   340 bits (872),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 164/230 (71%), Positives = 190/230 (83%), Gaps = 3/230 (1%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLI---DEFKLN  690
            A F+ +A  YKKKIGF+GTL +EPKPQEPTKHQYDWDAATT  FL+  GL    +++KLN
Sbjct  250  ATFLRSAAEYKKKIGFEGTLLLEPKPQEPTKHQYDWDAATTMGFLKNYGLSGTNNDYKLN  309

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +ECNHATLSGHSCHHE+ETARI G+LG++DAN+GD QTGWDTDQF  DV+EATL+MLSVI
Sbjct  310  LECNHATLSGHSCHHELETARIYGMLGSVDANTGDAQTGWDTDQFLTDVSEATLIMLSVI  369

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            KNGGLAPGGFNFDAKLRRES DVED+FIAHI GMDT+ARGLR+AAKL+E+G L +LV  R
Sbjct  370  KNGGLAPGGFNFDAKLRRESVDVEDLFIAHISGMDTIARGLRNAAKLLEEGRLTKLVEDR  429

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            Y SF+S LG  IE GK  FE LEK +LE  EP + S KQELAEMI  S +
Sbjct  430  YSSFNSPLGKTIEEGKVGFEELEKISLEAEEPPITSGKQELAEMIFYSYV  479



>ref|XP_002991242.1| hypothetical protein SELMODRAFT_229601 [Selaginella moellendorffii]
 gb|EFJ07670.1| hypothetical protein SELMODRAFT_229601 [Selaginella moellendorffii]
Length=476

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/228 (69%), Positives = 191/228 (84%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
              +F+++A  YKKKI F G L IEPKPQEPTKHQYDWDAAT   FL+K GL D+FKLNIE
Sbjct  249  LGQFLKSAAEYKKKIDFDGVLLIEPKPQEPTKHQYDWDAATAIGFLQKYGLKDDFKLNIE  308

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATL+GHSC+HE+E +RING+LGNIDAN+GD QTGWDTDQF MD+AE T VMLSV++N
Sbjct  309  CNHATLAGHSCYHELEVSRINGVLGNIDANTGDAQTGWDTDQFLMDIAETTQVMLSVLQN  368

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FI+HI GMD +ARGLR+AAK++E+G+L  +V++RY 
Sbjct  369  GGLAPGGFNFDAKLRRESTDVEDLFISHIAGMDAMARGLRNAAKILEEGTLPSIVKERYA  428

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFDS LGA+IE G+  FE LE++AL   EP   S KQELAEM+  +++
Sbjct  429  SFDSALGASIESGELGFEELEREALRMEEPLPASGKQELAEMVFYNSI  476



>ref|XP_002991182.1| hypothetical protein SELMODRAFT_161472 [Selaginella moellendorffii]
 gb|EFJ07726.1| hypothetical protein SELMODRAFT_161472 [Selaginella moellendorffii]
Length=478

 Score =   337 bits (864),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/228 (69%), Positives = 191/228 (84%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
              +F+++A  YKKKI F G L IEPKPQEPTKHQYDWDAAT   FL+K GL D+FKLNIE
Sbjct  251  LGQFLKSAAEYKKKIEFDGVLLIEPKPQEPTKHQYDWDAATAIGFLQKYGLKDDFKLNIE  310

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATL+GHSC+HE+E +RING+LGNIDAN+GD QTGWDTDQF MD+AE T VMLSV++N
Sbjct  311  CNHATLAGHSCYHELEVSRINGVLGNIDANTGDAQTGWDTDQFLMDIAETTQVMLSVLQN  370

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGGFNFDAKLRRESTDVED+FI+HI GMD +ARGLR+AAK++E+G+L  +V++RY 
Sbjct  371  GGLAPGGFNFDAKLRRESTDVEDLFISHIAGMDAMARGLRNAAKILEEGTLPSIVKERYA  430

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SFDS LGA+IE G+  FE LE++AL   EP   S KQELAEM+  +++
Sbjct  431  SFDSALGASIESGELGFEELEQEALRMEEPLPASGKQELAEMVFYNSI  478



>emb|CAA64544.1| xylose isomerase [Hordeum vulgare subsp. vulgare]
 prf||2209268A xylose isomerase
Length=479

 Score =   329 bits (844),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/230 (70%), Positives = 184/230 (80%), Gaps = 0/230 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E  A F++AAV +KKKIGF GTL IEPKPQEPTKHQYDWD ATT +FL+K GL  EFK+N
Sbjct  250  EHLANFLQAAVNHKKKIGFNGTLLIEPKPQEPTKHQYDWDVATTFSFLQKFGLTGEFKIN  309

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +ECNHATLSGHSCHHE+ETARIN +LGNIDAN+GDPQ GWDTD+F  D++EATL+M SV+
Sbjct  310  VECNHATLSGHSCHHELETARINDILGNIDANTGDPQVGWDTDEFLTDISEATLIMSSVV  369

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            KN GLAPGGFNF AKLRRESTDVED+FIAHI GMDT+ARG R+  KLIEDGSL ELVRKR
Sbjct  370  KNDGLAPGGFNFYAKLRRESTDVEDLFIAHISGMDTMARGRRNVVKLIEDGSLDELVRKR  429

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            YQSFD+E+GA IEG  +     +  +     P       ELAEM+ QSAL
Sbjct  430  YQSFDTEIGAMIEGSSSFTAQCKYISAPMIVPYDLLLPAELAEMLFQSAL  479



>ref|XP_010065874.1| PREDICTED: xylose isomerase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010065875.1| PREDICTED: xylose isomerase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010065876.1| PREDICTED: xylose isomerase-like isoform X1 [Eucalyptus grandis]
Length=467

 Score =   298 bits (763),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 160/190 (84%), Gaps = 5/190 (3%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            ARF+EAAVAYKKKIGF GTL +EPKPQEPTKHQYDWD ATTA+FLRK GL+ EFK+N+E 
Sbjct  254  ARFLEAAVAYKKKIGFNGTLLLEPKPQEPTKHQYDWDVATTASFLRKYGLLGEFKINVEY  313

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATLSG SCHHE+ET R+NG  GN+DAN+GD Q GWDTDQF  D+ EATLVMLSV++NG
Sbjct  314  NHATLSGRSCHHELETGRLNGRFGNLDANTGDTQIGWDTDQFQTDIGEATLVMLSVVRNG  373

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GLAPG     A +  ES DVED+FIAHI GMDTLARG R+ AKLIEDGSL ELVRKRY+S
Sbjct  374  GLAPG-----ASIYEESMDVEDLFIAHISGMDTLARGFRNVAKLIEDGSLDELVRKRYES  428

Query  320  FDSELGAAIE  291
            FD+E GA IE
Sbjct  429  FDAECGAQIE  438



>ref|XP_005646804.1| xylose isomerase [Coccomyxa subellipsoidea C-169]
 gb|EIE22260.1| xylose isomerase [Coccomyxa subellipsoidea C-169]
Length=471

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 171/227 (75%), Gaps = 2/227 (1%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A F++ AVAYKKKIGFKG L +EPKPQEPTKHQYDWDAATT  FL + GL DEFKLN+E
Sbjct  241  LAAFLKGAVAYKKKIGFKGALLLEPKPQEPTKHQYDWDAATTMGFLNQYGLSDEFKLNVE  300

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATL+GHSC HE++ A   G LGNIDAN+GD QTGWDTDQF  D  EATLV   ++K 
Sbjct  301  CNHATLAGHSCEHELQLASAYGKLGNIDANTGDAQTGWDTDQFLTDPKEATLVAAVILKQ  360

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGG NFDAKLRRESTDV D+F  HI GMD LARGLR+AA+++E+G L  +++ RY 
Sbjct  361  GGLAPGGINFDAKLRRESTDVNDLFYGHISGMDALARGLRNAAQMLEEGILPGMIKDRYS  420

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPK--VPSAKQELAEMILQ  189
            ++   +G  I  GK DF  LEK AL   +P   +PSA+ EL E++L 
Sbjct  421  TYSKGVGKKIRDGKVDFVELEKVALASADPAEDLPSARAELYEIVLS  467



>gb|KIZ04907.1| xylose isomerase [Monoraphidium neglectum]
Length=472

 Score =   285 bits (728),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 178/232 (77%), Gaps = 4/232 (2%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARFM  A  YKK++G+  TL +EPKPQEPTKHQYDWD ATT +FLRK GL  EFK+N+E
Sbjct  241  LARFMRLASEYKKQVGWDATLLLEPKPQEPTKHQYDWDVATTVSFLRKYGLEKEFKINVE  300

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
            CNHATLSGHSC HE+ETARING+LGNIDAN+GDPQTGWDTDQF +D  EATL+ML+VI+N
Sbjct  301  CNHATLSGHSCEHELETARINGVLGNIDANTGDPQTGWDTDQFLVDPREATLIMLAVIRN  360

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGL  GGFNFDAKLRREST + D+F  HI GMD LARGLR+AA L++ G+L +L  +RY 
Sbjct  361  GGLGTGGFNFDAKLRRESTALVDLFYGHISGMDALARGLRNAAALLDAGALTKLREERYA  420

Query  323  SFDSE--LGAAIEGGKADFELLEKKALEWGEP--KVPSAKQELAEMILQSAL  180
            S+ ++  +G  I  GK  F+ LEK AL   +P   V S  QELAE++L   L
Sbjct  421  SWGAKGGIGPKIIAGKVGFDDLEKFALSHPDPADDVGSGSQELAEILLDMHL  472



>ref|WP_034568836.1| xylose isomerase [Clostridiales bacterium oral taxon 876]
Length=440

 Score =   275 bits (704),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 165/228 (72%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF   AV Y KKIGF G   IEPKP+EPTKHQYD+D AT  +FL+K GL   FK+NIE
Sbjct  209  LARFFHMAVDYAKKIGFTGQFLIEPKPKEPTKHQYDFDVATVMSFLQKYGLEKYFKVNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HEV  ARING+LG++D N GDP  GWDTDQFP ++ +ATL+M  V+KN
Sbjct  269  ANHATLAGHTFQHEVHLARINGMLGSLDINQGDPNLGWDTDQFPTNIYDATLLMYEVLKN  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+ PGG NFDAK+RR S +VED+F+ +I GMDTLA+GL+ A K++E+G  + +V++RY+
Sbjct  329  GGITPGGLNFDAKVRRASFEVEDLFLGYIAGMDTLAQGLKIAYKMLEEGEFENIVKERYK  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF+  +G  I  GKADFE LEK AL     K  S +QEL E  L   +
Sbjct  389  SFNEGIGKDIVEGKADFESLEKYALSHSSIKNNSGRQELLEARLNQYI  436



>gb|ERI94441.1| xylose isomerase [Clostridiales bacterium oral taxon 876 str. 
F0540]
Length=455

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 165/228 (72%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF   AV Y KKIGF G   IEPKP+EPTKHQYD+D AT  +FL+K GL   FK+NIE
Sbjct  224  LARFFHMAVDYAKKIGFTGQFLIEPKPKEPTKHQYDFDVATVMSFLQKYGLEKYFKVNIE  283

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HEV  ARING+LG++D N GDP  GWDTDQFP ++ +ATL+M  V+KN
Sbjct  284  ANHATLAGHTFQHEVHLARINGMLGSLDINQGDPNLGWDTDQFPTNIYDATLLMYEVLKN  343

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+ PGG NFDAK+RR S +VED+F+ +I GMDTLA+GL+ A K++E+G  + +V++RY+
Sbjct  344  GGITPGGLNFDAKVRRASFEVEDLFLGYIAGMDTLAQGLKIAYKMLEEGEFENIVKERYK  403

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF+  +G  I  GKADFE LEK AL     K  S +QEL E  L   +
Sbjct  404  SFNEGIGKDIVEGKADFESLEKYALSHSSIKNNSGRQELLEARLNQYI  451



>ref|XP_001633389.1| predicted protein [Nematostella vectensis]
 gb|EDO41326.1| predicted protein [Nematostella vectensis]
Length=399

 Score =   272 bits (695),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 161/224 (72%), Gaps = 0/224 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F +  VAYK+KIGF G L IEPKP+EPT+HQYD+DA T   FL+  GL   FKLNIE 
Sbjct  173  ASFFKMVVAYKEKIGFTGQLLIEPKPKEPTRHQYDYDAQTVIGFLKTYGLDHHFKLNIEP  232

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GHS  H++  A   G+LG+IDAN+G P  GWDTDQFPM+V     +M ++I+ G
Sbjct  233  NHTTLAGHSYEHDIVLASKVGMLGSIDANTGSPDLGWDTDQFPMNVKNCMFIMKAIIEQG  292

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GLAPGG NFD K+RRESTD+ED+FI+HIG MDTLAR LR AA LIE+G +  LV++RY S
Sbjct  293  GLAPGGLNFDCKVRRESTDIEDMFISHIGAMDTLARALRCAATLIEEGKMSGLVKERYSS  352

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQ  189
            FDS +G+ IE G A  E LE   +  GEP++ S KQE  E IL 
Sbjct  353  FDSGIGSKIEKGLATLEELENFVMANGEPQLLSGKQEKYESILN  396



>ref|WP_039037140.1| xylose isomerase [Pseudoalteromonas sp. ECSMB14103]
Length=439

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 166/234 (71%), Gaps = 5/234 (2%)
 Frame = -1

Query  872  AEPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKL  693
            +E + RF++  V +KKKIGFKGTL IEPKPQEPTKHQYD+D AT A FL K+GL +E K+
Sbjct  208  SEQYTRFLKMVVEHKKKIGFKGTLLIEPKPQEPTKHQYDYDTATVAGFLHKHGLQNEIKV  267

Query  692  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  513
            NIE NHATL+GHS HHE+  A   G++G+IDAN GD Q GWDTDQFP DVAE TL+M  +
Sbjct  268  NIEANHATLAGHSFHHEIAVACAEGIMGSIDANRGDMQNGWDTDQFPNDVAECTLIMYEI  327

Query  512  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  333
            +KNGG   GGFNFD KLRR+S + +D+FI HIGGMDT+A+ L +AA +IE G L + V K
Sbjct  328  LKNGGFTTGGFNFDTKLRRQSCERDDLFIGHIGGMDTMAKALLNAAAMIEGGELSDFVEK  387

Query  332  RYQSFDSELGAAIEGGKADFELLEKKALEWGE---PKVPSAKQELAEMILQSAL  180
            RY  +  ELG +I  G+   E L   AL  G+   PK  S +QEL E I+   L
Sbjct  388  RYAGWKEELGRSILNGEQSLESL--SALVHGQDINPKQVSGRQELLENIVNRYL  439



>ref|WP_016710605.1| xylose isomerase [Pseudoalteromonas haloplanktis]
Length=439

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 165/228 (72%), Gaps = 1/228 (0%)
 Frame = -1

Query  872  AEPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKL  693
            +E +ARF++  V +KKKIGFKGTL IEPKPQEPTKHQYD+D AT A FL K+GL DE K+
Sbjct  208  SEQYARFLKMVVEHKKKIGFKGTLLIEPKPQEPTKHQYDYDTATVAGFLHKHGLQDEIKV  267

Query  692  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  513
            NIE NHATL+GHS HHE+  A   G++G+IDAN GD Q GWDTDQFP DVAE TLVM  +
Sbjct  268  NIEANHATLAGHSFHHEIAVACAEGIMGSIDANRGDMQNGWDTDQFPNDVAECTLVMYEI  327

Query  512  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  333
            +K+GGL  GGFNFD KLRR+S + +D+FI HIGGMDT+A+ L +AA +IE G L + V K
Sbjct  328  LKSGGLTTGGFNFDTKLRRQSCERDDLFIGHIGGMDTMAKALLNAAAMIEGGELADFVEK  387

Query  332  RYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMIL  192
            RY  +  +LG +I  G+   E L     E   +PK  S +QEL E I+
Sbjct  388  RYAGWKEDLGQSILKGEQSLESLAALVHENNIDPKQVSGRQELLENIV  435



>ref|WP_008131330.1| xylose isomerase [Pseudoalteromonas sp. BSi20480]
 dbj|GAA76310.1| xylose isomerase [Pseudoalteromonas sp. BSi20480]
Length=439

 Score =   271 bits (693),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/232 (56%), Positives = 164/232 (71%), Gaps = 1/232 (0%)
 Frame = -1

Query  872  AEPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKL  693
            +E +ARF++  V +KKKIGFKGTL IEPKPQEPTKHQYD+D AT A FL K+GL +E K+
Sbjct  208  SEQYARFLKMVVEHKKKIGFKGTLLIEPKPQEPTKHQYDYDTATVAGFLHKHGLQNEIKV  267

Query  692  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  513
            NIE NHATL+GHS HHE+  A   G++G+IDAN GD Q GWDTDQFP DVAE TL+M  +
Sbjct  268  NIEANHATLAGHSFHHEIAVACAEGIMGSIDANRGDMQNGWDTDQFPNDVAECTLIMYEI  327

Query  512  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  333
            +KNGG   GGFNFD KLRR+S + +D+FI HIGGMDT+A+ L +AA +IE G L + V K
Sbjct  328  LKNGGFTTGGFNFDTKLRRQSCERDDLFIGHIGGMDTMAKALLNAAAMIEGGELSDFVEK  387

Query  332  RYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            RY  +  ELG +I  G+   E L     +    P+  S +QEL E I+   L
Sbjct  388  RYAGWKEELGQSILNGEQSLESLSALVHQQNINPEQVSGRQELLENIVNRYL  439



>ref|WP_010556356.1| xylose isomerase [Pseudoalteromonas marina]
 gb|ERG25884.1| xylose isomerase [Pseudoalteromonas marina mano4]
Length=439

 Score =   271 bits (693),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 133/230 (58%), Positives = 166/230 (72%), Gaps = 5/230 (2%)
 Frame = -1

Query  872  AEPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKL  693
            +E +ARF++  V +KKKIGFKGTL IEPKPQEPTKHQYD+D AT A FL K+GL +E K+
Sbjct  208  SEQYARFLKMVVDHKKKIGFKGTLLIEPKPQEPTKHQYDYDTATVAGFLHKHGLQNEIKV  267

Query  692  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  513
            NIE NHATL+GHS HHE+  A   G++G+IDAN GD Q GWDTDQFP DVAE TL+M  +
Sbjct  268  NIEANHATLAGHSFHHEIAVACAEGIMGSIDANRGDMQNGWDTDQFPNDVAECTLIMYEI  327

Query  512  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  333
            +KNGG   GGFNFD KLRR+S + +D+FI HIGGMDT+A+ L +AA +IE G L + V K
Sbjct  328  LKNGGFTTGGFNFDTKLRRQSCERDDLFIGHIGGMDTMAKALLNAAAMIEGGELSDFVEK  387

Query  332  RYQSFDSELGAAIEGGKADFELLEKKALEWGE---PKVPSAKQELAEMIL  192
            RY  +  ELG +I  G+   E L   AL  G+   P+  S +QEL E I+
Sbjct  388  RYAGWKEELGQSILNGEQSLESL--SALVHGQNINPEQVSGRQELLENIV  435



>gb|EGI71574.1| xylose isomerase [Pseudoalteromonas haloplanktis ANT/505]
Length=308

 Score =   266 bits (679),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 162/228 (71%), Gaps = 1/228 (0%)
 Frame = -1

Query  872  AEPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKL  693
            +E +ARF++  V +KKKIGFKGTL IEPKPQEPTKHQYD+D A+ A FL K+GL DE K+
Sbjct  77   SEQYARFLKMVVEHKKKIGFKGTLLIEPKPQEPTKHQYDYDTASVAGFLHKHGLQDEIKV  136

Query  692  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  513
            NIE NHATL+GHS HHE+  A   G++G+IDAN GD Q GWDTDQFP DVAE TLV+  +
Sbjct  137  NIEANHATLAGHSFHHEIAVACAKGIMGSIDANRGDMQNGWDTDQFPNDVAECTLVVYEI  196

Query  512  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  333
            +KNGG   GGFNFD KLRR+S + +D+FI HIG MDT+A+ L +AA +IE G L + V K
Sbjct  197  LKNGGFTTGGFNFDTKLRRQSCERDDLFIGHIGCMDTMAKALLNAAAMIEGGELSDFVEK  256

Query  332  RYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMIL  192
            RY  +  +LG +I  G+   E L     E    PK  S +QEL E I+
Sbjct  257  RYAGWKEDLGQSILKGEQSLESLAALVHENDIYPKQVSGRQELLENIV  304



>ref|WP_024599023.1| xylose isomerase [Pseudoalteromonas haloplanktis]
Length=439

 Score =   268 bits (685),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 163/228 (71%), Gaps = 1/228 (0%)
 Frame = -1

Query  872  AEPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKL  693
            +E +ARF++  V +KKKIGFKGTL IEPKPQEPTKHQYD+D AT A FL K+GL DE K+
Sbjct  208  SEQYARFLKMVVEHKKKIGFKGTLLIEPKPQEPTKHQYDYDTATVAGFLYKHGLQDEIKV  267

Query  692  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  513
            NIE NHATL+GHS HHE+  A   G++G+IDAN GD Q GWDTDQFP DVAE TLV+  +
Sbjct  268  NIEANHATLAGHSFHHEIAVACAEGIMGSIDANRGDMQNGWDTDQFPNDVAECTLVVYEI  327

Query  512  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  333
            +K GG   GGFNFD KLRR+S + +D+FI HIGGMDT+A+ L +AA +IE G L + V K
Sbjct  328  LKMGGFTTGGFNFDTKLRRQSCERDDLFIGHIGGMDTMAKALLNAAAMIEGGELSDFVEK  387

Query  332  RYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMIL  192
            RY  +  +LG +I  G+   E L     E   +PK  S +QEL E I+
Sbjct  388  RYAGWKEDLGQSILNGEQSLESLSALVHENNIDPKQVSGRQELLENIV  435



>ref|WP_007585153.1| xylose isomerase [Pseudoalteromonas sp. BSi20429]
 dbj|GAA68798.1| xylose isomerase [Pseudoalteromonas sp. BSi20429]
Length=439

 Score =   268 bits (685),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 163/228 (71%), Gaps = 1/228 (0%)
 Frame = -1

Query  872  AEPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKL  693
            +E +ARF++  V +KKKIGFKGTL IEPKPQEPTKHQYD+D AT A FL K+GL DE K+
Sbjct  208  SEQYARFLKMVVEHKKKIGFKGTLLIEPKPQEPTKHQYDYDTATVAGFLYKHGLQDEIKV  267

Query  692  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  513
            NIE NHATL+GHS HHE+  A   G++G+IDAN GD Q GWDTDQFP DVAE TLV+  +
Sbjct  268  NIEANHATLAGHSFHHEIAVACAEGIMGSIDANRGDMQNGWDTDQFPNDVAECTLVVYEI  327

Query  512  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  333
            +K GG   GGFNFD KLRR+S + +D+FI HIGGMDT+A+ L +AA +IE G L + V K
Sbjct  328  LKMGGFTTGGFNFDTKLRRQSCERDDLFIGHIGGMDTMAKALLNAAAMIEGGELTDFVEK  387

Query  332  RYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMIL  192
            RY  +  +LG +I  G+   E L     E   +PK  S +QEL E I+
Sbjct  388  RYAGWKEDLGQSILNGEQSLESLSALVHENNIDPKQVSGRQELLENIV  435



>ref|WP_007375167.1| MULTISPECIES: xylose isomerase [Pseudoalteromonas]
 gb|EKS14609.1| xylose isomerase [Pseudoalteromonas sp. Bsw20308]
 gb|KDC52315.1| xylose isomerase [Pseudoalteromonas citrea]
 gb|KHM51124.1| xylose isomerase [Pseudoalteromonas flavipulchra NCIMB 2033 = 
ATCC BAA-314]
 gb|KID34426.1| xylose isomerase [Pseudoalteromonas distincta]
 gb|KJZ27161.1| xylose isomerase [Spongiobacter sp. S2292]
Length=439

 Score =   268 bits (685),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 163/228 (71%), Gaps = 1/228 (0%)
 Frame = -1

Query  872  AEPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKL  693
            +E +ARF++  V +KKKIGFKGTL IEPKPQEPTKHQYD+D AT A FL K+GL DE K+
Sbjct  208  SEQYARFLKMVVEHKKKIGFKGTLLIEPKPQEPTKHQYDYDTATVAGFLYKHGLQDEIKV  267

Query  692  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  513
            NIE NHATL+GHS HHE+  A   G++G+IDAN GD Q GWDTDQFP DVAE TLV+  +
Sbjct  268  NIEANHATLAGHSFHHEIAVACAEGIMGSIDANRGDMQNGWDTDQFPNDVAECTLVVYEI  327

Query  512  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  333
            +K GG   GGFNFD KLRR+S + +D+FI HIGGMDT+A+ L +AA +IE G L + V K
Sbjct  328  LKMGGFTTGGFNFDTKLRRQSCERDDLFIGHIGGMDTMAKALLNAAAMIEGGELTDFVEK  387

Query  332  RYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMIL  192
            RY  +  +LG +I  G+   E L     E   +PK  S +QEL E I+
Sbjct  388  RYAGWKEDLGQSILNGEQSLESLSALVHENNIDPKQVSGRQELLENIV  435



>ref|WP_024594232.1| xylose isomerase [Pseudoalteromonas haloplanktis]
Length=439

 Score =   268 bits (685),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 163/228 (71%), Gaps = 1/228 (0%)
 Frame = -1

Query  872  AEPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKL  693
            +E +ARF++  V +KKKIGFKGTL IEPKPQEPTKHQYD+D AT A FL K+GL DE K+
Sbjct  208  SEQYARFLKMVVEHKKKIGFKGTLLIEPKPQEPTKHQYDYDTATVAGFLYKHGLQDEIKV  267

Query  692  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  513
            NIE NHATL+GHS HHE+  A   G++G+IDAN GD Q GWDTDQFP DVAE TLV+  +
Sbjct  268  NIEANHATLAGHSFHHEIAVACAEGIMGSIDANRGDMQNGWDTDQFPNDVAECTLVVYEI  327

Query  512  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  333
            +K GG   GGFNFD KLRR+S + +D+FI HIGGMDT+A+ L +AA +IE G L + V K
Sbjct  328  LKMGGFTTGGFNFDTKLRRQSCERDDLFIGHIGGMDTMAKALLNAAAMIEGGELTDFVEK  387

Query  332  RYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMIL  192
            RY  +  +LG +I  G+   E L     E   +PK  S +QEL E I+
Sbjct  388  RYAGWKEDLGQSILNGEQSLESLSALVHENNIDPKQVSGRQELLENIV  435



>ref|WP_019027960.1| xylose isomerase [Colwellia piezophila]
Length=438

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/228 (58%), Positives = 161/228 (71%), Gaps = 1/228 (0%)
 Frame = -1

Query  872  AEPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKL  693
             E +ARF++  + +K KIGFKG L IEPKPQEPTKHQYD+D AT A FL K+G+  E  +
Sbjct  207  GEQYARFLKMVIEHKHKIGFKGKLLIEPKPQEPTKHQYDYDTATVAGFLHKHGIAGEVHV  266

Query  692  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  513
            NIE NHATL+GHS HHEV  A   G+LG+IDAN GD Q GWDTDQFP DVAE TLVM  +
Sbjct  267  NIEANHATLAGHSFHHEVAVACAEGILGSIDANRGDMQNGWDTDQFPNDVAECTLVMYEI  326

Query  512  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  333
            +KNGGL  GGFNFD KLRR+S + +D+FIAHIGGMDT+A+ L +AAKLIED  L   V +
Sbjct  327  LKNGGLDTGGFNFDTKLRRQSCERDDLFIAHIGGMDTMAKALLNAAKLIEDAPLSNFVDE  386

Query  332  RYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMIL  192
            RY  +  +LG +I  G    + L K  L+    PK  S +QEL E I+
Sbjct  387  RYAGWKGQLGQSIMSGDHSLDSLSKLVLDNDINPKQESGRQELLENIV  434



>ref|WP_017895180.1| xylose isomerase [Clostridium tyrobutyricum]
 emb|CDL91629.1| Xylose isomerase [Clostridium tyrobutyricum DIVETGP]
Length=440

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/228 (55%), Positives = 163/228 (71%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FAR +  AV Y K+IGFKG   IEPKP+EPTKHQYD+D A    FLRK  L   FK+NIE
Sbjct  209  FARLLHMAVDYAKEIGFKGQFLIEPKPKEPTKHQYDFDVAAVLAFLRKYELDKYFKINIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE++TARIN  LG++DAN GDP  GWDTDQFP ++ + TL M  V+KN
Sbjct  269  ANHATLAGHTFQHEIQTARINNALGSLDANQGDPNLGWDTDQFPTNIYDTTLAMYEVLKN  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGG NFDAK+RR S + ED+F+A+I GMDT A+GLR A KL+EDG ++  ++++Y 
Sbjct  329  GGIAPGGLNFDAKVRRASFEPEDLFLAYIAGMDTFAKGLRVAYKLLEDGPIENFIKEKYS  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF+S++G  I  GK  F  LEK ALE    +  S +QE+ E I+   +
Sbjct  389  SFNSKIGKDIIEGKIGFNELEKYALENTSIENKSGRQEMLESIVNQYI  436



>ref|WP_010588344.1| xylose isomerase [Schlesneria paludicola]
Length=436

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 161/230 (70%), Gaps = 3/230 (1%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A+FM  AV Y KKIGF G    EPKP+EPTKHQYD+DAA   NF R NGL+D  KLNIE
Sbjct  208  LAKFMHMAVDYAKKIGFTGQFLFEPKPKEPTKHQYDFDAAACLNFCRANGLLDHIKLNIE  267

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+E ARI G LG+IDAN+GD   GWDTDQFP D+   T  ML +++ 
Sbjct  268  TNHATLAGHTMMHELEYARIQGALGSIDANTGDLLLGWDTDQFPTDIYLTTQCMLVILEQ  327

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGG NFDAK+RRES D  D+F AHIG MD  ARG + AA + +DG LK+ V+KRY+
Sbjct  328  GGIAPGGVNFDAKVRRESFDPIDLFHAHIGAMDAFARGTKIAAAIRKDGVLKDFVKKRYR  387

Query  323  SFDSELGAAIEGGKADFELLEKKAL--EWGEPKVPSAKQELAEMILQSAL  180
            SFD+ +GA IE GKA FE LEK  L  E   P   S +QE+ E I+   L
Sbjct  388  SFDTGVGAEIESGKATFESLEKYVLGKETLNPN-ESGRQEMLENIINQYL  436



>ref|XP_004356776.1| xylose isomerase [Acanthamoeba castellanii str. Neff]
 gb|ELR24876.1| xylose isomerase [Acanthamoeba castellanii str. Neff]
Length=437

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 161/224 (72%), Gaps = 0/224 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF++ A  YKK+IGF+G L IEPKP+EPTKHQYD+D A    FL+   L  ++K+NIE
Sbjct  210  FARFLQLAADYKKQIGFQGQLLIEPKPREPTKHQYDFDTAAVVAFLKSYNLDKDYKVNIE  269

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NH TL+GH+  HE+  A   G LG+IDAN+GDP  GWDTDQF MDV + TL M  V++ 
Sbjct  270  ANHCTLAGHTFEHELTYASAYGFLGSIDANTGDPLLGWDTDQFNMDVKQTTLAMQVVLRQ  329

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGL PGG NFDAKLRRES+D+ED+FI HI GMDT ARGL +AA+L E+G+ +    +RY 
Sbjct  330  GGLQPGGLNFDAKLRRESSDLEDLFIGHIAGMDTFARGLLAAARLEEEGTFQAWRDERYA  389

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  192
            S+  ELG  I  G+  F  LE+ AL+ GEPK  SAKQE  EM+L
Sbjct  390  SWKGELGQKIVSGQVTFAELEQFALQAGEPKQVSAKQEKYEMLL  433



>gb|ETK93389.1| xylose isomerase, partial [Phytophthora parasitica]
 gb|ETL46799.1| xylose isomerase, partial [Phytophthora parasitica]
Length=269

 Score =   260 bits (665),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 158/224 (71%), Gaps = 0/224 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A F +  VAYKK++G    L +EPKP+EP KHQYD+DAAT   FL   GL ++FKLNIE
Sbjct  41   MAAFFKLVVAYKKELGATFQLLVEPKPREPMKHQYDYDAATVMAFLHTYGLQNDFKLNIE  100

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +I+ 
Sbjct  101  PNHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKIIEI  160

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++RY 
Sbjct  161  GGLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQRYA  220

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  192
            S+ S LG  IE GKA  E +   A E GEP   S KQELAE++L
Sbjct  221  SWKSALGERIEQGKATLEEVAAYAKESGEPDHVSGKQELAELML  264



>ref|XP_002506620.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67878.1| predicted protein [Micromonas sp. RCC299]
Length=411

 Score =   265 bits (677),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 161/210 (77%), Gaps = 2/210 (1%)
 Frame = -1

Query  803  LFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARI  624
            L IEPKPQEP+KHQYDWD  TTA FLR+ GL  +FKLN+ECNHATL+GHSC HE+ETA  
Sbjct  201  LLIEPKPQEPSKHQYDWDVGTTAGFLREFGLEKDFKLNVECNHATLAGHSCSHEIETAVA  260

Query  623  NGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTD  444
              +LG +DAN+GDPQ GWDTDQF  D  EA LV+ +++++ G APGG NFDAK RRESTD
Sbjct  261  MDMLGGLDANTGDPQVGWDTDQFMTDGREAALVLSAIVRSKGFAPGGINFDAKTRRESTD  320

Query  443  VEDIFIAHIGGMDTLARGLRSAAKLIE-DGSLKELVRKRYQSFDSELGAAIEGGKADFEL  267
            V D+  AHIGGMD +A GL+ AAKL++ DG+L+ + R+RY S+ SELGA IE GKA  + 
Sbjct  321  VNDLLYAHIGGMDAMANGLKLAAKLVDPDGALERVKRERYSSWASELGAKIEKGKATLKE  380

Query  266  LEKKALEW-GEPKVPSAKQELAEMILQSAL  180
            LEK ALE  GEP V S KQELA+ I+ + +
Sbjct  381  LEKLALEADGEPAVGSGKQELADNIIAAVV  410



>gb|ETK93384.1| xylose isomerase [Phytophthora parasitica]
Length=287

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 158/224 (71%), Gaps = 0/224 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A F +  VAYKK++G    L +EPKP+EP KHQYD+DAAT   FL   GL ++FKLNIE
Sbjct  59   MAAFFKLVVAYKKELGATFQLLVEPKPREPMKHQYDYDAATVMAFLHTYGLQNDFKLNIE  118

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +I+ 
Sbjct  119  PNHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKIIEI  178

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++RY 
Sbjct  179  GGLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQRYA  238

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  192
            S+ S LG  IE GKA  E +   A E GEP   S KQELAE++L
Sbjct  239  SWKSALGERIEQGKATLEEVAAYAKESGEPDHVSGKQELAELML  282



>ref|XP_010738383.1| PREDICTED: xylose isomerase-like isoform X2 [Larimichthys crocea]
Length=365

 Score =   263 bits (672),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 157/227 (69%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F + AV YK+KIG K    IEPKP+EP KHQYD+DA +   FL+  GL   FKLNIE 
Sbjct  139  ANFFKMAVQYKEKIGLKCQFLIEPKPKEPCKHQYDYDAMSVIGFLKHYGLESHFKLNIEP  198

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GHS  H+V  A   G+LG++D+N+G P  GWDTDQFPMD+   TLVM ++++ G
Sbjct  199  NHTTLAGHSYEHDVVMASAFGMLGSVDSNTGSPDLGWDTDQFPMDIRNTTLVMKTIVEQG  258

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GL PGG NFDAK+RRESTD+ED+FIAHIG MD  ARGLR+A ++IEDG +  +V++RY S
Sbjct  259  GLQPGGLNFDAKVRRESTDLEDLFIAHIGAMDAFARGLRNAVRIIEDGLIAGMVKERYSS  318

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            F   +G  +E G A  E +E    + GEPKV S KQE  E I    +
Sbjct  319  FSHGIGQKVEEGSATLEEMEAFITQKGEPKVTSGKQEKYESIFNHYI  365



>gb|EQF74127.1| xylose isomerase [Peptoclostridium difficile CD212]
Length=272

 Score =   260 bits (664),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 158/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF++ AV Y K+IGF G   IEPKP+EPTKHQYD+D AT   FLRK  L   FK+NIE
Sbjct  36   FARFLQMAVDYAKEIGFSGQFLIEPKPKEPTKHQYDFDTATVLGFLRKYNLDKYFKMNIE  95

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V+K 
Sbjct  96   ANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEVLKQ  155

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++RY 
Sbjct  156  GGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKERYA  215

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  216  SFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  263



>ref|WP_016205623.1| xylose isomerase [Clostridium sartagoforme]
 gb|EOR28235.1| xylose isomerase [Clostridium sartagoforme AAU1]
Length=439

 Score =   265 bits (678),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 160/228 (70%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF++ AV Y  KIGF G   IEPKP+EPTKHQYD+D AT   FLR  GL   FK+NIE
Sbjct  209  LARFLQMAVDYAHKIGFTGQFLIEPKPKEPTKHQYDFDVATVLAFLRNYGLDKYFKMNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HEV  ARING+LG++D N GDP  GWDTDQFP ++ +ATL+M  V+KN
Sbjct  269  ANHATLAGHTFQHEVALARINGVLGSLDINQGDPNLGWDTDQFPTNIYDATLLMYEVLKN  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+  GG NFDAK+RR S +VED+F+ +I GMDTLA+GLR A K++E+G  +  V +RY+
Sbjct  329  GGIGQGGLNFDAKVRRASFEVEDLFLGYIAGMDTLAQGLRIAYKMLEEGEFEAAVAERYK  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF   +G  I  GKADFE LEK AL     K  S +QEL E  L   +
Sbjct  389  SFTEGIGKDILEGKADFESLEKYALTNSLIKNKSGRQELLEAKLNQYI  436



>gb|ETL46794.1| xylose isomerase, partial [Phytophthora parasitica]
Length=307

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 158/224 (71%), Gaps = 0/224 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A F +  VAYKK++G    L +EPKP+EP KHQYD+DAAT   FL   GL ++FKLNIE
Sbjct  79   MAAFFKLVVAYKKELGATFQLLVEPKPREPMKHQYDYDAATVMAFLHTYGLQNDFKLNIE  138

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +I+ 
Sbjct  139  PNHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKIIEI  198

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++RY 
Sbjct  199  GGLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQRYA  258

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  192
            S+ S LG  IE GKA  E +   A E GEP   S KQELAE++L
Sbjct  259  SWKSALGERIEQGKATLEEVAAYAKESGEPDHVSGKQELAELML  302



>ref|WP_007061694.1| xylose isomerase [Clostridium carboxidivorans]
 gb|EET86757.1| xylose isomerase [Clostridium carboxidivorans P7]
 gb|EFG89380.1| xylose isomerase [Clostridium carboxidivorans P7]
Length=440

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 161/228 (71%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FAR ++ AV Y KKIGFKG   IEPKP+EPTKHQYD+D AT   FLRK  L + FK+NIE
Sbjct  209  FARILQMAVDYAKKIGFKGQFLIEPKPKEPTKHQYDFDVATVLGFLRKYKLENYFKVNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  AR N +LG++DAN GDP  GWDTDQFP ++ +ATL M  ++KN
Sbjct  269  ANHATLAGHTFQHEICLARNNNVLGSLDANQGDPHLGWDTDQFPTNIYDATLAMYEILKN  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGG NFDAK+RR S + ED+F+++I GMDT A+GLR A KL++DG ++  +++RY 
Sbjct  329  GGIAPGGLNFDAKVRRASFEPEDLFLSYIAGMDTFAKGLRIAYKLLQDGPIENFIKERYS  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF + +G  I  GK  FE LEK AL        S +QE  E I+   +
Sbjct  389  SFSTGIGKDIVDGKVGFEELEKYALSNNVMNNKSGRQEYLESIVNQYI  436



>gb|AKA69666.1| xylose isomerase [Clostridium scatologenes]
Length=440

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 162/228 (71%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            F+R ++ AV Y KKIGFKG   IEPKP+EPTKHQYD+D AT   FLRK  L + FK+NIE
Sbjct  209  FSRILQMAVDYAKKIGFKGQFLIEPKPKEPTKHQYDFDVATVLGFLRKYKLENYFKVNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  AR N +LG++DAN GDP  GWDTDQFP ++ +ATL M  ++KN
Sbjct  269  ANHATLAGHTFQHEICLARNNNVLGSLDANQGDPHLGWDTDQFPTNIYDATLAMYEILKN  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGG NFDAK+RR S + ED+F+++I GMDT A+GLR A KL++DG ++  +++RY 
Sbjct  329  GGIAPGGLNFDAKVRRASFEPEDLFLSYIAGMDTFAKGLRIAYKLLQDGPIENFIKERYS  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF + +G  I  GKA FE LEK AL        S +QE  E I+   +
Sbjct  389  SFSTGIGKDIVDGKAGFEELEKYALSNNVMNNHSGRQEYLESIVNQYI  436



>gb|ETI53522.1| xylose isomerase [Phytophthora parasitica P1569]
Length=349

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 158/223 (71%), Gaps = 0/223 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F +  VAYKK++G    L +EPKP+EP KHQYD+DAAT   FL   GL ++FKLNIE 
Sbjct  122  AAFFKLVVAYKKELGATFQLLVEPKPREPMKHQYDYDAATVMAFLHTYGLQNDFKLNIEP  181

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +I+ G
Sbjct  182  NHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKIIEIG  241

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++RY S
Sbjct  242  GLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQRYAS  301

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  192
            + S LG  IE GKA  E +   A E GEP   S KQELAE++L
Sbjct  302  WKSALGERIEQGKATLEEVAAYAKESGEPDHVSGKQELAELML  344



>emb|CAF93733.1| unnamed protein product [Tetraodon nigroviridis]
Length=414

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 158/227 (70%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F + AV YK+KIG K    IEPKP+EP KHQYD+DA +   FL+  GL  +FKLNIE 
Sbjct  188  ASFFKMAVKYKEKIGLKCQFLIEPKPKEPCKHQYDYDAMSVIAFLKHYGLEGDFKLNIEP  247

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GHS  H+V  A   G+LG++DAN+G P  GWDTDQFPMDV   TLVM +VI+ G
Sbjct  248  NHTTLAGHSYEHDVVMASAFGMLGSVDANTGSPDLGWDTDQFPMDVRNTTLVMKTVIEQG  307

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GL PGG NFDAK+RRESTD+ED+FIAHI  MD  ARGLR+AA+++EDG +  +V++RY S
Sbjct  308  GLQPGGLNFDAKVRRESTDMEDLFIAHIAAMDAFARGLRNAARIVEDGIMAAMVKERYSS  367

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            F  ++G  ++ G A  E +E    E GEPK  S KQE  E I    +
Sbjct  368  FSRDIGQKVDEGSATLEEMEAFIKENGEPKTTSGKQEKYESIFNCYI  414



>gb|EFX66553.1| hypothetical protein DAPPUDRAFT_218978 [Daphnia pulex]
Length=399

 Score =   262 bits (670),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 161/227 (71%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F+  A+ YKKKIGF+G L IEPKP+EPT+HQYD+DA T  +FLR+  L ++FKLNIE 
Sbjct  173  ANFLRMALVYKKKIGFEGQLLIEPKPKEPTRHQYDYDAQTVMSFLRQFNLQNDFKLNIEP  232

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GH   H+V  A   G+LG+IDAN+G P  GWDTDQFPMD+   T VML VI+ G
Sbjct  233  NHTTLAGHGYEHDVVMASTFGILGSIDANTGSPDLGWDTDQFPMDIRACTAVMLQVIRQG  292

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            G+ PGG NFDAK+RREST+ +D+FIAHI  MD+ ARGLR+A+K++EDG +   +++RY S
Sbjct  293  GVQPGGLNFDAKVRRESTNTKDLFIAHIAAMDSFARGLRNASKIVEDGIMARHLKERYIS  352

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            F+S  G  I  G  D E  E+   + GEP++ S +QE  E I    L
Sbjct  353  FESGFGLKICNGLTDLEECEEFIHQHGEPEMISGQQEHCEAIFNRYL  399



>ref|XP_011603566.1| PREDICTED: xylose isomerase-like isoform X3 [Takifugu rubripes]
 ref|XP_011603567.1| PREDICTED: xylose isomerase-like isoform X3 [Takifugu rubripes]
Length=414

 Score =   262 bits (670),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 158/227 (70%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F + AV YK+KIG K    IEPKP+EP KHQYD+DA +   FL+  GL  +FKLNIE 
Sbjct  188  ASFFKMAVKYKEKIGLKCQFLIEPKPKEPCKHQYDYDAMSVIGFLKHYGLERDFKLNIEP  247

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GHS  H++  A   G+LG++DAN+G P  GWDTDQFPMD+   TLVM +V++ G
Sbjct  248  NHTTLAGHSYEHDIVMASAFGMLGSVDANTGSPDLGWDTDQFPMDIRNTTLVMKTVVEQG  307

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GL PGG NFDAK+RRESTDVED+F+AH+  MDT ARGLR+A ++IEDG +  +V+ RY S
Sbjct  308  GLQPGGLNFDAKVRRESTDVEDLFVAHVAAMDTFARGLRNAVRIIEDGIMAGMVKDRYSS  367

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            F  ++G  ++ G A  E +E    E GEPK+ S KQE  E I    +
Sbjct  368  FSRDIGQKVDEGSATLEEMEAFIKEKGEPKMMSGKQETYESIFNRYI  414



>gb|ERM41646.1| xylose isomerase [Clostridium difficile P68]
Length=316

 Score =   259 bits (661),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 158/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF++ AV Y K+IGF G   IEPKP+EPTKHQYD+D AT   FLRK  L   FK+NIE
Sbjct  80   FARFLQMAVDYAKEIGFTGQFLIEPKPKEPTKHQYDFDTATVLGFLRKYNLDKYFKMNIE  139

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V+K 
Sbjct  140  ANHATLAGHTFQHELNIARINDVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEVLKQ  199

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++RY 
Sbjct  200  GGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKERYA  259

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  260  SFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  307



>ref|WP_009959507.1| xylose isomerase [Verrucomicrobium spinosum]
Length=436

 Score =   263 bits (671),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 160/225 (71%), Gaps = 0/225 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARFM  AV YKKKIGF G  +IEPKP+EP+ HQYD D+A   NFLR+ GL++ FKLNIE
Sbjct  209  LARFMHMAVDYKKKIGFAGPFYIEPKPREPSTHQYDSDSAACLNFLREYGLLEHFKLNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+E A   G LG+IDAN+GD   GWDTDQFP D+   T +ML ++K 
Sbjct  269  TNHATLAGHTMRHELEVALAAGALGSIDANTGDELIGWDTDQFPTDIYLTTEIMLVLLKM  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG   GG NFDAK+RRES +  D+F AHIGGMD  ARGL+ AA +IEDG L+  +++RY 
Sbjct  329  GGFTTGGLNFDAKVRRESFEPVDLFHAHIGGMDAFARGLKIAAAIIEDGRLEGFLKQRYS  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQ  189
            +FDS +GA IE G   FE LE   L+ GEP + S +QE+ E ++ 
Sbjct  389  TFDSGIGAQIERGDVGFEELEAYTLKNGEPAIGSGRQEMLENLVN  433



>ref|XP_010738382.1| PREDICTED: xylose isomerase-like isoform X1 [Larimichthys crocea]
Length=439

 Score =   262 bits (670),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 157/227 (69%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F + AV YK+KIG K    IEPKP+EP KHQYD+DA +   FL+  GL   FKLNIE 
Sbjct  213  ANFFKMAVQYKEKIGLKCQFLIEPKPKEPCKHQYDYDAMSVIGFLKHYGLESHFKLNIEP  272

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GHS  H+V  A   G+LG++D+N+G P  GWDTDQFPMD+   TLVM ++++ G
Sbjct  273  NHTTLAGHSYEHDVVMASAFGMLGSVDSNTGSPDLGWDTDQFPMDIRNTTLVMKTIVEQG  332

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GL PGG NFDAK+RRESTD+ED+FIAHIG MD  ARGLR+A ++IEDG +  +V++RY S
Sbjct  333  GLQPGGLNFDAKVRRESTDLEDLFIAHIGAMDAFARGLRNAVRIIEDGLIAGMVKERYSS  392

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            F   +G  +E G A  E +E    + GEPKV S KQE  E I    +
Sbjct  393  FSHGIGQKVEEGSATLEEMEAFITQKGEPKVTSGKQEKYESIFNHYI  439



>gb|ELU13203.1| hypothetical protein CAPTEDRAFT_149382 [Capitella teleta]
Length=442

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 160/224 (71%), Gaps = 0/224 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F + A+AYKKKIGF G   IEPKP+EPTKHQYD+DA T   FL+  GL  +FK+N+E 
Sbjct  216  ANFFKMALAYKKKIGFTGQFLIEPKPKEPTKHQYDYDAMTVIAFLKNFGLEKDFKINVEP  275

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GH   H++  A   G+LG+ID+N+G P  GWDTDQFPMD    T+VM +V++ G
Sbjct  276  NHTTLAGHCYEHDIVMASAFGMLGSIDSNTGSPDLGWDTDQFPMDTKACTMVMKTVLEQG  335

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            G+ PGG NFDAK+RREST+V D+FIAHIG MD  ARGL++AA+LIEDG +K+ +  RY+S
Sbjct  336  GIQPGGLNFDAKVRRESTEVSDMFIAHIGAMDAFARGLKNAARLIEDGIIKKNLEARYKS  395

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQ  189
            F  ++GA I+ G A  E  E   L+ GEPK  S KQE  E +L 
Sbjct  396  FSVDIGAKIKAGSATLEECEAFILKNGEPKKTSGKQEHFESMLN  439



>ref|XP_011603565.1| PREDICTED: xylose isomerase-like isoform X2 [Takifugu rubripes]
Length=437

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 158/227 (70%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F + AV YK+KIG K    IEPKP+EP KHQYD+DA +   FL+  GL  +FKLNIE 
Sbjct  211  ASFFKMAVKYKEKIGLKCQFLIEPKPKEPCKHQYDYDAMSVIGFLKHYGLERDFKLNIEP  270

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GHS  H++  A   G+LG++DAN+G P  GWDTDQFPMD+   TLVM +V++ G
Sbjct  271  NHTTLAGHSYEHDIVMASAFGMLGSVDANTGSPDLGWDTDQFPMDIRNTTLVMKTVVEQG  330

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GL PGG NFDAK+RRESTDVED+F+AH+  MDT ARGLR+A ++IEDG +  +V+ RY S
Sbjct  331  GLQPGGLNFDAKVRRESTDVEDLFVAHVAAMDTFARGLRNAVRIIEDGIMAGMVKDRYSS  390

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            F  ++G  ++ G A  E +E    E GEPK+ S KQE  E I    +
Sbjct  391  FSRDIGQKVDEGSATLEEMEAFIKEKGEPKMMSGKQETYESIFNRYI  437



>ref|WP_032079132.1| xylose isomerase [Clostridium drakei]
Length=440

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 160/228 (70%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FAR ++ AV Y KKIGFKG   IEPKP+EPTKHQYD+D AT   FLRK  L + FK+NIE
Sbjct  209  FARILQMAVDYAKKIGFKGQFLIEPKPKEPTKHQYDFDVATVLGFLRKYKLENYFKVNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  AR N +LG++DAN GDP  GWDTDQFP ++ +ATL M  ++KN
Sbjct  269  ANHATLAGHTFQHEICLARNNNVLGSLDANQGDPHLGWDTDQFPTNIYDATLAMYEILKN  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            G +APGG NFDAK+RR S + ED+F+++I GMDT A+GLR A KL+ DG ++  +++RY 
Sbjct  329  GDIAPGGLNFDAKVRRASFEPEDLFLSYIAGMDTFAKGLRIAYKLLHDGPIENFIKERYS  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF + +G  I  GKA FE LEK AL        S +QE  E I+   +
Sbjct  389  SFSTGIGKDIVDGKAGFEELEKYALSNNTMNNQSGRQEYLESIVNQYI  436



>ref|WP_038164239.1| xylose isomerase [Verrucomicrobium sp. BvORR106]
Length=437

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 163/225 (72%), Gaps = 1/225 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A+F+  AV Y K+IGFKG  +IEPKP+EPTKHQYD DAA   NFLR+  L+  FKLN+E
Sbjct  209  LAKFLHMAVDYAKQIGFKGQFYIEPKPKEPTKHQYDSDAAACLNFLREYDLLPYFKLNLE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GHS  HE+E A   G LG++DAN+GD   GWDTDQF  D + AT +ML+ +K 
Sbjct  269  TNHATLAGHSMQHEMEVAGAAGALGSLDANTGDLLLGWDTDQFLTDASTATQMMLTTLKY  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGL  GG NFDAK+RRES D ED+F +HIGGMDT ARGL++AA +  DG L + V++RY 
Sbjct  329  GGLTTGGVNFDAKVRRESVDPEDLFYSHIGGMDTFARGLKNAAAIRADGRLGDFVKQRYS  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGE-PKVPSAKQELAEMIL  192
            ++D+ LGA+IE GK  F  LE  ALE GE  +VPS +QE  E ++
Sbjct  389  TWDTGLGASIEAGKESFSSLEAFALEKGEATQVPSGRQEFLENLV  433



>ref|XP_003387079.1| PREDICTED: xylose isomerase-like [Amphimedon queenslandica]
Length=460

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 161/225 (72%), Gaps = 0/225 (0%)
 Frame = -1

Query  854  FMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNH  675
            F +  VAYKKKIGF G L IEPKP+EPTKHQYD+DA T  +FL+  GL  +FKLNIE NH
Sbjct  234  FFKMVVAYKKKIGFTGQLLIEPKPKEPTKHQYDYDAQTVISFLKTYGLDTDFKLNIEPNH  293

Query  674  ATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGL  495
             TL+GH   H+V  A   G+LG+ID+N+G P  GWDTDQFPM++   TL+M ++I+ GGL
Sbjct  294  TTLAGHGHEHDVVVASKFGMLGSIDSNTGSPDLGWDTDQFPMEIKNTTLIMKAIIEQGGL  353

Query  494  APGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFD  315
            APGG NFD K+RRES D++D+FIAHIG MD+ ARGL  A +L   G +++ V+ RY S+D
Sbjct  354  APGGLNFDCKVRRESIDLQDLFIAHIGAMDSFARGLMCAVELFNQGVMEKCVKDRYSSYD  413

Query  314  SELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            S +G++IE GKA  E LE+     G P   S +QE+ E++  +AL
Sbjct  414  SGIGSSIENGKASLEQLEEYIKANGFPTPTSGQQEMYEVLFNNAL  458



>gb|AAR09155.1| xylose isomerase [Mannheimia granulomatis]
Length=239

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 157/231 (68%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KI FKG L IEPKPQEPTKHQYD+D AT   FL++ GL +E K+N
Sbjct  7    EQIGRFMQLVVEHKHKIVFKGILLIEPKPQEPTKHQYDYDVATVYGFLKQFGLENEIKMN  66

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GH+  HE+ TA   G+ G+IDAN GDPQ GWDTDQFP  V E TLVM  ++
Sbjct  67   IEANHATLAGHTFQHEIATATALGIFGSIDANRGDPQLGWDTDQFPNSVEENTLVMYEIL  126

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GGFNFDAK+RR+STD  D+F AHIG MD LA  L+ AAK+ ED +L+++V  R
Sbjct  127  KAGGFTTGGFNFDAKIRRQSTDPYDLFHAHIGAMDVLALSLKQAAKMFEDQTLQKVVDNR  186

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++ +LG  I  GKA  E L K     G +PK  S +QE  E ++ S +
Sbjct  187  YAGWNQDLGQQILTGKASLEALAKIVETQGLDPKPVSGQQEYLENLVNSYI  237



>ref|WP_016601082.1| xylose isomerase, partial [Yersinia pestis]
Length=328

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 154/224 (69%), Gaps = 1/224 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K K GF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  96   EQIGRFMQMVVEHKHKTGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  155

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GHS HHE+ +A   G+ G++DAN GDPQ GWDTDQFP  V E TLVM  ++
Sbjct  156  IEANHATLAGHSFHHEIASAIALGIFGSVDANRGDPQLGWDTDQFPNSVEENTLVMFEIL  215

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F  HIG MDT+A  L+ AAK+IEDG L ++V KR
Sbjct  216  KAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKFAAKMIEDGQLDQIVAKR  275

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAE  201
            Y  ++SELG  I  GK   E L + A +    P+  S  QEL E
Sbjct  276  YAGWNSELGQQILQGKMSLEELSRYASQHNLNPQHQSGHQELLE  319



>ref|WP_009959227.1| xylose isomerase [Verrucomicrobium spinosum]
Length=437

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 163/225 (72%), Gaps = 1/225 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A+F+  AV Y K+IGFKG  +IEPKP+EPTKHQYD DAA   NFLR+  L+  FKLN+E
Sbjct  209  LAKFLHMAVDYAKQIGFKGQFYIEPKPKEPTKHQYDSDAAACLNFLREYDLLPYFKLNLE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GHS  HE+E A   G LG++DAN+GD   GWDTDQF  D + AT +ML+ +K 
Sbjct  269  TNHATLAGHSMQHEMEVAGAAGALGSLDANTGDLLLGWDTDQFLTDASTATQMMLTALKY  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGL  GG NFDAK+RRES D ED+F +HIGGMDT ARGL++AA +  DG L + V++RY 
Sbjct  329  GGLTTGGVNFDAKVRRESVDPEDLFYSHIGGMDTFARGLKNAAAIRADGRLGDFVKQRYS  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGE-PKVPSAKQELAEMIL  192
            ++D+ LGA+IE GK  F  LE  ALE GE  +VPS +QE  E ++
Sbjct  389  TWDTGLGASIEAGKESFSSLEAFALEKGEATQVPSGRQEYLENLV  433



>ref|WP_013238479.1| MULTISPECIES: xylose isomerase [Clostridium]
 gb|ADK14887.1| predicted xylose isomerase [Clostridium ljungdahlii DSM 13528]
 gb|AGY78133.1| Xylose isomerase [Clostridium autoethanogenum DSM 10061]
Length=440

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 159/228 (70%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FAR ++ AV Y KKIGFKG   IEPKP+EPTKHQYD+D AT   FLRK  L D FK+NIE
Sbjct  209  FARILQMAVDYAKKIGFKGQFLIEPKPKEPTKHQYDFDVATVLGFLRKYKLEDYFKINIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  AR N  LG++DAN GDP  GWDTDQFP +V + TL M  V+KN
Sbjct  269  ANHATLAGHTFQHEICLARNNNALGSLDANQGDPHLGWDTDQFPTNVYDTTLSMYEVLKN  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGG NFDAK+RR S + ED+F+A+I GMD+ A+GLR A KL++D  ++  +++RY 
Sbjct  329  GGIAPGGLNFDAKVRRASFEPEDLFLAYIAGMDSFAKGLRVAYKLLQDAPIENFIKERYS  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF + +G  I  GK  F+ LEK ALE       S +QE  E ++   +
Sbjct  389  SFSTGIGKDIVDGKVGFDELEKYALENNVINNKSGRQEYLESVVNQYI  436



>ref|WP_035688493.1| xylose isomerase [Avibacterium paragallinarum]
 gb|KKA98553.1| xylose isomerase [Avibacterium paragallinarum]
Length=439

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 160/234 (68%), Gaps = 7/234 (3%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGFKGTL IEPKPQEPTKHQYD+D AT   FL++ GL +E K+N
Sbjct  207  EQIGRFMQMVVEHKHKIGFKGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLENEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GHS HHE+ TA   G+ G+IDAN GDPQ+GWDTDQFP  V E TLVM  ++
Sbjct  267  IEANHATLAGHSFHHEIATAYALGIFGSIDANRGDPQSGWDTDQFPNSVEENTLVMYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            KNGG   GGFNFDAK+RR+S D  D+F  HIG +D LA  LR AA +I+D  L++LV +R
Sbjct  327  KNGGFTTGGFNFDAKIRRQSNDPYDLFYGHIGAIDVLALSLRRAADMIQDQQLQKLVEQR  386

Query  329  YQSFDSELGAAIEGGKADFE----LLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            Y  +DS+LG AI  G    E    L+E + L    P+  S +QE  E ++   +
Sbjct  387  YSGWDSQLGKAILSGNTSLEALAQLVETQNL---NPQPVSGQQEYLENLVNRYI  437



>ref|XP_005090167.1| PREDICTED: xylose isomerase-like [Aplysia californica]
Length=338

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 157/227 (69%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F   A+AYKKKIGF G   IEPKP+EPTKHQYD+DA T   FLR  GL  E KLNIE 
Sbjct  112  ATFFRLAIAYKKKIGFNGVFLIEPKPKEPTKHQYDYDAMTVIAFLRTYGLEKEIKLNIEP  171

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GHS  H+V  A    +LG++D+N+G P  GWDTDQFPMDV  ATL+M  +++ G
Sbjct  172  NHTTLAGHSYEHDVVMASAYNMLGSVDSNTGSPDLGWDTDQFPMDVKNATLLMKVLLRQG  231

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GL PGG NFD K+RRESTD++D+FI+HIG MDT AR L+ AAK+ ++  + + V +RY++
Sbjct  232  GLQPGGLNFDCKVRRESTDLKDMFISHIGAMDTFARALKCAAKIFDEEVISKQVEERYKT  291

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            F S +GA IE G    E LE+  L+ GEP   S +QE  E +L   L
Sbjct  292  FQSGIGAKIESGDTTLEELEEYVLQNGEPSQISGQQEHFENMLNYYL  338



>ref|XP_008321922.1| PREDICTED: xylose isomerase-like isoform X2 [Cynoglossus semilaevis]
Length=407

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 157/227 (69%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F + AV YK+KIG K    IEPKP+EP +HQYD+DA +   FL+  GL D FKLNIE 
Sbjct  181  ANFFKMAVKYKEKIGLKCQFLIEPKPKEPCRHQYDYDAMSVIGFLKHYGLQDHFKLNIEP  240

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GHS  H++  A   G+LG++DAN+G P  GWDTDQFPMD+   TLVM ++I+ G
Sbjct  241  NHTTLAGHSYEHDIVMASAFGMLGSVDANTGSPDLGWDTDQFPMDIKNTTLVMKTIIEQG  300

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GL PGG NFDAK+RRESTD+ D+FIAHIG MD  ARGLR+A ++++DG +  +V +RY S
Sbjct  301  GLQPGGLNFDAKVRRESTDLVDLFIAHIGAMDAFARGLRNAVRIMDDGIMTGMVMERYSS  360

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            F   LG  ++ G A  E +E   ++ GEP+V S KQE  E I    +
Sbjct  361  FSHGLGHKVDNGSATLEEMEDFVIQNGEPEVKSGKQEKYESIFNHYI  407



>ref|XP_008290598.1| PREDICTED: xylose isomerase-like [Stegastes partitus]
Length=440

 Score =   261 bits (667),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 157/227 (69%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F + AV YK+KIG K    IEPKP+EP KHQYD+DA +   FL+  GL   FKLNIE 
Sbjct  214  ANFFQMAVKYKEKIGLKCQFLIEPKPKEPCKHQYDYDAMSVIGFLKHYGLESHFKLNIEP  273

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GHS  H+V  A   G+LG++D+N+G P  GWDTDQFPMD+   TLVM ++I+ G
Sbjct  274  NHTTLAGHSYEHDVVMASAFGMLGSVDSNTGSPDLGWDTDQFPMDIRNTTLVMKTIIEQG  333

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GL PGG NFDAK+RRESTD+ED+FIAHIG MD  ARGLR+A +++EDG +  ++++RY S
Sbjct  334  GLQPGGLNFDAKVRRESTDLEDLFIAHIGAMDAFARGLRNAVRILEDGLIGGMLKERYSS  393

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            F   LG  +E G A  E +E    + GEPKV S KQE  E I    +
Sbjct  394  FSHGLGQKVEEGSATLEEMEAFVNQNGEPKVTSGKQEKYESIFNHYI  440



>gb|EOS54587.1| xylose isomerase [Paenibacillus barengoltzii G22]
Length=439

 Score =   261 bits (666),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 152/206 (74%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF + A+ Y K+IGFKG   IEPKP+EPTKHQYD+DAATT  FL+K GL D FKLN+E
Sbjct  208  LARFFQMAIDYAKEIGFKGQFLIEPKPKEPTKHQYDFDAATTIAFLQKYGLQDHFKLNLE  267

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTD+FP D+   TL M  ++KN
Sbjct  268  ANHATLAGHTFEHELRVARINNMLGSIDANQGDMLLGWDTDEFPTDLYAVTLAMYEILKN  327

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGL  GG NFDAK+RR S + ED+F AHI GMDT A+GL+ A K+IED  ++ L+ +RY 
Sbjct  328  GGLGSGGVNFDAKVRRTSFEPEDLFYAHIAGMDTFAKGLKVAGKMIEDNFIENLIEERYA  387

Query  323  SFDSELGAAIEGGKADFELLEKKALE  246
            SF S +GA I  GKA+F+ LE  ALE
Sbjct  388  SFKSGIGADIVSGKANFKTLEAYALE  413



>ref|XP_008900733.1| xylose isomerase [Phytophthora parasitica INRA-310]
 gb|ETN13656.1| xylose isomerase [Phytophthora parasitica INRA-310]
Length=452

 Score =   261 bits (667),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 158/223 (71%), Gaps = 0/223 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F +  VAYKK++G      +EPKP+EP KHQYD+DAAT   FL   GL ++FKLNIE 
Sbjct  225  AAFFKLVVAYKKELGATFQFLVEPKPREPMKHQYDYDAATVMAFLHTYGLQNDFKLNIEP  284

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +I+ G
Sbjct  285  NHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKIIEIG  344

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GLAPGGFNFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++RY S
Sbjct  345  GLAPGGFNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQRYAS  404

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  192
            + S LG  IE GKA  E +   A E GEP   S KQELAE++L
Sbjct  405  WKSALGERIEQGKATLEEVAAYAKESGEPDHVSGKQELAELML  447



>ref|XP_003965907.2| PREDICTED: xylose isomerase-like isoform X1 [Takifugu rubripes]
Length=492

 Score =   262 bits (670),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 158/227 (70%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F + AV YK+KIG K    IEPKP+EP KHQYD+DA +   FL+  GL  +FKLNIE 
Sbjct  266  ASFFKMAVKYKEKIGLKCQFLIEPKPKEPCKHQYDYDAMSVIGFLKHYGLERDFKLNIEP  325

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GHS  H++  A   G+LG++DAN+G P  GWDTDQFPMD+   TLVM +V++ G
Sbjct  326  NHTTLAGHSYEHDIVMASAFGMLGSVDANTGSPDLGWDTDQFPMDIRNTTLVMKTVVEQG  385

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GL PGG NFDAK+RRESTDVED+F+AH+  MDT ARGLR+A ++IEDG +  +V+ RY S
Sbjct  386  GLQPGGLNFDAKVRRESTDVEDLFVAHVAAMDTFARGLRNAVRIIEDGIMAGMVKDRYSS  445

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            F  ++G  ++ G A  E +E    E GEPK+ S KQE  E I    +
Sbjct  446  FSRDIGQKVDEGSATLEEMEAFIKEKGEPKMMSGKQETYESIFNRYI  492



>gb|EES74125.1| xylose isomerase [Paenibacillus sp. oral taxon 786 str. D14]
Length=439

 Score =   261 bits (666),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 152/206 (74%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF + A+ Y K+IGFKG   IEPKP+EPTKHQYD+DAATT  FL+K GL D FKLN+E
Sbjct  208  LARFFQMAIDYAKEIGFKGQFLIEPKPKEPTKHQYDFDAATTIAFLQKYGLQDHFKLNLE  267

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTD+FP D+   TL M  ++KN
Sbjct  268  ANHATLAGHTFEHELRVARINNMLGSIDANQGDMLLGWDTDEFPTDLYAVTLAMYEILKN  327

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGL  GG NFDAK+RR S + ED+F AHI GMDT A+GL+ A K+IED  ++ L+ +RY 
Sbjct  328  GGLGSGGVNFDAKVRRTSFEPEDLFYAHIAGMDTFAKGLKVAGKMIEDNFIENLIEERYA  387

Query  323  SFDSELGAAIEGGKADFELLEKKALE  246
            SF S +GA I  GKA+F+ LE  ALE
Sbjct  388  SFKSGIGADIVSGKANFKTLEAYALE  413



>ref|WP_028537509.1| MULTISPECIES: xylose isomerase [Paenibacillus]
Length=438

 Score =   261 bits (666),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 152/206 (74%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF + A+ Y K+IGFKG   IEPKP+EPTKHQYD+DAATT  FL+K GL D FKLN+E
Sbjct  207  LARFFQMAIDYAKEIGFKGQFLIEPKPKEPTKHQYDFDAATTIAFLQKYGLQDHFKLNLE  266

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTD+FP D+   TL M  ++KN
Sbjct  267  ANHATLAGHTFEHELRVARINNMLGSIDANQGDMLLGWDTDEFPTDLYAVTLAMYEILKN  326

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGL  GG NFDAK+RR S + ED+F AHI GMDT A+GL+ A K+IED  ++ L+ +RY 
Sbjct  327  GGLGSGGVNFDAKVRRTSFEPEDLFYAHIAGMDTFAKGLKVAGKMIEDNFIENLIEERYA  386

Query  323  SFDSELGAAIEGGKADFELLEKKALE  246
            SF S +GA I  GKA+F+ LE  ALE
Sbjct  387  SFKSGIGADIVSGKANFKTLEAYALE  412



>ref|WP_026462632.1| xylose isomerase [Adhaeribacter aquaticus]
Length=444

 Score =   260 bits (665),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 161/231 (70%), Gaps = 0/231 (0%)
 Frame = -1

Query  872  AEPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKL  693
             E  ARF+E A  Y +K GFKGT  IEPKP EPTKHQYD+DAAT   FL K GL D+FKL
Sbjct  214  VEHMARFLEMARDYGRKQGFKGTFLIEPKPMEPTKHQYDFDAATVIGFLNKFGLQDDFKL  273

Query  692  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  513
            N+E NHATL+ H+  HE++ A   G+LG+IDAN GD Q GWDTDQFP+D+ E T  ML +
Sbjct  274  NLETNHATLANHTFAHELQVAVDAGMLGSIDANRGDYQNGWDTDQFPVDLYELTEAMLVI  333

Query  512  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  333
            ++ GG+  GG NFDAKLRR STD++D+F AHIGGMD  ARGL  AA ++E    K++ ++
Sbjct  334  LEGGGIMTGGVNFDAKLRRNSTDLDDLFHAHIGGMDAFARGLLIAADVLEKSDYKKIRQQ  393

Query  332  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            RY SFDS  G A E GK  FE L + A+  GEP+  S KQEL E I+   +
Sbjct  394  RYASFDSGDGQAFEQGKLTFEELTQIAIRNGEPQQISGKQELLENIINQYI  444



>ref|WP_036644393.1| xylose isomerase [Paenibacillus sp. oral taxon 786]
Length=438

 Score =   260 bits (665),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 152/206 (74%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF + A+ Y K+IGFKG   IEPKP+EPTKHQYD+DAATT  FL+K GL D FKLN+E
Sbjct  207  LARFFQMAIDYAKEIGFKGQFLIEPKPKEPTKHQYDFDAATTIAFLQKYGLQDHFKLNLE  266

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTD+FP D+   TL M  ++KN
Sbjct  267  ANHATLAGHTFEHELRVARINNMLGSIDANQGDMLLGWDTDEFPTDLYAVTLAMYEILKN  326

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGL  GG NFDAK+RR S + ED+F AHI GMDT A+GL+ A K+IED  ++ L+ +RY 
Sbjct  327  GGLGSGGVNFDAKVRRTSFEPEDLFYAHIAGMDTFAKGLKVAGKMIEDNFIENLIEERYA  386

Query  323  SFDSELGAAIEGGKADFELLEKKALE  246
            SF S +GA I  GKA+F+ LE  ALE
Sbjct  387  SFKSGIGADIVSGKANFKTLEAYALE  412



>ref|WP_008302073.1| xylose isomerase [Glaciecola agarilytica]
 dbj|GAC03229.1| xylose isomerase [Glaciecola agarilytica NO2]
Length=439

 Score =   260 bits (665),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 129/231 (56%), Positives = 162/231 (70%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM   V +K KIGFKG L IEPKPQEPTKHQYD+D AT   FL++ GL +EFK+N
Sbjct  207  EQLGRFMNMVVEHKHKIGFKGLLLIEPKPQEPTKHQYDYDTATVYGFLKQYGLENEFKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GHS  HEV TA   GL G+IDAN GDPQ GWDTDQFP  V E +LV+  ++
Sbjct  267  IEANHATLAGHSFQHEVATAISLGLFGSIDANRGDPQLGWDTDQFPNSVEELSLVIYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GGFNFD KLRR+S+D +D+FIAHIGGMD LA GL+ AA++IE+  L ++V KR
Sbjct  327  KAGGFTSGGFNFDTKLRRQSSDPQDMFIAHIGGMDHLAMGLKKAAQMIENDFLGQVVSKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++ ELG  I+GG+   E L    ++   +P+  S +QEL E  + + L
Sbjct  387  YAGWNGELGKGIQGGEFTLESLANLCVDKDLQPQHVSGQQELLENKVNNVL  437



>ref|WP_007985011.1| MULTISPECIES: xylose isomerase [Glaciecola]
 gb|AEE24646.1| xylose isomerase [Glaciecola sp. 4H-3-7+YE-5]
 dbj|GAC08661.1| xylose isomerase [Glaciecola chathamensis S18K6]
Length=439

 Score =   260 bits (664),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 129/231 (56%), Positives = 162/231 (70%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM   V +K KIGFKG L IEPKPQEPTKHQYD+D AT   FL++ GL +EFK+N
Sbjct  207  EQLGRFMNMVVEHKHKIGFKGLLLIEPKPQEPTKHQYDYDTATVYGFLKQYGLENEFKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GHS  HEV TA   GL G+IDAN GDPQ GWDTDQFP  V E +LV+  ++
Sbjct  267  IEANHATLAGHSFQHEVATAISLGLFGSIDANRGDPQLGWDTDQFPNSVEELSLVIYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GGFNFD KLRR+S+D +D+FIAHIGGMD LA GL+ AA++IE+  L ++V KR
Sbjct  327  KAGGFTSGGFNFDTKLRRQSSDPQDMFIAHIGGMDHLAMGLKKAAQMIENDFLGQVVSKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++ ELG  I+GG+   E L    ++   +P+  S +QEL E  + + L
Sbjct  387  YAGWNGELGKGIQGGEFTLESLANLCVDKDLQPQHVSGQQELLENKVNNVL  437



>emb|CDQ80418.1| unnamed protein product [Oncorhynchus mykiss]
Length=438

 Score =   260 bits (664),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/227 (53%), Positives = 155/227 (68%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F +  V YK+KIG K    IEPKP+EP KHQYD+DA +   FL+   L   FKLNIE 
Sbjct  212  ANFFKMTVKYKEKIGLKCQFLIEPKPKEPCKHQYDYDAMSVIGFLKHYDLDSHFKLNIEP  271

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GHS  H+V  A + G+LG++D+N+G P  GWDTDQFPMD+   T++M +VI+ G
Sbjct  272  NHTTLAGHSYEHDVVMASVFGMLGSVDSNTGSPDLGWDTDQFPMDIRNTTMIMKTVIEQG  331

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GL PGG NFDAK+RRESTD+ED+FIAH+G MD  ARGLR+A ++IE+G +  +V++RY S
Sbjct  332  GLQPGGLNFDAKVRRESTDLEDLFIAHVGAMDAFARGLRNAVRIIEEGVITSMVKERYMS  391

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            F   +G  +E G    E LE    + GEPKV S KQE  E +    L
Sbjct  392  FSHGIGQKVEDGSTSLEELEDFVKQNGEPKVTSGKQEKYETVFNHYL  438



>ref|WP_010074860.1| xylose isomerase [Clostridium cellulovorans]
 gb|ADL50361.1| xylose isomerase [Clostridium cellulovorans 743B]
Length=439

 Score =   260 bits (664),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 157/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF + AV Y KKIGF G   IEPKP+EPTKHQYD+D AT   FLRK  L   FK+NIE
Sbjct  209  LARFFQMAVDYAKKIGFTGQFLIEPKPKEPTKHQYDFDVATVLGFLRKYNLEKYFKMNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+ H+  HEV  AR+NG+LG++D N GDP  GWDTDQFP ++ +AT+VM  V+KN
Sbjct  269  ANHATLAQHTFQHEVAVARVNGVLGSLDVNQGDPNLGWDTDQFPTNIYDATMVMYEVLKN  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGG NFDAK RR S + ED+F+++I GMDT+A+GLR A  L++D  L+    +RY+
Sbjct  329  GGIAPGGLNFDAKTRRASFEPEDLFLSYIAGMDTMAKGLRVAYSLLDDAVLENNTSERYK  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            +F   +G  I  GK DFE LEK ALE       S +QE  E ++   +
Sbjct  389  TFSEGIGKDIVEGKVDFESLEKYALENSVISNKSGRQEYLESVVNQYI  436



>ref|WP_026658263.1| Xylose isomerase [Acholeplasma palmae]
 emb|CCV64223.1| Xylose isomerase [Acholeplasma palmae J233]
Length=439

 Score =   260 bits (664),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 155/227 (68%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A  ++ +  Y +KIGFKG  +IEPKP+EPTKHQYD+D+ATT  FLRKN L+ +F+LNIE 
Sbjct  210  ATMLKISRDYGRKIGFKGDFYIEPKPKEPTKHQYDFDSATTIGFLRKNDLLKDFRLNIEA  269

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATL+GH+  HE+ TARI G+ G+IDAN GD   GWDTDQFP +V +ATL M  V+K G
Sbjct  270  NHATLAGHTFQHEIATARIEGVFGSIDANEGDLLLGWDTDQFPFNVYDATLCMYEVLKAG  329

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            G   GG NFDAK RR S  VED+ +A+I GMDT A GLR A +LIED  L      RYQS
Sbjct  330  GFTDGGLNFDAKTRRPSNTVEDLLLAYIHGMDTYALGLRKAVELIEDERLDNFKENRYQS  389

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            F++E G  I   K   E L + AL+  EP V S KQE  EMI+   L
Sbjct  390  FNTEFGQKILNNKITLEELTEHALKNQEPDVKSGKQEYLEMIVNQIL  436



>gb|ETL77578.1| xylose isomerase [Phytophthora parasitica]
 gb|ETL99919.1| xylose isomerase [Phytophthora parasitica]
 gb|ETM30630.1| xylose isomerase [Phytophthora parasitica]
 gb|ETM53081.1| xylose isomerase [Phytophthora parasitica]
 gb|ETO82200.1| xylose isomerase [Phytophthora parasitica P1976]
 gb|ETO82215.1| xylose isomerase [Phytophthora parasitica P1976]
 gb|ETP23318.1| xylose isomerase [Phytophthora parasitica CJ01A1]
 gb|ETP23343.1| xylose isomerase [Phytophthora parasitica CJ01A1]
Length=452

 Score =   260 bits (665),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 158/223 (71%), Gaps = 0/223 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F +  VAYKK++G    L +EPKP+EP KHQYD+DAAT   FL   GL ++FKLNIE 
Sbjct  225  AAFFKLVVAYKKELGATFQLLVEPKPREPMKHQYDYDAATVMAFLHTYGLQNDFKLNIEP  284

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +I+ G
Sbjct  285  NHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKIIEIG  344

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++RY S
Sbjct  345  GLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQRYAS  404

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  192
            + S LG  IE GKA  E +   A E GEP   S KQELAE++L
Sbjct  405  WKSALGERIEQGKATLEEVAAYAKESGEPDHVSGKQELAELML  447



>ref|WP_045959980.1| xylose isomerase [Acholeplasma palmae]
Length=434

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 155/227 (68%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A  ++ +  Y +KIGFKG  +IEPKP+EPTKHQYD+D+ATT  FLRKN L+ +F+LNIE 
Sbjct  205  ATMLKISRDYGRKIGFKGDFYIEPKPKEPTKHQYDFDSATTIGFLRKNDLLKDFRLNIEA  264

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATL+GH+  HE+ TARI G+ G+IDAN GD   GWDTDQFP +V +ATL M  V+K G
Sbjct  265  NHATLAGHTFQHEIATARIEGVFGSIDANEGDLLLGWDTDQFPFNVYDATLCMYEVLKAG  324

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            G   GG NFDAK RR S  VED+ +A+I GMDT A GLR A +LIED  L      RYQS
Sbjct  325  GFTDGGLNFDAKTRRPSNTVEDLLLAYIHGMDTYALGLRKAVELIEDERLDNFKENRYQS  384

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            F++E G  I   K   E L + AL+  EP V S KQE  EMI+   L
Sbjct  385  FNTEFGQKILNNKITLEELTEHALKNQEPDVKSGKQEYLEMIVNQIL  431



>ref|WP_012341741.1| xylose isomerase [Histophilus somni]
 sp|B0UT19.1|XYLA_HISS2 RecName: Full=Xylose isomerase [Haemophilus somnus 2336]
 gb|ACA32619.1| xylose isomerase [Haemophilus somnus 2336]
Length=439

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 159/231 (69%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL +E K+N
Sbjct  207  EQIGRFMQLVVEHKYKIGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLENEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GH+  HE+ TA   G+ G+IDAN GDPQ GWDTDQFP  V E TL M  ++
Sbjct  267  IEANHATLAGHTFQHEIATATSLGIFGSIDANRGDPQLGWDTDQFPNSVEENTLAMYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GGFNFDAK+RR+STD  D+F AHIG MD LA  L+ AAK+IED +L+++V  R
Sbjct  327  KAGGFTTGGFNFDAKIRRQSTDPYDLFHAHIGAMDVLALSLKRAAKMIEDQTLQKVVDNR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  +D ELG  I  GKA  E L K     G +PK  S +QE  E ++ S L
Sbjct  387  YAGWDQELGQKILSGKASLEDLAKIVETQGLDPKPVSGQQEYLENLVNSYL  437



>ref|XP_008321921.1| PREDICTED: xylose isomerase-like isoform X1 [Cynoglossus semilaevis]
Length=439

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 157/227 (69%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F + AV YK+KIG K    IEPKP+EP +HQYD+DA +   FL+  GL D FKLNIE 
Sbjct  213  ANFFKMAVKYKEKIGLKCQFLIEPKPKEPCRHQYDYDAMSVIGFLKHYGLQDHFKLNIEP  272

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GHS  H++  A   G+LG++DAN+G P  GWDTDQFPMD+   TLVM ++I+ G
Sbjct  273  NHTTLAGHSYEHDIVMASAFGMLGSVDANTGSPDLGWDTDQFPMDIKNTTLVMKTIIEQG  332

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GL PGG NFDAK+RRESTD+ D+FIAHIG MD  ARGLR+A ++++DG +  +V +RY S
Sbjct  333  GLQPGGLNFDAKVRRESTDLVDLFIAHIGAMDAFARGLRNAVRIMDDGIMTGMVMERYSS  392

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            F   LG  ++ G A  E +E   ++ GEP+V S KQE  E I    +
Sbjct  393  FSHGLGHKVDNGSATLEEMEDFVIQNGEPEVKSGKQEKYESIFNHYI  439



>ref|WP_020532079.1| hypothetical protein [Flexithrix dorotheae]
Length=438

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 164/230 (71%), Gaps = 0/230 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   +F+  A  Y +KIGF+GT  IEPKP EP+KHQYD+DAAT   FL + GL D+FKLN
Sbjct  209  EHMGQFLRLARDYGRKIGFEGTFLIEPKPAEPSKHQYDFDAATVIGFLHQQGLADDFKLN  268

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GH+  H++  A  + +LG+IDAN GD Q GWDTD FP D+ +AT VM+ ++
Sbjct  269  IEANHATLAGHTFAHDIRVAADHKMLGSIDANQGDYQNGWDTDYFPHDIYDATEVMMVLL  328

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            ++GGL  GGFNFDAK+RR STD+EDIFI+HI GMD  ARGL  A K++++ +  +L + R
Sbjct  329  ESGGLGKGGFNFDAKVRRNSTDLEDIFISHIAGMDIFARGLLVADKILKETNFTQLKKDR  388

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            Y SFDS  GAA E G+ + E L + A+E GEPK  S KQEL E ++   +
Sbjct  389  YSSFDSGKGAAYEKGELNLEALREIAVEVGEPKKISGKQELFESLVNQCI  438



>ref|WP_007106886.1| xylose isomerase [Glaciecola polaris]
 dbj|GAC35123.1| xylose isomerase [Glaciecola polaris LMG 21857]
Length=439

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 159/231 (69%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM   V +K KIGFKG L IEPKPQEPTKHQYD+D AT   FL++ GL +EFK+N
Sbjct  207  EQLGRFMNMVVEHKHKIGFKGLLLIEPKPQEPTKHQYDYDTATVYGFLKQYGLENEFKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GHS  HEV TA   GL G+IDAN GD Q GWDTDQFP  V E TLV+  ++
Sbjct  267  IEANHATLAGHSFQHEVATAISLGLFGSIDANRGDAQLGWDTDQFPNSVEELTLVIYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GGFNFD KLRR+S+D +D+FIAHIGGMD LA GL+ AAK+IE   L + V KR
Sbjct  327  KAGGFTSGGFNFDTKLRRQSSDPQDMFIAHIGGMDHLAMGLKKAAKMIESDFLGQAVSKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++ +LG  I+GG    E L K  ++   +PK  S +QEL E  + + L
Sbjct  387  YAGWNGDLGKGIQGGDFTLESLSKLCIDKNLQPKHVSGQQELLENKVNNVL  437



>ref|WP_006990989.1| MULTISPECIES: xylose isomerase [Alteromonadales]
 dbj|GAC22838.1| xylose isomerase [Glaciecola mesophila KMM 241]
Length=439

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 160/231 (69%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM   V +K KIGFKG L IEPKPQEPTKHQYD+D AT   FL++ GL +EFK+N
Sbjct  207  EQLGRFMNMVVEHKHKIGFKGLLLIEPKPQEPTKHQYDYDTATVYGFLKQYGLENEFKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GHS  HEV TA   GL G+IDAN GDPQ GWDTDQFP  V E +LV+  ++
Sbjct  267  IEANHATLAGHSFQHEVATAISLGLFGSIDANRGDPQLGWDTDQFPNSVEELSLVIYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GGFNFD KLRR+S+D +D+FIAHIGGMD LA GL+ AA +IE+  L + V KR
Sbjct  327  KAGGFTSGGFNFDTKLRRQSSDPQDMFIAHIGGMDHLAMGLKKAALMIENDFLGQAVSKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++ ELG  I+GG  + E L    ++   +PK  S +QEL E  + + L
Sbjct  387  YAGWNGELGKGIQGGDFNLESLANLCVDKNLQPKHVSGQQELLENKVNNVL  437



>ref|WP_023563217.1| xylose isomerase, partial [Escherichia coli]
 gb|EST88966.1| xylose isomerase, partial [Escherichia coli ECA-0157]
Length=246

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 154/231 (67%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+DAAT   FL++ GL  E KLN
Sbjct  13   EQLGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTKHQYDYDAATVYGFLKQFGLEKEIKLN  72

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GHS HHE+ TA   GL G++DAN GD Q GWDTDQFP  V E  LVM  ++
Sbjct  73   IEANHATLAGHSFHHEIATAIALGLFGSVDANRGDAQLGWDTDQFPNSVEENALVMYEIL  132

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F  HIG MDT+A  L+ AA++IEDG L + + +R
Sbjct  133  KAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKIAARMIEDGELDKRIAQR  192

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++SELG  I  G+     L K A E    P   S +QE  E ++   L
Sbjct  193  YSGWNSELGQQILKGQMSLADLAKYAQEHNLSPVHQSGRQEQLENLVNHYL  243



>ref|WP_032233807.1| xylose isomerase, partial [Escherichia coli]
Length=237

 Score =   253 bits (645),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 154/231 (67%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+DAAT   FL++ GL  E KLN
Sbjct  4    EQLGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTKHQYDYDAATVYGFLKQFGLEKEIKLN  63

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GHS HHE+ TA   GL G++DAN GD Q GWDTDQFP  V E  LVM  ++
Sbjct  64   IEANHATLAGHSFHHEIATAIALGLFGSVDANRGDAQLGWDTDQFPNSVEENALVMYEIL  123

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F  HIG MDT+A  L+ AA++IEDG L + + +R
Sbjct  124  KAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKIAARMIEDGELDKRIAQR  183

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++SELG  I  G+     L K A E    P   S +QE  E ++   L
Sbjct  184  YSGWNSELGQQILKGQMSLADLAKYAQEHNLSPVHQSGRQEQLENLVNHYL  234



>ref|WP_007414259.1| xylose isomerase [Pedosphaera parvula]
 gb|EEF61725.1| xylose isomerase [bacterium Ellin514]
Length=437

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 161/226 (71%), Gaps = 3/226 (1%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A+F+  AV YKKKIGFKG  +IEPKP+EPTKHQYD DAA   NFLR+  L D  KLN+E
Sbjct  209  LAQFLHMAVEYKKKIGFKGQFYIEPKPKEPTKHQYDSDAAACLNFLREYELTDHLKLNLE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+E A   G LG+IDAN+GDP  GWDTDQFP D+   +  ML+++K 
Sbjct  269  TNHATLAGHTMQHEMEVAAAAGALGSIDANTGDPMLGWDTDQFPTDIYLTSQCMLTIMKM  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGL  GG NFDAK+RRES +  D+F AHIGGMD  ARGL+ AA + +DG L E V++RY 
Sbjct  329  GGLTTGGVNFDAKVRRESFEPIDLFHAHIGGMDAFARGLKIAAAIRKDGRLAEFVQQRYS  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGE--PKVPSAKQELAEMIL  192
            S+DS +GA IE GK DF+ LE   L+ GE  P   S +QE+ E ++
Sbjct  389  SYDSGIGAKIEKGKTDFKELEAYILKKGEAAPNT-SGRQEMLENLI  433



>emb|CBK25455.2| unnamed protein product [Blastocystis hominis]
Length=435

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 158/223 (71%), Gaps = 0/223 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
             +FM  AV YKKKIG    L IEPKP+EPTKHQYD+DA T   FLRK GL  +FKLNIE 
Sbjct  209  GQFMRMAVEYKKKIGATFQLLIEPKPREPTKHQYDYDAQTVIGFLRKYGLEKDFKLNIEP  268

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GH   H++  A   G+LG++DAN+GD   GWDTDQFPMDV +A +VM  +I+ G
Sbjct  269  NHTTLAGHDYEHDIVFACNEGMLGSVDANTGDTLLGWDTDQFPMDVKKAVIVMYHIIRAG  328

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GL  GG NFDA +RRESTD+ED FIAHIG MDT AR L    K++ D   +E+V KRY+S
Sbjct  329  GLHSGGLNFDAHVRRESTDMEDRFIAHIGAMDTFARALLIVEKIMNDKIYQEMVDKRYES  388

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  192
            + + +GA IE G+A FE  EK  LE G+P+  SAKQE  EM+L
Sbjct  389  YTTGIGARIENGEATFEECEKYILENGKPEPQSAKQEKFEMLL  431



>ref|WP_021376347.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQE83572.1| xylose isomerase [Peptoclostridium difficile CD69]
 gb|KJF63558.1| xylose isomerase [Peptoclostridium difficile]
Length=445

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 159/228 (70%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF++ AV Y K+IGF G   IEPKP+EPTKHQYD+D AT   FLRK  L   FK+NIE
Sbjct  209  FARFLQMAVDYAKEIGFTGQFLIEPKPKEPTKHQYDFDTATVLGFLRKYNLDKYFKVNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V+K 
Sbjct  269  ANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEVLKQ  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +  +++RY 
Sbjct  329  GGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFIKERYA  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  389  SFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>ref|WP_038172460.1| xylose isomerase [Verrucomicrobium sp. BvORR106]
Length=436

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 158/225 (70%), Gaps = 0/225 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
              RF+  AV YK KIGF G  +IEPKP+EP+ HQYD D+A   NFLR+ GL++ FKLNIE
Sbjct  209  LGRFLHMAVDYKNKIGFTGPFYIEPKPREPSTHQYDSDSAACLNFLREYGLLEHFKLNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+E A   G LG+IDAN+GD   GWDTDQFP D+   T +ML ++K 
Sbjct  269  TNHATLAGHTMRHELEVALAAGALGSIDANTGDELIGWDTDQFPTDIYLTTEIMLVLLKM  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG   GG NFDAK+RRES +  D+F AHIGGMD  ARGL+ AA +IEDG L   V++RY 
Sbjct  329  GGFTSGGLNFDAKVRRESFEPVDLFHAHIGGMDAFARGLKIAAAIIEDGRLDAFVKQRYS  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQ  189
            +FD+ +GA IE G+  FE LE   L+ GEP + S +QE+ E ++ 
Sbjct  389  TFDNGIGAQIERGEVGFEELEAYTLKNGEPPIGSGRQEMLENLVN  433



>gb|ABI24864.1| D-xylose isomerase [Haemophilus somnus 129PT]
Length=441

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 158/231 (68%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL +E K+N
Sbjct  209  EQIGRFMQLVVEHKYKIGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLENEIKVN  268

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GH+  HE+ TA   G+ G+IDAN GDPQ GWDTDQFP  V E TL M  ++
Sbjct  269  IEANHATLAGHTFQHEIATATSLGIFGSIDANRGDPQLGWDTDQFPNSVEENTLAMYEIL  328

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GGFNFDAK+RR+STD  D+F AHIG MD LA  L+ AAK+IED +L+++V  R
Sbjct  329  KAGGFTTGGFNFDAKIRRQSTDPYDLFHAHIGAMDVLALSLKRAAKMIEDQTLQKVVDNR  388

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  +D ELG  I  GKA  E L K     G  PK  S +QE  E ++ S L
Sbjct  389  YAGWDQELGQKILNGKASLEDLAKIVETQGLAPKPVSGQQEYLENLVNSYL  439



>gb|ETP51333.1| xylose isomerase [Phytophthora parasitica P10297]
Length=452

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 157/223 (70%), Gaps = 0/223 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F +  VAYKK++G      +EPKP+EP KHQYD+DAAT   FL   GL ++FKLNIE 
Sbjct  225  AAFFKLVVAYKKELGATFQFLVEPKPREPMKHQYDYDAATVMAFLHTYGLQNDFKLNIEP  284

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +I+ G
Sbjct  285  NHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKIIEIG  344

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++RY S
Sbjct  345  GLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQRYAS  404

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  192
            + S LG  IE GKA  E +   A E GEP   S KQELAE++L
Sbjct  405  WKSALGERIEQGKATLEEVAAYAKESGEPDHVSGKQELAELML  447



>ref|WP_044704476.1| xylose isomerase, partial [Escherichia coli]
Length=240

 Score =   252 bits (644),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 154/231 (67%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+DAAT   FL++ GL  E KLN
Sbjct  7    EQLGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTKHQYDYDAATVYGFLKQFGLEKEIKLN  66

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GHS HHE+ TA   GL G++DAN GD Q GWDTDQFP  V E  LVM  ++
Sbjct  67   IEANHATLAGHSFHHEIATAIALGLFGSVDANRGDAQLGWDTDQFPNSVEENALVMYEIL  126

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F  HIG MDT+A  L+ AA++IEDG L + + +R
Sbjct  127  KAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKIAARMIEDGELDKRIAQR  186

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++SELG  I  G+     L K A E    P   S +QE  E ++   L
Sbjct  187  YSGWNSELGQQILKGQMSLADLAKYAQEHHLSPVHQSGRQEQLENLVNHYL  237



>ref|WP_011576446.1| xylose isomerase [Pseudoalteromonas atlantica]
 sp|Q15PG0.1|XYLA_PSEA6 RecName: Full=Xylose isomerase [Pseudoalteromonas atlantica T6c]
 gb|ABG42228.1| D-xylose isomerase [Pseudoalteromonas atlantica T6c]
Length=439

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 160/231 (69%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM   V +K KIGFKG L IEPKPQEPTKHQYD+D AT   FL++ GL +EFK+N
Sbjct  207  EQLGRFMNMVVEHKHKIGFKGLLLIEPKPQEPTKHQYDYDTATVYGFLKQYGLENEFKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GHS  HEV TA   GL G+IDAN GDPQ GWDTDQFP  V E +LV+  ++
Sbjct  267  IEANHATLAGHSFQHEVATAISLGLFGSIDANRGDPQLGWDTDQFPNSVEELSLVIYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GGFNFD KLRR+S+D +D+FIAHIGGMD LA GL+ AA +IE+  L + V KR
Sbjct  327  KAGGFTSGGFNFDTKLRRQSSDPQDMFIAHIGGMDHLAIGLKKAALMIENDFLGQAVSKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++ ELG  I+GG  + E L    ++   +PK  S +QEL E  + + L
Sbjct  387  YAGWNGELGKGIQGGDFNLESLANLCVDKNLQPKHVSGQQELLENKVNNVL  437



>ref|WP_041604097.1| xylose isomerase [Histophilus somni]
Length=439

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 158/231 (68%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL +E K+N
Sbjct  207  EQIGRFMQLVVEHKYKIGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLENEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GH+  HE+ TA   G+ G+IDAN GDPQ GWDTDQFP  V E TL M  ++
Sbjct  267  IEANHATLAGHTFQHEIATATSLGIFGSIDANRGDPQLGWDTDQFPNSVEENTLAMYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GGFNFDAK+RR+STD  D+F AHIG MD LA  L+ AAK+IED +L+++V  R
Sbjct  327  KAGGFTTGGFNFDAKIRRQSTDPYDLFHAHIGAMDVLALSLKRAAKMIEDQTLQKVVDNR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  +D ELG  I  GKA  E L K     G  PK  S +QE  E ++ S L
Sbjct  387  YAGWDQELGQKILNGKASLEDLAKIVETQGLAPKPVSGQQEYLENLVNSYL  437



>gb|KHI92157.1| xylose isomerase, partial [Escherichia coli]
Length=257

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 154/231 (67%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+DAAT   FL++ GL  E KLN
Sbjct  24   EQLGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTKHQYDYDAATVYGFLKQFGLEKEIKLN  83

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GHS HHE+ TA   GL G++DAN GD Q GWDTDQFP  V E  LVM  ++
Sbjct  84   IEANHATLAGHSFHHEIATAIALGLFGSVDANRGDAQLGWDTDQFPNSVEENALVMYEIL  143

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F  HIG MDT+A  L+ AA++IEDG L + + +R
Sbjct  144  KAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKIAARMIEDGELDKRIAQR  203

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++SELG  I  G+     L K A E    P   S +QE  E ++   L
Sbjct  204  YSGWNSELGQQILKGQMSLADLAKYAQEHNLSPVHQSGRQEQLENLVNHYL  254



>gb|ETO82214.1| xylose isomerase [Phytophthora parasitica P1976]
Length=452

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 157/223 (70%), Gaps = 0/223 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F +  VAYKK++G      +EPKP+EP KHQYD+DAAT   FL   GL ++FKLNIE 
Sbjct  225  AAFFKLVVAYKKELGATFQFLVEPKPREPMKHQYDYDAATVMAFLHTYGLQNDFKLNIEP  284

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +I+ G
Sbjct  285  NHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKIIEIG  344

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++RY S
Sbjct  345  GLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQRYAS  404

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  192
            + S LG  IE GKA  E +   A E GEP   S KQELAE++L
Sbjct  405  WKSALGERIEQGKATLEEVAAYAKESGEPDHVSGKQELAELML  447



>ref|WP_021369126.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQE42109.1| xylose isomerase [Peptoclostridium difficile CD41]
 gb|EQF66993.1| xylose isomerase [Peptoclostridium difficile CD201]
Length=445

 Score =   258 bits (660),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 158/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF++ AV Y K+IGF G   IEPKP+EPTKHQYD+D AT   FLRK  L   FK+NIE
Sbjct  209  FARFLQMAVDYAKEIGFSGQFLIEPKPKEPTKHQYDFDTATVLGFLRKYNLDKYFKMNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V+K 
Sbjct  269  ANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEVLKQ  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++RY 
Sbjct  329  GGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKERYA  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  389  SFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>ref|WP_014625278.1| xylose isomerase [Spirochaeta thermophila]
 gb|AEJ61949.1| Xylose isomerase [Spirochaeta thermophila DSM 6578]
Length=440

 Score =   258 bits (660),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/228 (56%), Positives = 156/228 (68%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF+  AV Y KKIGFKG   IEPKP+EPTKHQYD+D A    FLRK  L+  FK+NIE
Sbjct  210  LARFLHMAVDYAKKIGFKGQFLIEPKPKEPTKHQYDFDVAAVYGFLRKYDLLPYFKVNIE  269

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+ H+  HE+  ARING+LG++D N GD   GWDTDQFP ++ E TL M  VIKN
Sbjct  270  MNHATLAYHTFQHELHFARINGILGSMDVNQGDYLLGWDTDQFPTNIYETTLAMYEVIKN  329

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGG NFDAK+RR S + EDIFIAHI GMD  ARG + A KL+ED ++++ V +RY 
Sbjct  330  GGIAPGGLNFDAKVRRGSFEPEDIFIAHIAGMDAFARGFKVAWKLLEDKAIEKHVEERYA  389

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            S+   +G  I  GK  FE LE   ++  E K  S +QEL E +L   L
Sbjct  390  SYREGIGKKIVEGKVGFEDLEAYIIDKAEIKNASGRQELLEAVLNRYL  437



>ref|WP_036097976.1| xylose isomerase [Listeria floridensis]
 gb|EUJ28504.1| xylose isomerase [Listeria floridensis FSL S10-1187]
Length=435

 Score =   258 bits (660),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 164/227 (72%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            AR  + AV Y +KIG K    IEPKP EP+KHQYD+DAATT  F++K GL ++FKLN+E 
Sbjct  208  ARLFKMAVNYSEKIGHKPQFLIEPKPMEPSKHQYDFDAATTLQFIQKYGLENDFKLNLEA  267

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATL+GH+  HE+  ARING LG+IDAN GD   GWDTD+FP ++ + TL M  +++NG
Sbjct  268  NHATLAGHTFEHELTVARINGALGSIDANQGDVLLGWDTDEFPTNIYDVTLTMREILENG  327

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            G+APGG NFDAK+RR + DVED+F+AHI GMDT ARGL++AAKL +DG L+EL+ +RY S
Sbjct  328  GIAPGGINFDAKVRRSAFDVEDLFLAHIAGMDTFARGLKNAAKLKQDGFLEELIAERYAS  387

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            F + +GA+I   + D E L   ALE  + +V S+  E  + +L   +
Sbjct  388  FQTGIGASILADQEDLESLSTFALEHEDAEVKSSHIEYVKNVLNDYM  434



>ref|WP_009898127.1| xylose isomerase [Peptoclostridium difficile]
 ref|YP_001089578.1| xylose isomerase [Peptoclostridium difficile 630]
 emb|CAJ69956.1| Xylose isomerase [Peptoclostridium difficile 630]
 gb|EQE01648.1| xylose isomerase [Peptoclostridium difficile CD3]
 gb|EQE08496.1| xylose isomerase [Peptoclostridium difficile CD13]
 gb|EQE15056.1| xylose isomerase [Peptoclostridium difficile CD17]
 gb|EQE18626.1| xylose isomerase [Peptoclostridium difficile CD18]
 gb|EQE20922.1| xylose isomerase [Peptoclostridium difficile CD21]
 gb|EQE25993.1| xylose isomerase [Peptoclostridium difficile CD22]
 gb|EQE29593.1| xylose isomerase [Peptoclostridium difficile CD34]
 gb|EQE32510.1| xylose isomerase [Peptoclostridium difficile CD38]
 gb|EQE40998.1| xylose isomerase [Peptoclostridium difficile CD39]
 gb|EQE47185.1| xylose isomerase [Peptoclostridium difficile CD42]
 gb|EQE52245.1| xylose isomerase [Peptoclostridium difficile CD43]
 gb|EQE56340.1| xylose isomerase [Peptoclostridium difficile CD44]
 gb|EQE59925.1| xylose isomerase [Peptoclostridium difficile CD45]
 gb|EQE61807.1| xylose isomerase [Peptoclostridium difficile CD46]
 gb|EQE67835.1| xylose isomerase [Peptoclostridium difficile CD47]
 gb|EQE73383.1| xylose isomerase [Peptoclostridium difficile CD49]
 gb|EQE76032.1| xylose isomerase [Peptoclostridium difficile CD51]
 gb|EQE78106.1| xylose isomerase [Peptoclostridium difficile CD68]
 gb|EQE89803.1| xylose isomerase [Peptoclostridium difficile CD70]
 gb|EQE90036.1| xylose isomerase [Peptoclostridium difficile CD104]
 gb|EQE95031.1| xylose isomerase [Peptoclostridium difficile CD109]
 gb|EQF01536.1| xylose isomerase [Peptoclostridium difficile CD129]
 gb|EQF01725.1| xylose isomerase [Peptoclostridium difficile CD131]
 gb|EQF04489.1| xylose isomerase [Peptoclostridium difficile CD132]
 gb|EQF08956.1| xylose isomerase [Peptoclostridium difficile CD133]
 gb|EQF13448.1| xylose isomerase [Peptoclostridium difficile CD144]
 gb|EQF17676.1| xylose isomerase [Peptoclostridium difficile CD149]
 gb|EQF25157.1| xylose isomerase [Peptoclostridium difficile CD159]
 gb|EQF30719.1| xylose isomerase [Peptoclostridium difficile CD165]
 gb|EQF35439.1| xylose isomerase [Peptoclostridium difficile CD166]
 gb|EQF38595.1| xylose isomerase [Peptoclostridium difficile CD169]
 gb|EQF43727.1| xylose isomerase [Peptoclostridium difficile CD170]
 gb|EQF49602.1| xylose isomerase [Peptoclostridium difficile CD178]
 gb|EQF51757.1| xylose isomerase [Peptoclostridium difficile CD181]
 gb|EQF59063.1| xylose isomerase [Peptoclostridium difficile CD200]
 gb|EQF60209.1| xylose isomerase [Peptoclostridium difficile CD196]
 gb|EQF74925.1| xylose isomerase [Peptoclostridium difficile CD211]
 gb|EQF79514.1| xylose isomerase [Peptoclostridium difficile 342]
 gb|EQF85662.1| xylose isomerase [Peptoclostridium difficile 655]
 gb|EQF87405.1| xylose isomerase [Peptoclostridium difficile 824]
 gb|EQF93982.1| xylose isomerase [Peptoclostridium difficile 840]
 gb|EQF94288.1| xylose isomerase [Peptoclostridium difficile 842]
 gb|EQG00794.1| xylose isomerase [Peptoclostridium difficile 6041]
 gb|EQG04453.1| xylose isomerase [Peptoclostridium difficile 6042]
 gb|EQG07308.1| xylose isomerase [Peptoclostridium difficile 6057]
 gb|EQG08669.1| xylose isomerase [Peptoclostridium difficile DA00044]
 gb|EQG17277.1| xylose isomerase [Peptoclostridium difficile DA00062]
 gb|EQG21796.1| xylose isomerase [Peptoclostridium difficile DA00114]
 gb|EQG27364.1| xylose isomerase [Peptoclostridium difficile DA00126]
 gb|EQG31616.1| xylose isomerase [Peptoclostridium difficile DA00129]
 gb|EQG32925.1| xylose isomerase [Peptoclostridium difficile DA00128]
 gb|EQG39021.1| xylose isomerase [Clostridium difficile DA00131]
 gb|EQG41765.1| xylose isomerase [Clostridium difficile DA00132]
 gb|EQG44081.1| xylose isomerase [Clostridium difficile DA00134]
 gb|EQG50860.1| xylose isomerase [Clostridium difficile DA00141]
 gb|EQG55523.1| xylose isomerase [Clostridium difficile DA00142]
 gb|EQG55697.1| xylose isomerase [Clostridium difficile DA00145]
 gb|EQG58956.1| xylose isomerase [Clostridium difficile DA00149]
 gb|EQG64463.1| xylose isomerase [Clostridium difficile DA00154]
 gb|EQG67823.1| xylose isomerase [Clostridium difficile DA00160]
 gb|EQG74313.1| xylose isomerase [Clostridium difficile DA00165]
 gb|EQG74989.1| xylose isomerase [Clostridium difficile DA00167]
 gb|EQG80554.1| xylose isomerase [Clostridium difficile DA00183]
 gb|EQG82128.1| xylose isomerase [Clostridium difficile DA00174]
 gb|EQG90093.1| xylose isomerase [Clostridium difficile DA00191]
 gb|EQG91727.1| xylose isomerase [Clostridium difficile DA00189]
 gb|EQG93286.1| xylose isomerase [Clostridium difficile DA00193]
 gb|EQH01415.1| xylose isomerase [Clostridium difficile DA00196]
 gb|EQH02374.1| xylose isomerase [Clostridium difficile DA00195]
 gb|EQH07253.1| xylose isomerase [Clostridium difficile DA00197]
 gb|EQH11286.1| xylose isomerase [Clostridium difficile DA00203]
 gb|EQH16986.1| xylose isomerase [Clostridium difficile DA00210]
 gb|EQH19049.1| xylose isomerase [Clostridium difficile DA00212]
 gb|EQH21244.1| xylose isomerase [Clostridium difficile DA00211]
 gb|EQH27947.1| xylose isomerase [Clostridium difficile DA00215]
 gb|EQH33652.1| xylose isomerase [Clostridium difficile DA00238]
 gb|EQH33729.1| xylose isomerase [Clostridium difficile DA00232]
 gb|EQH35646.1| xylose isomerase [Clostridium difficile DA00216]
 gb|EQH40082.1| xylose isomerase [Clostridium difficile DA00244]
 gb|EQH46390.1| xylose isomerase [Clostridium difficile DA00246]
 gb|EQH48431.1| xylose isomerase [Clostridium difficile DA00245]
 gb|EQH54096.1| xylose isomerase [Clostridium difficile DA00261]
 gb|EQH59051.1| xylose isomerase [Clostridium difficile DA00273]
 gb|EQH60142.1| xylose isomerase [Clostridium difficile DA00275]
 gb|EQH63488.1| xylose isomerase [Clostridium difficile DA00256]
 gb|EQH67395.1| xylose isomerase [Clostridium difficile DA00305]
 gb|EQH69872.1| xylose isomerase [Clostridium difficile DA00306]
 gb|EQH74613.1| xylose isomerase [Clostridium difficile DA00307]
 gb|EQH79245.1| xylose isomerase [Clostridium difficile DA00310]
 gb|EQH81328.1| xylose isomerase [Clostridium difficile DA00313]
 gb|EQH86870.1| xylose isomerase [Clostridium difficile F152]
 gb|EQH92463.1| xylose isomerase [Clostridium difficile F249]
 gb|EQH98070.1| xylose isomerase [Clostridium difficile F314]
 gb|EQI04458.1| xylose isomerase [Clostridium difficile Y10]
 gb|EQI09688.1| xylose isomerase [Clostridium difficile Y21]
 gb|EQI16335.1| xylose isomerase [Clostridium difficile Y41]
 gb|EQI20016.1| xylose isomerase [Clostridium difficile Y155]
 gb|EQI24220.1| xylose isomerase [Clostridium difficile Y171]
 gb|EQI28648.1| xylose isomerase [Clostridium difficile Y184]
 gb|EQI33282.1| xylose isomerase [Clostridium difficile Y215]
 gb|EQI37326.1| xylose isomerase [Clostridium difficile Y202]
 gb|EQI40230.1| xylose isomerase [Clostridium difficile Y231]
 gb|EQI45261.1| xylose isomerase [Clostridium difficile Y247]
 gb|EQI50233.1| xylose isomerase [Clostridium difficile Y270]
 gb|EQI54457.1| xylose isomerase [Clostridium difficile Y266]
 gb|EQI55619.1| xylose isomerase [Clostridium difficile Y307]
 gb|EQI56034.1| xylose isomerase [Clostridium difficile Y312]
 gb|EQI64060.1| xylose isomerase [Clostridium difficile Y343]
 gb|EQI65175.1| xylose isomerase [Clostridium difficile Y358]
 gb|EQI71845.1| xylose isomerase [Clostridium difficile Y381]
 gb|EQI77153.1| xylose isomerase [Clostridium difficile Y384]
 gb|EQI78026.1| xylose isomerase [Clostridium difficile Y401]
 gb|EQI78173.1| xylose isomerase [Clostridium difficile P1]
 gb|EQI84893.1| xylose isomerase [Clostridium difficile P2]
 gb|EQI90063.1| xylose isomerase [Clostridium difficile P3]
 gb|EQI98886.1| xylose isomerase [Clostridium difficile P6]
 gb|EQJ08241.1| xylose isomerase [Clostridium difficile P8]
 gb|EQJ14493.1| xylose isomerase [Clostridium difficile P9]
 gb|EQJ15166.1| xylose isomerase [Clostridium difficile P11]
 gb|EQJ22276.1| xylose isomerase [Clostridium difficile P15]
 gb|EQJ29066.1| xylose isomerase [Clostridium difficile P19]
 gb|EQJ33738.1| xylose isomerase [Clostridium difficile P21]
 gb|EQJ34478.1| xylose isomerase [Clostridium difficile P20]
 gb|EQJ44681.1| xylose isomerase [Clostridium difficile P25]
 gb|EQJ45644.1| xylose isomerase [Clostridium difficile P24]
 gb|EQJ57731.1| xylose isomerase [Clostridium difficile P32]
 gb|EQJ67025.1| xylose isomerase [Clostridium difficile P42]
 gb|EQJ70774.1| xylose isomerase [Clostridium difficile P36]
 gb|EQJ87881.1| xylose isomerase [Clostridium difficile P50]
 gb|EQJ89221.1| xylose isomerase [Clostridium difficile P49]
 gb|EQJ94626.1| xylose isomerase [Clostridium difficile P51]
 gb|EQJ99998.1| xylose isomerase [Clostridium difficile P61]
 gb|EQK02305.1| xylose isomerase [Clostridium difficile P59]
 gb|EQK04229.1| xylose isomerase [Clostridium difficile P78]
 gb|EQK10687.1| xylose isomerase [Clostridium difficile P69]
 gb|EQK16957.1| xylose isomerase [Clostridium difficile P72]
 gb|EQK37729.1| xylose isomerase [Clostridium difficile P77]
 gb|EQK49092.1| xylose isomerase [Clostridium difficile F480]
 gb|EQK51346.1| xylose isomerase [Clostridium difficile F525]
 gb|EQK54747.1| xylose isomerase [Clostridium difficile F200]
 gb|EQK58237.1| xylose isomerase [Clostridium difficile F548]
 gb|EQK64361.1| xylose isomerase [Clostridium difficile F601]
 gb|EQK68079.1| xylose isomerase [Clostridium difficile CD90]
 gb|EQK69966.1| xylose isomerase [Clostridium difficile CD92]
 gb|EQK72693.1| xylose isomerase [Clostridium difficile CD111]
 gb|EQK74047.1| xylose isomerase [Clostridium difficile CD113]
 gb|EQK80012.1| xylose isomerase [Clostridium difficile CD127]
 gb|EQK85900.1| xylose isomerase [Clostridium difficile P30]
 gb|EQL05253.1| xylose isomerase [Clostridium difficile CD88]
 gb|EQL06681.1| xylose isomerase [Clostridium difficile CD86]
 gb|ERM23750.1| xylose isomerase [Clostridium difficile P41]
 gb|ERM24697.1| xylose isomerase [Clostridium difficile P33]
 gb|ERM26495.1| xylose isomerase [Clostridium difficile DA00130]
 gb|ERM34891.1| xylose isomerase [Clostridium difficile P64]
 gb|ERM45012.1| xylose isomerase [Clostridium difficile F665]
 gb|ERM46949.1| xylose isomerase [Clostridium difficile P53]
 emb|CCL09474.1| Xylose isomerase [Peptoclostridium difficile E16]
 emb|CCL27325.1| Xylose isomerase [Clostridium difficile T11]
 emb|CCL31303.1| Xylose isomerase [Clostridium difficile E15]
 emb|CCL35322.1| Xylose isomerase [Peptoclostridium difficile T23]
 emb|CCL39146.1| Xylose isomerase [Clostridium difficile E19]
 emb|CCL43343.1| Xylose isomerase [Clostridium difficile E24]
 emb|CCL47357.1| Xylose isomerase [Clostridium difficile T42]
 emb|CCL54438.1| Xylose isomerase [Clostridium difficile E14]
 emb|CCL58589.1| Xylose isomerase [Peptoclostridium difficile T17]
 emb|CCL62121.1| Xylose isomerase [Clostridium difficile E9]
 emb|CCL66125.1| Xylose isomerase [Clostridium difficile E7]
 emb|CCL70060.1| Xylose isomerase [Clostridium difficile T3]
 emb|CCL73732.1| Xylose isomerase [Clostridium difficile E28]
 emb|CCL77430.1| Xylose isomerase [Clostridium difficile E23]
 emb|CCL81265.1| Xylose isomerase [Clostridium difficile E12]
 emb|CCL84764.1| Xylose isomerase [Clostridium difficile T19]
 emb|CCL88962.1| Xylose isomerase [Clostridium difficile T10]
 emb|CCL92635.1| Xylose isomerase [Clostridium difficile T14]
 emb|CCL96886.1| Xylose isomerase [Peptoclostridium difficile T61]
 gb|EZR29626.1| xylose isomerase [Peptoclostridium difficile]
 emb|CDS88891.1| Xylose isomerase [Peptoclostridium difficile]
 emb|CDS89521.1| xylose isomerase [Peptoclostridium difficile]
 emb|CDT71017.1| Xylose isomerase [Peptoclostridium difficile]
 emb|CEJ99702.1| Xylose isomerase [Peptoclostridium difficile]
 gb|AJP12826.1| xylose isomerase [Peptoclostridium difficile 630]
Length=445

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 158/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF++ AV Y K+IGF G   IEPKP+EPTKHQYD+D AT   FLRK  L   FK+NIE
Sbjct  209  FARFLQMAVDYAKEIGFTGQFLIEPKPKEPTKHQYDFDTATVLGFLRKYNLDKYFKMNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V+K 
Sbjct  269  ANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEVLKQ  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++RY 
Sbjct  329  GGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKERYA  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  389  SFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>ref|WP_039463449.1| xylose isomerase [Pectobacterium carotovorum]
 gb|KFF70124.1| xylose isomerase [Pectobacterium carotovorum subsp. brasiliense]
Length=439

 Score =   258 bits (659),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/231 (55%), Positives = 159/231 (69%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +E NHATL+GHS HHE+ TA   G+ G++DAN GDPQ GWDTDQFP  V E TL+M  ++
Sbjct  267  VEANHATLAGHSFHHEIATAVALGIFGSVDANRGDPQLGWDTDQFPNSVEENTLIMYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F AHIG MDT+A  L++AA++IED  L +LV KR
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDRYDLFHAHIGAMDTMALALKAAARMIEDDKLNQLVAKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++ ELG  I  GKA  E L + A      P+  S +QEL E ++   L
Sbjct  387  YAGWNGELGQQILQGKASLESLARYAESHQLAPQHQSGQQELLENLVNRHL  437



>ref|WP_039279877.1| xylose isomerase [Pectobacterium carotovorum]
 gb|KFF64105.1| xylose isomerase [Pectobacterium carotovorum subsp. brasiliense]
Length=439

 Score =   258 bits (659),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/231 (55%), Positives = 159/231 (69%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +E NHATL+GHS HHE+ TA   G+ G++DAN GDPQ GWDTDQFP  V E TL+M  ++
Sbjct  267  VEANHATLAGHSFHHEIATAVALGIFGSVDANRGDPQLGWDTDQFPNSVEENTLIMYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F AHIG MDT+A  L++AA++IED  L +LV KR
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDRYDLFHAHIGAMDTMALALKAAARMIEDDKLNQLVAKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++ ELG  I  GKA  E L + A      P+  S +QEL E ++   L
Sbjct  387  YAGWNGELGQQILQGKASLESLARYAESHQLAPQHQSGQQELLENLVNRHL  437



>ref|WP_009891378.1| xylose isomerase [Peptoclostridium difficile]
 ref|YP_006200085.1| xylose isomerase [Peptoclostridium difficile BI1]
 gb|EQH96874.1| xylose isomerase [Clostridium difficile F253]
 gb|EQJ38592.1| xylose isomerase [Clostridium difficile P23]
 gb|EQJ77358.1| xylose isomerase [Clostridium difficile P45]
 gb|EQK85731.1| xylose isomerase [Clostridium difficile P31]
Length=445

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 158/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF++ AV Y K+IGF G   IEPKP+EPTKHQYD+D AT   FLRK  L   FK+NIE
Sbjct  209  FARFLQMAVDYAKEIGFTGQFLIEPKPKEPTKHQYDFDTATVLGFLRKYNLDKYFKMNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V+K 
Sbjct  269  ANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEVLKQ  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++RY 
Sbjct  329  GGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKERYA  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  389  SFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>gb|EFP62823.1| putative xylose isomerase [Erysipelotrichaceae bacterium 3_1_53]
Length=300

 Score =   254 bits (648),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/230 (54%), Positives = 156/230 (68%), Gaps = 0/230 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A F + AV Y  +IGFKG  +IEPKP+EPTKHQYD+D  T   FL+  GL D F+LNIE
Sbjct  71   LASFFKMAVKYADEIGFKGQFYIEPKPKEPTKHQYDFDVQTVIGFLKTYGLDDRFQLNIE  130

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+ H+  HE+  ARING+LG++DAN GD   GWDTDQFP ++ +ATL M  +++ 
Sbjct  131  ANHATLASHTFQHELNMARINGMLGSVDANQGDMLLGWDTDQFPTNLYDATLAMYEILQT  190

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGL  GG NFDAK+RRES  +EDI  A+I GMDT A+GLR+AA L+EDG LK+ V++RY+
Sbjct  191  GGLKSGGLNFDAKVRRESFTMEDIAYAYIAGMDTYAKGLRTAALLLEDGILKQAVKERYE  250

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL*K  174
            S+   +G  I  GK DF  L   AL      + S KQE  E IL   L K
Sbjct  251  SYTYGIGKKISEGKTDFRELSAYALSLPTITIGSGKQERLERILSDYLVK  300



>gb|ADD61976.1| putative protein [uncultured organism]
Length=291

 Score =   253 bits (647),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 157/232 (68%), Gaps = 2/232 (1%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            +  AR M+  V Y +  G+ G  +IEPKP+EPTKHQYD+D AT   FLRK GL  +FK+N
Sbjct  57   DNMARLMKMTVDYARSKGYTGDFYIEPKPKEPTKHQYDFDTATVLGFLRKYGLDKDFKMN  116

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+ H+  HE+  AR NG+ G+IDAN GDP  GWDTDQFP +  +ATL M  V+
Sbjct  117  IEANHATLAQHTFQHELRVARDNGVFGSIDANQGDPLLGWDTDQFPTNAYDATLCMYEVL  176

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK RR S  +EDIF+++I GMDT A GL++AAK+IEDG L + V  R
Sbjct  177  KAGGFTNGGLNFDAKARRGSYTMEDIFLSYIAGMDTFALGLKAAAKIIEDGRLDKFVDDR  236

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWGE--PKVPSAKQELAEMILQSAL  180
            Y S+ + +GA I  GKAD E LEK A+E GE    + S +QE  E +L   +
Sbjct  237  YASWTTGIGADIIAGKADMESLEKYAVEKGEVTDSLSSGRQEYLESVLNQIM  288



>ref|WP_036626617.1| xylose isomerase [Paenibacillus macerans]
 gb|KFN11524.1| beta-xylosidase [Paenibacillus macerans]
Length=438

 Score =   258 bits (659),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 151/206 (73%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF   AV Y K+IGFKG   IEPKP+EPTKHQYD+DAATT  FL+K GL D FKLN+E
Sbjct  207  LARFFNMAVDYAKEIGFKGQFLIEPKPKEPTKHQYDFDAATTIAFLQKYGLQDHFKLNLE  266

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GDP  GWDTD+FP D+   TL M  +++N
Sbjct  267  ANHATLAGHTFEHELRVARINNMLGSIDANQGDPLLGWDTDEFPTDLYAVTLAMYEILQN  326

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGL  GG NFDAK+RR S + ED+F AHI GMD+ A+GL+ A KLIED    +L+ +RY 
Sbjct  327  GGLGSGGVNFDAKVRRGSFEPEDLFYAHIAGMDSFAKGLKVAGKLIEDKFFDKLIEERYA  386

Query  323  SFDSELGAAIEGGKADFELLEKKALE  246
            SF + +GA I  GKA+F+ LE  AL+
Sbjct  387  SFKTGIGADIVSGKANFKTLEAYALQ  412



>ref|WP_021421788.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQJ55091.1| xylose isomerase [Clostridium difficile P29]
Length=445

 Score =   258 bits (659),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 158/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF++ AV Y K+IGF G   IEPKP+EPTKHQYD+D AT   FLRK  L   FK+NIE
Sbjct  209  FARFLQMAVDYAKEIGFTGQFLIEPKPKEPTKHQYDFDTATVLGFLRKYNLDKYFKMNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V+K 
Sbjct  269  ANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEVLKQ  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++RY 
Sbjct  329  GGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKERYA  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  389  SFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLESILNRYI  436



>ref|WP_015923669.1| xylose isomerase [Halothermothrix orenii]
 gb|ACL70700.1| xylose isomerase [Halothermothrix orenii H 168]
Length=439

 Score =   258 bits (659),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 161/230 (70%), Gaps = 0/230 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E FARF+  AV Y ++IGF+G   IEPKP+EPTKHQYD+DAAT  +FL+K  L   FKLN
Sbjct  207  ENFARFLHMAVDYAREIGFEGQFLIEPKPKEPTKHQYDFDAATVISFLKKYDLDKHFKLN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GH+  HE+  +RING+LG++DAN GD   GWDTDQFP ++ E TL M  ++
Sbjct  267  IEANHATLAGHTFQHELHVSRINGMLGSVDANQGDLLLGWDTDQFPTNIYETTLAMYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            KNGGL PGG NFDAK+RR S +  D+F AHI GMD  ARGL+ A KL+E G L++ + +R
Sbjct  327  KNGGLEPGGLNFDAKVRRASFEPVDLFYAHIAGMDAFARGLKVAHKLLESGELEDFISER  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            Y+S+ + +G  I  G+  F+ LE  AL  G+    S +QEL E I+   +
Sbjct  387  YKSYRNGIGEKIVKGEVGFKELEDYALNNGKITNVSGRQELLESIVNKYI  436



>ref|WP_021423576.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQJ65588.1| xylose isomerase [Clostridium difficile P38]
Length=445

 Score =   258 bits (659),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 158/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF++ AV Y K+IGF G   IEPKP+EPTKHQYD+D AT   FLRK  L   FK+NIE
Sbjct  209  FARFLQMAVDYAKEIGFTGQFLIEPKPKEPTKHQYDFDTATVLGFLRKYNLGKYFKMNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V+K 
Sbjct  269  ANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEVLKQ  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++RY 
Sbjct  329  GGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKERYA  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  389  SFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>gb|EHJ36230.1| xylose isomerase [Peptoclostridium difficile 70-100-2010]
Length=454

 Score =   258 bits (660),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 158/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF++ AV Y K+IGF G   IEPKP+EPTKHQYD+D AT   FLRK  L   FK+NIE
Sbjct  218  FARFLQMAVDYAKEIGFSGQFLIEPKPKEPTKHQYDFDTATVLGFLRKYNLDKYFKMNIE  277

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V+K 
Sbjct  278  ANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEVLKQ  337

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++RY 
Sbjct  338  GGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKERYA  397

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  398  SFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  445



>ref|YP_003219374.1| xylose isomerase [Peptoclostridium difficile R20291]
 emb|CBA65635.1| xylose isomerase [Peptoclostridium difficile CD196]
 emb|CBE06558.1| xylose isomerase [Peptoclostridium difficile R20291]
Length=454

 Score =   258 bits (660),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 158/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF++ AV Y K+IGF G   IEPKP+EPTKHQYD+D AT   FLRK  L   FK+NIE
Sbjct  218  FARFLQMAVDYAKEIGFTGQFLIEPKPKEPTKHQYDFDTATVLGFLRKYNLDKYFKMNIE  277

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V+K 
Sbjct  278  ANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEVLKQ  337

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++RY 
Sbjct  338  GGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKERYA  397

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  398  SFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  445



>ref|WP_028514448.1| xylose isomerase [Ruminococcus flavefaciens]
Length=438

 Score =   258 bits (659),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 157/229 (69%), Gaps = 2/229 (1%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            AR M+ AV Y + IGFKG  +IEPKP+EPTKHQYD+D AT   FLRK GL  +FK+NIE 
Sbjct  207  ARLMKMAVEYARSIGFKGDFYIEPKPKEPTKHQYDFDTATVLGFLRKYGLDKDFKMNIEA  266

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATL+ H+  HE+  AR NG+ G+IDAN GDP  GWDTDQFP ++ + T+ M  VIK G
Sbjct  267  NHATLAQHTFQHELRVARDNGVFGSIDANQGDPLLGWDTDQFPTNIYDTTMCMYEVIKAG  326

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            G   GG NFDAK RR S   EDIF+++I GMD  A G R+A KLIEDG + + V  RY S
Sbjct  327  GFTNGGLNFDAKARRGSFTPEDIFLSYIAGMDAFALGFRAALKLIEDGRIDKFVEDRYAS  386

Query  320  FDSELGAAIEGGKADFELLEKKALEWGE--PKVPSAKQELAEMILQSAL  180
            + + +GA I  GKADF  LEK ALE GE    + S +QE+ E I+ + L
Sbjct  387  WKTGIGADIIAGKADFASLEKYALEKGEVTASLTSGRQEMLESIVNNVL  435



>ref|WP_009906213.1| xylose isomerase [Peptoclostridium difficile]
 emb|CCK88406.1| Xylose isomerase [Peptoclostridium difficile T5]
 emb|CCK91841.1| Xylose isomerase [Peptoclostridium difficile T20]
 emb|CCK95551.1| Xylose isomerase [Peptoclostridium difficile E1]
 emb|CCK99539.1| Xylose isomerase [Peptoclostridium difficile E10]
Length=445

 Score =   258 bits (659),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 158/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF++ AV Y K+IGF G   IEPKP+EPTKHQYD+D AT   FLRK  L   FK+NIE
Sbjct  209  FARFLQMAVDYAKEIGFTGQFLIEPKPKEPTKHQYDFDTATVLGFLRKYNLDKYFKVNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V+K 
Sbjct  269  ANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEVLKQ  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++RY 
Sbjct  329  GGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKERYA  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  389  SFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>ref|WP_016679053.1| xylose isomerase, partial [Yersinia pestis]
Length=395

 Score =   256 bits (655),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 154/224 (69%), Gaps = 1/224 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K K GF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  163  EQIGRFMQMVVEHKHKTGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  222

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GHS HHE+ +A   G+ G++DAN GDPQ GWDTDQFP  V E TLVM  ++
Sbjct  223  IEANHATLAGHSFHHEIASAIALGIFGSVDANRGDPQLGWDTDQFPNSVEENTLVMFEIL  282

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F  HIG MDT+A  L+ AAK+IEDG L ++V KR
Sbjct  283  KAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKFAAKMIEDGQLDQIVAKR  342

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAE  201
            Y  ++SELG  I  GK   E L + A +    P+  S  QEL E
Sbjct  343  YAGWNSELGQQILQGKMSLEELSRYASQHNLNPQHQSGHQELLE  386



>ref|XP_010883508.1| PREDICTED: xylose isomerase-like [Esox lucius]
Length=501

 Score =   259 bits (663),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 156/227 (69%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F + A+ YK+KIG      IEPKP+EP KHQYD+DA +   FL+  GL   FKLNIE 
Sbjct  275  ANFFKMAIKYKEKIGLNCQFLIEPKPKEPCKHQYDYDAMSVIGFLKHFGLDSHFKLNIEP  334

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GHS  H++  A + G+LG++D+N+G P  GWDTDQFPMD+   T+VM +V++ G
Sbjct  335  NHTTLAGHSYEHDIVMASVFGMLGSVDSNTGSPDLGWDTDQFPMDIRNTTMVMKTVVEQG  394

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GL  GG NFDAK+RRESTD+ED+FIAHIG MD  +RGLR+A +++EDG +  +V++RY S
Sbjct  395  GLKTGGLNFDAKVRRESTDIEDLFIAHIGAMDAFSRGLRNAVRILEDGVITSMVKERYMS  454

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            F   +G  +E G A  E LE    + GEPKV S KQE  E +    L
Sbjct  455  FSHGIGQKVEDGSASLEDLEDFVKQNGEPKVTSGKQEKYETVFNHYL  501



>ref|XP_006636149.1| PREDICTED: xylose isomerase-like [Lepisosteus oculatus]
Length=378

 Score =   256 bits (653),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 121/223 (54%), Positives = 156/223 (70%), Gaps = 0/223 (0%)
 Frame = -1

Query  848  EAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHAT  669
            E + AYK+KIG K    IEPKP+EP KHQYD+DA +   FL+   L   FKLNIE NH T
Sbjct  156  ECSSAYKEKIGLKCQFLIEPKPKEPCKHQYDYDAMSVIGFLKHFELDSYFKLNIEPNHTT  215

Query  668  LSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAP  489
            L+GHS  H++  A   G+LG++D+N+G P  GWDTDQFPMD+   T+VM  VI+ GGL P
Sbjct  216  LAGHSYEHDIIMASAFGMLGSVDSNTGSPDLGWDTDQFPMDIKNTTMVMKCVIEQGGLQP  275

Query  488  GGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSE  309
            GG NFDAK+RRESTD+ED+FIAH+G MDT ARGLRSA ++IE+G + +++++RY SF S 
Sbjct  276  GGLNFDAKVRRESTDLEDLFIAHVGAMDTFARGLRSAVQIIEEGVIAQMLQQRYLSFSSG  335

Query  308  LGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            +G+ +E G A    LE+   + GEPK  S KQE  E I    L
Sbjct  336  IGSMVEEGTATLVELEEFIKQNGEPKTTSGKQEKYESIFNHYL  378



>ref|WP_021393548.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQG16946.1| xylose isomerase [Peptoclostridium difficile DA00065]
 gb|EQK20169.1| xylose isomerase [Clostridium difficile P71]
 gb|EQK28958.1| xylose isomerase [Clostridium difficile P74]
 emb|CCL03401.1| Xylose isomerase [Peptoclostridium difficile E13]
 emb|CCL08382.1| Xylose isomerase [Peptoclostridium difficile CD002]
Length=445

 Score =   258 bits (658),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 158/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF++ AV Y K+IGF G   IEPKP+EPTKHQYD+D AT   FLRK  L   FK+NIE
Sbjct  209  FARFLQMAVDYAKEIGFTGQFLIEPKPKEPTKHQYDFDTATVLGFLRKYNLDKYFKVNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V+K 
Sbjct  269  ANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEVLKQ  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++RY 
Sbjct  329  GGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKERYA  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  389  SFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>ref|WP_021361041.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQE03070.1| xylose isomerase [Peptoclostridium difficile CD8]
 gb|EQE03425.1| xylose isomerase [Peptoclostridium difficile CD9]
 gb|EQI94371.1| xylose isomerase [Clostridium difficile P5]
 gb|EQJ05263.1| xylose isomerase [Clostridium difficile P7]
 gb|EQJ16852.1| xylose isomerase [Clostridium difficile P13]
 gb|EQJ77004.1| xylose isomerase [Clostridium difficile P46]
 gb|EQJ80819.1| xylose isomerase [Clostridium difficile P48]
 gb|EQK14534.1| xylose isomerase [Clostridium difficile P70]
 gb|EQK27028.1| xylose isomerase [Clostridium difficile P73]
 gb|EQK29846.1| xylose isomerase [Clostridium difficile P75]
 gb|ERM33438.1| xylose isomerase [Clostridium difficile P37]
Length=445

 Score =   258 bits (658),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 158/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF++ AV Y K+IGF G   IEPKP+EPTKHQYD+D AT   FLRK  L   FK+NIE
Sbjct  209  FARFLQMAVDYAKEIGFTGQFLIEPKPKEPTKHQYDFDTATVLGFLRKYNLDKYFKMNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V+K 
Sbjct  269  ANHATLAGHTFQHELNIARINDVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEVLKQ  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++RY 
Sbjct  329  GGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKERYA  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  389  SFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>ref|WP_021388228.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQF46170.1| xylose isomerase [Peptoclostridium difficile CD175]
Length=445

 Score =   258 bits (658),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 158/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF++ AV Y K+IGF G   IEPKP+EPTKHQYD+D AT   FLRK  L   FK+NIE
Sbjct  209  FARFLQMAVDYAKEIGFTGQFLIEPKPKEPTKHQYDFDTATVLGFLRKYNLDKYFKVNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V+K 
Sbjct  269  ANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEVLKQ  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++RY 
Sbjct  329  GGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKERYA  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  389  SFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>ref|WP_037562869.1| xylose isomerase [Spirochaeta sp. JC202]
 gb|KGM43000.1| xylose isomerase [Spirochaeta sp. JC202]
Length=437

 Score =   258 bits (658),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 155/230 (67%), Gaps = 0/230 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E  ARF   AV Y ++IGF+G   IEPKP+EPTKHQYD+DAAT  +FLR   L D FKLN
Sbjct  208  EQMARFFHMAVDYARQIGFEGQFLIEPKPKEPTKHQYDFDAATVLSFLRAYDLFDHFKLN  267

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GH+  H++  A I+G LG+IDAN GDP  GWDTDQF  D A  TL ML V+
Sbjct  268  IEANHATLAGHTFEHDLTVASIDGKLGSIDANVGDPLLGWDTDQFATDPASCTLAMLVVL  327

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG+  GG NFDAK RR S D  D+F AHI GMDT ARGL +A ++IEDG L + ++ R
Sbjct  328  KQGGIGSGGLNFDAKPRRGSFDEIDLFYAHISGMDTFARGLLAAHQIIEDGVLDDFIKTR  387

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            Y S+   +G     G+  FE LE+  L+ G+P   S +QE+ E IL S +
Sbjct  388  YASYQEGIGQRTMNGQESFESLEQYVLQQGDPAFKSGRQEMLESILHSYV  437



>ref|WP_014757233.1| MULTISPECIES: xylose isomerase [Thermoanaerobacterium]
 gb|AFK85311.1| Xylose isomerase [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
 gb|ETO38801.1| Xylose isomerase [Thermoanaerobacterium aotearoense SCUT27]
 gb|AIE39924.1| xylose isomerase [Thermoanaerobacterium saccharolyticum]
Length=439

 Score =   258 bits (658),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 126/228 (55%), Positives = 154/228 (68%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF+  AV Y K+IGF+G   IEPKP+EPTKHQYD+D A    FLRK GL   FK+NIE
Sbjct  209  FARFLHMAVDYAKEIGFEGQFLIEPKPKEPTKHQYDFDVANVLAFLRKYGLDKYFKVNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+ H   HE+  ARING+LG+IDAN+GD   GWDTDQFP D+   TL M  VIK 
Sbjct  269  ANHATLAFHDFQHELRYARINGVLGSIDANTGDMLLGWDTDQFPTDIRMTTLAMYEVIKM  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG   GG NFDAK+RR S + ED+F+ HI GMD  A+G + A KL++DG   + + +RY 
Sbjct  329  GGFDKGGLNFDAKVRRASFEPEDLFLGHIAGMDAFAKGFKVAYKLVKDGVFDKFIEERYA  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            S+   +GA I  GKADF+ LEK ALE  +    S +QEL E IL   L
Sbjct  389  SYKDGIGADIVSGKADFKSLEKYALEHSQIVNKSGRQELLESILNQYL  436



>gb|EFH05881.1| xylose isomerase [Clostridium difficile NAP08]
 gb|EFH17349.1| xylose isomerase [Clostridium difficile NAP07]
Length=454

 Score =   258 bits (659),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 158/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF++ AV Y K+IGF G   IEPKP+EPTKHQYD+D AT   FLRK  L   FK+NIE
Sbjct  218  FARFLQMAVDYAKEIGFTGQFLIEPKPKEPTKHQYDFDTATVLGFLRKYNLDKYFKVNIE  277

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V+K 
Sbjct  278  ANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEVLKQ  337

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++RY 
Sbjct  338  GGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKERYA  397

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  398  SFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  445



>gb|EHJ32437.1| xylose isomerase [Peptoclostridium difficile 002-P50-2011]
Length=454

 Score =   258 bits (659),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 158/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF++ AV Y K+IGF G   IEPKP+EPTKHQYD+D AT   FLRK  L   FK+NIE
Sbjct  218  FARFLQMAVDYAKEIGFTGQFLIEPKPKEPTKHQYDFDTATVLGFLRKYNLDKYFKVNIE  277

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V+K 
Sbjct  278  ANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEVLKQ  337

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++RY 
Sbjct  338  GGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKERYA  397

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  398  SFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  445



>ref|WP_039882234.1| xylose isomerase [Mesotoga infera]
Length=440

 Score =   257 bits (657),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 156/230 (68%), Gaps = 0/230 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E  ARF   A  Y K+IGF G   IEPKP EPTKHQYD+D A    FLRK GL + FK N
Sbjct  206  ENLARFFHMAADYAKEIGFSGQFLIEPKPMEPTKHQYDFDVANALAFLRKFGLEENFKFN  265

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +E NHATL+GH+  HE+  ARIN LLG++DAN GDP  GWDTDQFP D+   TL M  +I
Sbjct  266  VEANHATLAGHTFQHELRFARINDLLGSVDANQGDPLLGWDTDQFPTDLYSTTLGMYEII  325

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            KNGGL PGG NFDAK+RR S D  D+FI HI GMDT A GL++AAKLI++G+L+ L++ R
Sbjct  326  KNGGLNPGGLNFDAKVRRGSYDERDLFIGHIAGMDTFALGLKAAAKLIDEGTLESLLKDR  385

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            Y+S+ S +G  I  G ADF  LE+  ++   P    + QE  E ++  A+
Sbjct  386  YRSYQSGVGKEITEGIADFRSLEEYIIDKKNPLPEPSNQEYLERLVNWAI  435



>ref|WP_018751681.1| xylose isomerase [Paenibacillus sanguinis]
Length=438

 Score =   257 bits (657),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 153/206 (74%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF + A+ Y K+IGF G   IEPKP+EPT HQYD+DAATT +FL+K GL D FKLN+E
Sbjct  207  LARFFQMAIDYAKEIGFTGQFLIEPKPKEPTTHQYDFDAATTISFLQKYGLQDHFKLNLE  266

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE++ ARIN +LG+IDAN GDP  GWDTD+FP D+   TL M  +++N
Sbjct  267  ANHATLAGHTFQHELQVARINNMLGSIDANQGDPLLGWDTDEFPTDMYAVTLAMYEILQN  326

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+  GG NFDAK+RR S + ED+F AHI GMD+ ARGL+ A KL+ED   ++L+ +RY 
Sbjct  327  GGIGSGGVNFDAKVRRGSFEPEDLFYAHIAGMDSFARGLKVAGKLVEDKFFEQLLEERYA  386

Query  323  SFDSELGAAIEGGKADFELLEKKALE  246
            SF + +GA I  GKA+F+ LE  AL+
Sbjct  387  SFKTGIGADIVSGKANFKTLEAYALQ  412



>ref|WP_021013961.1| Xylose isomerase [Serratia sp. ATCC 39006]
 gb|ESN63278.1| Xylose isomerase [Serratia sp. ATCC 39006]
Length=439

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 157/231 (68%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +E NHATL+GH+ HHE+ TA   G+ G++DAN GDPQ+GWDTDQFP  V E  LVM  ++
Sbjct  267  VEANHATLAGHTFHHEIATAIALGIFGSVDANRGDPQSGWDTDQFPNSVEENALVMHEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F  HIG MDT+A  L+ AA++IED  L +LV KR
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALSLKVAARMIEDNQLNQLVAKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++SELG  I  GKA  E+L K A      P   S +QE  E ++   L
Sbjct  387  YAGWNSELGQQILQGKASLEMLSKYAESHQLAPHHQSGRQERLENLVNQYL  437



>ref|WP_021412148.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQI20652.1| xylose isomerase [Clostridium difficile Y165]
Length=445

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 158/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF++ AV Y K+IGF G   IEPKP+EPTKHQYD+D AT   FLRK  L   +K+NIE
Sbjct  209  FARFLQMAVDYAKEIGFTGQFLIEPKPKEPTKHQYDFDTATVLGFLRKYNLDKYYKMNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V+K 
Sbjct  269  ANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEVLKQ  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++RY 
Sbjct  329  GGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKERYA  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  389  SFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>ref|WP_014731027.1| xylose isomerase [Mesotoga prima]
 gb|AFK07082.1| xylose isomerase [Mesotoga prima MesG1.Ag.4.2]
Length=440

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 155/230 (67%), Gaps = 0/230 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E  ARF   A  Y K+IGF G   IEPKP EPTKHQYD+D A    FLRK GL + FK N
Sbjct  206  ENLARFFHMAADYAKEIGFSGQFLIEPKPMEPTKHQYDFDVANALAFLRKFGLEENFKFN  265

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +E NHATL+GH+  HE+  ARIN LLG++DAN GDP  GWDTDQFP D+   TL M  +I
Sbjct  266  VEANHATLAGHTFQHELRFARINDLLGSVDANQGDPLLGWDTDQFPTDLYSTTLGMYEII  325

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            KNGGL PGG NFDAK+RR S D  D+FI HI GMDT A GL++AAKLI++G+L+ L++ R
Sbjct  326  KNGGLNPGGLNFDAKVRRGSYDERDLFIGHIAGMDTFALGLKAAAKLIDEGTLESLLKDR  385

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            Y S+ S +G  I  G ADF  LE+  ++   P    + QE  E ++  A+
Sbjct  386  YSSYQSGVGKEITEGIADFRSLEEYIIDKKNPLPEPSNQEYLERLVNWAI  435



>ref|WP_022618581.1| Xylose isomerase [Peptoclostridium difficile]
 emb|CCL15498.1| Xylose isomerase [Peptoclostridium difficile T22]
 emb|CCL19498.1| Xylose isomerase [Clostridium difficile E25]
 emb|CCL23442.1| Xylose isomerase [Clostridium difficile T15]
 emb|CCL50480.1| Xylose isomerase [Clostridium difficile T6]
Length=445

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 158/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF++ AV Y K+IGF G   IEPKP+EPTKHQYD+D AT   FLRK  L   FK+NIE
Sbjct  209  FARFLQMAVDYAKEIGFTGQFLIEPKPKEPTKHQYDFDTATVLGFLRKYNLDKYFKMNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  +RIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V+K 
Sbjct  269  ANHATLAGHTFQHELNISRINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEVLKQ  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++RY 
Sbjct  329  GGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKERYA  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  389  SFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>emb|CCU83726.1| Xylose isomerase [Mesotoga infera]
Length=446

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 156/230 (68%), Gaps = 0/230 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E  ARF   A  Y K+IGF G   IEPKP EPTKHQYD+D A    FLRK GL + FK N
Sbjct  212  ENLARFFHMAADYAKEIGFSGQFLIEPKPMEPTKHQYDFDVANALAFLRKFGLEENFKFN  271

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +E NHATL+GH+  HE+  ARIN LLG++DAN GDP  GWDTDQFP D+   TL M  +I
Sbjct  272  VEANHATLAGHTFQHELRFARINDLLGSVDANQGDPLLGWDTDQFPTDLYSTTLGMYEII  331

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            KNGGL PGG NFDAK+RR S D  D+FI HI GMDT A GL++AAKLI++G+L+ L++ R
Sbjct  332  KNGGLNPGGLNFDAKVRRGSYDERDLFIGHIAGMDTFALGLKAAAKLIDEGTLESLLKDR  391

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            Y+S+ S +G  I  G ADF  LE+  ++   P    + QE  E ++  A+
Sbjct  392  YRSYQSGVGKEITEGIADFRSLEEYIIDKKNPLPEPSNQEYLERLVNWAI  441



>ref|WP_002209593.1| MULTISPECIES: xylose isomerase [Yersinia]
 ref|YP_002348901.1| xylose isomerase [Yersinia pestis CO92]
 sp|Q8Z9Z1.1|XYLA_YERPE RecName: Full=Xylose isomerase [Yersinia pestis]
 sp|Q663Y3.1|XYLA_YERPS RecName: Full=Xylose isomerase [Yersinia pseudotuberculosis IP 
32953]
 sp|Q1CDB8.1|XYLA_YERPN RecName: Full=Xylose isomerase [Yersinia pestis Nepal516]
 sp|Q1C0D3.1|XYLA_YERPA RecName: Full=Xylose isomerase [Yersinia pestis Antiqua]
 sp|A4TS63.1|XYLA_YERPP RecName: Full=Xylose isomerase [Yersinia pestis Pestoides F]
 sp|A7FP68.1|XYLA_YERP3 RecName: Full=Xylose isomerase [Yersinia pseudotuberculosis IP 
31758]
 sp|B2K7D2.1|XYLA_YERPB RecName: Full=Xylose isomerase [Yersinia pseudotuberculosis PB1/+]
 sp|B1JH40.1|XYLA_YERPY RecName: Full=Xylose isomerase [Yersinia pseudotuberculosis YPIII]
 gb|AAM87601.1|AE014007_5 D-xylose isomerase [Yersinia pestis KIM10+]
 gb|AAS63561.1| xylose isomerase [Yersinia pestis biovar Microtus str. 91001]
 emb|CAH23129.1| xylose isomerase [Yersinia pseudotuberculosis IP 32953]
 gb|ABG20012.1| D-xylose isomerase [Yersinia pestis Nepal516]
 gb|ABG16089.1| D-xylose isomerase [Yersinia pestis Antiqua]
 emb|CAL22614.1| xylose isomerase [Yersinia pestis CO92]
 gb|ABP42125.1| D-xylose isomerase [Yersinia pestis Pestoides F]
 gb|EDM40499.1| xylose isomerase [Yersinia pestis CA88-4125]
 gb|ABS49160.1| xylose isomerase [Yersinia pseudotuberculosis IP 31758]
 gb|EDR33700.1| xylose isomerase [Yersinia pestis biovar Orientalis str. IP275]
 gb|EDR38307.1| xylose isomerase [Yersinia pestis biovar Orientalis str. F1991016]
 gb|EDR43750.1| xylose isomerase [Yersinia pestis biovar Antiqua str. E1979001]
 gb|EDR50018.1| xylose isomerase [Yersinia pestis biovar Antiqua str. B42003004]
 gb|EDR57228.1| xylose isomerase [Yersinia pestis biovar Orientalis str. MG05-1020]
 gb|EDR60427.1| xylose isomerase [Yersinia pestis biovar Antiqua str. UG05-0454]
 gb|EDR65090.1| xylose isomerase [Yersinia pestis biovar Mediaevalis str. K1973002]
 gb|ACA66370.1| xylose isomerase [Yersinia pseudotuberculosis YPIII]
 gb|ACC91054.1| xylose isomerase [Yersinia pseudotuberculosis PB1/+]
 gb|EEO74586.1| D-xylose isomerase [Yersinia pestis Nepal516]
 gb|EEO83219.1| D-xylose isomerase [Yersinia pestis biovar Orientalis str. India 
195]
 gb|EEO86156.1| D-xylose isomerase [Yersinia pestis biovar Orientalis str. PEXU2]
 gb|EEO92697.1| D-xylose isomerase [Yersinia pestis Pestoides A]
 gb|ACY60456.1| xylose isomerase [Yersinia pestis D106004]
 gb|ACY64227.1| xylose isomerase [Yersinia pestis D182038]
 gb|EFA47585.1| xylose isomerase [Yersinia pestis KIM D27]
 gb|ADW00936.1| D-xylose isomerase [Yersinia pestis biovar Medievalis str. Harbin 
35]
 gb|AEL71794.1| xylose isomerase [Yersinia pestis A1122]
 gb|EIQ83290.1| xylose isomerase [Yersinia pestis PY-01]
 gb|EIQ83366.1| xylose isomerase [Yersinia pestis PY-02]
 gb|EIQ83458.1| xylose isomerase [Yersinia pestis PY-03]
 gb|EIQ96581.1| xylose isomerase [Yersinia pestis PY-04]
 gb|EIQ97867.1| xylose isomerase [Yersinia pestis PY-05]
 gb|EIR00942.1| xylose isomerase [Yersinia pestis PY-06]
 gb|EIR12092.1| xylose isomerase [Yersinia pestis PY-07]
 gb|EIR12163.1| xylose isomerase [Yersinia pestis PY-08]
 gb|EIR13602.1| xylose isomerase [Yersinia pestis PY-09]
 gb|EIR26348.1| xylose isomerase [Yersinia pestis PY-10]
 gb|EIR26950.1| xylose isomerase [Yersinia pestis PY-11]
 gb|EIR28175.1| xylose isomerase [Yersinia pestis PY-12]
 gb|EIR40744.1| xylose isomerase [Yersinia pestis PY-13]
 gb|EIR41848.1| xylose isomerase [Yersinia pestis PY-14]
 gb|EIR41920.1| xylose isomerase [Yersinia pestis PY-15]
 gb|EIR55112.1| xylose isomerase [Yersinia pestis PY-16]
 gb|EIR59432.1| xylose isomerase [Yersinia pestis PY-25]
 gb|EIR65819.1| xylose isomerase [Yersinia pestis PY-19]
 gb|EIR69624.1| xylose isomerase [Yersinia pestis PY-29]
 gb|EIR70354.1| xylose isomerase [Yersinia pestis PY-34]
 gb|EIR70784.1| xylose isomerase [Yersinia pestis PY-32]
 gb|EIR82307.1| xylose isomerase [Yersinia pestis PY-36]
 gb|EIR84992.1| xylose isomerase [Yersinia pestis PY-42]
 gb|EIR86963.1| xylose isomerase [Yersinia pestis PY-45]
 gb|EIR99013.1| xylose isomerase [Yersinia pestis PY-47]
 gb|EIR99031.1| xylose isomerase [Yersinia pestis PY-46]
 gb|EIR99393.1| xylose isomerase [Yersinia pestis PY-48]
 gb|EIS12053.1| xylose isomerase [Yersinia pestis PY-52]
 gb|EIS13455.1| xylose isomerase [Yersinia pestis PY-53]
 gb|EIS15935.1| xylose isomerase [Yersinia pestis PY-54]
 gb|EIS25359.1| xylose isomerase [Yersinia pestis PY-55]
 gb|EIS26461.1| xylose isomerase [Yersinia pestis PY-56]
 gb|EIS35596.1| xylose isomerase [Yersinia pestis PY-58]
 gb|EIS38705.1| xylose isomerase [Yersinia pestis PY-60]
 gb|EIS39249.1| xylose isomerase [Yersinia pestis PY-59]
 gb|EIS51557.1| xylose isomerase [Yersinia pestis PY-61]
 gb|EIS51928.1| xylose isomerase [Yersinia pestis PY-63]
 gb|EIS52664.1| xylose isomerase [Yersinia pestis PY-64]
 gb|EIS63440.1| xylose isomerase [Yersinia pestis PY-65]
 gb|EIS65175.1| xylose isomerase [Yersinia pestis PY-66]
 gb|EIS72332.1| xylose isomerase [Yersinia pestis PY-71]
 gb|EIS73657.1| xylose isomerase [Yersinia pestis PY-72]
 gb|EIS82786.1| xylose isomerase [Yersinia pestis PY-76]
 gb|EIS85391.1| xylose isomerase [Yersinia pestis PY-88]
 gb|EIS89108.1| xylose isomerase [Yersinia pestis PY-89]
 gb|EIS94365.1| xylose isomerase [Yersinia pestis PY-90]
 gb|EIT01007.1| xylose isomerase [Yersinia pestis PY-91]
 gb|EIT09192.1| xylose isomerase [Yersinia pestis PY-93]
 gb|EIT09500.1| xylose isomerase [Yersinia pestis PY-94]
 gb|EIT09583.1| xylose isomerase [Yersinia pestis PY-92]
 gb|EIT22087.1| xylose isomerase [Yersinia pestis PY-95]
 gb|EIT23772.1| xylose isomerase [Yersinia pestis PY-96]
 gb|EIT25332.1| xylose isomerase [Yersinia pestis PY-98]
 gb|EIT37378.1| xylose isomerase [Yersinia pestis PY-99]
 gb|EIT38231.1| xylose isomerase [Yersinia pestis PY-100]
 gb|EIT38685.1| xylose isomerase [Yersinia pestis PY-101]
 gb|EIT51676.1| xylose isomerase [Yersinia pestis PY-102]
 gb|EIT51770.1| xylose isomerase [Yersinia pestis PY-103]
 gb|EIT52667.1| xylose isomerase [Yersinia pestis PY-113]
 gb|EKS43352.1| xylose isomerase [Yersinia pestis INS]
 gb|ERP78426.1| xylose isomerase [Yersinia pestis 24H]
 gb|ERP78457.1| xylose isomerase [Yersinia pestis S3]
 gb|ERP79516.1| xylose isomerase [Yersinia pestis 113]
 gb|ERP84291.1| xylose isomerase [Yersinia pestis 9]
 gb|EXU73353.1| xylose isomerase [Yersinia pestis EV NIIEG]
 gb|KFB61373.1| xylose isomerase [Yersinia pestis subsp. pestis]
 gb|AIN12544.1| xylose isomerase [Yersinia pseudotuberculosis]
 gb|KGA52725.1| xylose isomerase [Yersinia pestis]
 gb|AJI93601.1| xylose isomerase [Yersinia pestis]
 gb|AJK08309.1| xylose isomerase [Yersinia pestis]
 gb|AJJ49856.1| xylose isomerase [Yersinia pestis]
 gb|AJJ55712.1| xylose isomerase [Yersinia pseudotuberculosis IP 32953]
 gb|AJJ00256.1| xylose isomerase [Yersinia pestis Pestoides F]
 gb|AJJ01227.1| xylose isomerase [Yersinia pseudotuberculosis]
 gb|AJJ05453.1| xylose isomerase [Yersinia pseudotuberculosis]
 gb|AJJ58237.1| xylose isomerase [Yersinia pseudotuberculosis YPIII]
 gb|AJJ65752.1| xylose isomerase [Yersinia pseudotuberculosis PB1/+]
 gb|AJJ72785.1| xylose isomerase [Yersinia pseudotuberculosis]
 gb|AJJ13104.1| xylose isomerase [Yersinia pestis]
 gb|AJJ76118.1| xylose isomerase [Yersinia pestis A1122]
 gb|AJJ33411.1| xylose isomerase [Yersinia pestis]
 gb|AJJ78027.1| xylose isomerase [Yersinia pestis Antiqua]
 gb|AJJ90104.1| xylose isomerase [Yersinia pestis CO92]
 gb|AJJ41996.1| xylose isomerase [Yersinia pestis]
 gb|AJJ42605.1| xylose isomerase [Yersinia pestis]
 gb|AJK11082.1| xylose isomerase [Yersinia pestis str. Pestoides B]
 gb|AJK14634.1| xylose isomerase [Yersinia pseudotuberculosis str. PA3606]
 gb|AJK23024.1| xylose isomerase [Yersinia pestis Pestoides G]
 gb|AJK21483.1| xylose isomerase [Yersinia pestis]
 gb|KJG87721.1| xylose isomerase [Yersinia pestis subsp. microtus bv. Ulegeica]
 gb|KJG89667.1| xylose isomerase [Yersinia pestis subsp. microtus bv. Ulegeica]
 emb|CFQ99010.1| xylose isomerase [Yersinia pseudotuberculosis]
 emb|CFU98901.1| xylose isomerase [Yersinia pseudotuberculosis]
 emb|CFV20706.1| xylose isomerase [Yersinia pseudotuberculosis]
 gb|AKB88639.1| xylose isomerase [Yersinia pestis]
Length=439

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 154/224 (69%), Gaps = 1/224 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K K GF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKTGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GHS HHE+ +A   G+ G++DAN GDPQ GWDTDQFP  V E TLVM  ++
Sbjct  267  IEANHATLAGHSFHHEIASAIALGIFGSVDANRGDPQLGWDTDQFPNSVEENTLVMFEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F  HIG MDT+A  L+ AAK+IEDG L ++V KR
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKFAAKMIEDGQLDQIVAKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAE  201
            Y  ++SELG  I  GK   E L + A +    P+  S  QEL E
Sbjct  387  YAGWNSELGQQILQGKMSLEELSRYASQHNLNPQHQSGHQELLE  430



>ref|WP_014913698.1| xylose isomerase [Pectobacterium carotovorum]
 gb|AFR01490.1| xylose isomerase [Pectobacterium carotovorum subsp. carotovorum 
PCC21]
Length=439

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 159/231 (69%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +E NHATL+GHS HHE+ TA   G+ G++DAN GDPQ GWDTDQFP  V E +L+M  ++
Sbjct  267  VEANHATLAGHSFHHEIATAVALGIFGSVDANRGDPQLGWDTDQFPNSVEENSLIMYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F AHIG MDT+A  L++AA++IED  L +LV KR
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDRYDLFHAHIGAMDTMALALKAAARMIEDDKLNQLVAKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++ ELG  I  GKA  E L + A      P+  S +QEL E ++   L
Sbjct  387  YAGWNGELGQQILQGKASLESLARYAESHQLAPQHQSGQQELLENLVNRHL  437



>ref|WP_032466856.1| xylose isomerase [Yersinia pseudotuberculosis]
 gb|KGA65859.1| xylose isomerase [Yersinia pseudotuberculosis]
Length=439

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 154/224 (69%), Gaps = 1/224 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K K GF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKTGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GHS HHE+ +A   G+ G++DAN GDPQ GWDTDQFP  V E TLVM  ++
Sbjct  267  IEANHATLAGHSFHHEIASAIALGIFGSVDANRGDPQLGWDTDQFPNSVEENTLVMFEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F  HIG MDT+A  L+ AAK+IEDG L ++V KR
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKFAAKMIEDGQLDQIVAKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAE  201
            Y  ++SELG  I  GK   E L + A +    P+  S  QEL E
Sbjct  387  YAGWNSELGQQILQGKMSLEELSRYASQHNLNPQHQSGHQELLE  430



>ref|WP_033847877.1| MULTISPECIES: xylose isomerase [Yersinia]
Length=439

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 154/224 (69%), Gaps = 1/224 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K K GF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKTGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GHS HHE+ +A   G+ G++DAN GDPQ GWDTDQFP  V E TLVM  ++
Sbjct  267  IEANHATLAGHSFHHEIASAIALGIFGSVDANRGDPQLGWDTDQFPNSVEENTLVMFEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F  HIG MDT+A  L+ AAK+IEDG L ++V KR
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKFAAKMIEDGQLDQIVAKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAE  201
            Y  ++SELG  I  GK   E L + A +    P+  S  QEL E
Sbjct  387  YAGWNSELGQQILQGKMSLEELSRYASQHNLNPQHQSGHQELLE  430



>ref|WP_012230197.1| xylose isomerase [Yersinia pestis]
 sp|A9R5Q1.1|XYLA_YERPG RecName: Full=Xylose isomerase [Yersinia pestis Angola]
 gb|ABX85301.1| xylose isomerase [Yersinia pestis Angola]
 gb|AJJ82566.1| xylose isomerase [Yersinia pestis Angola]
Length=439

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 154/224 (69%), Gaps = 1/224 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K K GF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKTGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GHS HHE+ +A   G+ G++DAN GDPQ GWDTDQFP  V E TLVM  ++
Sbjct  267  IEANHATLAGHSFHHEIASAIALGIFGSVDANRGDPQLGWDTDQFPNSVEENTLVMFEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F  HIG MDT+A  L+ AAK+IEDG L ++V KR
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKFAAKMIEDGQLDQIVAKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAE  201
            Y  ++SELG  I  GK   E L + A +    P+  S  QEL E
Sbjct  387  YAGWNSELGQQILQGKMSLEELSRYASQHNLNPQHQSGHQELLE  430



>ref|XP_010792168.1| PREDICTED: xylose isomerase-like [Notothenia coriiceps]
Length=312

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 156/227 (69%), Gaps = 3/227 (1%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F + AV   KKIG K    IEPKP+EP KHQYD++A +   FL+  GL  +FKLNIE 
Sbjct  89   ANFFKMAV---KKIGLKCQFLIEPKPKEPCKHQYDYEAVSVIGFLKYYGLEYDFKLNIEP  145

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GHS  H+V  A   G+LG++D+N+G P  GWDTDQFPMD+  ATLVM ++I+ G
Sbjct  146  NHTTLAGHSYEHDVVMASAFGMLGSVDSNTGSPDLGWDTDQFPMDIRNATLVMKTIIEQG  205

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GL PGG NFDAK+RRESTD+ED+FIAHIG MDT ARGLR+A ++IEDG +  +V+ RY S
Sbjct  206  GLQPGGLNFDAKVRRESTDLEDLFIAHIGAMDTFARGLRNAVRIIEDGIIPGMVKDRYSS  265

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            F   +   +E G A  E +E    + GEPKV S KQE  E I    +
Sbjct  266  FSHGIWQKVEEGSASLEEMEDFIKQNGEPKVTSGKQEKYESIFNHYI  312



>gb|EHJ34457.1| xylose isomerase [Peptoclostridium difficile 050-P50-2011]
Length=454

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 158/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF++ AV Y K+IGF G   IEPKP+EPTKHQYD+D AT   FLRK  L   FK+NIE
Sbjct  218  FARFLQMAVDYAKEIGFTGQFLIEPKPKEPTKHQYDFDTATVLGFLRKYNLDKYFKMNIE  277

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  +RIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V+K 
Sbjct  278  ANHATLAGHTFQHELNISRINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEVLKQ  337

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++RY 
Sbjct  338  GGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKERYA  397

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  398  SFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  445



>ref|WP_025235120.1| xylose isomerase [Mannheimia varigena]
 gb|AHG72324.1| Xylose isomerase [Mannheimia varigena USDA-ARS-USMARC-1261]
Length=439

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 162/234 (69%), Gaps = 7/234 (3%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGFKGTL IEPKPQEPTKHQYD+D AT   FL++ GL +E K+N
Sbjct  207  EQIGRFMQLVVEHKHKIGFKGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLENEIKMN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GH+  HE+ TA   G+ G+IDAN GDPQ GWDTDQFP  V E TLVM  ++
Sbjct  267  IEANHATLAGHTFQHEIATATALGIFGSIDANRGDPQLGWDTDQFPNSVEENTLVMYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GGFNFDAK+RR+STD  D+F AHIG MD LA  L+ AAK+IED +L+++V  R
Sbjct  327  KAGGFTTGGFNFDAKIRRQSTDPYDLFHAHIGAMDVLALSLKRAAKMIEDQALQKVVDNR  386

Query  329  YQSFDSELGAAIEGGKADFE----LLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            Y  ++ +LG  I  GKA  E    ++E + L   +PK  S +QE  E ++ S +
Sbjct  387  YAGWNQDLGQQILTGKASLEDLARIVETQDL---DPKPVSGQQEYLENLVNSYI  437



>ref|WP_027072689.1| xylose isomerase [Luteimonas sp. J29]
Length=444

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/231 (56%), Positives = 159/231 (69%), Gaps = 1/231 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF+  A  Y + IGFKG  FIEPKP EP KHQYD+D+AT A FL+++GL  +F LNIE
Sbjct  215  FARFLAMARDYGRSIGFKGQFFIEPKPMEPMKHQYDFDSATVAGFLKEHGLEKDFSLNIE  274

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATLSGH+  H+++ A  +GLLG+IDAN G+PQ GWDTDQFP D+ +    ML V++ 
Sbjct  275  ANHATLSGHTFEHDLQVASDHGLLGSIDANRGNPQNGWDTDQFPTDLYDTVGAMLVVLRQ  334

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GGL PGG NFDAK RRESTD+ED+FIAHIGGMD  ARGL  A  L+ D   ++  ++RY 
Sbjct  335  GGL-PGGLNFDAKPRRESTDMEDLFIAHIGGMDAFARGLEVAHALLNDSPWEQWRKERYA  393

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL*KR  171
            SFDS  GA  E GK     L   A + GEP+  S KQE  E +L   L +R
Sbjct  394  SFDSGPGADFEAGKLSLADLVAHAAKHGEPQQTSGKQERYENLLNQYLLRR  444



>ref|WP_015842241.1| xylose isomerase [Pectobacterium carotovorum]
 sp|C6DIH5.1|XYLA_PECCP RecName: Full=Xylose isomerase [Pectobacterium carotovorum subsp. 
carotovorum PC1]
 gb|ACT15169.1| xylose isomerase [Pectobacterium carotovorum subsp. carotovorum 
PC1]
Length=440

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/231 (55%), Positives = 158/231 (68%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +E NHATL+GHS HHE+ TA   G+ G++DAN GDPQ GWDTDQFP  V E TL+M  ++
Sbjct  267  VEANHATLAGHSFHHEIATAVALGVFGSVDANRGDPQLGWDTDQFPNSVEENTLIMYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F AHIG MDT+A  L++AA++IED  L +LV KR
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDRYDLFHAHIGAMDTMALALKAAARMIEDDKLNQLVAKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++ ELG  I  GKA  E L   A      P+  S +QEL E ++   L
Sbjct  387  YAGWNGELGQQILQGKASLESLAHYAESHQLAPQHQSGQQELLENLVNRHL  437



>ref|WP_040043960.1| xylose isomerase [Pectobacterium carotovorum]
 gb|KHS78226.1| xylose isomerase [Pectobacterium carotovorum subsp. brasiliense]
Length=440

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 158/231 (68%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +E NHATL+GHS HHE+ TA   G+ G++DAN GDPQ GWDTDQFP  V E  L+M  ++
Sbjct  267  VEANHATLAGHSFHHEIATAVALGIFGSVDANRGDPQLGWDTDQFPNSVEENALIMYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F AHIG MDT+A  L++AA++IED  L +LV KR
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDRYDLFHAHIGAMDTMALALKAAARMIEDDKLNQLVAKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++ ELG  I  GKA  E L + A      P+  S +QEL E ++   L
Sbjct  387  YAGWNGELGQQILQGKASLESLARYAESHQLAPQHQSGQQELLENLVNRHL  437



>ref|WP_024063558.1| xylose isomerase [Yersinia pseudotuberculosis]
 dbj|GAE13341.1| xylose isomerase [Yersinia pseudotuberculosis NBRC 105692]
Length=439

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 154/224 (69%), Gaps = 1/224 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K K GF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKTGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GHS HHE+ +A   G+ G++DAN GDPQ GWDTDQFP  + E TLVM  ++
Sbjct  267  IEANHATLAGHSFHHEIASAIALGIFGSVDANRGDPQLGWDTDQFPNSIEENTLVMFEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F  HIG MDT+A  L+ AAK+IEDG L ++V KR
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKFAAKMIEDGQLDQIVAKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAE  201
            Y  ++SELG  I  GK   E L + A +    P+  S  QEL E
Sbjct  387  YAGWNSELGQQILQGKMSLEELSRYASQHNLNPQHQSGHQELLE  430



>ref|WP_007415126.1| xylose isomerase [Pedosphaera parvula]
 gb|EEF60951.1| xylose isomerase [bacterium Ellin514]
Length=437

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/229 (56%), Positives = 160/229 (70%), Gaps = 3/229 (1%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            +  A+ +  AVAYKK+IGFKG  +IEPKP+EPTKHQYD DAA   NFLR++GL+  FKLN
Sbjct  207  QHLAKLLHLAVAYKKQIGFKGQFYIEPKPKEPTKHQYDSDAAACLNFLREHGLLPHFKLN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GH+  HE+E A   G LG+IDAN+GD   GWDTDQFP  +   T  MLSV+
Sbjct  267  IETNHATLAGHTMQHELEVAGAAGALGSIDANTGDELLGWDTDQFPTSIYLTTYTMLSVL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RRES +  D+F AHIGGMD  ARGL+ AA + +DG L E V++R
Sbjct  327  KYGGFKTGGVNFDAKVRRESFEPVDLFYAHIGGMDAFARGLKIAAAIRKDGRLAEFVKQR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWGE--PKVPSAKQELAEMILQ  189
            Y S+DS LG+ IE GKA  + LE   L+ GE  P   S +QE  E ++ 
Sbjct  387  YASWDSSLGSKIESGKATMKELEAYMLKKGEVTPNT-SGRQEFLENLIN  434



>gb|AHM63135.1| xylose isomerase [Flammeovirgaceae bacterium 311]
Length=443

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 157/230 (68%), Gaps = 0/230 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E FARF+  A  Y +K GFKGT FIEPKP EPTKHQYD+DAAT A FLR+  L+D+FKLN
Sbjct  214  EHFARFLHTARDYARKQGFKGTFFIEPKPMEPTKHQYDYDAATVAGFLRQYDLMDDFKLN  273

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GH+  HE++ A   GLLG+IDAN GD Q GWDTDQFP D+ E T  ML  +
Sbjct  274  IEVNHATLAGHTFQHELQVAADQGLLGSIDANRGDYQNGWDTDQFPNDIYELTEAMLVFL  333

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            + GGL  GG NFDAK+RR STD +D+F AH+GG D  AR L +A  +++    K++ ++R
Sbjct  334  EAGGLQGGGVNFDAKIRRNSTDPKDLFYAHVGGADIFARALLTADAILQKSDYKKIRQER  393

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            Y SFDS  G A E G+   E L   A+E GEP   S +QE  E ++   +
Sbjct  394  YASFDSGKGKAFEEGQLSLEDLRAYAIENGEPATISGRQEYLENLINRYI  443



>ref|XP_009537176.1| hypothetical protein PHYSODRAFT_565503 [Phytophthora sojae]
 gb|EGZ07610.1| hypothetical protein PHYSODRAFT_565503 [Phytophthora sojae]
Length=409

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 156/223 (70%), Gaps = 0/223 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F +  VAYKK++G      +EPKP+EP KHQYD+DAAT   FL   GL  +FKLN+E 
Sbjct  182  AAFFKLVVAYKKELGATFQFLVEPKPREPMKHQYDYDAATVIAFLHTYGLQHDFKLNVEP  241

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +++ G
Sbjct  242  NHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKIVEIG  301

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++RY S
Sbjct  302  GLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQRYAS  361

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  192
            + S LG  IE G+A  E +   A E GEP   S KQELAE++L
Sbjct  362  WKSALGERIEDGRATLEEVAAYAKEAGEPDHVSGKQELAELML  404



>ref|WP_039521824.1| xylose isomerase [Pectobacterium carotovorum]
 gb|KHS72420.1| xylose isomerase [Pectobacterium carotovorum subsp. brasiliense]
 gb|KHS88480.1| xylose isomerase [Pectobacterium carotovorum subsp. carotovorum]
 gb|KHT07542.1| xylose isomerase [Pectobacterium carotovorum subsp. brasiliense]
 gb|KHT16087.1| xylose isomerase [Pectobacterium carotovorum subsp. brasiliense]
Length=439

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 158/231 (68%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +E NHATL+GHS HHE+ TA   G+ G++DAN GDPQ GWDTDQFP  V E  L+M  ++
Sbjct  267  VEANHATLAGHSFHHEIATAVALGIFGSVDANRGDPQLGWDTDQFPNSVEENALIMYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F AHIG MDT+A  L++AA++IED  L +LV KR
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDRYDLFHAHIGAMDTMALALKAAARMIEDDKLNQLVAKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++ ELG  I  GKA  E L + A      P+  S +QEL E ++   L
Sbjct  387  YAGWNGELGQQILQGKASLESLARYAESHQLAPQHQSGQQELLENLVNRHL  437



>ref|WP_025381905.1| xylose isomerase [Yersinia similis]
 gb|AHK19150.1| xylose isomerase [Yersinia similis]
 emb|CFQ64205.1| xylose isomerase [Yersinia similis]
Length=439

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 154/224 (69%), Gaps = 1/224 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K K GF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKTGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GHS HHE+ +A   G+ G++DAN GDPQ GWDTDQFP  V E TLVM  ++
Sbjct  267  IEANHATLAGHSFHHEIASAIALGIFGSVDANRGDPQLGWDTDQFPNSVEENTLVMFEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F  HIG MDT+A  L+ AAK+IEDG L ++V KR
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKFAAKMIEDGQLDQIVAKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAE  201
            Y  ++SELG  I  GK   E L + A +    P+  S  QEL E
Sbjct  387  YAGWNSELGQQILQGKLSLEELARYASQHNLNPQHQSGHQELLE  430



>ref|WP_039284980.1| xylose isomerase [Pectobacterium carotovorum]
 gb|KFF66767.1| xylose isomerase [Pectobacterium carotovorum subsp. brasiliense]
 gb|KHS67605.1| xylose isomerase [Pectobacterium carotovorum subsp. brasiliense]
 gb|KHT04082.1| xylose isomerase [Pectobacterium carotovorum subsp. brasiliense]
 gb|KHT15405.1| xylose isomerase [Pectobacterium carotovorum subsp. carotovorum]
 gb|KHT40742.1| xylose isomerase [Pectobacterium carotovorum subsp. carotovorum]
Length=439

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 158/231 (68%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +E NHATL+GHS HHE+ TA   G+ G++DAN GDPQ GWDTDQFP  V E  L+M  ++
Sbjct  267  VEANHATLAGHSFHHEIATAVALGIFGSVDANRGDPQLGWDTDQFPNSVEENALIMYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F AHIG MDT+A  L++AA++IED  L +LV KR
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDRYDLFHAHIGAMDTMALALKAAARMIEDDKLNQLVAKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++ ELG  I  GKA  E L + A      P+  S +QEL E ++   L
Sbjct  387  YAGWNGELGQQILQGKASLESLARYAESHQLAPQHQSGQQELLENLVNRHL  437



>ref|WP_013298905.1| xylose isomerase [Thermoanaerobacterium thermosaccharolyticum]
 sp|P29441.2|XYLA_THETC RecName: Full=Xylose isomerase [Thermoanaerobacterium thermosaccharolyticum 
DSM 571]
 gb|ADL69948.1| xylose isomerase [Thermoanaerobacterium thermosaccharolyticum 
DSM 571]
Length=439

 Score =   256 bits (654),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 153/228 (67%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF+  AV Y K+IGF+G   IEPKP+EPTKHQYD+D A    FLRK  L   FK+NIE
Sbjct  209  FARFLHMAVDYAKEIGFEGQFLIEPKPKEPTKHQYDFDVANVLAFLRKYDLDKYFKVNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+ H   HE+  ARING+LG+IDAN+GD   GWDTDQFP D+   TL M  VIK 
Sbjct  269  ANHATLAAHDFQHELRYARINGVLGSIDANTGDMLLGWDTDQFPTDIRMTTLAMYEVIKM  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG   GG NFDAK+RR S + ED+F+ HI GMD  A+G + A KL++DG   + + +RY 
Sbjct  329  GGFDKGGLNFDAKVRRASFEPEDLFLGHIAGMDAFAKGFKVAYKLVKDGVFDKFIEERYA  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            S+   +GA I  GKADF+ LEK ALE  E    S +QE+ E IL   L
Sbjct  389  SYKDGIGADIVSGKADFKSLEKYALEHSEIVNKSGRQEMLESILNQYL  436



>ref|WP_039490220.1| xylose isomerase [Pectobacterium carotovorum]
 gb|KGA37656.1| xylose isomerase [Pectobacterium carotovorum subsp. odoriferum]
 gb|KGA40236.1| xylose isomerase [Pectobacterium carotovorum subsp. odoriferum]
 gb|AIU86804.1| xylose isomerase [Pectobacterium carotovorum subsp. odoriferum]
Length=439

 Score =   256 bits (654),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 158/231 (68%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +E NHATL+GHS HHE+ TA   G+ G++DAN GDPQ GWDTDQFP  V E  L+M  ++
Sbjct  267  VEANHATLAGHSFHHEIATAVALGIFGSVDANRGDPQLGWDTDQFPNSVEENALIMYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F AHIG MDT+A  L++AA++IED  L +LV KR
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDRYDLFHAHIGAMDTMALALKAAARMIEDDKLNQLVAKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++ ELG  I  GKA  E L + A      P+  S +QEL E ++   L
Sbjct  387  YAGWNGELGQQILQGKASLESLARYAESHQLAPQHQSGQQELLENLVNRHL  437



>ref|WP_010284187.1| xylose isomerase [Pectobacterium carotovorum]
 gb|KGA22575.1| xylose isomerase [Pectobacterium carotovorum subsp. brasiliense]
Length=440

 Score =   256 bits (654),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 158/231 (68%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKIGFRGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +E NHATL+GHS HHE+ TA   G+ G++DAN GDPQ GWDTDQFP  V E  L+M  ++
Sbjct  267  VEANHATLAGHSFHHEIATAVALGIFGSVDANRGDPQLGWDTDQFPNSVEENALIMYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F AHIG MDT+A  L++AA+++ED  L +LV KR
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDRYDLFHAHIGAMDTMALALKAAARMVEDDKLNQLVAKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++ ELG  I  GKA  E L + A      P+  S +QEL E ++   L
Sbjct  387  YTGWNGELGQQILQGKASLESLARYAESHQLAPQHQSGQQELLENLVNRHL  437



>ref|WP_013788885.1| xylose isomerase [Thermoanaerobacterium xylanolyticum]
 gb|AEF18157.1| Xylose isomerase [Thermoanaerobacterium xylanolyticum LX-11]
Length=439

 Score =   256 bits (654),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/228 (55%), Positives = 153/228 (67%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF+  AV Y K+IGF+G L IEPKP+EPTKHQYD+D A    FLRK  L   FK+NIE
Sbjct  209  FARFLHMAVDYAKEIGFEGQLLIEPKPKEPTKHQYDFDVANVLAFLRKYDLDKYFKVNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+ H   HE+  ARING+LG+IDAN+GD   GWDTDQFP D+   TL M  VIK 
Sbjct  269  ANHATLAFHDFQHELRYARINGVLGSIDANTGDMLLGWDTDQFPTDIRMTTLAMYEVIKM  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG   GG NFDAK+RR S + ED+F+ HI GMD  A+G + A KL++DG   + + +RY 
Sbjct  329  GGFDKGGLNFDAKVRRASFEPEDLFLGHIAGMDAFAKGFKVAYKLVKDGVFDKFIEERYA  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            S+   +GA I  GKADF  LEK ALE  +    S +QEL E IL   L
Sbjct  389  SYKDGIGADIVSGKADFRSLEKYALEHSQIVNKSGRQELLESILNQYL  436



>ref|WP_012570371.1| xylose isomerase [Coxiella burnetii]
 gb|ACJ18944.1| xylose isomerase [Coxiella burnetii CbuG_Q212]
Length=436

 Score =   256 bits (654),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 158/225 (70%), Gaps = 1/225 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            F RF+   V YK KIGF G L IEPKP EPTKHQYD+D AT   FL+++GL  EFK+NIE
Sbjct  209  FGRFLSLLVDYKHKIGFNGLLLIEPKPCEPTKHQYDFDVATVYAFLQRHGLEKEFKVNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GHS  HE+  A  N + G++DAN GDPQ GWDTDQFP+D+ E  LV+  ++K+
Sbjct  269  ANHATLAGHSFAHEIAYACANDIFGSVDANRGDPQLGWDTDQFPIDLQETVLVLYLILKH  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG   GGFNFDAKLRR+S D+ED+F AHI G+DTLARGL  AA +IE+  LK    KRYQ
Sbjct  329  GGFTSGGFNFDAKLRRQSLDLEDLFYAHISGIDTLARGLLIAATIIENDKLKTTKEKRYQ  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMIL  192
            ++   L A +  GK DFE + K+AL+   +PK  S +QE  E  L
Sbjct  389  AWKEPLNANMLSGKLDFETIAKRALDNNLDPKPTSGEQEKLERWL  433



>ref|WP_013314408.1| xylose isomerase [Spirochaeta thermophila]
 gb|ADN02569.1| xylose isomerase [Spirochaeta thermophila DSM 6192]
Length=440

 Score =   256 bits (654),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/228 (55%), Positives = 156/228 (68%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             ARF+  AV Y KKIGFKG   IEPKP+EPTKHQYD+D A    FL+K  L+  FK+NIE
Sbjct  210  LARFLHMAVDYAKKIGFKGQFLIEPKPKEPTKHQYDFDVAAVYGFLKKYDLLPYFKVNIE  269

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+ H+  HE+  ARING+LG++D N GD   GWDTDQFP ++ E TL M  VIKN
Sbjct  270  MNHATLAYHTFQHELHFARINGILGSMDVNQGDYLLGWDTDQFPTNLYETTLAMYEVIKN  329

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG+APGG NFDAK+RR S + EDIFIAHI GMD  ARG + A KL+ED ++++ V +RY 
Sbjct  330  GGIAPGGLNFDAKVRRGSFEPEDIFIAHIAGMDAFARGFKVAWKLLEDKAIEKHVEERYA  389

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            S+   +G  I  GK  FE LE   ++  E K  S +QEL E +L   L
Sbjct  390  SYREGIGKKIVEGKVGFEDLEAYIIDKAEIKNASGRQELLEAVLNRYL  437



>ref|XP_002904118.1| xylose isomerase 1 [Phytophthora infestans T30-4]
 gb|EEY54296.1| xylose isomerase 1 [Phytophthora infestans T30-4]
Length=469

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 157/226 (69%), Gaps = 0/226 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F +  VAYKK++G      +EPKP+EP KHQYD+DAAT   FL   GL ++FKLNIE 
Sbjct  224  AAFFKLVVAYKKELGATFQFLVEPKPREPMKHQYDYDAATVVAFLHTYGLQNDFKLNIEP  283

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +++ G
Sbjct  284  NHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKIVEIG  343

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L ELV++RY S
Sbjct  344  GLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGELVKQRYAS  403

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSA  183
            + S LG  IE G+A  E +   A E GEP   S KQELAE++  + 
Sbjct  404  WKSTLGERIEQGQATLEEVAAYAKESGEPDHVSGKQELAELMWSTV  449



>ref|WP_039316685.1| xylose isomerase [Pectobacterium carotovorum]
 gb|KGA32758.1| xylose isomerase [Pectobacterium carotovorum subsp. brasiliense]
Length=439

 Score =   256 bits (654),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 158/231 (68%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKIGFRGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +E NHATL+GHS HHE+ TA   G+ G++DAN GDPQ GWDTDQFP  V E  L+M  ++
Sbjct  267  VEANHATLAGHSFHHEIATAVALGIFGSVDANRGDPQLGWDTDQFPNSVEENALIMYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F AHIG MDT+A  L++AA+++ED  L +LV KR
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDRYDLFHAHIGAMDTMALALKAAARMVEDDKLNQLVAKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++ ELG  I  GKA  E L + A      P+  S +QEL E ++   L
Sbjct  387  YAGWNGELGQQILQGKASLESLARYAESHQLAPQHQSGQQELLENLVNRHL  437



>ref|WP_039510331.1| xylose isomerase [Pectobacterium carotovorum]
 gb|KHS98361.1| xylose isomerase [Pectobacterium carotovorum subsp. brasiliense]
Length=439

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 158/231 (68%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +E NHATL+GHS HHE+ TA   G+ G++DAN GDPQ GWDTDQFP  V E  L+M  ++
Sbjct  267  VEANHATLAGHSFHHEIATAVALGIFGSVDANRGDPQLGWDTDQFPNSVEENALIMYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F AHIG MDT+A  L++AA++IED  L +LV KR
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDRYDLFHAHIGAMDTMALALKAAARMIEDDKLNQLVAKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++ ELG  I  GKA  E L + A      P+  S +QEL E ++   L
Sbjct  387  YAGWNGELGQQILQGKASLESLAQYAESHQLAPQHQSGQQELLENLVNRHL  437



>ref|WP_013411463.1| xylose isomerase [Caldicellulosiruptor owensensis]
 gb|ADQ04052.1| xylose isomerase [Caldicellulosiruptor owensensis OL]
Length=438

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 154/227 (68%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            ARF+  AV Y K+IGF G   IEPKP+EPTKHQYD+DAA    FL+K  L   FKLNIE 
Sbjct  209  ARFLRMAVDYAKEIGFDGQFLIEPKPKEPTKHQYDFDAAHVYGFLKKYDLDKYFKLNIEV  268

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATL+GH  HHE+  ARIN +LG+IDAN GD   GWDTDQFP DV   TL M  VIK G
Sbjct  269  NHATLAGHDFHHELRFARINNMLGSIDANMGDLLLGWDTDQFPTDVRLTTLAMYEVIKMG  328

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            G   GG NFDAK+RR S ++ED+ I HI GMD  A+G + A KL++DG   + + +RY+S
Sbjct  329  GFDKGGLNFDAKVRRSSFELEDLVIGHIAGMDAFAKGFKIAYKLVKDGVFDKFIEERYRS  388

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            +   +GA I  G+ADF+ LE+ AL   + +  S KQEL EMIL   +
Sbjct  389  YKEGIGAKIVSGQADFKTLEEYALNLSQIENKSGKQELLEMILNKYM  435



>ref|WP_013289876.1| xylose isomerase [Caldicellulosiruptor obsidiansis]
 gb|ADL41871.1| xylose isomerase [Caldicellulosiruptor obsidiansis OB47]
Length=438

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 154/227 (68%), Gaps = 0/227 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            ARF+  AV Y K+IGF G   IEPKP+EPTKHQYD+DAA    FL+K  L   FKLNIE 
Sbjct  209  ARFLRMAVDYAKEIGFDGQFLIEPKPKEPTKHQYDFDAAHVYGFLKKYDLDKYFKLNIEV  268

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATL+GH  HHE+  ARIN +LG+IDAN GD   GWDTDQFP DV   TL M  VIK G
Sbjct  269  NHATLAGHDFHHELRFARINNMLGSIDANMGDLLLGWDTDQFPTDVRLTTLAMYEVIKMG  328

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            G   GG NFDAK+RR S ++ED+ I HI GMD  A+G + A KL++DG   + + +RY+S
Sbjct  329  GFDKGGLNFDAKVRRSSFELEDLVIGHIAGMDAFAKGFKIAYKLVKDGVFDKFIEERYRS  388

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            +   +GA I  G+ADF+ LE+ AL   + +  S KQEL EMIL   +
Sbjct  389  YKEGIGAKIVSGQADFKTLEEYALNLSQIENKSGKQELLEMILNKYM  435



>ref|WP_011091740.1| xylose isomerase [Pectobacterium atrosepticum]
 sp|Q6DB05.1|XYLA_PECAS RecName: Full=Xylose isomerase [Pectobacterium atrosepticum SCRI1043]
 emb|CAG73017.1| putative D-xylose isomerase [Pectobacterium atrosepticum SCRI1043]
 gb|AIA69115.1| xylose isomerase [Pectobacterium atrosepticum]
 gb|AIK12020.1| xylose isomerase [Pectobacterium atrosepticum]
 gb|KFX13567.1| xylose isomerase [Pectobacterium atrosepticum]
 gb|KFX24271.1| xylose isomerase [Pectobacterium atrosepticum]
Length=439

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 158/231 (68%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +E NHATL+GHS HHE+ TA   G+ G++DAN GDPQ GWDTDQFP  V E TL+M  ++
Sbjct  267  VEANHATLAGHSFHHEIATAVALGVFGSVDANRGDPQLGWDTDQFPNSVEENTLIMYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F AHIG MDT+A  L++AA++IED  L +LV KR
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDRYDLFHAHIGAMDTMALALKAAARMIEDDKLNQLVAKR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++ ELG  I  G A  E L + A      P+  S +QEL E ++   L
Sbjct  387  YAGWNGELGQQILQGNASLESLAQYAESHQLAPQHQSGQQELLENLVNRHL  437



>gb|ETI53536.1| xylose isomerase [Phytophthora parasitica P1569]
Length=452

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 156/223 (70%), Gaps = 0/223 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            A F +  VAYKK++G      +EPK +EP KHQYD+DAAT   FL   GL ++FKLNIE 
Sbjct  225  AAFFKLVVAYKKELGATFQFLVEPKSREPMKHQYDYDAATVMAFLHTYGLQNDFKLNIEP  284

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +I+ G
Sbjct  285  NHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKIIEIG  344

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            GLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++RY S
Sbjct  345  GLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQRYAS  404

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  192
            + S LG  IE GKA  E +   A E GEP   S KQELAE++L
Sbjct  405  WKSALGERIEQGKATLEEVAAYAKESGEPDHVSGKQELAELML  447



>ref|WP_015358602.1| MULTISPECIES: xylose isomerase XylA [Ruminiclostridium]
 gb|AGC67911.1| xylose isomerase XylA [ [[Clostridium] stercorarium subsp. stercorarium 
DSM 8532]
 gb|AGI38951.1| Xyi [ [[Clostridium] stercorarium subsp. stercorarium DSM 8532]
Length=441

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 157/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            FARF+  AV YKK+IGF G L IEPKP+EPTKHQYD+DAAT   FL+ +GL  +FKLNIE
Sbjct  210  FARFLRMAVDYKKEIGFDGQLLIEPKPKEPTKHQYDFDAATVIGFLKMHGLDKDFKLNIE  269

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  H++  ARI+ +LG+IDAN GD   GWDTDQFP ++ E TL M+ VIK 
Sbjct  270  ANHATLAGHTFQHDLRVARIHDMLGSIDANQGDLLLGWDTDQFPTNIYETTLAMMEVIKM  329

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG   GG NFDAK+RR S +  D+F  HI GMD  A G + A K+++DG   + + +RY 
Sbjct  330  GGFTKGGLNFDAKVRRGSFEPVDLFYGHIAGMDAFALGFKVAYKIVQDGIFDKFIEERYA  389

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            SF + +G  I  GK  F+ LE   LE GEP++ S +QE+ E IL   +
Sbjct  390  SFRTGIGKDIVEGKVGFKELEAYVLEHGEPEITSGRQEMLEAILNQYI  437



>ref|WP_009110894.1| xylose isomerase [Brenneria sp. EniD312]
 gb|EHD19573.1| Xylose isomerase [Brenneria sp. EniD312]
Length=439

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 158/234 (68%), Gaps = 7/234 (3%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +E NHATL+GHS HHE+ TA   G+ G++DAN GDPQ GWDTDQFP  V E TLVM  ++
Sbjct  267  VEANHATLAGHSFHHEIATAIALGVFGSVDANRGDPQLGWDTDQFPNSVEENTLVMYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F AHIG MDTLA  L++AA++IED  L +LV  R
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDRYDLFHAHIGAMDTLALSLKAAARMIEDDQLNQLVAIR  386

Query  329  YQSFDSELGAAIEGGKADFELL----EKKALEWGEPKVPSAKQELAEMILQSAL  180
            Y  ++ ELG  I  GKA  E L    E + L    P+  S  QEL E I+   L
Sbjct  387  YAGWNGELGQQILQGKASLESLAGYAESRQL---APQHQSGHQELLENIVNRHL  437



>ref|WP_025423857.1| xylose isomerase [Sodalis sp. HS1]
 gb|AHF78735.1| Xylose isomerase [Sodalis sp. HS1]
Length=439

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/231 (55%), Positives = 159/231 (69%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM   V +K KIGF+G L IEPKPQEPTKHQYD+D AT   FL++ GL  E ++N
Sbjct  207  EQIGRFMRMVVEHKHKIGFQGALLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIRVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +E NHATL+GHS HHE+ TA   G+LG+IDAN GDPQ+GWDTDQFP  V E TLVM  ++
Sbjct  267  VEANHATLAGHSFHHEIATAIALGVLGSIDANRGDPQSGWDTDQFPNSVEENTLVMYELL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG + GG NFDAK+RR+STD  D+F  HIGG+DTLA  L+ AA++IEDG L E V++R
Sbjct  327  KAGGFSTGGMNFDAKVRRQSTDRYDLFHGHIGGIDTLALALKKAARMIEDGRLDEWVKQR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++ +LG  I  G      L + A E G  P   S +QEL E I+  AL
Sbjct  387  YAGWNEDLGQRILQGNLSLADLARYADEQGLAPVHRSGRQELLENIVNQAL  437



>ref|WP_035601129.1| xylose isomerase [Haloferula sp. BvORR071]
Length=435

 Score =   255 bits (652),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 153/228 (67%), Gaps = 0/228 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
             A  +  AV YKKKIGF G  +IEPKP+EP+ HQYD D+A   NFLR+  L+D FKLNIE
Sbjct  208  LAALLHMAVDYKKKIGFTGQFYIEPKPREPSTHQYDSDSAACLNFLRQYNLLDHFKLNIE  267

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GH+  HE+  A   G LG+IDAN GD   GWDTDQFP D+   T VML +++ 
Sbjct  268  TNHATLAGHTMEHELTVAMDAGALGSIDANQGDELLGWDTDQFPSDLYGTTKVMLKLLEM  327

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG   GG NFDAK RRES +  D+F AHIGGMD  ARGLR AA + EDG +   V+ RY 
Sbjct  328  GGFTTGGLNFDAKRRRESHEPVDLFHAHIGGMDAFARGLRVAAAIREDGRISNFVKTRYS  387

Query  323  SFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  180
            S+D+ +GA IE GK DF+ L   AL  GEP V S +QEL E IL   L
Sbjct  388  SWDNGIGAEIEAGKMDFDQLSDWALRNGEPVVASGRQELMENILNELL  435



>ref|WP_039483227.1| xylose isomerase [Pectobacterium carotovorum]
 gb|KFX16651.1| xylose isomerase [Pectobacterium carotovorum subsp. carotovorum]
 gb|KHS95548.1| xylose isomerase [Pectobacterium carotovorum subsp. carotovorum]
Length=439

 Score =   255 bits (652),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 158/231 (68%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+D AT   FL++ GL  E K+N
Sbjct  207  EQIGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVN  266

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            +E NHATL+GHS HHE+ TA   G+ G++DAN GDPQ GWDTDQFP  V E  L+M  ++
Sbjct  267  VEANHATLAGHSFHHEIATAVALGIFGSVDANRGDPQLGWDTDQFPNSVEENALIMYEIL  326

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F AHIG MDT+A  L++AA++IED  L +LV +R
Sbjct  327  KAGGFTTGGLNFDAKVRRQSTDRYDLFHAHIGAMDTMALALKAAARMIEDDKLNQLVARR  386

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++ ELG  I  GKA  E L + A      P+  S +QEL E ++   L
Sbjct  387  YAGWNGELGQQILQGKASLESLTRYAESHQLAPQHQSGQQELLENLVNRHL  437



>ref|WP_005769174.1| xylose isomerase [Coxiella burnetii]
 gb|EAX33351.1| xylose isomerase [Coxiella burnetii 'MSU Goat Q177']
 gb|EDR36202.1| xylose isomerase [Coxiella burnetii Q321]
 gb|ACJ19819.1| xylose isomerase [Coxiella burnetii CbuK_Q154]
 gb|AIT62837.1| Xylose isomerase [Coxiella burnetii str. Namibia]
Length=436

 Score =   255 bits (652),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 157/225 (70%), Gaps = 1/225 (0%)
 Frame = -1

Query  863  FARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIE  684
            F RF+   V YK KIGF G L IEPKP EPTKHQYD+D AT   FL++ GL  EFK+NIE
Sbjct  209  FGRFLSLLVDYKHKIGFNGLLLIEPKPCEPTKHQYDFDVATVYAFLQRYGLEKEFKVNIE  268

Query  683  CNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKN  504
             NHATL+GHS  HE+  A  N + G++DAN GDPQ GWDTDQFP+D+ E  LV+  ++K+
Sbjct  269  ANHATLAGHSFAHEIAYACANDIFGSVDANRGDPQLGWDTDQFPIDLQETVLVLYLILKH  328

Query  503  GGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQ  324
            GG   GGFNFDAKLRR+S D+ED+F AHI G+DTLARGL  AA +IE+  LK    KRYQ
Sbjct  329  GGFTSGGFNFDAKLRRQSLDLEDLFYAHISGIDTLARGLLIAATIIENDKLKTTKEKRYQ  388

Query  323  SFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMIL  192
            ++   L A +  GK DFE + K+AL+   +PK  S +QE  E  L
Sbjct  389  AWKEPLNANMLSGKLDFETIAKRALDNNLDPKPTSGEQEKLERWL  433



>emb|CDK78581.1| Xylose isomerase [Klebsiella pneumoniae IS22]
Length=306

 Score =   251 bits (641),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 154/231 (67%), Gaps = 1/231 (0%)
 Frame = -1

Query  869  EPFARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLN  690
            E   RFM+  V +K KIGF+GTL IEPKPQEPTKHQYD+DAAT   FL++ GL  E KLN
Sbjct  73   EQLGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTKHQYDYDAATVYGFLKQFGLEKEIKLN  132

Query  689  IECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVI  510
            IE NHATL+GHS HHE+ TA   GL G++DAN GD Q GWDTDQFP  V E  LVM  ++
Sbjct  133  IEANHATLAGHSFHHEIATAIALGLFGSVDANRGDAQLGWDTDQFPNSVEENALVMYEIL  192

Query  509  KNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKR  330
            K GG   GG NFDAK+RR+STD  D+F  HIG MDT+A  L+ AA++IEDG L + + +R
Sbjct  193  KAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKIAARMIEDGELDKRIAQR  252

Query  329  YQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  180
            Y  ++SELG  I  G+     L K A E    P   S +QE  E ++   L
Sbjct  253  YSGWNSELGQQILKGQMSLADLAKYAQEHNLSPVHQSGRQEQLENLVNHYL  303



>ref|WP_029450677.1| xylose isomerase [Clostridium algidicarnis]
Length=437

 Score =   255 bits (652),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 153/229 (67%), Gaps = 0/229 (0%)
 Frame = -1

Query  860  ARFMEAAVAYKKKIGFKGTLFIEPKPQEPTKHQYDWDAATTANFLRKNGLIDEFKLNIEC  681
            AR M+ AV Y +K GF G  +IEPKP+EPTKHQYD+DAAT   FLRK  L+D+FKLNIE 
Sbjct  209  ARLMKMAVKYARKKGFNGDFYIEPKPKEPTKHQYDFDAATVIGFLRKYDLMDDFKLNIEA  268

Query  680  NHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNG  501
            NHATL+GH+  HE+  ARING+ G++DAN GD   GWDTDQFP DV EATL ML +IK G
Sbjct  269  NHATLAGHTFPHELAVARINGVFGSVDANQGDSLLGWDTDQFPTDVKEATLSMLEIIKAG  328

Query  500  GLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQS  321
            G   GG NFDAK+RR S   EDI   +I GMDT A GL  A ++IEDG + E + KRY S
Sbjct  329  GFTNGGLNFDAKVRRPSFTFEDIVYGYISGMDTFALGLIKAYEVIEDGRIDEFIEKRYAS  388

Query  320  FDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL*K  174
            ++S +G  I   +   E LE   LE  E  + S +QE  E IL   L K
Sbjct  389  YESGIGKKILNNEVTLEELEAYTLENKERPMESGRQEYLETILNQILYK  437



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1949878542686